WorldWideScience

Sample records for ili jeshtsho raz

  1. Izvinite, jeshtsho raz izvinite / Raul Kalev

    Index Scriptorium Estoniae

    Kalev, Raul

    2007-01-01

    Autor selgitab eestlaste ja venelaste erinevat suhtumist Teise maailmasõja tulemustesse ning valitsuse käitumist pronkssõduri probleemi lahendamisel ja leiab, et eestlased ja venelased peavad proovima mõista teineteist, soovima tundma õppida kõrvuti elavate rahvaste ajalugu, kombeid ja pühadusi

  2. Sheron Stoun reshila jeshtsho raz trjahnut "instinktom" / Olga Saburova

    Index Scriptorium Estoniae

    Saburova, Olga

    2006-01-01

    Täna toimub maailma-esilinastus põnevikule "Ürginstinkt 2" ("Basic Instinct 2") : režissöör Michael Caton-Jones : stsenaristid Leora Barish, Henry Bean : peaosas, nagu esimeseski samanimelises filmis, Sharon Stone : Saksamaa - Hispaania - Suurbritannia - Ameerika Ühendriigid 2006

  3. "Ne opravilsja jeshtsho posle grippa..." : [luuletused] / Aleksei Koroljov

    Index Scriptorium Estoniae

    Koroljov, Aleksei

    2001-01-01

    Autor endast lk. 44. Sisu: "Ne opravilsja jeshtsho posle grippa..." ; "Tak plohho mne, kak ne bõlo davno..." ; "Vokrug tebja, kak satellit..." ; "Hotja i ne ossobenno ona..." ; Iz dnevnika ; Zdravõi smõsl ; "V ushko igolnoje prodenu..." ; "Zhenshtshine prostitelnõ nedostatki..." ; "Balagurja, taratorja..." "Kogda bõ sprava - rai..." ; 23-i skorõi ; "Velmozhi v rogozhe iz blazhi i drozhi..."

  4. Subliminalne poruke: mit ili stvarnost

    OpenAIRE

    Baj, Igor

    2017-01-01

    Subliminalne poruke dugi su niz godina prisutne u gotovo svim medijima, a u ovom je radu naglasak stavljen na praksu koja se odnosi na vizualnu komunikaciju. Pojašnjeni su osnovni pojmovi kao što su subliminalne poruke i šest temeljnih audiovizualnih tehnika pomoću kojih se prenose subliminalne ili podsvjesne informacije. Pored povijesnog prikaza i navedenih primjera uporabe subliminalnih poruka u medijima analizirana su brojna sekundarna istraživanja koja upućuju da nema znanstvenog istraživ...

  5. Pipeline integrity: ILI baseline data for QRA

    Energy Technology Data Exchange (ETDEWEB)

    Porter, Todd R. [Tuboscope Pipeline Services, Houston, TX (United States)]. E-mail: tporter@varco.com; Silva, Jose Augusto Pereira da [Pipeway Engenharia, Rio de Janeiro, RJ (Brazil)]. E-mail: guto@pipeway.com; Marr, James [MARR and Associates, Calgary, AB (Canada)]. E-mail: jmarr@marr-associates.com

    2003-07-01

    The initial phase of a pipeline integrity management program (IMP) is conducting a baseline assessment of the pipeline system and segments as part of Quantitative Risk Assessment (QRA). This gives the operator's integrity team the opportunity to identify critical areas and deficiencies in the protection, maintenance, and mitigation strategies. As a part of data gathering and integration of a wide variety of sources, in-line inspection (ILI) data is a key element. In order to move forward in the integrity program development and execution, the baseline geometry of the pipeline must be determined with accuracy and confidence. From this, all subsequent analysis and conclusions will be derived. Tuboscope Pipeline Services (TPS), in conjunction with Pipeway Engenharia of Brazil, operate ILI inertial navigation system (INS) and Caliper geometry tools, to address this integrity requirement. This INS and Caliper ILI tool data provides pipeline trajectory at centimeter level resolution and sub-metre 3D position accuracy along with internal geometry - ovality, dents, misalignment, and wrinkle/buckle characterization. Global strain can be derived from precise INS curvature measurements and departure from the initial pipeline state. Accurate pipeline elevation profile data is essential in the identification of sag/over bend sections for fluid dynamic and hydrostatic calculations. This data, along with pipeline construction, operations, direct assessment and maintenance data is integrated in LinaViewPRO{sup TM}, a pipeline data management system for decision support functions, and subsequent QRA operations. This technology provides the baseline for an informed, accurate and confident integrity management program. This paper/presentation will detail these aspects of an effective IMP, and experience will be presented, showing the benefits for liquid and gas pipeline systems. (author)

  6. Teplo, jeshtsho tepleje, gorjatsho!

    Index Scriptorium Estoniae

    2006-01-01

    28. aprillist kuni 4. maini toimub II Vene Filmide Kevadfestival : Aleksandr Atanesjani "Lurjused" ("Svolotshi"), Deniss Neimandi "Vanaraud", ekstsentriline komöödia "Rahapäev" ("Den deneg"), fantaasiaseiklus "Aziris-Nuna" Sergei Lukjanenko ja Juri Burkini romaani järgi, režissöör ja stsenarist Oleg Kompassov, Marina Migunova seikluskomöödia "Krahv Montenegro"

  7. Seasonal Web Search Query Selection for Influenza-Like Illness (ILI) Estimation

    DEFF Research Database (Denmark)

    Hansen, Niels Dalum; Mølbak, Kåre; Cox, Ingemar Johansson

    2017-01-01

    Inuenza-like illness (ILI) estimation from web search data is an important web analytics task. The basic idea is to use the frequencies of queries in web search logs that are correlated with past ILI activity as features when estimating current ILI activity. It has been noted that since inuenza...

  8. Statistical implications of adjustments of raw ILI (In-Line Inspection) data

    Energy Technology Data Exchange (ETDEWEB)

    Timashev, Svyatoslav A.; Bushinskaya, Anna V. [Russian Academy of Sciences, Ekaterinburg (Russian Federation). Ural Branch. Sciences and Engineering Center ' Reliability and Safety of Large Systems and Machines'

    2009-07-01

    The paper describes the implications and inferences that inevitably arise when deliberate 'adjustments' of raw MFL ILI data are made when delivering the final report on conducted ILI and/or performing defect sizing and reliability assessments needed for pipeline integrity management plans (IMPs). The root causes of data adjustments are discussed, main types of adjustments are classified and the consequences as related to pipeline residual life, reliability and safety are described. A comparison is performed between adjustment and the full statistical analysis (FSA), as applied to raw ILI and verification data. The consequences of defect data adjustment as related to pipeline reliability and POF and possible litigation issues are discussed. Case studies are presented which demonstrate the application of the FSA method to the results of ILI and verification measurements on pipelines that are located on three continents. Some assessments of the actual reliability of pipelines with defects are given. (author)

  9. A review on pipeline corrosion, in-line inspection (ILI), and corrosion growth rate models

    International Nuclear Information System (INIS)

    Vanaei, H.R.; Eslami, A.; Egbewande, A.

    2017-01-01

    Pipelines are the very important energy transmission systems. Over time, pipelines can corrode. While corrosion could be detected by in-line inspection (ILI) tools, corrosion growth rate prediction in pipelines is usually done through corrosion rate models. For pipeline integrity management and planning selecting the proper corrosion ILI tool and also corrosion growth rate model is important and can lead to significant savings and safer pipe operation. In this paper common forms of pipeline corrosion, state of the art ILI tools, and also corrosion growth rate models are reviewed. The common forms of pipeline corrosion introduced in this paper are Uniform/General Corrosion, Pitting Corrosion, Cavitation and Erosion Corrosion, Stray Current Corrosion, Micro-Bacterial Influenced Corrosion (MIC). The ILI corrosion detection tools assessed in this study are Magnetic Flux Leakage (MFL), Circumferential MFL, Tri-axial MFL, and Ultrasonic Wall Measurement (UT). The corrosion growth rate models considered in this study are single-value corrosion rate model, linear corrosion growth rate model, non-linear corrosion growth rate model, Monte-Carlo method, Markov model, TD-GEVD, TI-GEVD model, Gamma Process, and BMWD model. Strengths and limitations of ILI detection tools, and also corrosion predictive models with some practical examples are discussed. This paper could be useful for those whom are supporting pipeline integrity management and planning. - Highlights: • Different forms of pipeline corrosion are explained. • Common In-Line Inspection (ILI) tools and corrosion growth rate models are introduced. • Strength and limitations of corrosion growth rate models/ILI tools are discussed. • For pipeline integrity management programs using more than one corrosion growth rate model/ILI tool is suggested.

  10. Una nueva lectura de Razón de amor

    Directory of Open Access Journals (Sweden)

    Francisco Manuel Gómez Domingo

    1996-12-01

    Full Text Available Razón de Amor es un poema de difícil explicación. Es un poema medieval de autor desconocido que se nos da a conocer por primera vez en 1887 por Morel-Fatio. Desde esa fecha, se han escrito diversos artículos de todo tipo, intentando encontrar o descubrir su sentido último, su estructura, su unidad, etc. La mayoría de la crítica ha fijado su interés en intentar encontrar su unidad compositiva o en negársela. Noes extraño que esto haya sido así porque, no es normal encontramos dos composiciones tan distintas, como lo son un poema de amor y un debate goliardesco, en una sola obra.

  11. La razón de ser de los conglomerantes

    Directory of Open Access Journals (Sweden)

    Fernández Paris, J. M.

    1978-09-01

    Full Text Available La palabra cemento sirve para designar cualquier sustancia con capacidad adherente, mientras que el término conglomerante se aplica a la acción de aglutinar en un todo partículas que anteriormente estaban sueltas o independientes. Según su capacidad o no de endurecer bajo agua, los conglomerantes se clasifican en hidráulicos y no hidráulicos. Se denominan hidráulicos a aquéllos que tienen la citada facultad. Entre todos los conglomerantes hidráulicos, han adquirido en la construcción una carta de naturaleza inusitada durante los últimos tiempos los denominados cementos porland. Quiero hacer constar que trato de exponer simplemente aquellos conceptos químicos que, a mi modo de ver y de acuerdo con mi experiencia, constituyen la razón de ser que nos permita apreciar sus cualidades y propiedades.

  12. La razón religiosa según Zubiri

    Directory of Open Access Journals (Sweden)

    Enzo Solari

    2010-01-01

    Full Text Available se expone en este trabajo una posible reconstrucción de la estructura de la razón religiosa al hilo de la fenomenología o analítica de la inteligencia de Zubiri. Así, la modalidad intelectiva racional es presentada a la luz de su particular configuración religiosa o teísta. La razón, en efecto, viene a ser una profundización del logos religioso y, por lo mismo, de la interpretación específicamente teísta del poder de lo real que, según Zubiri, religa a la existencia humana y a todas las cosas. Dios es, entonces, la realidad plenaria que se esboza y experiencia por conformación de la vida humana y -a veces- por compenetración con su realidad personal o vital, y en todo caso como realidad fundamental digna de fe y confianza.This paper discussed in a possible reconstruction on the structure of the religious reason in a row of the Zubiri's phenomenology or analytical of the intelligence. Thus, the mode rational of intelligence is presented in the light of their particular religious or theistic configuration. The reason, indeed, amounts to a deepening of religious logos and, therefore, of specifically theistic interpretation on the power of reality, that, according to Zubiri, reconnects to human existence and all things. God then is the summum reality outlined and experienced shaping human life and, at times, by bonding with their personal reality or life, and in any case as fundamental reality of faith and trust worthy.

  13. Analysis of Pathogenesis of Autoimmune Insulitis in NOD Mice: Adoptive Transfer Experiments of Insulitis in ILI and NOD Nude Mice

    OpenAIRE

    Nakamura, Moritaka; Nishimura, Masahiko; Koide, Yukio; Takato, O.Yoshida

    2003-01-01

    In an effort to study the pathophysiological events in the development of insulitis in NOD mice, we have developed ILI- and NOD-nu/nu mice. ILI mice are a nondiabetic inbred strain but are derived from the same Jcl:ICR mouse as NOD mice and share the same H-2 allotype with NOD mice. Splenocytes and CD4+ cells from diabetic NOD mice appeared to transfer insulitis to ILI-nu/nu mice, suggesting that ILI mice already express autoantigen(s) responsible for insulitis. But reciprocal thymic grafts f...

  14. Statistical analysis of real ILI (In-Line Inspection) data: implications, inferences and lessons learned

    Energy Technology Data Exchange (ETDEWEB)

    Timashev, Svyatoslav A.; Bushinskaya, Anna V. [Russian Academy of Sciences, Ekaterinburg (Russian Federation). Ural Branch. Sciences and Engineering Center ' Reliability and Safety of Large Systems and Machines'

    2009-07-01

    The paper discusses current possibilities and drawbacks of in-line inspection (ILI) in sizing defects in oil and gas pipelines. A methodology based on analysis of variances (ANOVA) is presented that extracts maximum possible information from the ILI measurements of defects and subsequent verification results. This full statistical analysis (FSA) methodology was extensively tested by using the Monte Carlo simulation method. It was then applied to analyze the content of sections 7, 9 and appendix E of the API 1163 RP Standard. (author)

  15. Mulher: sonho, razão e poder

    Directory of Open Access Journals (Sweden)

    Flávia Regina Ramos Gonzaga

    1992-09-01

    Full Text Available O texto apresenta uma síntese do filme "Mulher: Sonho, Razão e Poder", no qual as autoras discutem as relações de poder presentes no cotidiano de uma enfermeira. 0 eixo principal se estabelece em torno da condição da mulher e da enfermagem profissional na sociedade brasileira. A reflexão, enriquecida com recortes de vários .átudiosos contemporâneos do tema "poder", percorre três momentos: - o confronto consigo mesma, - o despertar para a realidade, e - a tomada de consciência do poder. O objetivo do trabalho foi estabelecer a trajetória do processo de amadurecimento pessoal e profissional que culmina numa nova visão de si e da profissão e recupera a consciência da diversidade e do potencial de oposição às forças que condicionam a realidade impondo-lhe novo rumo.

  16. Analyzing Idioms and Their Frequency in Three Advanced ILI Textbooks: A Corpus-Based Study

    Science.gov (United States)

    Alavi, Sepideh; Rajabpoor, Aboozar

    2015-01-01

    The present study aimed at identifying and quantifying the idioms used in three ILI "Advanced" level textbooks based on three different English corpora; MICASE, BNC and the Brown Corpus, and comparing the frequencies of the idioms across the three corpora. The first step of the study involved searching the books to find multi-word…

  17. Analysis on Cu and Zn Concentrations in Agricultural Soils of Ili District, Xinjiang Autonomous Region, China

    Directory of Open Access Journals (Sweden)

    YANG Jing-na

    2015-02-01

    Full Text Available The aim of this work is mainly to investigate the contents of copper(Cuand zinc(Znin agricultural soils to provide basic infor-mation for the establishment of green and organic production base in Ili District, Xinjiang Autonomous Region. 600 topsoil samples of the a-gricultural land were collected from eight counties of Ili District, and the contents of Cu and Zn were determined by AAS after microwave di-gestion. The statistics analysis showed that the mean contents of Cu and Zn in the agricultural soils of Ili District were 28.68 mg·kg-1 and 83.17 mg·kg-1, respectively. The concentrations of Cu in the agricultural soils of Ili District ranged from 11.07 mg·kg-1 to 59.90 mg·kg-1, 85% of which ranged from 20 mg·kg-1 to 40 mg·kg-1; and the concentrations of Zn in the agricultural soils of Ili District ranged from 39.58 mg·kg-1 to 160.40 mg·kg-1, 90%of which ranged from 60 mg·kg-1 to 110 mg·kg-1. Furthermore, compared the Cu and Zn contents of the tested soils among the eight counties, Cu contents in Tekes County were higher than other counties, while Zn contents showed little difference. The con-tents of Cu and Zn in the tested soils were all below the threshold values that were established in the national environmental quality standard for soils(secondary standards, GB 15618-1995, but about 7% and 21% were higher than the Cu and Zn background values of soil in Ili District, respectively. Furthermore, the concentrations of Cu and Zn in soils of Ili District accord with the environmental requirements for or-ganic and green production base regulated by national standard of organic products(GB/T 19630-2011and industrial standard of green food(NY/T 391-2013.

  18. Probabilistic daily ILI syndromic surveillance with a spatio-temporal Bayesian hierarchical model.

    Directory of Open Access Journals (Sweden)

    Ta-Chien Chan

    Full Text Available BACKGROUND: For daily syndromic surveillance to be effective, an efficient and sensible algorithm would be expected to detect aberrations in influenza illness, and alert public health workers prior to any impending epidemic. This detection or alert surely contains uncertainty, and thus should be evaluated with a proper probabilistic measure. However, traditional monitoring mechanisms simply provide a binary alert, failing to adequately address this uncertainty. METHODS AND FINDINGS: Based on the Bayesian posterior probability of influenza-like illness (ILI visits, the intensity of outbreak can be directly assessed. The numbers of daily emergency room ILI visits at five community hospitals in Taipei City during 2006-2007 were collected and fitted with a Bayesian hierarchical model containing meteorological factors such as temperature and vapor pressure, spatial interaction with conditional autoregressive structure, weekend and holiday effects, seasonality factors, and previous ILI visits. The proposed algorithm recommends an alert for action if the posterior probability is larger than 70%. External data from January to February of 2008 were retained for validation. The decision rule detects successfully the peak in the validation period. When comparing the posterior probability evaluation with the modified Cusum method, results show that the proposed method is able to detect the signals 1-2 days prior to the rise of ILI visits. CONCLUSIONS: This Bayesian hierarchical model not only constitutes a dynamic surveillance system but also constructs a stochastic evaluation of the need to call for alert. The monitoring mechanism provides earlier detection as well as a complementary tool for current surveillance programs.

  19. Razón y Racionalidad. Una Dialéctica de la Modernidad

    Directory of Open Access Journals (Sweden)

    Rosa María Ramírez Martínez

    2000-01-01

    Full Text Available En este trabajo se discute acerca de la distinción entre razón y racionalidad, pues se le ha colmado con prejuicios, imaginarios y mitos. Sin embargo, la comprensión del concepto de racionalidad lleva a la interpretación moderna del mundo y debido a la conexión entre teoría de la racionalidad y de la modernidad se puede construir una teoría de la sociedad. Para el análisis se recuperan aquellos autores que han enfatizado la ponencia crítica de la razón, para cuestionar como plantea Habermas las aporías de la razón y reivindicar el proyecto emancipador de la propia razón, rescatar el mundo de la vida de la racionalidad instrumental para crear la posibilidad de una sociedad verdaderamente humana.

  20. Luminescence dating of the Zeketai loess section in the Ili Basin, northwestern China: Methodological considerations

    Science.gov (United States)

    Qin, Jintang; Zhou, Liping

    2018-04-01

    Loess deposits in Xinjiang, northwestern China are ideal archives for past environmental changes in the Westerlies-dominated central Asia. Among previous luminescence dating studies of loess in Xinjiang, few have attempted to systematically investigate the methodological aspects. In this study, we report results of a multiple-procedure luminescence dating of the Zeketai loess section in the Ili Basin, central Xinjiang. Optically stimulated luminescence (OSL) and post-infrared infrared stimulated luminescence (pIRIR) signals were used for quartz and polymineral grains of different sizes. The pIRIR ages obtained with two protocols agree well with each other and constrain the loess deposition between 50 ka and 88 ka. The OSL ages of fine-grained quartz are in stratigraphic order and range from 37 ka to 61 ka, but are ∼30% younger than the pIRIR295 ages of both fine and medium grained polyminerals. Although the causes of the discrepancy between the ages derived from different luminescence dating protocols are still to be understood, we stress that the quartz OSL ages of loess in this region are likely to be underestimated, especially for samples older than 40 ka. The polymineral or potassium feldspar pIRIR signal is recommended for dating loess in the Ili Basin, at least as an internal check.

  1. La razón en el cristianismo. Una reivindicación de Joseph Ratzinger

    OpenAIRE

    Blanco-Sarto, P. (Pablo)

    2005-01-01

    La raz6n supone un rasgo diferencial del cristianismo con respecto a otras religiones. La postura del cristianismo, segiin repite Ratzinger una y otra vez, es positiva y complementaria: la fe admite la critica de la raz6n, a la vez que el conocimiento humano se amplia y enriquece con la revelacion. El cristianismo admiti6 la filosofia, antes que las religiones: es lo que €\\ ha llamado «la victoria de la inteligencia» en el mundo de las religiones, y se ha d...

  2. Survival and Transcendence of Transnational Indigenous Latina Immigrants (ILIs in the US

    Directory of Open Access Journals (Sweden)

    Margarita Machado-Casas

    2013-12-01

    Full Text Available Transnational indigenous Latino immigrants today seem to live multiple lives across multiple borders. Based on a 3-year Mix methods research study that took place in a new immigrant-receiving community in North Carolina, the manuscript describes the experiences of Indigenous Latina Immigrants (ILIs living in the United States, specifically pedagogies of survival based on fluid social identities. The indigenous women who took part in this study had to adopt fluid unknown identities both in the home for cultural survival, and also outside the home (external identities for physical and social survival, often in hostile environments. In addition, it raises questions about the ways multilingualism affects border mobility and transnationality as well as how indigenous Latina immigrants become Camaleónas guerreras (Chameleon Warriors who use “critical survival tools” as a transnational bridge to facilitate their survival in a hostile US environment, the community, and in schools.

  3. Quality of life for parents of children with influenza-like illness: development and validation of Care-ILI-QoL.

    Science.gov (United States)

    Chow, Maria Yui Kwan; Morrow, Angela; Heron, Leon; Yin, Jiehui Kevin; Booy, Robert; Leask, Julie

    2014-04-01

    Influenza-like illnesses (ILI) cause paediatric morbidity and affect the quality of life (QoL) of children and their parents. We have developed a disease-specific questionnaire (Care-ILI-QoL) to measure the QoL of caregivers of children with ILI. The drafting of the Care-ILI-QoL questionnaire was based on a systematic review, a quantitative survey, qualitative interviews with parents, and meetings with paediatricians. Children aged 6-48 months recruited from childcare centres in Sydney, Australia, were followed up during the 2011 influenza season. Care-ILI-QoL and SF-12v2 Acute Form were administered to the parent of a sick child 2 weeks after the onset of ILI, and again 2 weeks after the child had recovered. Exploratory factor analysis was conducted. Internal consistency, concurrent validity, discriminant validity, homogeneity of items, and responsiveness were tested. Out of the 125 children enrolled from 48 childcare centres, 55 children had ILI (total 75 ILI episodes). Care-ILI-QoL was reduced from 25 to 16 items covering four factors: Daily Activities, Perceived Support, Social Life, and Emotions (Cronbach's alphas 0.90, 0.92, 0.78, and 0.72, respectively). Care-ILI-QoL has satisfactory concurrent and discriminant validity, good internal consistency, and excellent responsiveness. Total QoL and factor scores correlated well with SF-12v2 scores. Total QoL scores were significantly lower in parents who perceived their child as very/extremely sick, sacrificed 10 hours or more in work or recreation in caring for the child, or whose child had two or more general practitioner visits. Total QoL and factor scores were significantly higher after the child had recovered than when the child had ILI. Care-ILI-QoL is the first ILI-specific QoL instrument for parents and is demonstrated to be valid and reliable in a developed country setting where the child is affected by ILI. It has the potential to be applied in clinical and research settings to assist measurement of

  4. La pragmática de la razón comunicativa

    Directory of Open Access Journals (Sweden)

    McCarthy, Thomas

    1993-10-01

    Full Text Available Not available.

    El autor conocido representante de la Teoría Critica en EE.UU. y divulgador de la obra de Habermas, intenta hacerse cargo de las criticas postmodernas al carácter abstracto de la concepción de la razón comunicativa de este último. Para ello realiza un acercamiento a las lecciones que acerca de la interacción comunicativa nos ofrece, extramuros la filosofía, la etnometodología. La idea que intenta defender McCarthy es que la trascendencia e idealización centrales para la concepción de la razón comunicativa de Habermas pueden combinarse de formaa fructífera con la indexicalidad y practicidad subrayadas en los estudios de Garfinkel.

  5. [Environmental geochemical baseline of heavy metals in soils of the Ili river basin and pollution evaluation].

    Science.gov (United States)

    Zhao, Xin-Ru; Nasier, Telajin; Cheng, Yong-Yi; Zhan, Jiang-Yu; Yang, Jian-Hong

    2014-06-01

    Environmental geochemical baseline models of Cu, Zn, Pb, As, Hg were established by standardized method in the ehernozem, chestnut soil, sierozem and saline soil from the Ili river valley region. The theoretical baseline values were calculated. Baseline factor pollution index evaluation method, environmental background value evaluation method and heavy metal cleanliness evaluation method were used to compare soil pollution degrees. The baseline factor pollution index evaluation showed that As pollution was the most prominent among the four typical types of soils within the river basin, with 7.14%, 9.76%, 7.50% of sampling points in chernozem, chestnut soil and sierozem reached the heavy pollution, respectively. 7.32% of sampling points of chestnut soil reached the permitted heavy metal Pb pollution index in the chestnut soil. The variation extent of As and Pb was the largest, indicating large human disturbance. Environmental background value evaluation showed that As was the main pollution element, followed by Cu, Zn and Pb. Heavy metal cleanliness evaluation showed that Cu, Zn and Pb were better than cleanliness level 2 and Hg was the of cleanliness level 1 in all four types of soils. As showed moderate pollution in sierozem, and it was of cleanliness level 2 or better in chernozem, chestnut soil and saline-alkali soil. Comparing the three evaluation systems, the baseline factor pollution index evaluation more comprehensively reflected the geochemical migration characteristics of elements and the soil formation processes, and the pollution assessment could be specific to the sampling points. The environmental background value evaluation neglected the natural migration of heavy metals and the deposition process in the soil since it was established on the regional background values. The main purpose of the heavy metal cleanliness evaluation was to evaluate the safety degree of soil environment.

  6. La razón y el absurdo en la obra de Leon Battista Alberti

    OpenAIRE

    Sverlij, Mariana

    2012-01-01

    Uno de los rasgos más destacados de la producción de Leon Battista Alberti (1404- 1472) es la formulación de dos visiones del mundo simultáneas y contradictorias. El “paradigma de la razón”, que nutre sus tratados sobre la pintura, la escultura y la arquitectura se contradice e interactúa con el “paradigma de lo absurdo”, que da entidad a sus trabajos literarios, fundamentalmente su narración latina, Momus sive de Principe, y sus Intercenales. Si en Momus y las Intercenales predomina el carác...

  7. Paixão e razão na economia política

    Directory of Open Access Journals (Sweden)

    Alexandre Queiroz Guimarães

    2013-12-01

    Full Text Available O artigo procura apresentar, por ângulos distintos, algumas relações existentes entre paixão, razão e economia. Recorre, com este intuito, ao lançamento e à evolução da problemática paixão-razão no seio da filosofia política moderna, desembocando, com Adam Smith, no "nascimento" da economia política. Percorre, então, o tratamento metodológico da ciência econômica, apontando o "modelo de homem" adotado e indicando as brechas para a introdução das paixões. Enfim, procura, com Tocqueville e Sérgio Buarque de Holanda, exemplificar "experiências concretas", reiterando a importância de alguns valores e paixões para o êxito do empreendimento capitalista. Conclui, sem negar a funcionalidade das abstrações e do modelo de homem utilizado, pela necessidade de descer às paixões, buscando, na "constituição dos indivíduos" de determinada sociedade, mais um fator relevante para o entendimento das trajetórias de desenvolvimento econômico.

  8. Integrity management and optimization of planning activities from results of the ILI run

    Energy Technology Data Exchange (ETDEWEB)

    Farinas, Jaime [TRANSIERRA S.A., Santa Cruz (Bolivia)

    2009-07-01

    Transierra owns and operates the Yacuiba - Rio Grande pipeline (GASYRG), 432 kilometers in length and 32 inches in diameter, which transports natural gas from the fields of San Alberto and San Antonio (southern Bolivia) to the Rio Grande compression station (Santa Cruz), and is part of the gas export system to Brazil. This pipeline system has a sustained capacity to transport 17,6 million of cubic meter per day. Within the Integrity Management Program (IMP) has been developing and implementing activities and techniques that seeking to ensure the technical integrity of the pipeline, from the good practices of the industry, which also get an optimization for the use of resources for inspection, operation and maintenance activities. In response to that goal at the beginning of 2008, it was concluded the baseline of the GASYRG ILI runs, getting a very good stage of both the internal and external condition of the pipeline, found some stables anomalies (manufacturing and construction) which do not affect the safe operation status of the pipeline, in this way, it was appropriate to re-planning the maintenance programs of all facilities and main elements, in order to achieve a balance between safety operation condition of the pipeline and the resources used for these purposes, which means that there is a 'before' and an 'after' regarding to planning and maintenance activities are concerned. All of this re-planning gives us a cost optimization for the main activities in the order of 30%. Additionally there has been a very particular approach to care for and prevent threats related to corrosion, maintaining a stable cathodic protection system, taking into account the presence of interfering elements (crossing with pipelines, power lines, railroads, etc.). Also important steps have been taken regarding to the changing dynamic to the action of third parties, it is part of a specific program for strengthening contingency plans. Concluding the above, the

  9. El Error de Descartes, La emoción, la razón y el cerebro Humano (Book Review

    Directory of Open Access Journals (Sweden)

    David Alberto Quebradas Angrino

    2011-12-01

    Full Text Available El alma y el cuerpo, al igual que la razón y las emociones, fueron en la modernidad grandes protagonistas de discusiones suscitadas en el escenario de la filosofía, donde el afán de comprender al “Hombre” hizo de éstos, actores antagónicos de un conflicto que terminó con la separación del cuerpo y la mente, y con la instauración del régimen de la razón sobre las emociones. Así, se enseñó que la razón debía desembarazarse de las interferencias de las emociones y las decisiones “debían tomarse con la cabeza fría”.

  10. El Error de Descartes, La emoción, la razón y el cerebro Humano (Book Review)

    OpenAIRE

    David Alberto Quebradas Angrino

    2011-01-01

    El alma y el cuerpo, al igual que la razón y las emociones, fueron en la modernidad grandes protagonistas de discusiones suscitadas en el escenario de la filosofía, donde el afán de comprender al “Hombre” hizo de éstos, actores antagónicos de un conflicto que terminó con la separación del cuerpo y la mente, y con la instauración del régimen de la razón sobre las emociones. Así, se enseñó que la razón debía desembarazarse de las interferencias de las emociones y las decisiones “debían tomarse ...

  11. A crítica hegeliana do entendimento e a perspectiva da razão

    OpenAIRE

    Bezerra, Hildemar de Araújo

    2011-01-01

    O objetivo deste trabalho é apresentar a crítica de Hegel à forma de pensar do Entendimento (Verstand) e a perspectiva de um novo conceito de Razão (Vernunft) ou racionalidade que daí surge, e isto tendo como base os três momentos do processo lógico (o momento do Entendimento, o Dialético e o Especulativo) apresentados por Hegel na Enciclopédia das Ciências Filosóficas. Mostrar-se-á que esta crítica se faz imanente à própria filosofia de Hegel, pois o Entendimento é tanto o objeto da crítica,...

  12. Razón y fe en Clemente de Alejandría

    Directory of Open Access Journals (Sweden)

    Marcelo Merino Rodríguez

    2011-01-01

    Full Text Available Este artículo analiza la relación entre fe y razón en Clemente de Alejandría, quien, si bien no ha desarrollado una teoría sistemática sobre el particular, ha intuido el gran principio equilibrador: Dios mismo es autor de la naturaleza y la gracia. En este sentido, logra una eficaz síntesis de ambas: no permite minusvalorar o desconocer la modesta contribución de la razón, sin enaltecer tampoco la doctrina revelada, al punto de declararla única certeza soberana en el camino que el hombre debe recorrer hacia su propia salvación eterna. El artículo está complementado con un estudio de los antecedentes histórico-culturales y biográficos que permite comprender adecuadamente el contexto del pensamiento de Clemente.This article analyzes the relationship between faith and reason in Clement of Alexandria, who, although he did not develop a systematic theory on the matter, sensed the great balance principle: God Himself is the author of nature and grace. Thus he achieves an effective synthesis of both: he does not allow the modest contribution of reason to be underestimated or ignored, but does not exalt revealed doctrine to the point of declaring it the only sovereign certainty on the road that man must take towards his own eternal salvation. This article is complemented by a study of historical-cultural and biographical background information to properly understand the context of Clement's thought.

  13. Potência de ação e ordem: o poder e a razão segundo Nicolau Maquiavel e Thomas Hobbes

    OpenAIRE

    Kersting, Wolfgang

    2006-01-01

    O autor apresenta aborda, primeiramente, a relação entre poder e razão no pensamento político de Maquiavel. Num segundo momento, apresenta, no pensamento de Hobbes, a trajetória que se estende da razão impotente do estado de natureza até à razão poderosa do Estado, dispensador de segurança

  14. Potência de ação e ordem: o poder e a razão segundo Nicolau Maquiavel e Thomas Hobbes

    Directory of Open Access Journals (Sweden)

    Kersting, Wolfgang

    2006-01-01

    Full Text Available O autor apresenta aborda, primeiramente, a relação entre poder e razão no pensamento político de Maquiavel. Num segundo momento, apresenta, no pensamento de Hobbes, a trajetória que se estende da razão impotente do estado de natureza até à razão poderosa do Estado, dispensador de segurança

  15. As razões da conquista de Tenochtitlán (1519-1521 contidas na narrativa de Hernan Cortez

    Directory of Open Access Journals (Sweden)

    Alexandra Ferreira Martins Ribeiro

    2018-03-01

    Full Text Available Este artigo faz um estudo da trajetória de Hernan Cortez, de 1519 até a conquista de Tenochtitlán, em 1521, e procura responder: de acordo com as representações contidas cartas de Cortez, quais razões levaram a civilização asteca a ser conquistada pelo contingente militar liderado pelo espanhol? O artigo buscou analisar algumas razões representadas nas cartas enviadas por Cortez que levaram à conquista de Tenochtitlán e relacioná-las com a historiografia acerca do tema. A metodologia utilizada foi análise das fontes buscando as representações das razões que foram narradas por Cortez, confrontando-as com os estudos de Levy (2010 e Léon-Portilha (2012, dentre outros. Os resultados demonstraram que superioridade bélica, comunicação, influência da religião, ambição, epidemias e o comando de Cortez foram algumas das possíveis razões da conquista.

  16. Resonancias emocionales de la razón en Kant [Emotional resonances of reason in Kant

    Directory of Open Access Journals (Sweden)

    Nuria Sánchez Madrid

    2016-09-01

    Full Text Available Este artículo se propone calibrar, partiendo del estado actual de la cuestión, las funciones que los sentimientos o emociones ejercen en todo el arco del proyecto crítico, afectando a la concepción del conocimiento y de la acción moral. Para ello, comenzaré analizando el sentido, no sólo retórico, del concepto kantiano de Bedürfnis, planteando sucesivamente la dimensión radical que el sentimiento de placer y displacer posee en el ánimo humano, la necesidad de que la virtud sea ejercida con un corazón alegre, siguiendo la enseñanza de Epicuro, y finalmente la conexión de la belleza con la resonancia afectiva que penetra todo el edificio de la reflexión. En la conclusión extraeré algunas consecuencias que un estudio de las Críticas en clave sentimental puede introducir en la concepción usual de la razón en Kant, ampliando los mecanismos de implantación en el mundo de esta facultad, al reconocer la importancia del sentimiento y la inclinación para la construcción de la autonomía humana.

  17. Racionalidade online: provimento de razões em discussões virtuais

    Directory of Open Access Journals (Sweden)

    Ricardo Fabrino Mendonça

    Full Text Available Resumo Este artigo se propõe a discutir a ideia de racionalidade que está no coração das abordagens deliberacionistas de democracia. Essa discussão embasa a realização de um estudo empírico focado em um banco de dados com 2.375 comentários sobre direitos LGBT em quatro arenas online: Youtube, Facebook, comentários de notícias e Votenaweb. O objetivo é discutir os principais fatores a influenciar no incremento do provimento de razões por postagens nessas arenas. Na análise, testamos cinco hipóteses: (H1 A chance de postagens apresentarem justificativas depende da plataforma em que se encontram essas postagens; (H2 A chance de postagens apresentarem justificativas é maior em debates em que há equilíbrio entre as posições defendidas; (H3 A chance de postagens apresentarem justificativas tende a ser maior quando há mais reciprocidade; (H4 A chance de postagens apresentarem justificativas é menor se o nível de desrespeito é maior; e (H5 A chance de postagens apresentarem justificativas é menor em mensagens enviadas por anônimos. Os resultados indicam que, entre as variáveis testadas, a "plataforma" e a "presença de respeito" são as mais importantes para induzir o provimento de justificativas.

  18. Razón y fe, un diálogo entre Kant y Jacobi

    Directory of Open Access Journals (Sweden)

    Hugo Ochoa

    2003-01-01

    Full Text Available El presente trabajo expone dialécticamente las concepciones de Jacobi y Kant respecto de la relación entre fe y razón. Con este propósito se analiza especialmente el trabajo de Kant, ¿Qué significa orientarse en el pensamiento?, escrito para mediar en el conflicto entre Mendelssohn y Jacobi a propósito del presunto panteísmo de Lessing, así como otros escritos postcríticos atingentes al tema. Respecto de Jacobi, este trabajo se centra particularmente en la introducción a David Hume y la creencia, o Idealismo y realismo, un diálogo, que el mismo autor considera una introducción al conjunto de escritos filosóficos del autor (65The present work dialectically sets forth Jacobi´s and Kant´s conception of the relation between faith and reason. With this intention Kant´s work is specially analyzed _Was heißt: Sich im Denken orientieren? (1786_, and written in order to mediate the conflict between Mendelssohn and Jacobi apropos of Lessing´s allegedly pantheism, as well as other postcritic writings relevant to the issue. In regard to Jacobi, this work is maily focused in the introduction to "David Hume über den Glauben, oder Idealismus und Realismus", a dialogue, that the author himself considers an introduction to the philosophic writings of the author in its entirety

  19. El Otro: razón de ser del docente especialista

    Directory of Open Access Journals (Sweden)

    Aarom Oramas

    2017-12-01

    Full Text Available Todos los docentes son formados para llevar adelante procesos de planificación, enseñanza y evaluación sobre el conocimiento y cultura de la sociedad donde se desenvuelven, tomando como punto de partida, la realidad biopsicosocial de sus estudiantes. El propósito de este ensayo es mostrar cómo el Otro se convierte en la razón de ser del quehacer pedagógico del docente especialista desde una visión interdisciplinaria, que parte de la filosofía de la educación, la pedagogía y la enseñanza, enmarcado en los documentos sobre política educativa del Estado venezolano en materia de Educación Especial. Se concluye el escrito afirmando que el docente especialista, según lo dispuesto en la política educativa venezolana sobre Educación Especial, debe estar atento a las características individuales de sus educandos y que su accionar docente esté marcado por el reconocimiento del Otro, respetando su humanidad, escuchando sus necesidades, caminando a su lado, transformando así su realidad social donde la inclusión sea la característica esencial.

  20. Genetic polymorphisms, forensic efficiency and phylogenetic analysis of 15 autosomal STR loci in the Kazak population of Ili Kazak Autonomous Prefecture, northwestern China.

    Science.gov (United States)

    Feng, Chunmei; Wang, Xin; Wang, Xiaolong; Yu, Hao; Zhang, Guohua

    2018-03-01

    We investigated the frequencies of 15 autosomal STR loci in the Kazak population of the Ili Kazak Autonomous Prefecture with the aim of expanding the available population information in human genetic databases and for forensic DNA analysis. Genetic polymorphisms of 15 autosomal short tandem repeat (STR) loci were analysed in 456 individuals of the Kazak population from Ili Kazakh Autonomous Prefecture, northwestern China. A total of 173 alleles at 15 autosomal STR loci were found; the allele frequencies ranged from 0.5022-0.0011. The combined power of discrimination and exclusion statistics for the 15 STR loci were 0.999 999 999 85 and 0.999 998 800 65, respectively. In addition, phylogenetic analysis involving the Ili Uygur population and other relevant populations was carried out. A neighbour-joining tree and multidimensional scaling plot were generated based on Nei's standard genetic distance. Results of the population comparison indicated that the Ili Uygur population was most closely related genetically to the Uygur populations from other regions in China. These findings are consistent with the historical and geographic backgrounds of these populations.

  1. Critical Evaluation of the New Headway Advanced and the ILI Advanced Series: A Comparison of Curricular Components and CLT Objectives Based on ACTFL

    Directory of Open Access Journals (Sweden)

    Esmail Zare-Behtash

    2017-07-01

    Full Text Available The critical evaluation of systematic planning, development and review practices of instructional materials intend to improve the quality of teaching and learning. This study investigates the objectives of communicative language teaching and curricular components of two important textbooks which are widely studied in Iran: the New Headway Advanced Series (2015, the Iran Language Institute (ILI Advanced1 (2008. The evaluation is done in terms of two prospects; firstly, the interpretation of communicative language teaching objectives and secondly, curricular components of the books. To this aim, a checklist of 5 Cs standards and seven curricular components evaluation developed by American Council on the Teaching of Foreign Languages (ACTFL was employed. The evaluation reveals that the New Headway advanced series is more preferable and desirable than the ILI Advanced 1 due to the design and organization, authenticity, attractiveness, functionality, practicality and the other qualities mentioned above regarding communication, cultures, connection, comparison, and community in all aspects. The evaluation based on the seven curricular components- language systems, communication strategies, cultural knowledge, learning strategies, content from other subject areas, critical thinking skills, technology and the other features- indicates that the ILI textbook enjoys low standards and is not well developed in all components. The ILI textbook is highly reading and writing oriented and not appropriate for transactional and interactional learning purposes. This study acquaints language teachers and learners with the more desirable and cogent book.

  2. Razón de contacto total en los engranajes cónicos circulares. // Contact Rate in circular Bevel gears.

    OpenAIRE

    E. Mirabet Lemos; L. Martínez Delgado

    2006-01-01

    En el presente trabajo se realiza un análisis deductivo de las expresiones que permiten evaluar la razón de contacto total enlos engranajes cónicos circulares. Dicho análisis se ha realizado haciendo uso de la transmisión cilíndrica virtual.Se obtienen dos formulas equivalentes, pero que se diferencian en algunos de los parámetros que las conforman. Cada unade estas formulas esta basada en formas diferentes de analizar la razón de contacto total y en particular uno de suscomponentes, la razón...

  3. Razón de Estado y razones del Estado, (Decimas Conferencias Aranguren

    Directory of Open Access Journals (Sweden)

    Díaz, Elías

    2002-06-01

    Full Text Available As against bad «reasons of state», both past and present, a number of good reasons of state are put forward here as sound demands for times to come. One of the aims we try to attain is a necessary theoretical and practical retrieval of politics along with culture and ethics in the public field. As against the prevailing untrammelled power of economics -in particular its purportedly one version, namely «scientific capitalism» and the quite lopsided globalization- it becomes mandatory to completely take into account the view-point of general interests (both national and transnational, universal; and, within that framework, legitimate individual interests, mainly those of broad social sections least endowed with bargaining leverage and resources. The ground for those good reasons of state (and reasons, too, for a civil society critically harmonized with the state lies in an ethics of enlightened values of freedom, equality and brotherhood (solidarity, as well as of such security as stems from social cohesion (a conjunction of justice and efficiency.

    Frente a la mala «Razón de Estado», del pasado y del presente, se alegan aquí algunas de las posibles y potenciales buenas razones del Estado, también como exigencias válidas para el futuro. Con ello se pretende coadyuvar a una imprescindible recuperación teórica y práctica de la política y, con ella, de la cultura y de la ética en el espacio público. Ante el actual poder omnimodo e «incontrolado» de la economía, de su versión pretendidamente única, la del «capitalismo científico» y la muy desigual «globalización», se hace necesario tomar completamente en serio la perspectiva de los intereses generales (nacionales y transnacionales, universales: y, dentro de ellos, los legítimos intereses individuales y, en especial, los de aquellos amplios sectores sociales dotados de muchos menos poderes y posibilidades. La ética de los valores ilustrados de libertad, igualdad

  4. Economia verde: por que o otimismo deve ser aliado ao ceticismo da razão

    Directory of Open Access Journals (Sweden)

    Andrei Cechin

    2012-01-01

    Full Text Available A iniciativa da economia verde carrega consigo o otimismo da vontade de que a economia pode e deve ser impulsionada por investimentos em atividades limpas em contraposição à extração de recursos naturais e à indústria poluente. No entanto, existem limites à ênfase que se coloca nos aumentos de eficiência e na substituição entre setores de uma economia. Para ser verde de fato, a redução no impacto ambiental por unidade do PIB deve ser maior do que o aumento do PIB num período. Mesmo que evidências recentes mostrem que alguns países já passaram do pico no uso de materiais e energia, globalmente a extração de recursos naturais e a emissão de CO2 só tem aumentado. Uma provável causa é porque países ricos têm terceirizado as atividades poluentes para países mais pobres. É hora de trazer o ceticismo da razão para o debate e discutir seriamente o decrescimento, não do PIB ou das oportunidades de desenvolvimento humano, mas da extração de recursos e da emissão de carbono globais.The green economy initiative carries with it the optimistic view that the economy can and should be driven by investments in clean activities as opposed to the extraction of natural resources and polluting industries. However there are limits to the emphasis that is often put on efficiency improvements and on the substitution between sectors of an economy. For the economy to be green, the reduction in environmental impact per unit of GDP should be higher than GDP growth over a period. Even though recent evidence shows that some countries aparently passed the peak in the use of materials and energy, global extraction of natural resources and CO2 emissions has increased. A probable cause is that rich countries have outsourced polluting activities to poorer countries. It is time to bring the skepticism of reason to the debate and seriously discuss degrowth, not of GDP or of opportunities for human development, but of the global resource extration

  5. Chemical composition and antimicrobial activity of the essential oil from Satureja horvatii Šilić (Lamiaceae

    Directory of Open Access Journals (Sweden)

    BRANISLAVA LAKUSIC

    2008-07-01

    Full Text Available The present paper describes the chemical composition and antimicrobial activity of the essential oil of the endemic species Satureja horvatii Šilić, collected in Montenegro. The essential oil was obtained from the aerial parts of the plant by hydrodistillation and analyzed by GC–MS. From the 34 compounds representing 100 % of the oil, the major compound was the phenolic monoterpene thymol (63.37 %. The oil contained smaller amounts of g-terpinene (7.49 %, carvacrol methyl ether (4.92 %, carvacrol (4.67 %, p-cymene (4.52%, a-terpinene (1.81 %, borneol (1.58 %, a-thujene (1.56 %, b-caryophyllene (1.55 % and b-myrcene (1.44 %. The antimicrobial activity of the essential oil of S. horvatii was evaluated using the agar diffusion and broth microdilution methods. The essential oil exhibited antimicrobial activity to varying degrees against all the tested strains. The maximum activity of S. horvatii oil was observed against Gram-positive bacteria (Micrococcus luteus, Staphylococcus epidermidis, Staphylococcus aureus and Enterococcus faecalis and against the yeast (Candida albicans. The oil exhibited moderate activity against the Gram-negative bacteria Escherichia coli and Klebsiella pneumoniae and weak activity against Pseudomonas aeruginosa. This study confirms that the essential oil of S. horvatii possesses antimicrobial activities in vitro against medically important pathogens.

  6. Morphological characteristics of a rare endemic species, Erysimum croceum M. Pop. (Brassicaceae from Trans-Ili Alatau, Kazakhstan

    Directory of Open Access Journals (Sweden)

    Karime T. Abidkulova

    2017-12-01

    Full Text Available Erysimum croceum is a rare endemic species listed in the Red Book of Kazakhstan. In 2015–2017 we studied three populations of this species on the territory of the Ile-Alatau National Park (Trans-Ili Alatau, Northern Tian-Shan. As a result of the inventory of sampling plots, we estimated the elevation range occupied by the species and identified age structure and population density. Our results confirmed earlier reports of low population counts of E. croceum. We also studied biometric characteristics of virginal and generative individuals of E. croceum from different populations, and measured parameters of their seeds. The morphometric parameters were highly variable across the studied populations. The only exception was the morphometric parameters of the seeds, which had low or very low variability. We conclude that these parameters are the most stable characteristics of the species. The results of the study can contribute to our understanding of population structure and dynamics of E. croceum and assist in developing effective conservation strategies for this species.

  7. Internet-based monitoring of influenza-like illness (ILI in the general population of the Netherlands during the 2003–2004 influenza season

    Directory of Open Access Journals (Sweden)

    Schellevis François G

    2006-10-01

    Full Text Available Abstract Background An internet-based survey of influenza-like illness (ILI – the Great Influenza Survey or GIS – was launched in the Netherlands in the 2003–2004 influenza season. The aim of the present study was to validate the representativeness of the GIS population and to compare the GIS data with the official ILI data obtained by Dutch GPs participating in the Dutch Sentinel Practice Network. Method Direct mailings to schools and universities, and repeated interviews on television and radio, and in newspapers were used to kindle the enthusiasm of a broad section of the public for GIS. Strict symptomatic criteria for ILI were formulated with the assistance of expert institutes and only participants who responded at least five times to weekly e-mails asking them about possible ILI symptoms were included in the survey. Validation of GIS was done at different levels: 1 some key demographic (age distribution and public health statistics (prevalence of asthma and diabetes, and influenza vaccination rates for the Dutch population were compared with corresponding figures calculated from GIS; 2 the ILI rates in GIS were compared with the ILI consultation rates reported by GPs participating in the Dutch Sentinel Practice Network. Results 13,300 persons (53% of total responders, replied at least five times to weekly e-mails and were included in the survey. As expected, there was a marked under-representation of the age groups 0–10 years and 81->90 years in the GIS population, although the similarities were remarkable for most other age groups, albeit that the age groups between 21 and 70 years were slightly overrepresented. There were striking similarities between GIS and the Dutch population with regard to the prevalence of asthma (6.4% vs. 6.9% and the influenza vaccination rates, and to a lesser degree for diabetes (2.4% vs. 3.5%. The vaccination rates in patients with asthma or diabetes, and persons older than 65 years were 68%, 85%, and

  8. Estudio crítico de la razón instrumental totalitaria en Adorno y Horkheimer

    Directory of Open Access Journals (Sweden)

    Fernando R. Contreras

    2006-01-01

    Full Text Available Este estudio contempla la consolidación de la razón instrumental en la sociedad moderna. Se explica la dificultad de la oposición a la lógica de la cultura instrumental y las vías alternativas abiertas por Adorno y Horkheimer.This article contemplates the consolidation of the instrumental reason in the modern society. The difficulty is explained from the opposition to the logic of the instrumental culture and the alternative ways opened up by Adorno and Horkheimer

  9. Critical Evaluation of the New Headway Advanced and the ILI Advanced Series: A Comparison of Curricular Components and CLT Objectives Based on ACTFL

    OpenAIRE

    Esmail Zare-Behtash; Hassan Banaruee

    2017-01-01

    The critical evaluation of systematic planning, development and review practices of instructional materials intend to improve the quality of teaching and learning. This study investigates the objectives of communicative language teaching and curricular components of two important textbooks which are widely studied in Iran: the New Headway Advanced Series (2015), the Iran Language Institute (ILI) Advanced1 (2008). The evaluation is done in terms of two prospects; firstly, the interpretation of...

  10. SPECT and 123I-Iodolisuride (123-I-ILIS) in extra-pyramidal syndromes. The use of different models of γ-cameras

    International Nuclear Information System (INIS)

    Ribeiro, M.J.; Jannuario, C.; Santos, A.C.; Cunha, L.; Pedroso de Lima, J.J.; Prunier-Levilion, C.; Autret, A.; Guilloteau, D.; Besnard, J.C.; Baulieu, J.L.; Chassat, F.; Bekhechi, D.; Marchand, J.; Mauclaire, L.; Catela, L.

    1999-01-01

    The aim of this work was to evaluate 123 I-ILIS as a radioligand of dopamine receptors in patients with extra-pyramidal diseases by using different cameras in two different centers. 45 patients were included and divided in 2 groups: group I (n=28): idiopathic Parkinson disease, group II (n=17): other extra-pyramidal syndrome. 123 I-ILIS, 1.7 to 2.8 MBq/kg, was injected after informed consent. Imaging was performed with a single head camera, a dual head camera, a triple head camera and a brain dedicated annular detector. The pattern of the transverse slices containing the basal ganglia was classified according to 3 types: type 1: visible basal ganglia and invisible cortex, type 2: invisible basal ganglia and visible cortex, type 3: visible basal ganglia and cortex. Striatal/frontal cortex ratio (S/FC) was calculated from standardized, geometrical ROI's. No patient showed any undesirable effect. All SPECT images were interpretable. In group 1, 45/45 scintigraphic pattern were type 1 or 3, in group II 18/23 scintigraphic patterns were type 2 or 3. S/FC was significantly lower in group II than in group I patients. We conclude that 123 I-ILIS SPECT can be performed with any conventional γ-camera. It provides functional informations about the striatal dopaminergic synapse in patients with extra-pyramidal degenerative disease, and could be useful in the differential diagnosis between Parkinson disease and other extra-pyramidal syndromes. (author)

  11. Max Weber e Martin Heidegger: a centralidade da razão e a perda da liberdade

    Directory of Open Access Journals (Sweden)

    Edilene Maria de Carvalho Leal

    2015-10-01

    Full Text Available A intenção desse artigo é analisar algumas ambivalências da modernidade, com destaque para a que consideramos a principal delas: a centralidade da razão como categoria analítica e como modelo das práticas sociais. Essa proposta é, evidentemente, uma proposta de análise teórica que se dará no âmbito específico da teoria social e da filosofia, principalmente desde interpretações produzidas por Max Weber e Martin Heidegger. Trata-se, em uma primeira instância, da tentativa de discutir criticamente as “autodescrições” que esses pensadores fizeram da modernidade. De um lado, a defesa weberiana da centralidade da razão; de outro, a crítica pós-metafísica heideggeriana dessa centralidade. Desse flagrante desencontro, podemos destacar um possível encontro analítico entre eles, ou seja, a crítica à perda da liberdade no contexto moderno.

  12. Max Weber e Martin Heidegger: a centralidade da razão e a perda da liberdade

    Directory of Open Access Journals (Sweden)

    Edilene Maria de Carvalho Leal

    2015-09-01

    Full Text Available A intenção desse artigo é analisar algumas ambivalências da modernidade, com destaque para a que consideramos a principal delas: a centralidade da razão como categoria analítica e como modelo das práticas sociais. Essa proposta é, evidentemente, uma proposta de análise teórica que se dará no âmbito específico da teoria social e da filosofia, principalmente desde interpretações produzidas por Max Weber e Martin Heidegger. Trata-se, em uma primeira instância, da tentativa de discutir criticamente as “autodescrições” que esses pensadores fizeram da modernidade. De um lado, a defesa weberiana da centralidade da razão; de outro, a crítica pós-metafísica heideggeriana dessa centralidade. Desse flagrante desencontro, podemos destacar um possível encontro analítico entre eles, ou seja, a crítica à perda da liberdade no contexto moderno.

  13. Sem raz skazhi - odin raz ispolnim

    Index Scriptorium Estoniae

    2006-01-01

    Venemaa presidendi Vladimir Putini aastapäevakõne sai kõrge hinnangu ning kaasa kahtluse, et läkitust ootab sama saatus, mis eelnevaid - plaane ei viida ellu. Võrdlused 2000. a. - 2004. a. lubatu ja täidetu vahel

  14. Environmental and seasonal impacts on the chemical composition of Satureja horvatii Šilić (Lamiaceae) essential oils.

    Science.gov (United States)

    Lakušić, Branislava; Ristić, Mihailo; Slavkovska, Violeta; Milenković, Marina; Lakušić, Dmitar

    2011-03-01

    The chemical composition of the essential oils of Satureja horvatii Šilić from two natural habitats (Mt. Orjen and Mt. Lovćen in Montenegro) and from cultivated plants (Belgrade, Serbia) were characterized. For the latter, plants from the locus classicus, i.e., Orjenske Lokve (Mt. Orjen), were transferred to Belgrade and, after three years of cultivation, the chemical composition of their essential oils at different phenological stages was analyzed. The essential oils were obtained from the aerial parts of the plants by hydrodistillation and analyzed by GC and GC/MS. The yields and chemical compositions of the S. horvatii oils showed significant differences between the plants collected in the natural habitats and those from cultivation, as well as between the plants at different phenological stages. In the populations from the natural habitats, growing in Mediterranean conditions, the most abundant oil constituents were the phenols thymol (63.7% in the samples from Mt. Orjen) or carvacrol (68.1% in the samples from Mt. Lovćen), while the oils from the cultivated plants (Belgrade), growing in continental conditions, were dominated by linalool (up to 65.8 and 55.9% in average). The basic characteristics of the essential oil from plants at the early phenological stage (before flowering) were high percentages of linalool (37.4%), thymol (27.3%), and carvacrol (12.2%). At the stage of flowering, the percentage of linalool (56.6-57.5%) increased, while those of thymol (15.5-15.8%) and carvacrol (1.4-1.5%) significantly decreased. The essential oil of plants in the full stage of fruiting was characterized by the domination of linalool (58.4 and 65.8%) and lower percentages of thymol (7.6 and 1.3%) and carvacrol (0.7 and 0.1%). In conclusion, the oil composition of S. horvatii was found to depend on the pedoclimatic conditions of the habitat and the phenological stage of the plants. Copyright © 2011 Verlag Helvetica Chimica Acta AG, Zürich.

  15. Feminismo e Ilustración (XIV Conferencias Aranguren: I. De la razón inerte a la razón meritoria; II. Por una Ilustración multicultural

    Directory of Open Access Journals (Sweden)

    Amorós, Celia

    2006-06-01

    Full Text Available In the first part of this text, we present a reading of the Enlightenment that seeks to identify, among the different conceptualisations of reason displayed by enlightened thinking, the one offering the greatest emancipatory virtualities for feminism. The starting point is an analysis of Hume’s concept of personal identity that exposes its patriarchal bias. Against Hume’s notion of an inert reason we set the train of thought that led Poullain de la Barre to conceive reason as permanent work, or effort. The contribution of this feminist philosopher, an epigone of cartesianism, is liked to the spinozian «conatus» by a line that takes us all the way to Mary Wollstonecraft’s idea of reason as «meriting reason »: a reason that is free of adscriptive privileges in the network of forces in which it operates together with passions, a reason that is endowed with emerging critical value towards the Ancien Régime. In the second part, we argue that the critical- reflexive processes that challenge the legitimacy of institutions in force in a culture are not the monopoly of the Western World. In this sense, the Enlightenment is not an exclusive western property in so far as we can find, in other cultures, «veins of Enlightenment ». As endorsement of this hypothesis, we re-read the work of Maghreb philosopher Al -Yabri, author of Critique of Arab Reason, as a paradigmatic example of how it is possible to carry out a selective appropriation of a culture’s own past on the grounds of the «cultural interpellations» of the present. Under this light, Averroes is reclaimed as a classic of a «planetary modernity», a modernity committed to laicism, and one, moreover, that yields interesting implications for feminism.

    En una primera parte presentamos una lectura de la Ilustración guiada por el interés de identificar, entre las distintas concepciones de la razón que se despliegan en ella, la que presenta mayores virtualidades

  16. Razón, tiempo y la noción de eternidad en economía

    Directory of Open Access Journals (Sweden)

    Alberto Carrasquilla

    1989-07-01

    Full Text Available Frente a las aspiraciones y desconsuelos de la escuela neoclásica de economía: la búsqueda de “un territorio analítico en el cual pueda coexistir armónicamente las nociones teóricas de tiempo y razón”, aparece el valioso aporte de Keynes consistente en vincular al análisis económico “los más recientes cuestionamientos al concepto de tiempo, en general, y a su subordinación con respecto al concepto de racionalidad”. Por otra parte, a la noción teórica de eternidad, de los neoclásicos, Keynes propone el principio de incertidumbre, que es apenas un componente para la negación global de aquella.

  17. Las claves de la razón poética de María Zambrano

    OpenAIRE

    Marín Cuenca, Manuel

    2016-01-01

    La filosofía de María Zambrano busca la sintonía en un lenguaje que se dirige más hacia el interior de las cosas y la intimidad del propio hombre más que a la superficialidad y a la apariencia de lo real, es lo que ella define como razón poética. Teniendo en cuenta que el lenguaje siempre distorsiona la realidad debemos buscar la claridad, volver a la inocencia de las cosas. Para ella la realidad esta en una mezcla de lo racional, lo emocional y lo afectivo, le da mucho valor a la intuición,...

  18. Acoso sexual y acoso por razón de sexo : riesgos de especial incidencia en la mujer trabajadora

    OpenAIRE

    Vallejo Dacosta, Ruth

    2010-01-01

    El Proyecto de Ley de Garantía de Igualdad entre Hombres y Mujeres que en próximas fechas se convertirá en la norma marco que impulse el principio de trasversalidad en todos los órdenes de la vida social, cultural, económica y política, contiene una regulación específica sobre el acoso sexual y el acoso por razón de sexo. En el presente artículo se analiza la futura regulación poniéndose de manifiesto las lagunas jurídicas y más de un problema interpretativo que requiere la intervención del o...

  19. Libertad práctica y trascendental en la Crítica de la razón pura

    Directory of Open Access Journals (Sweden)

    Francisco Iracheta Fernández

    2012-01-01

    Full Text Available Se problematiza la conexión entre la libertad práctica y trascendental en la Crítica de la razón pura. La intención es explicitar las dificultades que enfrenta Kant al relacionar estos sentidos de libertad dentro del marco de la filosofía crítica. Por lo general, los intérpretes entienden la relación entre estos dos sentidos de libertad como ontológica o como conceptual. Se quiere mostrar que ninguna de estas interpretaciones alcanza a superar los presuntos dogmatismos racionalista y empirista que, en conformidad con Kant, sustentan las posturas del proponente de la Tesis y de la Antítesis, respectivamente.

  20. A ideia de Deus em Kant: da ilusão da razão pura ao postulado de agente moral

    Directory of Open Access Journals (Sweden)

    Rose Silvania Figueiredo do Vale

    2013-06-01

    Full Text Available Dissertação de Mestrado.VALE, Rose Silvania Figueiredo do. A ideia de Deus em Kant: da ilusão da razão pura ao postulado de agente moral. 2012. 132 folhas. Dissertação (Mestrado – Pontifícia Universidade Católica de Minas Gerais, Programa de Pós-graduação em Ciências da Religião, Belo Horizonte.Palavras-chave: Ideias transcendentais. Ilusão. Razão. Moral. Deus. Homem.Key works: Transcendental ideas, Illusion, Reason, Moral, God, Man.

  1. Mikrobiološka kvaliteta i biokemijske promjene u svježem, mekanom kiselom siru Xinotyri, pripravljenom od svježeg ili pasteriziranog kozjeg mlijeka

    OpenAIRE

    Pappa, Eleni C.; Bontinis, Thomas G.; Tasioula-Margari, Maria; Samelis, John

    2017-01-01

    U radu su ispitani sljedeći parametri: mikrobiološka kakvoća, promjene u glavnim fizikalno-kemijskim značajkama i tijeku proteolize i lipolize te udjelu hlapljivih sastojaka u mekanom siru Xinotyri, tradicionalnom grčkom kiselom siru (pH vrijednosti od približno 4,4; udjela vlage od 65 % i udjela soli od 1 %), pripravljenom od svježeg ili pasteriziranog kozjeg mlijeka bez dodatka starter-kultura, i to tijekom 60 dana aerobnog skladištenja pri 4 °C. Nisu pronađene statistički bitne razlike u u...

  2. Hemşirelerin problem çözme becerileri ve atılganlıkları arasındaki ilişkinin incelenmesi

    OpenAIRE

    Polat, Hatice

    2014-01-01

    Araştırma, hemşirelerin problem çözme becerileri ile atılganlıkları arasındaki ilişkinin incelenmesi amacıyla analitik- kesitsel olarak planlanmıştır. Araştırmanın evrenini 2011 yılı itibariyle ve araştırma takvimi süresince Muğla ili Muğla Üniversitesi Eğitim ve Araştırma Hastanesi'nde çalışan 300 hemşire oluşturmaktadır. Araştırma verileri, tanımlayıcı özellikleri içeren Kişisel Bilgi Formu, Rathus Atılganlık Envanteri ve Gözden Geçirilmiş Sosyal Sorun Çözme Envanteri (GGSSÇE) ile toplanmış...

  3. A unique mountainous vertical distribution patterns and related environmental interpretation-a case study on the northern slope of the ili river valley

    International Nuclear Information System (INIS)

    Tian, Z.P.; Wang, X.L.; Zhuang, L.

    2016-01-01

    Patterns of plant diversity and soil factors along the altitude gradient on the northern slope of Ili River Valley were examined. Plant and environment characteristics were surveyed from 1000-2200 m. There were a total of 155 vascular plant, 133 herbage, 18 shrub, and 7 tree species in 44 sampled plots. The plant richness of vegetation types generally showed a special pattern along altitude, with a bimodal change of plant species number at 100m intervals of altitude samples. The two belts of higher plant richness were in transient areas between vegetation types, the first in areas from low-mountain desert to forest, and the other from dry grass to coniferous forest. Matching the change of richness of plant species to environmental factors along altitude by GAM model and relation analysis revealed that the environmental factors controlling species richness and their patterns were the combined effects of soil salt and nutrition. Water was more important at lower altitude, and temperature at higher altitude, the role of the inversion layer at high altitude coniferous forest species diversity appearing to rise. Soil nutrition and salt also showed a similar distribution pattern of diversity. Especially, diversity index and soil salinity showed a strong correlation. This study provides insights into plant diversity conservation of ili River Valley in Tianshan Mountain. (author)

  4. Central Asia’s Ili River Ecosystem as a Wicked Problem: Unraveling Complex Interrelationships at the Interface of Water, Energy, and Food

    Directory of Open Access Journals (Sweden)

    Steven G. Pueppke

    2018-04-01

    Full Text Available The Ili River originates in the mountains of Xinjiang, China, and flows across an increasingly arid landscape before terminating in Kazakhstan’s Lake Balkhash, which has no outlet to the ocean. The river has been extensively impounded and diverted over the past half century to produce hydroelectric power and food on irrigated land. Water withdrawals are increasing to the extent that they are beginning to threaten the ecosystem, just as it is becoming stressed by altered inflows as glaciers retreat and disappear. If the Ili River ecosystem is to be preserved, it is crucial that we thoroughly understand the spatial and temporal nuances of the interrelationships between water, energy, and food—and the vulnerability of these components to climate change. The ecosystem has all of the characteristics of a classically-defined “wicked problem”, and so it warrants treatment as a complex and dynamic challenge subject to changing assumptions, unexpected consequences, and strong social and economic overtones. Research should thus focus not just on new knowledge about the water, energy, or food component, but on advancing our understanding of the ecosystem as a whole. This will require the participation of interdisciplinary teams of researchers with both tacit and specialized knowledge.

  5. Jeshtsho odin shag - i v dessjatku! / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2008-01-01

    Tallinna Linnateatris esitleti näitekirjaniku teist näidendiraamatut. "Näidendid II" koondab neli lavateksti : "Kaev", "Meeletu", "Latern" ja "Kaotajad". Sel puhul käis Jaan Tätte päevaks Vilsandilt ära Tallinnas. Lühidalt ka varasemate näidendite populaarsusest eri teatrite lavadel

  6. "Ironiju sudbõ-2" Rjazanov jeshtsho ne videl

    Index Scriptorium Estoniae

    2007-01-01

    Eldar Rjazanovi igihaljale komöödiafilmile on Timur Bekmambetovi käe all loodud järg "Ironija sudbõ-2" (stsenarist Aleksei Slapovski), mille ümber juba enne esilinastust on loodud salapära hkkond ja ette võetud protestiaktsioone

  7. Ves god jeshtsho vperedi / Viktoria Jürmann

    Index Scriptorium Estoniae

    Jürmann, Viktoria

    2007-01-01

    Tallinna linnavalitsuse kavandatud töid 2007. aastaks. Nende hulgas on Harju tänava rekonstrueerimise lõpetamine, linnahalli rekonstrueerimise ideekonkurss, Vabaduse väljaku rekonstrueerimisprojekt, detailplaneeringute kooskõlastamine elektrooniliselt

  8. Das sesmarias à resistência ao cercamento: razões históricas dos Fundos de Pasto

    Directory of Open Access Journals (Sweden)

    Luiz Antonio Ferraro Júnior

    Full Text Available O artigo recupera as razões históricas para o surgimento da categoria dos fundos de pasto. Nele, são utilizados dados secundários recolhidos de relatórios governamentais e obtidos em entrevistas com técnicos, agentes pastorais e comunidades pastoris. Os fundos de pasto eram apenas áreas não-cercadas de Caatinga, utilizadas para pastoreio comunal. Esse padrão de ocupação, que se desenvolveu em todo o semiárido nordestino, foi progressivamente usurpado em um processo similar aos enclosures ingleses. Na Bahia, com os avanços do capital sobre essas áreas, a partir da década de 1970, houve articulações regionais e apoios institucionais que estimularam resistências diversas. Assim, "Fundo de Pasto" passou a designar não só as áreas, mas os grupos sociais que as defendiam por delas depender. O termo Fundo de Pasto, antes regional, generalizou-se por todo o estado, principalmente após sua citação na constituição baiana. Os vínculos familiares dessas comunidades também concorreram para a resistência dessa forma de ocupação.

  9. Siber Kimliklerin Kişiliğe Yansıması: Proteus Etki (Tanımı, Nedenleri Ve Önlenmesi)

    OpenAIRE

    TANHAN, Fuat; ALAV, Özlem

    2015-01-01

    Hayatın vazgeçilmez bir parçası haline gelmiş olan teknoloji ve internet bireyi ve toplumu farklı yönlerden etkisi altına alabilmektedir. Teknoloji ve internet sanal çevre diye bilinen yeni bir sosyal dünyanın oluşmasına neden olmuştur. Sanal dünya, sınırları neredeyse çizilemeyen bir çevre sunmakta ve bu çevre içinde bulunan bireyleri, kurumları etkilemekte ve dönüştürmektedir.  Söz konusu etki, kimi yönlerden olumlu, kimi yönlerden ise olumsuzlaşmaktadır. Sanal dünyadaki ilişkiler, kimlikle...

  10. Performance of the inFLUenza Patient-Reported Outcome (FLU-PRO) diary in patients with influenza-like illness (ILI)

    Science.gov (United States)

    Bacci, Elizabeth D.; Leidy, Nancy K.; Poon, Jiat-Ling; Stringer, Sonja; Memoli, Matthew J.; Han, Alison; Fairchok, Mary P.; Coles, Christian; Owens, Jackie; Chen, Wei-Ju; Arnold, John C.; Danaher, Patrick J.; Lalani, Tahaniyat; Burgess, Timothy H.; Millar, Eugene V.; Ridore, Michelande; Hernández, Andrés; Rodríguez-Zulueta, Patricia; Ortega-Gallegos, Hilda; Galindo-Fraga, Arturo; Ruiz-Palacios, Guillermo M.; Pett, Sarah; Fischer, William; Gillor, Daniel; Moreno Macias, Laura; DuVal, Anna; Rothman, Richard; Dugas, Andrea; Guerrero, M. Lourdes

    2018-01-01

    Background The inFLUenza Patient Reported Outcome (FLU-PRO) measure is a daily diary assessing signs/symptoms of influenza across six body systems: Nose, Throat, Eyes, Chest/Respiratory, Gastrointestinal, Body/Systemic, developed and tested in adults with influenza. Objectives This study tested the reliability, validity, and responsiveness of FLU-PRO scores in adults with influenza-like illness (ILI). Methods Data from the prospective, observational study used to develop and test the FLU-PRO in influenza virus positive patients were analyzed. Adults (≥18 years) presenting with influenza symptoms in outpatient settings in the US, UK, Mexico, and South America were enrolled, tested for influenza virus, and asked to complete the 37-item draft FLU-PRO daily for up to 14-days. Analyses were performed on data from patients testing negative. Reliability of the final, 32-item FLU-PRO was estimated using Cronbach’s alpha (α; Day 1) and intraclass correlation coefficients (ICC; 2-day reproducibility). Convergent and known-groups validity were assessed using patient global assessments of influenza severity (PGA). Patient report of return to usual health was used to assess responsiveness (Day 1–7). Results The analytical sample included 220 ILI patients (mean age = 39.3, 64.1% female, 88.6% white). Sixty-one (28%) were hospitalized at some point in their illness. Internal consistency reliability (α) of FLU-PRO Total score was 0.90 and ranged from 0.72–0.86 for domain scores. Reproducibility (Day 1–2) was 0.64 for Total, ranging from 0.46–0.78 for domain scores. Day 1 FLU-PRO scores correlated (≥0.30) with the PGA (except Gastrointestinal) and were significantly different across PGA severity groups (Total: F = 81.7, pFLU-PRO scores are reliable, valid, and responsive in adults with influenza-like illness. PMID:29566007

  11. Eolian dust dispersal patterns since the last glacial period in eastern Central Asia: insights from a loess-paleosol sequence in the Ili Basin

    Science.gov (United States)

    Li, Yue; Song, Yougui; Fitzsimmons, Kathryn E.; Chang, Hong; Orozbaev, Rustam; Li, Xinxin

    2018-03-01

    The extensive loess deposits of the Eurasian mid-latitudes provide important terrestrial archives of Quaternary climatic change. As yet, however, loess records in Central Asia are poorly understood. Here we investigate the grain size and magnetic characteristics of loess from the Nilka (NLK) section in the Ili Basin of eastern Central Asia. Weak pedogenesis suggested by frequency-dependent magnetic susceptibility (χfd%) and magnetic susceptibility (MS) peaks in primary loess suggest that MS is more strongly influenced by allogenetic magnetic minerals than pedogenesis, and may therefore be used to indicate wind strength. This is supported by the close correlation between variations in MS and proportions of the sand-sized fraction. To further explore the temporal variability in dust transport patterns, we identified three grain size end-members (EM1, mode size 47.5 µm; EM2, 33.6 µm; EM3, 18.9 µm) which represent distinct aerodynamic environments. EM1 and EM2 are inferred to represent grain size fractions transported from proximal sources in short-term, near-surface suspension during dust outbreaks. EM3 appears to represent a continuous background dust fraction under non-dust storm conditions. Of the three end-members, EM1 is most likely the most sensitive recorder of wind strength. We compare our EM1 proportions with mean grain size from the Jingyuan section in the Chinese loess plateau, and assess these in the context of modern and Holocene climate data. Our research suggests that the Siberian High pressure system is the dominant influence on wind dynamics, resulting in loess deposition in the eastern Ili Basin. Six millennial-scale cooling (Heinrich) events can be identified in the NLK loess records. Our grain size data support the hypothesis that the Siberian High acts as teleconnection between the climatic systems of the North Atlantic and East Asia in the high northern latitudes, but not for the mid-latitude westerlies.

  12. El pensamiento político de la Contrarreforma y la razón de estado

    Directory of Open Access Journals (Sweden)

    Ivo Comparato, Vittor

    2016-06-01

    del antimaquiavelismo a la literatura encomiástica de los gobiernos existentes, del tacitismo a la razón de Estado, hasta las escrituras críticas de la sociedad como la utopía- perfilan por un lado el esfuerzo de conservar una imagen de la política como gobierno justo, con un príncipe virtuoso, pero por el otro el inevitable compromiso con las praxis del realismo político, bien representado por la evolución del concepto de razón de Estado en Botero y en otros escritores del siglo XVII. Fue sólo con la llegada del derecho natural moderno, que puso en primer plano la cuestión del origen y los fines de la sociedad civil, que el pensamiento político se sustrajo en parte de la discusión sobre el eterno conflicto entre moral y praxis política para abrir la era de la investigación racional y científica y de los derechos individuales.

  13. Reasons not to select patients for corneal refractive surgery Razões para recusar candidatos à cirurgia refrativa corneana

    Directory of Open Access Journals (Sweden)

    André Luiz Parolin Ribeiro

    2002-08-01

    Full Text Available Purpose: To present how the section of Refractive Surgery of the Federal University of São Paulo assesses the candidates and the reasons to indicate for corneal refractive surgery. Methods: We examined 1626 patients. Anamnesis, complete ophthalmologic examination and corneal topography were performed in all patients. The patients spontaneously seeked evaluation at the Refractive Surgery Section by telephone without a previous screening. Reasons to refuse patients for refractive surgery were previously established by the Refractive Surgery Section. Results: Based on current technology and clinical experience, 265 patients (16.29% were refused for excimer laser corneal refractive surgery. Myopia of patients who had insufficient preoperative corneal pachymetry for the laser treatment was the main cause for refusal (51 patients. Cataract (45 patients, keratoconus (31 patients, amblyopia (21 patients, hyperopia > 5 diopters and mixed astigmatism (19 patients, presbyopia (unaware ness of the need for optical correction after the procedure; 16 patients, pupillary diameter > 5mm (9 patients, single eye (9 patients, progressive myopia (8 patients, postradial keratotomy (7 patients and low ametropia (7 patients were among the reasons for the refusal. Conclusion: Candidates for excimer laser corneal refractive surgery may present risk factors that should be known in order to avoid complications.Objetivo: O objetivo deste estudo é mostrar como o setor de Cirurgia Refrativa da Escola Paulista de Medicina da Universidade Federal de São Paulo avalia seus candidatos e quais as razões para não selecioná-los para cirurgia refrativa. Métodos: Foram examinados 1626 pacientes. Anamnese, avaliação oftalmológica completa e topografia corneana foram realizadas em todos os pacientes. Os pacientes procuraram avaliação no setor de Cirurgia Refrativa espontaneamente sem triagem prévia. Resultados: Não foram selecionados 265 pacientes (16,29% para cirurgia

  14. Razón de contacto en engranajes cilíndricos rectos con socavado. // Contact ration in spur gears with undercut.

    Directory of Open Access Journals (Sweden)

    E. Mirabet Lemos

    2007-09-01

    Full Text Available En el presente trabajo se muestra el desarrollo y la aplicación de una serie de expresiones que permiten evaluar la razón decontacto en transmisiones por engranajes donde el piñón y la rueda o el piñón solo poseen socavado. Además se muestra elprocedimiento para la aplicación de dichas expresiones, mediante la solución de cuatro problemas.Palabras claves: Socavado, trocoide, evolvente, engranajes, razón de contacto.________________________________________________________________________________Abstract.This paper deals with the development and application of a series of relations that allow evaluating the contact ratio in geartransmissions where the pinion and the wheel have undercut. The procedure is applied in the solution of four problems.Key words: Undercut, trochoid, evolvent, spur gear, contact ration.

  15. Sombras ilustradas sobre la Crítica de la razón pura. La estrategia kantiana frente a la problemática del Iluminismo alemán

    Directory of Open Access Journals (Sweden)

    Miguel Alejandro Herszenbaun

    2016-08-01

    Full Text Available Se busca precisar cómo la Crítica de la razón pura responde al problema fundamen-tal del Iluminismo alemán: la articulación entre la autoridad de la razón y la fe. Kant busca rescatar las intenciones del racionalista dogmático –compatibilizar la fe y la razón–, pero rechaza el racionalismo y su método. La “Antinomia de la razón pura” y la “Disciplina de la razón pura” llevan a cabo esta estrategia: la primera evidencia que el racionalismo no puede fundamentar la fe por medio de la razón y elucida el origen de esta incapacidad; la segunda se distancia del método racionalista utilizado en las pruebas de la “Antinomia”. Queda así abierto el camino para una razón finita pero crítica, capaz de ser restituida al lugar de autoridad que la Ilustración le ha reservado.

  16. El ser y la sustancia de Aristóteles ante la razón vital: las cuatro reducciones de la realidad

    Directory of Open Access Journals (Sweden)

    Francesco de Nigris

    2013-01-01

    Full Text Available «Hermenéutica» significa interpretar, mirar desde un punto de vista. En este estudio buscamos interpretar desde la «razón vital», el método de Ortega y Gasset y su discípulo Julián Marías, el concepto aristotélico de «sustancia». Si la vida es la realidad radical, como afirma Ortega, y la persona es su realización programática, según entiende Marías, una razón vital de la οὐσία significa descubrir su capacidad de comprensión para con la vida humana. Encontraremos, entonces, que hay esencialmente cuatro límites que desvían de esa comprensión; mediante ellos, habremos encontrado el núcleo de importantes contradicciones del pensamiento aristotélico que han sido objeto de encendidos debates a lo largo de la historia. Nos centraremos, sobre todo, en la función del lenguaje en la concepción de la razón griega, en los supuestos interpretativos del «ser» y del «ente» como puntos de partida del pensamiento de Aristóteles.

  17. 14-18 yaş arası ergenlerin benlik saygısı ve psikolojik dayanıklılık düzeyleri arasındaki ilişki

    OpenAIRE

    Sarıkaya, Açelya

    2015-01-01

    Bu araştırmanın amacı lise çağındaki ergenlerin benlik saygıları ile psikolojik dayanıklılıkları arasındaki ilişkinin incelenmesidir. Bunun yanı sıra teorik anlamda benlik saygısıyla ilişkili olduğu düşünülen; cinsiyet, yaş, doğum sırası, ebeveynlerin eğitim durumu, ebeveynlerin birliktelik durumu, algılanan sosyoekonomik düzey gibi demografik özelliklerin de bu değişkenle ilişkileri araştırılmıştır. Araştırmada ilişkisel tarama modeli kullanılmıştır ve araştırmanın evrenini Yalova ...

  18. Somatotipo, fatores de risco e razão cintura-estatura em indivíduos fisicamente ativos

    Directory of Open Access Journals (Sweden)

    Anderson Henrique Souza de Almeida

    2015-08-01

    Full Text Available INTRODUÇÃO: A relação entre o tipo físico e o risco cardiovascular vem sendo estudada em diversas populações do mundo. No Brasil, estudos que avaliam esta relação são escassos, principalmente quando se trata de indivíduos que praticam atividades físicas. Objetivo: Analisar a relação do somatotipo com fatores de risco cardiovascular e razão cintura-estatura (RCEst em praticantes de atividade física.MÉTODOS: Trata-se de uma pesquisa descritiva com delineamento transversal. A amostra foi constituída por 280 sujeitos, usuários da pista de Cooper da Universidade Federal de Pernambuco, na cidade de Recife, PE, Brasil. Para identificação do nível de atividade física, utilizou-se a versão curta do International Physical Activity Questionnaire(IPAQ. Os indivíduos classificados como muito ativos, ativos ou irregularmente ativos A ou B, foram incluídos na amostra. Excluíram-se os sujeitos inativos fisicamente. O somatotipo foi estimado através do protocolo antropométrico de Carter e Heath (1990. Determinaram-se como fatores de risco cardiovascular o tabagismo, o consumo de bebida alcoólica e a pressão arterial (PA. Empregou-se a estatística descritiva para caracterização da amostra, em seguida, utilizou-se a Análise de Variância Multivariada (MANOVA, com nível de significância de p < 0,05.RESULTADOS: Não foi identificada relação significativa para as variáveis tabagismo e consumo de bebida alcoólica. Na análise da PA (Pillai's trace = 0,082; F = 8,187; p < 0,05 e da RCEst (Pillai's trace = 0,298; F = 39,081; p < 0,05, verificou-se significância estatística com o somatotipo.CONCLUSÃO: O tipo físico foi positivo e significativamente relacionado com a PA e com a RCEst, demonstrando que esse indicador antropométrico pode ser utilizado para predizer precocemente o risco de desenvolvimento de doenças cardiovasculares.

  19. Eolian dust dispersal patterns since the last glacial period in eastern Central Asia: insights from a loess-paleosol sequence in the Ili Basin

    Directory of Open Access Journals (Sweden)

    Y. Li

    2018-03-01

    Full Text Available The extensive loess deposits of the Eurasian mid-latitudes provide important terrestrial archives of Quaternary climatic change. As yet, however, loess records in Central Asia are poorly understood. Here we investigate the grain size and magnetic characteristics of loess from the Nilka (NLK section in the Ili Basin of eastern Central Asia. Weak pedogenesis suggested by frequency-dependent magnetic susceptibility (χfd% and magnetic susceptibility (MS peaks in primary loess suggest that MS is more strongly influenced by allogenetic magnetic minerals than pedogenesis, and may therefore be used to indicate wind strength. This is supported by the close correlation between variations in MS and proportions of the sand-sized fraction. To further explore the temporal variability in dust transport patterns, we identified three grain size end-members (EM1, mode size 47.5 µm; EM2, 33.6 µm; EM3, 18.9 µm which represent distinct aerodynamic environments. EM1 and EM2 are inferred to represent grain size fractions transported from proximal sources in short-term, near-surface suspension during dust outbreaks. EM3 appears to represent a continuous background dust fraction under non-dust storm conditions. Of the three end-members, EM1 is most likely the most sensitive recorder of wind strength. We compare our EM1 proportions with mean grain size from the Jingyuan section in the Chinese loess plateau, and assess these in the context of modern and Holocene climate data. Our research suggests that the Siberian High pressure system is the dominant influence on wind dynamics, resulting in loess deposition in the eastern Ili Basin. Six millennial-scale cooling (Heinrich events can be identified in the NLK loess records. Our grain size data support the hypothesis that the Siberian High acts as teleconnection between the climatic systems of the North Atlantic and East Asia in the high northern latitudes, but not for the mid-latitude westerlies.

  20. Lise öğrencisi ergenlerde depresyon, internet bağımlılığı ve ilişkili faktörler

    OpenAIRE

    Öner, Kamile

    2015-01-01

    Bu çalışma, lise öğrencisi ergenlerde depresyon, internet bağımlılığı ve ilişkili faktörleri incelemek amacı ile kesitsel bir araştırma olarak yapılmıştır. Trabzon İl Merkezinde Milli Eğitim Müdürlüğüne bağlı 5 lise de eğitim-öğretim gören 3289 öğrenci üzerinden örneklem büyüklüğü Büyüköztürk ve arkadaşları tarafından önerilen eşitlik ile hesaplanmış olup %95 güven aralığı ile 345 öğrenci olarak bulunmuştur. Araştırmanın desen etkisi 2 kabul edilip 690 öğrenciye ulaşılması hedeflenmiş ancak ö...

  1. The Research on Ili Accordion Music Culture%伊犁手风琴音乐文化发展状况及其特征

    Institute of Scientific and Technical Information of China (English)

    马茜

    2012-01-01

    伊犁多元的文化孕育出多样的音乐艺术,手风琴音乐也同样丰富多彩。本文就伊犁手风琴自20世纪初到新世纪不同阶段的音乐教育情况作了系统的梳理和归纳;指出伊犁手风琴音乐在乐器种类、乐曲体裁风格、演奏形式、存在范围等方面呈现出鲜明的多样性特征,并探讨了音乐文化中“大、小传统”概念在伊犁手风琴音乐文化艺术中的和谐体现。%Ili's multi-cuhure has bred multiple music art, and the accordion is also rich and varied. The thesis has scientific summary music education in different periods from the beginning of 20~ century to the new millennium ; it points out that Ili accordion music culture shows distinct varied features in instrument kinds, musical composition types, playing forms and existing scopes and so on; it probes into the concept of "big and small traditions's" harmonious reflection in Ill accordion music culture.

  2. Üniversite öğrencilerinde ebeveyn kabulü ile psikolojik uyum arasındaki ilişkinin incelenmesi

    OpenAIRE

    KAVAK, Güler

    2013-01-01

    Bu çalışmada, alanyazında yer alan anne-baba kabul/reddi vepsikolojik uyum değişkenleri arasındaki ilişkilerin, kuramsal tartışmalar ve varolan araştırmalar ışığında bir yapısal model bağlamında test edilmesiamaçlanmıştır. Çalışmada ayrıca, anne-baba kabul/reddi ile psikolojik uyumdeğişkenlerinin cinsiyet ve anne-baba eğitim durumuna göre değişipdeğişmediği de incelenmiştir. Bunlara ek olarak, katılımcıların annelerinden vebabalarından algıladıkları kabul/reddin psikolojik uyumu yord...

  3. Abrupt climatic events recorded by the Ili loess during the last glaciation in Central Asia: Evidence from grain-size and minerals

    Science.gov (United States)

    Song, Yougui; Zeng, Mengxiu; Chen, Xiuling; Li, Yue; Chang, Hong; An, Zhisheng; Guo, Xiaohua

    2018-04-01

    The loess record of Central Asia provides an important archive of regional climate and environmental changes. In contrast to the widely investigated loess deposits in the Chinese Loess Plateau, Central Asian loess-paleosol sequences remain poorly understood. Here, we present an aeolian loess section in the southern Ili Basin. Based on granularity and mineralogical analyses, we reconstruct climatic changes during the last glaciation. The results indicated that most of the abrupt climatic events (such as Dansgaard-Oeschger events and Heinrich events) were imprinted in this loess section, although their amplitudes and ages showed some differences. Compared with the millennial oscillations recoded in loess and stalagmites in East Asia, the arid Central Asia responded more sensitively to the warming events than to the cooling events. The shifting trajectory of westerlies across Central Asia played an important role in dust deposition during the stadials. The North Atlantic climatic signals may have been transmitted from Central Asia to the East Asian monsoon regions via the westerlies.

  4. Gobernar a otros y gobernarse a sí mismo según la razón política liberal

    Directory of Open Access Journals (Sweden)

    Carlos Frade

    2007-01-01

    Full Text Available Este artículo intenta analizar la razón política liberal en sus dos arenas de despliegue privilegiadas: la relación de empleo en lo que concierne a gobernar a otros y la agencia empresarial en lo que concierne a gobernarse a sí mismo. Propone un marco teórico para abordar la razón política liberal como razón gubernamental, a la vez que trata de ilustrarlo mediante algunos análisis y estudios empíricos concretos. El artículo parte de una lectura crítica de Foucault y los estudios de gubernamentalidad y, en esencia, aspira a mostrar el doble imperativo, normalmente no reconocido, en que se fundamenta el liberalismo, consistente en aumentar la exposición de individuos y poblaciones al mercado y en someter ambos a la disciplina y a los controles cada vez más férreos que tal exposición inevitablemente conlleva. En particular, se muestra cómo la norma de empleo ha sido debilitada, y en parte sustituida, por un modelo de sujeto y de comportamiento impulsado por las políticas de empleabilidad y activación, mientras que las grandes empresas y los negocios tienden cada vez más a convertirse en puros modos de agencia revestidos de formas organizacionales cambiables y capaces de sustraerse a la inscripción legal, a la trazabilidad estadística y, en general, al control del Estado.

  5. Pós-modernidade como gesto de despedida: a "crítica autorreferencial da razão" no pensamento estético Nietzschiano:

    Directory of Open Access Journals (Sweden)

    Nabil Araújo

    2013-12-01

    Full Text Available Partindo das considerações de Gianni Vattimo e de Jürgen Habermas sobre a instauração nietzschiana da pós-modernidade como uma "despedida" à modernidade ocidental e ao tipo de racionalidade a ela associada, este texto analisa o modo pelo qual uma "crítica autorreferencial da razão" (Habermas é efetivamente engendrada pelo pensamento estético nietzschiano, de modo a reconsiderar os termos pelos quais a própria "despedida" pós-moderna deve ser concebida.

  6. “Manda quem pode, obedece quem tem juízo”: ou sobre a (desobediência e a razão em Hobbes

    Directory of Open Access Journals (Sweden)

    Rita Helena Sousa Ferreira Gomes

    2011-11-01

    Full Text Available Partindo do dito popular “manda quem pode, obedece quem tem juízo” o presente artigo tem como objetivo defender a tese de que o Estado hobbesiano sustenta-se tanto pela força quanto pela razáo. Dentro desta perspectiva, será analisada a noçáo de desobediência e, ao final, mostrar-se-á que o adágio referido só pode ser tido como verdadeiro de acordo com a filosofia política de Thomas Hobbes após feitas certas ressalvas.

  7. Razões para o não-uso de drogas ilícitas entre jovens em situação de risco

    OpenAIRE

    Sanchez,Zila van der Meer; Oliveira,Lúcio Garcia de; Nappo,Solange Aparecida

    2005-01-01

    OBJETIVO: Embora existam muitos estudos a respeito dos fatores de risco ao uso de drogas, pouco se sabe sobre as razões que mantêm jovens afastados do seu consumo. O objetivo do estudo foi identificar, entre adolescentes de baixo poder aquisitivo, quais os motivos que os impediriam a experimentação e o conseqüente uso de drogas psicotrópicas, mesmo quando submetidos a constante oferta. MÉTODOS: Adotou-se metodologia qualitativa, com amostra intencional selecionada por critérios. Foram entrevi...

  8. Razón pública, razonabilidad y religión. Para la crítica de una tradición liberal

    Directory of Open Access Journals (Sweden)

    Manfred Svensson

    2016-08-01

    Full Text Available Se aborda la idea de razón pública, atendiendo en particular a su concomitante ideal de razonabilidad. Se expone la continuidad de esta noción desde John Locke a John Rawls, destacando su vínculo con la religiosidad doctrinalmente minimalista de la tradición erasmista. Se cuestiona que, dado tal vínculo, esta ida pueda servir de criterio para evaluar la presencia de otras voces religiosas en la vida pública.

  9. Una prueba de razón de verosimilitudes para discriminar entre la distribución Poisson, Binomial y Binomial Negativa.

    OpenAIRE

    López Martínez, Laura Elizabeth

    2010-01-01

    En este trabajo se realiza inferencia estadística en la distribución Binomial Negativa Generalizada (BNG) y los modelos que anida, los cuales son Binomial, Binomial Negativa y Poisson. Se aborda el problema de estimación de parámetros en la distribución BNG y se propone una prueba de razón de verosimilitud generalizada para discernir si un conjunto de datos se ajusta en particular al modelo Binomial, Binomial Negativa o Poisson. Además, se estudian las potencias y tamaños de la prueba p...

  10. Knjižnična podrška studentskom učenju i istraživanju: ocjena kvalitete hrvatskih visokoškolskih knjižnica u postupku reakreditacije visokih učilišta

    Directory of Open Access Journals (Sweden)

    Aleksandra Pikić

    2016-12-01

    Full Text Available Potpisivanjem Bolonjske deklaracije Republika Hrvatska obavezala se na kontinuirano praćenje kvalitete sustava za visoko obrazovanje, koje se u praksi između ostaloga odvija postupkom reakreditacije. Cilj ovog istraživanja bio je ispitati razinu uspješnosti hrvatskih visokoškolskih knjižnica pomoću analize ocjena knjižničnih resursa koje su dali članovi stručnih povjerenstava prvog ciklusa reakreditacije hrvatskih visokih učilišta. Istraživanje obuhvaća sva hrvatska visoka učilišta koja su prošla postupak reakreditacije od samog početka njezina provođenja (ak. god. 2010./11. pa do kraja 2015. U tom periodu kroz postupak je prošlo ukupno 129 visokih učilišta ili dijelova visokih učilišta. Rezultati su pokazali da su, ukupno gledajući, hrvatske visokoškolske knjižnice u prosjeku dobile ocjenu 3. Također se pokazalo da nema razlike u ocjeni knjižničnih resursa između sveučilišnih sastavnica te veleučilišta i visokih škola, zatim između javnih i privatnih visokih učilišta te na kraju između glavnih sveučilišnih središta: Zagreba, Splita, Rijeke i Osijeka.

  11. Ergenlerde parasosyal etkileşim: İnternette gerçek benlik, kendilik algısı ve sosyal kaygı arasındaki ilişkiler

    OpenAIRE

    AYTULUN, Gözde

    2015-01-01

    Bu çalışmanın temel amacı, ergenlik dönemindeki seyircilerin dizikarakterleriyle geliştirdikleri parasosyal etkileşim ile internette gerçek benlik,kendilik algısı ve sosyal kaygı arasındaki ilişkiyi incelemektir. Bu çalışmada,cinsiyet ve yaşlarına göre sınıflandırılan bireyler, parasosyal etkileşim, internettegerçek benlik, kendilik algısı ve sosyal kaygı değişkenlerinden aldıkları puanlaraçısından da karşılaştırılmışlardır. Son olarak da, parasosyal etkileşimle ilişkili olanve paras...

  12. Leviatán como pretexto: T Hobbes y la invención moderna de la Razón

    Directory of Open Access Journals (Sweden)

    CARLOS MOYA VALGAÑÓN

    1979-01-01

    Full Text Available T. Hobbes inventó el concepto moderno de estado y el discurso político racional. En Leviatán se equipara razón con gobierno. Se examina la historia occidental que precedió la redacción de Leviatán, comenzando con la cristianización progresiva de los reinos bárbaros. Fue la noción secularizada de razón, en contraposición al reinado de Dios sobre el mundo, la que proporcionó a la burguesía el fundamento epistemológico necesario para su ascensión social. La monarquía absoluta se convirtió en la primera forma del estado moderno. El desarrollo de la imprenta fue el instrumento tecnológico-industrial de la moderna revolución burguesa en la cristiandad occidental. La Reforma Protestante surgió de la nueva libertad para leer libros otrora prohibidos, constituyendo el primer ímpetu para el crecimiento industrial y el desarrollo de la empresa. Así, las revelaciones de la Santa Escritura dieron paso a la investigación científica y a la ciencia moderna.

  13. Plan ili propal / Jekaterina Rodina

    Index Scriptorium Estoniae

    Rodina, Jekaterina

    2007-01-01

    Läbimõtlemata linnaplaneerimisest Tallinnas. "Vaeste-Tiskre" eramajade rajooni elanikud protestivad samasse piirkonda viiekorruseliste korterelamute ehitamise vastu. Elanike protest peatas 24-korruselise elumaja planeeringu kinnitamise Õismäe elurajoonis. Peatati Hiiul Sanatooriumi parki sanatooriumi sildi all valmiva korterelamu ehitustööd

  14. Humanismo, sujeto, modernidad. Sobre la crítica de la razón mítica de Franz Hinkelammert

    Directory of Open Access Journals (Sweden)

    Estela Fernández Nadal

    2010-03-01

    Full Text Available El trabajo aborda la concepción de la historia y la crítica de la modernidad desarrolladas por F. Hinkelammert, a las que se ubica en la perspectiva desarrollada por (la primera Escuela de Frankfurt, particularmente por Walter Benjamin. En la elaboración de las categorías fundamentales de la reflexion hinkelammertiana sobre la historia, se destaca un primer hito fundamental, constituido por la Crítica de la razón utópica. En esta obra, el autor presenta la aspiración de alcanzar verdaderas metas imposibles, pensadas en términos de instituciones perfectas, a partir de acercamientos progresivos, como una tendencia propia de la racionalidad moderna que debe ser sometida a critica. La Crítica de la razón mítica constituye el segundo hito de ese desarrollo critico, en el cual se retoma la relación entre cristianismo y modernidad a partir del concepto de “secularización”, mostrando sus relaciones de continuidad/ ruptura respecto a los resortes miticos que alientan paradójicamente la razón instrumental Abstract The work approaches the conception of history and the critique of modernity developed by F. Hinkelammert’s, which lies in the perspective developed by the (first Frankfurt School, particularly by Walter Benjamin. In the developing of the fundamental categories of the Hinkelammert reflection on history, highlights a fundamental first landmark, constituted by the Critic of the utopian reason. In this work, the author presents the aspiration to achieve real impossible goals, thought in terms of perfect institutions, from progressive approaches, as an own tendency of the modern rationality that must be subjected to criticism. The Critic of the mythical reason constitutes the second landmark of that critical development, in which retakes the relation between Christianity and modernity from the concept of “secularization”, showing its relations of continuity/rupture in respect to the mythical springs that paradoxically

  15. Historicismo, sujeto y moral (Max Weber y el «mito de la transparencia de la razón»

    Directory of Open Access Journals (Sweden)

    Valdecantos, Antonio

    1990-11-01

    Full Text Available Not available

    Recurso frecuente de lo que hoy reconstruimos como Ilustración fue desarbolar supersticiones y mitos. Es, sin embargo. lugar común redargüir que quien derriba ídolos no está libre de edificar otros nuevos (ni -tópico éste que cunde por doquier- de convertir su gesto iconoclasta en mito fundacional. No menos acostumbrado es apuntar a Max Weber como al primer desvelador de algún que otro episodio sobresaliente de la historia de la razón ilustrada, ya sea para abundar en su diagnóstico, ya para intentar salir de lo que se tiene por su «círculo hechizado ». En lo que sigue, se trata de rastrear algunas de las claves configuradoras de la crítica weberiana de la cultura procurando retrotraer a su desmantelamiento metodológico del ideal historicista, los términos en que elabora su problematízacíón del sujeto rnoderno. La inversión semántica de las categorías centrales de la epistemología y la Weltanschauung del historicísmo alemán decimonónico permite a Max Weber descubrir patologías del paradigma ilustrado allí donde se suele situar un momento de critica del mismo. Siguiendo los pasos de esta estrategia weberiana, nos es posible reconstruir la noción hípostasiada de racionalidad y de sujeto que Weber parece denunciar como tentación dogmática de la razón ilustrada. El programa weberiano constituye así el desenmascaramiento de un relato complaciente de lo moderno -al que llamo el «mito de la transparencia de la razóns-ey sobre ese supuesto cabe releer sus propuestas éticas más controvertidas, en particular la distinción entre «ética de convicción» y "ética de responsabílidad ».

  16. A QUESTÃO DA MORALIDADE: da razão prática de Kant à ética discursiva de Habermas

    Directory of Open Access Journals (Sweden)

    Barbara Freitag

    1989-12-01

    Full Text Available A moralidade, enquanto princípio que orienta a ação, permite várias abordagens, que sugerem um tratamento interdisciplinar. Neste ensaio a autora limita-se a quatro abordagens: a filosófica (Kant, a sociológica (Durkheim, a psicogenética (Kohlberg e a discursiva (Habermas. A grade que orienta esta seleção e delimita os temas abordados é o estruturalismo genético de Piaget, que fornece os elementos para se pensar adequadamente a questão em seu conjunto. O estruturalismo genético se funda na razão, inclui a sociedade na reflexão, reconstrói a gênese do julgamento e considera fundamental o discurso. Por isso, Piaget repousa em Kant, debate-se com Durkheim. prepara o terreno para Kohlberg e antecipa a teorização de Haberrnas.

  17. Considerações acerca da noção de razão pública no debate Rawls-Habermas

    Directory of Open Access Journals (Sweden)

    Raquel Kritsch

    2011-06-01

    Full Text Available Uma das diferenças principais entre o liberalismo político e a teoria da ação comunicativa repousa na fundamentação oferecida por seus formuladores da neutralidade de procedimento para alcançar princípios que devam reger as práticas e instituições políticas diante da pluralidade das doutrinas abrangentes em sociedades marcadas por uma grande heterogeneidade social e cultural. Tal distinção na fundamentação aparece com clareza na noção de razão pública, tema central do famoso debate no qual Rawls lança mão da idéia de overllaping consensus para explicitar uma concepção política da justiça que possa ser aceita pelas diversas doutrinas abrangentes de uma sociedade democrática bem-ordenada. Já o procedimento ideal de Habermas é o da deliberação, que pressupõe uma associação que se julga capaz de regular de um modo imparcial as condições de convivência numa sociedade, fazendo uso, para isso, de uma racionalidade procedimental para a justificação moral. Trata-se assim, aqui, de elucidar e debater duas fundamentações distintas (neutralidade de objetivo e princípio racionalmente justificável da noção de razão pública.

  18. Women entrepreneurs: reasons and difficulties for starting in business / Mulheres empreendedoras: razões e dificuldades para criação de empresas

    Directory of Open Access Journals (Sweden)

    Hilka Pelizza Vier Machado

    2016-06-01

    /conclusions: Results show that women entrepreneurs are not a homogenous group and that there is a need for public policies that would minimize difficulties in the setting up of companies to increase women´s participation as entrepreneurs. Objetivo: O objetivo desta pesquisa foi descrever as principais razões e as principais dificuldades para empreendedoras criarem seus negócios, bem como identificar possíveis diferenças entre as que empreenderam na indústria e as que o fizeram no comércio ou serviços. Originalidade/lacuna/relevância/implicações: A criação de empresas é importante para o Empreendedorismo e para compreendê-la é importante conhecer razões e dificuldades que empreendedores encontram para criarem suas empresas. Principais Aspectos Metodológicos: Foi realizado um estudo quantitativo com 102 empreendedoras da indústria e 96 no comércio/serviços. Os dados foram coletados por meio de um questionário estruturado e duas escalas do tipo Likert, as quais mensuraram razões e dificuldades para criação das empresas. Uma análise de cluster foi realizada para identificar possíveis grupos de atributos relacionados a razões e dificuldades para criar as empresas. O teste de Mann-Whitney foi empregado para comparar razões e dificuldades para criação de empresas nos dois grupos (indústria e comércio/serviços, a fim de identificar diferenças estatísticas significativas. Síntese dos Principais Resultados: Quanto aos resultados, o teste Mann-Whitney apontou que os dois grupos atribuíram o mesmo nível de importância às razões para criação do negócio: para ajudar financeiramente os filhos; dificuldade de crescimento no trabalho anterior; para se inserir novamente no mercado de trabalho; porque queria ganhar muito dinheiro. O mesmo teste indicou não haver diferença significativa quanto ao nível de importância atribuído a oito dificuldades para a criação do negócio: não acreditava no seu potencial; nunca tinha tido contato com outras empresas

  19. Halkla ilişkiler öğrencilerinin sosyal medyadaki siber zorbalık duyarlılıklarını ölçmeye ilişkin bir araştırma (A research related to the calculation of sensitivity for cyber bullying in social media among the students of public relations)

    OpenAIRE

    AKTAN, Ercan; ÇAKMAK, Veysel

    2015-01-01

    İnternet alt yapısındaki gelişmeye paralel olarak iletişim yöntemlerinde de bazı değişme ve gelişmeler yaşanmıştır. İletişimin sanal ortamlara hızlı biçimde kaydığı da gözlenmektedir. Bu ortamlardan biri de sosyal medyadır. Sosyal medyanın gelişmesi ile siber zorbalık kavramının gelişimi paralellik göstermiştir. Bu çalışma halkla ilişkiler ve tanıtım bölümü ön lisans ve lisans öğrencilerinin siber zorbalık duyarlılıklarını ölçmek amacıyla Aksaray Üniversitesi Sosyal Bilimler Meslek Yüksekokul...

  20. Evli erkeklerde eşlerine yönelik şiddet ve ilişkili etmenler/Spouse violence and related factors in married men

    Directory of Open Access Journals (Sweden)

    Guljan Dönmez

    2012-12-01

    Full Text Available Amaç: Araştırmanın amacı 25-49 yaş arası evli erkeklerde eşlerine yönelik şiddet uygulama durumunun, türlerinin ve etkileyen etmenlerin belirlenmesidir. Yöntem: Kesitsel tipteki çalışmanın evreni, İzmir’in Konak İlçesi’nde bulunan Esentepe Sağlık Ocağı Bölgesi’nde yaşayan 25-49 yaş arası 2615 evli erkektir. Sistematik örnekleme yöntemi ile seçilen 254 kişiye ulaşılmıştır. Bağımlı değişken olan şiddet varlığı “Yeniden Gözden Geçirilen Çatışma Taktikleri Ölçeği” (The Revised Conflict Tactics Scales=CTS 2 ile belirlenmiştir. Bağımsız değişkenler erkeğe ve eşine ilişkin sosyodemografik değişkenler, evliliğe ve aileye, sağlık durumuna, cinsel yaşama ilişkin özelliklerdir. Veri t Testi, Ki-kare, Lojistik Regresyon Analizi ile çözümlenmiştir. Bulgular: Eşe yönelik psikolojik şiddet sıklığı %93, fiziksel şiddet %37.5, ekonomik şiddet %34.4, cinsel şiddet %3.9 olarak saptanmıştır. Psikolojik şiddete maruziyet, ortaokul ve üzeri öğrenimli kadınlarda anlamlı olarak daha fazladır. Erkeklerin işsiz olması ya da düzensiz işlerde çalışması, haftada birkaç kez ya da her gün alkol kullanması, istenmeyen gebelik varlığı, kadının 25-34 yaş grubunda olması fiziksel şiddette belirleyici etmenler olarak saptanmıştır. Sonuç: Eşleri tarafından kadına yönelik olarak uygulanan psikolojik şiddet sıklığı beklenenden çok yüksek bulunmuştur. Üç erkekten biri ekonomik ve fiziksel şiddet uygulamaktadır. Cinsel şiddet düşük saptanmasına karşın sorunun daha büyük boyutlarda olabileceği düşünülmektedir. Anahtar Kelimeler: Aile içi şiddet, toplumsal cinsiyet, kadın sağlığı Spouse violence and related factors in married men Objective:The purpose of this study is to examine the presence, patterns and related factors of spouse violence among 25-49 years old men. Methods: The cross-sectional study was conducted in the

  1. Između progona i prešutne marginalizacije, ili iz povijesti stradanja Roma u nekim srednjoeuropskim državama za vrijeme Drugog svjetskog rata (Mađarska, Hrvatska, Čehoslovačka, Poljska)

    OpenAIRE

    Vojak, Danijel

    2016-01-01

    Većina europskih zemalja prije samog početka Drugoga svjetskog rata nije započela s nasilnijim pokušajima asimilacije, kakav je već bio u tijeku u nacističkoj Njemačkoj. Izbijanjem Drugoga svjetskog rata i širenjem nacističkog utjecaja na mnoge europske zemlje, bilo izravno kao okupirane, ili posredno kao države – saveznice, započeli su se provoditi neki dijelovi nacističkog anticiganističkog modela odnosa prema Romima. Analizom u ovom radu biti će obuhvaćen odnos srednjoeuropskih vlasti, pop...

  2. Povijest kemije i kemijskog inženjerstva Pedeseta obljetnica osnutka poslijediplomskog studija korozije i zaštite materijala na Tehnološkom fakultetu Sveučilišta u Zagrebu

    OpenAIRE

    Esih, I.; Stupnišek-Lisac, E.; Martinez, S.

    2011-01-01

    Prvi poslijediplomski studij na Kemijsko-tehnološkom odjelu Tehnološkog fakulteta (današnjem Fakultetu kemijskog inženjerstva i tehnologije) Sveučilišta u Zagrebu odnosio se na područje "Korozija i zaštita materijala", a osnovan je ak. god. 1960/61. na poticaj akademika Miroslava Karšulina. Studij je obuhvaćao 3 semestra a završavao je izradom i obranom magistarskog rada. Godine 1980. provedena je reorganizacija kojom su svi poslijediplomski studiji ujedinjeni u poslijediplomski studij "Inžen...

  3. Juicios morales y fronteras biológicas: más allá de la frontera razón / emoción

    Directory of Open Access Journals (Sweden)

    Cabezas, Mar

    2013-08-01

    Full Text Available We build boundaries that are theoretically based on biological grounds and we derive moral judgments from them. Likewise, we take for granted that emotions such as fear, disgust or rage were the element that led us to this mistake, especially when we realise the logical inconsistency of deriving moral judgments in this way. Consequently, we often associate emotions with prejudices, beliefs or fallacies, which we ought to free ourselves from. However, emotions are not the cause of the problem. Firstly, because the classical dichotomical framework that defends the reason/emotion polarity is also questionable. Secondly, because emotions, as alarms which transmit important information, may be a key element in the discovery and overcoming of the discriminations that arise at the boundaries of dichotomies. Thus, the aim here is to analyse the relationship between these three elements: biological boundaries, moral judgments and emotions. And then toargue in favour of the links between reason and emotions as a way of surpassing the old dichotomic model, and, to conclude, I will point out some of the benefits of replacing a dualistic framework by an interactive one.Construimos fronteras con supuesta base biológica y derivamos juicios morales de ellas. Asimismo, suponemos que fueron nuestras emociones —el miedo, el asco o la rabia— las que nos llevaron a tal error, especialmente cuando nos damos cuenta de la inconsistencia lógica de derivar juicios morales de dichas fronteras. En consecuencia, solemos identificar emociones con prejuicios, creencias u opciones falaces de las que más nos valdría librarnos. Sin embargo, como se tratará de argumentar a continuación, las emociones no son la causa del problema. Primero, porque el marco conceptual clásico dicotómico en el que razón y emoción son dos polos opuestos regidos por una tensión irreconciliable es a su vez cuestionable. Segundo, porque las emociones, en cuanto alarmas transmisoras de

  4. Los sueños de la razón: la crisis de sentido y el suicidio egoísta

    Directory of Open Access Journals (Sweden)

    Alejandro BIALAKOWSKY

    2016-02-01

    Full Text Available Este artículo se propone indagar las consecuencias teóricas y analíticas que posee el estudio del suicidio egoísta en la perspectiva de Durkheim. Para ello, en primer lugar, se reconstruye en su obra El Suicidio la distinción entre egoísmo y anomia, destacando tanto la importancia del egoísmo, muchas veces relegado por la literatura secundaria, como la relación de éste con las crisis de sentido. Con ese objetivo, se señala la diferencia entre las esferas sociales activas y pasivas como elemento central para comprender ese par conceptual. En segundo lugar, se rastrea en las postulaciones del autor la génesis social de la pregunta por el sentido, lo cual conlleva a un estudio del desarrollo histórico de las religiones y de las manifestaciones individuales del egoísmo (melancolía, languidez, solipsismo. En tercer lugar, se observa cómo el despliegue histórico de la razón señala la emergencia del idealismo simbólico, el cual supone una falta de integración social enmarcado en una serie de procesos: la desarticulación entre pensamiento y acción y entre creencias sofisticadas y prácticas; la pérdida de un objeto durable (representacional y “mundano” y de una representación totalizante; y la carencia de objetivos comunes de la sociedad. En última instancia, se analiza cómo la sociología, en tanto ciencia de lo social, puede intervenir en las patologías vinculadas a los “sueños de la razón” de las corrientes egoístas (pasivos y solipsistas; activos y destructores. Así, se vislumbran las diferentes búsquedas del autor por encontrar en la modernidad nuevos modos de articular representaciones de la totalidad de la sociedad con prácticas diarias, los cuales puedan dar sentido a los individuos racionalizados. Allí, el lugar del Estado, los rituales colectivos y los ideales de la humanidad y el patriotismo pueden ser releídos desde los interrogantes y propuestas teóricas que están en juego en el an

  5. Türkiye'nin 7 akarsu havzasında horozbina, Salaria fluviatilis (Asso,1801, balığına ait boy-ağırlık ilişkisi.

    Directory of Open Access Journals (Sweden)

    Ali İlhan

    2015-12-01

    Full Text Available Bu çalışmada Türkiye‟nin 7 akarsu havzasından toplanmış olan Horozbina Balığı (Salaria fluviatilis‟na ait boy-ağırlık ilişkisinin ortaya çıkarılması amaçlanmıştır. Marmara, Küçük Menderes, Batı Karadeniz, Antalya, Doğu Akdeniz, Seyhan ve Ceyhan havzalarına ait akarsulardan toplanmış olan 652 birey incelenmiştir. Tüm bireyler dikkate alındığında türün Türkiye içsularındaki total boy dağılımı 2.0-12.9 cm, total ağırlık dağılımı 0.10-33.82 g, boy-ağırlık ilişkisi parametreleri a= 0.0135, b= 3.004, r2= 0.986 olarak hesaplanmıştır. Ayrıca, büyüme tipi havzaların 5‟inde izometrik, 1 havzada pozitif allometrik ve 1 havzada da negatif allometrik olarak belirlenmiştir

  6. Türkiye’de denetleme, cezalar ve trafik güvenliği göstergeleri arasındaki ilişkiler: 2008-2012 yılları analizi

    Directory of Open Access Journals (Sweden)

    Nebi Sümer

    2015-12-01

    Full Text Available Amaç: Trafik denetiminin amacı, psikolojik caydırma ve öğrenme kuramı ilkelerine dayalı olarak yollarda trafik kurallarına ve düzenlemelerine tam uyumu sağlamaktır. Bu çalışmanın amacı Türkiye’de trafik denetimlerinin ve cezaların trafik kazaları, yaralanmaları ve ölümleri ile ilişkisini incelenmektir. Yöntem: Çalışmada 2008-2012 dönemine ait 81 ilin trafik denetleme, ceza ve kaza verileri kullanılmıştır. Bu amaçla, 81 ilde söz konusu dönemde araç başına düşen denetleme, ceza, kaza, yaralı ve ölümlere ilişkin trafik güvenliği göstergeleri hesaplanmış ve ilgili değişkenler arasındaki korelasyonlar incelenmiştir. Bulgular: Kaza, yaralanma ve ölüm oranın azaltılmasında, ceza sayısının denetim sayısından daha etkili olduğu gözlenmiştir. Denetim türleri arasında en yüksek düzeyde negatif anlamlı ilişki alkol denetimleri ile kaza riskine ilişkin çeşitli değişkenler arasında bulunmuştur. Emniyet kemeri ve aşırı hız denetimleri de trafikteki ölüm, yaralanma ve kazaları azaltmada anlamlı etkiye sahiptir. Genel olarak denetim/ceza ile trafik kazaları, ölümleri ve yaralanmaları arasındaki korelasyonlar -0,30 civarındadır. Bu da denetleme ve/veya ceza sayısının Türkiye’de kazaları %10 düzeyinde azalttığına işaret etmektedir. Sonuç: Hem beş yıllık toplamda, hem de yıllar bazında, trafik denetimlerinin ve cezalarının başta ölü, yaralı ve kaza sayısı olmak üzere, farklı trafik güvenliği göstergeleriyle negatif yönde ilişkili olduğu bulunmuştur.Anahtar Kelimeler: Trafik kazası, trafik güvenliği, trafik denetimi etkinliği, trafik cezası.

  7. Sobre la razón histórica moderna y su posteridad. Esbozo de una investigación histórico-conceptual

    Directory of Open Access Journals (Sweden)

    Carles Llinàs i Puentes

    2016-10-01

    Full Text Available El presente trabajo pretende esbozar algunos de los momentos más importantes del despliegue de la razón histórica moderna. Los complejos hilos que los conectan entre sí y con las aceleradamente cambiantes circunstancias de los últimos siglos constituyen la dificultad y, quizás, el interés del artículo. Sin querer proponer interpretaciones que agoten el sentido de las ideas y de los acontecimientos, la sucesión de Estado absoluto, crítica filosófico-histórica ilustrada liberal y, después, socialista, y, finalmente, crítica postilustrada (postmoderna genealógico-mitológica, sugiere muy probablemente la existencia de relaciones «ideales» y «materiales» con frecuencia no atendidas y abre tal vez nuevos caminos para tratar de ver en qué dirección se mueven las cosas.

  8. Las ciencias de la tierra y la biblia. Una aproximación desde la razón científica

    Directory of Open Access Journals (Sweden)

    Francisco J. Ayala

    2004-01-01

    Full Text Available El desarrollo de la Ciencia, Natural e Histórica, ha ido aportando nuevos elementos que permiten una aproximación a los relatos bíblicos desde la perspectiva de la razón científica. En este sentido, se presenta una aproximación científica, básicamente desde las Ciencias de la Tierra y teniendo en cuenta la realidad histórica del pueblo hebreo y la propia Biblia, al relato de la Creación, y los posibles núcleos histórico-científicos de los relatos del Diluvio Universal y la destrucción de Sodoma y Gomorra, de acuerdo con los últimos conocimientos disponibles. Por otra parte, se analizan los condicionamientos que los relatos bíblicos, especialmente la Creación y el Diluvio, impusieron históricamente al surgimiento de las Ciencias Geológicas.

  9. Razão, emoção e ação em cena: a mente humana sob um olhar evolucionista

    Directory of Open Access Journals (Sweden)

    Angela Donato Oliva

    Full Text Available O conhecimento científico da mente humana tem avançado desde a fundação da Psicologia. Aspectos biológicos e culturais, psicológicos e neurológicos, emocionais e racionais foram privilegiados separadamente em diferentes épocas e perspectivas - a visão de mente foi por vezes focalizada e por vezes relegada à caixa preta da ciência psicológica. Contemporaneamente, assiste-se a buscas de integração entre mente e comportamento humanos. A mente é vista como objeto da ciência e produto da seleção natural na evolução da espécie do Homo sapiens sapiens. Este trabalho visa apresentar uma breve história das principais transformações na concepção da mente, e de modelos evolucionistas de mente que contemplem a razão, a emoção e as ações humanas. Busca-se integrar e discutir as evidências das pesquisas de diversas disciplinas (Antropologia, Etologia, Primatologia, Psicologia, etc oferecendo uma compreensão evolucionista da mente humana, de sua filogênese e ontogênese. Comportamentos cooperativos e competitivos serão discutidos a partir dessas perspectivas.

  10. Razão e democracia: uso público da razão e política deliberativa em Habermas[ign] [title language="en"]Reason and democracy[ign]: [subtitle]Public use of reason and deliberative politics in Habermas

    Directory of Open Access Journals (Sweden)

    Denilson Luis Werle

    2013-01-01

    Full Text Available O objetivo do artigo é examinar como Habermas, orientado pela intuição normativa do uso público da razão, reconstrói uma concepção procedimental de democracia deliberativa, que, sem desconsiderar da dimensão estratégica e instrumental da esfera pública e da política, reformula a dimensão epistêmica da democracia: a aceitabilidade racional dos acordos políticos. Inicialmente, apresento brevemente a análise sociológica e histórica do conceito de esfera pública crítica, realizada em Mudança Estrutural da Esfera Pública (1962, para, em seguida, expor duas linhas de argumentação sobre o conceito de esfera pública e de política deliberativa, em Direito e Democracia (1992: a que se refere ao princípio de legitimação baseado na razão pública como uma reconstrução intersubjetiva e política do conceito kantiano de autonomia; e a que concerne aos aspectos essenciais da teoria crítica da sociedade fundada na distinção entre mundo da vida e sistema e a "tradução" sociológica e institucional do uso público da razão, nos conceitos de sociedade civil e esfera pública.The objective of this article is to examine how Habermas, guided by a normative intuition of the public use of reason, reconstructs a procedural conception of deliberative democracy which, without disregarding the strategic and instrumental dimensions of the public sphere and of politics, reconstructs the epistemic dimension of democracy: the rational acceptability of political agreements. First, I briefly present a historical and sociological analysis of the concept of the public sphere in The Structural Transformation of the Public Sphere (1962. I then present two lines of argumentation regarding the concept of the public sphere and deliberative democracy in Between Facts and Norms (1992: one refers to the principle of justification based on public reason as an intersubjective and political reconstruction of the Kantian concept of autonomy; the other

  11. Mersin ilinde görev yapan hekimlerin meslek örgütüyle ilişkileri ve beklentileri

    Directory of Open Access Journals (Sweden)

    Ahmet Öner Kurt

    2011-12-01

    Full Text Available Amaç: Bu çalışmada; Mersin İlinde görev yapan hekimlerin meslek örgütü olan tabip odası ile ilişkilerinin boyutu ve odadan beklentilerinin değerlendirilmesi amaçlanmıştır. Yöntem: Kesitsel tipteki bu çalışmada Mersin İlinde görev yapan toplam 1875 hekim evren olarak kabul edildi, örnek olarak 550 hekimin çalışmaya alınması hedeflendi. Çalışmaya alınacak hekimler; görev yeri, kurum, unvan ve cinsiyet oranına göre ağırlıklandırılarak tabakalı sistematik örnekleme yöntemi ile belirlendi. Veriler Kasım-Aralık 2009 tarihlerinde anket formu kullanılarak toplandı. Verilerin özetlenmesinde tanımlayıcı istatistikler ve değişkenlerin karşılaştırılmasında Ki-kare testi kullanıldı. Bulgular: Hekimlerin %69.1’i erkek, %82.5’i evli, %80.9’u kamu sağlık kurumlarında çalışıyor, %37.6’sı pratisyen hekim olarak görev yapıyordu. Hekimlerin ortalama görev süresi 17.4±9.6 (1–52 yıldı. Hekimlerin %77.1’i tabip odasına üye, %31.5’i son bir yılda tabip odası çalışmalarına katılmış ve %26.7’si bugünden sonraki süreçte tabip odası çalışmalarında görev almak istiyordu. Erkek, evli, özel sektörde çalışan, uzman olan, görev süresi 30 yıldan fazla olan ve çalışma koşullarının iyileştirilmesini bekleyen hekimlerin diğer gruplara göre tabip odasına daha fazla üye oldukları saptandı. Son bir yılda araştırma görevlileri tabip odası çalışmalarına daha az katılmıştı. Hekimlerin tabip odasından ilk sıradaki beklentisi; çalışma koşullarının iyileştirilmesiydi. Sonuç: Mersin’de dört hekimden birisinin tabip odasına üye olmaması, üçte ikisinin oda çalışmalarına katılmaması ve bugünden sonra da katılmayı düşünmemesi, hekimlerin örgütlü yaşamın gereklerini yeterince yerine getirmediğini ve meslek örgütlerine çok fazla sahip çıkmadığını düşündürmektedir. Tabip odaları üyelerinin odaya yakla

  12. Razón y amor en la teología medieval incipiente: Aproximación desde la confluencia de las fuentes griegas y latinas

    Directory of Open Access Journals (Sweden)

    Anneliese Meis

    2002-01-01

    Full Text Available El presente estudio escoje un período de gran envergadura teológica y excepcionalmente sensible al problema razón y amor. En el siglo XII se va gestando la subjetividad moderna, de tanta relevancia para la Teología, pero, sobre todo, se produce aquella confluencia de fuentes latinas y griegas, que como problema requiere máxima atención, ya que su recepción patrística medieval es vital para la búsqueda de la verdad a través de la ciencia. Se estudian siete autores que remontan al siglo XII: -Hildegard von Bingen, Guillermo de St. Thierry, Ricardo de San Víctor-, pero tres le preceden: -Gregorio Magno, Juan Escoto Eriúgena, Anselmo de Canterbury- y uno los complementa: Buenaventura. La elección de estos autores ha permitido seguir de cerca la articulación del problema, su contextualización y las soluciones novedosas, de gran riqueza antropológica teológicaThis study selects a period of great theological depth and particularty sensitive to the issue of reason and love. The modern subjectivity, which has had enormous relevance for Theology, started to germinate during the XII century; the times of the convergence of the Latin and Greek sources. This required much attention, as their reception by the medieval patristic is essential for a proper search of the truth through the science. The article focuses on seven authors who date from the XII century. Hildegard von Binger, Willian of St. Thierry, Richard of Saint Victor, who are preceded by Gregory the Greta, John Scotus Eriungena, Anselm of Canterbury and Bonaventure. The selecction of these authors allows a close articulation of the problem, its contextualisation and novel solutions of great theological and anthropological richness

  13. Resposta espectral de solos em razão do ângulo de visada, da umidade e da rugosidade superficial

    Directory of Open Access Journals (Sweden)

    ACCIOLY LUCIANO JOSÉ DE OLIVEIRA

    2000-01-01

    Full Text Available Este trabalho teve por objetivo avaliar as variações do fator de refletância bidirecional (FRB de três séries de solo (McAllister, Stronghold e Epitaph da microbacia experimental de Walnut Gulch (Arizona, EUA em razão do ângulo de visada, da rugosidade superficial e do teor de umidade. Foram consideradas as faixas espectrais do visível e do infravermelho próximo e médio presentes no sensor TM, e os resultados foram expressos em termos de FRB em relação à resposta no Nadir (FRB relativo. O anisotropismo variou de solo para solo e foi maior nas menores faixas espectrais, nos ângulos de visada maiores localizados na direção do retroespalhamento, nos ângulos solar-zenitais maiores, e na condição de solo seco. No solo Epitaph (único solo submetido ao estudo de rugosidade o anisotropismo foi também maior na superfície mais rugosa. Entretanto, uma melhor diferenciação entre as superfícies lisa e rugosa do solo Epitaph foi obtida na direção do espalhamento da energia refletida. Diferenças na escala e nos métodos de obtenção dos dados são apontadas como causas do realce do comportamento anisotrópico dos dados obtidos em condições de laboratório, em comparação com os dados de campo.

  14. Razão e emoção: o voto na eleição presidencial de 2006

    Directory of Open Access Journals (Sweden)

    Jairo Tadeu Pires Pimentel Junior

    2010-11-01

    Full Text Available Este artigo tem como proposta analisar o papel dos sentimentos na estruturação das escolhas eleitorais durante a eleição presidencial brasileira de 2006. Especificamente, analisa de que forma as emoções dos eleitores em relação aos candidatos afetam e estimulam a avaliação e o voto nos mesmos. Primeiramente, buscamos demonstrar formas de mensuração das emoções em termos quantitativos através de surveys realizados durante o período eleitoral. Em segundo lugar, buscamos evidenciar que a avaliação retrospectiva pode ser mais bem entendida se compreendermos como a avaliação de governo interage com os estados emocionais dos eleitores. Destarte, negando a longa tradição que contrapõe razão e emoção dentro da política, salientamos a tese de que os sentimentos constituem uma importante variável no processamento de informações e, consequentemente, na decisão do voto.This article to analyzes the role of emotion in the electoral choices during the 2006 Brazilian presidential election. Specifically, it analyzes in which way the emotions of the voters in relation to the candidates affect and stimulates the evaluation and the vote for them. In the first place, we demonstrate forms of measuring emotions in quantitative terms through surveys conducted during the electoral period. Second, we demonstrate that the retrospective evaluation government's can better be understood if we comprehend in which way the government's evaluation interacts with emotional states of the voters. Thus, denying the long tradition that opposes reason and emotion in politics, we point out the thesis that feelings constitute an important variable in the information processing and, consequently, in the vote decision.

  15. Kadın öğretmenlerin kariyer engelleri ile iş doyum düzeyleri arasındaki ilişki / Effect of career barriers facing women teachers on their level of job satisfaction

    Directory of Open Access Journals (Sweden)

    Yusuf İNANDI

    2012-12-01

    Full Text Available ÖZETBu çalışmada, kadın öğretmenlerin kariyer engellerinin, onların iş doyum düzeyleriyle ilişkisini ve yordama düzeyini belirlemek amaçlanmaktadır. Araştırmanın çalışma grubunu Türkiye’deki 21 ilin kent merkezlerindeki ilköğretim okullarında görev yapan 1.070 kadın öğretmen oluşturmaktadır. Betimsel nitelikte olan araştırmada, veriler ‘Kadınların Kariyer Engelleri Ölçeği’ (KKEÖ ve ‘İş Doyum Ölçeği’ (İDÖ ile toplanmıştır. Araştırma sonuçları, kadınların kariyer engelleri ile iş doyum düzeyleri arasında güçlü bir ilişki ortaya koymamaktadır. Yine araştırma sonuçlarına göre kadınların kariyer engelleri, iş doyumunun alt boyutları üzerinde sınırlı etkiye sahiptir. Kadın öğretmenlerin kariyer engelleri, iş doyumunun, sırasıyla, ‘iletişim’, ‘sosyal haklar’, ‘işin yapılma şekli’, ‘çalışma koşulları’, ‘maaş’, ‘işin yapısı’, ‘ilk amirle ilişkiler’, ‘yönetim’ ve ‘çalışma arkadaşları’ alt boyutlarını etkilemektedir. Kadın öğretmenlerin iş doyumları, en fazla, ‘toplumdaki cinsiyete ilişkin kalıp yargıları, ailevi durumlar ve kadınların kendi bakış açıları’ kaynaklı engellerden etkilenmektedir. Kadın öğretmenlerin kariyer engellerinin, onların iş doyumlarını düşük düzeyde yordaması, kadınların ve erkeklerin, kadınların yönetim süreçlerinde az olma durumlarını içselleştirmelerinden kaynaklanmış olabilir.

  16. Öğretmen, yönetici ve anne-babaların kaynaştırma uygulamalarına ilişkin görüşlerinin belirlenmesi

    Directory of Open Access Journals (Sweden)

    Tevhide Kargın

    2003-07-01

    Full Text Available Bu araştırma ülkemizde 1986 yılından beri uygulanmakta olan kaynaştırma uygulamalarına ilişkin mevcut durumu saptamak amacıyla 2566 kişiden veri toplanarak gerçekleştirilmiştir. Bu kişilerin 907’si sınıf öğretmeni, 519’u okul yöneticisi ve 1140’ı ise engelli çocukları normal sınıflara devam eden anne babalardır. Veriler, katılımcıların demografik özellikleri, kaynaştırma uygulamaları, problemler ve ileride yapılması gerekenlerle ilgili sorulardan oluşan “Kaynaştırma Uygulamalarına ilişkin Durum Saptama Anketi” aracılığı ile toplanmıştır. Verilerin analizi sonucunda, Türkiye’de kaynaştırmaya ilişkin birçok problem olduğu; öğretmenler, anne-babalar ve okul yöneticilerinin kaynaştırma uygulamalarına ilişkin bilgi ve becerileri ile okulların sınıf büyüklüğü, öğretim materyalleri ve destek servislerinin sınırlı olduğu görülmüştür. Ayrıca, sınıf öğretmenlerinin engelli çocuklara öğretim yapmak ve sınıfta bu çocukları desteklemek konusunda yeterli eğitim almadıkları bildirilmiştir. The research reported in this article investigated the current situation of the mainstreaming programs implemenred since 1986 in Turkey. Participants of the study were 907 elementary school teahers, 519 school administrators and 1140 parents of children with disabilities placed in regular schools. Data was collected by using “Mainstreaming Programs Situation Survey” consisted of questions related to the demographic characteristics of the respondents, ongoing mainstreaming applications, and problems. The frequency analysis of the responses of the subjects revealed that many problems existed in Turkey in terms of the information and the skills of the teachers, the parents and the administrators about the mainstreaming programs, physical conditions of the schools such as class size, amount of instructional materials, lack of support services. Morover all the

  17. Formación ética de los profesionales. Forjando el interés desde la razón y la emoción

    Directory of Open Access Journals (Sweden)

    Elsa González

    2013-11-01

    Full Text Available El presente trabajo realiza una propuesta crítica y práctica acerca de laformación humanística que las universidades deberían diseñar y proporcionar en elmarco de su responsabilidad social universitaria a los futuros profesionales (empresarios,docentes, comunicólogos, publicitarios, periodistas, sanitarios, etcétera.Como propuesta de reflexión crítica, el trabajo parte de una comprensión de laeducación universitaria como canal apropiado para interesar a las personas en labúsqueda y promoción de valores globales y humanistas que estén a la altura de laconciencia moral alcanzada por las sociedades con pluralismo moral. A partir de aquíse argumenta que la universidad, como institución social, tiene la responsabilidad deformar en capacidades tanto científicas y epistemológicas como prácticas.Como propuesta práctica, en este trabajo se plantean los rasgos que, de acuerdo conel marco crítico, se deberían potenciar a lo largo de la formación universitaria en losestudiantes para que fueran capaces de enlazar su propio proyecto vital con el proyectode la humanidad. No se puede olvidar que una de las tareas que tiene la educaciónuniversitaria, como actividad, es la de constituir auténticos agentes morales capacitadospara encarnar valores globales a la altura de la humanidad, es decir, ciudadanosy profesionales que descubren y van definiendo su propio proyecto personal dentro delos proyectos comunitarios y globales que existen en su sociedad y en la humanidad.En definitiva, con este trabajo se pretende desarrollar una propuesta que arroje luzacerca de la conexión entre tres aspectos esenciales para la formación científica y profesionaluniversitaria, interés, razón y emoción, y los proyectos que los seres humanos han tomado como propios porque humanizan, porque nos ayudan a ser ciudadanos ysociedades más justas, más responsables y mejores.

  18. Prikaz knjige: Budislav Vukas, ml., Hrvatska državnost – pravnopovijesne prosudbe: uz 25. godišnjicu prijama Republike Hrvatske u Ujedinjene narode, Pravni fakultet Sveučilišta u Rijeci, Rijeka, 2017.

    Directory of Open Access Journals (Sweden)

    Mirela Krešić

    2018-01-01

    Full Text Available Godina 2017. u svjetskim je razmjerima bila iznimno dinamična godina. Obilježila su je različita zbivanja koja u našem globalnom selu imaju posvemašnji utjecaj bilo da je riječ o prirodnim katastrofama (uragani, požari, poplave i potresi ili onima na koje je znatno više utjecaja imala ljudska ruka, od terorističkih samoubilačkih napada, nuklearnog mahnitanja sjevernokorejskog vođe Kim Jong Una, neobičnog predsjednikovanja Donalda Trumpa ili, ako pogledamo bliže našem dvorištu, migrantskih valova, pokretanja postupka britanskog izlaska iz Europske unije te pokušaja katalonske vlade da izbori neovisnost od Španjolske. Istodobno tu su godinu u Hrvatskoj obilježile duboke društvene podjele, ideološke svađe te iseljavanje znatnog broja građana. Nezadovoljstvo koje hrvatski građani osjećaju i izražavaju prema stanju u državi, funkcioniranju njezinih institucija i pravcu u kojem zemlja ide daje nam pravo, ali nas i obvezuje, svakog pojedinačno i društvo u cjelini, upitati se što smo učinili u proteklih nemalih dva i pol desetljeća, odnosno jesmo li učinili dovoljno kako bismo opravdali stečenu neovisnost o kojoj su brojne generacije prije nas sanjale. Upravo je protek čak četvrt stoljeća od stjecanja neovisnosti bio poticaj prof. Budislavu Vukasu, mlađem da se u godini obilježavanja 25. godišnjice prijama Republike Hrvatske u Ujedinjene narode (22. svibnja, ali i obljetnice njezina međunarodnog priznanja (15. siječnja, pozabavi pitanjem hrvatske državnosti u prošlosti i njezinu kontinuitetu/diskontinuitetu kroz stoljeća. Rezultat njegova istraživanja je monografija Hrvatska državnost – pravnopovijesne prosudbe u izdanju Pravnog fakulteta Sveučilišta u Rijeci. Na 240 stranica teksta monografija daje autorovo viđenje “fenomena kontinuiteta hrvatske državnosti” (str. 9, pri čemu se na događanja s početka devedesetih godina prošlog stoljeća može gledati kao na svojevrsnu kulminaciju spomenutog

  19. Discriminación de cantidad: efecto de la razón numérica sobre velocidad y precisión / Quantity discrimination: effect of number ratio over speed and accuracy

    Directory of Open Access Journals (Sweden)

    Jesica Formoso

    2016-06-01

    Full Text Available RESUMEN: La habilidad de estimar y discriminar cantidades es de aparición temprana en el desarrollo y previa a la adquisición de un sistema numérico simbólico. El rendimiento en tareas de discriminación está modulado por la razón numérica que diferencia los conjuntos, de forma tal que razones más pequeñas resultan en comparaciones más lentas y menos efectivas. El objetivo del presente trabajo es analizar la precisión y velocidad con que niños de 4 y 6 años discriminan entre dos cantidades en función de la razón numérica que las diferencia. Método: se administró una tarea de discriminación no simbólica de cantidades (ad hoc a 60 niños de 4 y 6 años de edad de la Ciudad Autónoma de Buenos Aires, Argentina. Se realizó un ANOVA de diseño mixto para analizar la cantidad de aciertos y los tiempos de reacción (TR en función de la edad y la razón numérica que diferencia los conjuntos. Se utilizó la prueba de contraste de Bonferroni para detectar las diferencias en aciertos y TR entre cada razón. Resultados: (a Los niños de 6 años mostraron TR más pequeños y mayor cantidad de aciertos que los niños de 4 años. Esto sugiere que la discriminación de cantidades atraviesa un proceso de desarrollo evolutivo. (b Cuanto mayor fue la razón numérica en la diferenciación de los conjuntos, más efectiva fue la discriminación. Esto sugiere que la razón modula el rendimiento, independientemente de la edad del sujeto. ABSTRACT: The ability to estimate and discriminate quantities is of early onset in the development and prior to the acquisition of a symbolic numerical system. The performance on tasks of discrimination is modulated by the number ratio that differentiates the sets, so that smaller reasons result in slower and less effective comparisons. The objective of the present study is to analyze the precision and speed by which 4 and 6 year old children discriminate between two quantities based on the number ratio that

  20. Adult sex ratio effects on male survivorship of Drosophila melanogaster Meigen (Diptera, Drosophilidae Efeito da razão sexual de adultos na curva de sobrevivência de machos de Drosophila melanogaster Meigen (Diptera, Drosophilidae

    Directory of Open Access Journals (Sweden)

    Marcelo Costa

    2010-01-01

    Full Text Available The behavioral biology has a central role in evolutionary biology mainly because the antagonistic relations that occur in the sexual reproduction. One involves the effect of reproduction on the future life expectation. In this scenario, changes in male operational sex ratio could lead to an increase in mortality due to costs associated with excessive courtship and mating displays. Thus, this work experimentally altered the male sex ratio of Drosophila melanogaster Meigen, 1830, to determine its impact on mortality. The results indicated that mortality increases as the sex ratio changes, including modifications in the survivorship curve type and in the curve concavity, measured by entropy.A biologia comportamental tem um papel central na biologia evolutiva principalmente pelas relações antagônicas que ocorrem na reprodução sexuada. Uma destas relações envolve o efeito da reprodução sobre a expectativa de vida futura. Neste cenário, alterações na razão sexual operacional de machos podem levar a um aumento na mortalidade por causa dos custos associados com o excesso de displays de corte e cópulas. Neste sentido este trabalho alterou experimentalmente a razão sexual em machos de Drosophila melanogaster Meigen, 1830, para determinar os efeitos em termos de mortalidade. Os resultados indicam que a mortalidade aumenta a medida que a razão sexual se enviesa incluindo alterações no tipo de curva de sobrevivência e da concavidade da curva, medida pela entropia.

  1. ¿Podemos esperar el auxilio divino? La autonomia moral y el recurso a la gracia en La religion dentro de los límites de la mera razón

    Directory of Open Access Journals (Sweden)

    Miguel González Vallejos

    2015-06-01

    Full Text Available En el presente artículo, el autor analiza el concepto de gracia desarrollado por Kant en La Religión dentro de los límites de la mera razón y lo confronta con el principio de autonomía. La tesis central sostiene que Kant desarrolla un concepto de gracia restringido compatible tanto con las tesis centrales de la segunda crítica como con el cristianismo entendido como religión moral.

  2. Validation of the ratio scale of the differents types of pain Validación de la escala de razón de los diferentes tipos de dolor Validação da escala de razão dos diferentes tipos de dor

    Directory of Open Access Journals (Sweden)

    Priscilla Hortense

    2008-08-01

    Full Text Available The main aim was to validate the ratio scale derived from the non-metric continuum of the intensity of the different types of pain using cross-modality matching. Magnitude estimation method and cross-modality matching were used with perceived line lengths. The study was formed by 30 outpatients from various specialty clinics, 30 physicians and 90 nurses. The results were: Cancer Pain, Myocardium Infarct Pain, Renal Colic, Burn Injury Pain, and Childbirth Labor Pain were regarded as the pains of greater intensity; the rank order of pain intensity for the different types of pain, comparing the different psychophysical methods used resulted in levels of significant agreement. The conclusion was that the relation between the magnitude estimates and cross modality matching estimates of the line-lengths is a power function, and the scale for the different types of pain is valid, stable and consistent.El objetivo general fue validar la escala de razón derivada para el continuo no métrico de intensidad de los diferentes tipos de dolor por medio del método de emparejamiento intermodal. Fueron utilizados los métodos de estimación de magnitud y de emparejamiento intermodal con la modalidad de respuesta en largo de líneas. Participaron 30 pacientes de ambulatorio de diferentes clínicas, 30 médicos y 30 enfermeros. Los resultados mostraron: Dolor en el Cáncer, Dolor por Infarto del Miocardio, Dolor por Cólico Renal, Dolor por Quemadura y Dolor en el Parto; que fueron considerados los tipos de dolor de mayor intensidad; el orden de las posiciones de la intensidad de los diferentes tipos de dolor, cuando se compara los diferentes métodos psicofísicos utilizados, resultó en niveles de concordancia significativa. Concluimos que la relación entre las estimativas de magnitudes y las estimativas de largo de líneas es una función exponencial y la escala de los diferentes tipos de dolor es válida, estable y consistente.O objetivo geral foi validar a

  3. Emeklilik Fonları ve Finansal İstikrar: Şili ve Türkiye Örneklerinden Dersler(Pension Funds and Financial Stability: Lessons from Chile and Turkey

    Directory of Open Access Journals (Sweden)

    Vedat Akgiray

    2016-03-01

    Full Text Available Emeklilik fonları, i uzun vadeli yatırım perspektifine sahip olması, ii finansal piyasalardaki oynaklığı uzun vadeye yayarak absorbe edebilmesi, ve iii yatırımlarını hisse senedi ve altyapı fonları ile reel ekonomiye aktarmaları sayesinde; finansal piyasalardaki oynaklığın azalmasına katkıda bulunmaktadır. Bu çalışma, gelişmekte olan ülkelerde (GOÜ,  emeklilik fonlarının ekonomideki payının en düşük olduğu ülkelerden Türkiye'de (%2 ve en yüksek olduğu ülkelerden Şili'de (%66 emeklilik sistemlerinin karşılaştırmalı analizini sunarak, emeklilik fonlarının finansal piyasalardaki oynaklığa olan etkisini 2004-2014 dönemi için incelemektedir. Çalışma aynı zamanda, Türkiye’de uygulanması planlanan ‘otomatik katılım sistemi’ ve bu sistemi tamamlayıcı ‘fon ürünleri’ üzerine politika önerilerini de kapsamaktadır.

  4. Ortaöğretim dokuzuncu sınıf matematik ders kitabına ilişkin öğretmen ve öğrenci görüşleri

    OpenAIRE

    Karaca Gün, Canan

    2009-01-01

    Bu araştırmanın amacı, ortaöğretim okullarının 9. sınıflarında okutulan matematik ders kitabına ilişkin öğretmen ve öğrenci görüşlerini belirlemektir. Araştırmanın çalışma evrenini, Aydın il merkezindeki toplam 19 ortaöğretim okulunda görev yapan matematik öğretmenleri ve bu okullarda öğrenim gören 9. sınıf öğrencileri oluşturmaktadır. Araştırmada nicel araştırma ve nitel araştırma yöntemleri birlikte kullanılarak, sayısal veriler sözel veriler ile desteklenmiştir. Örneklem seçimi iki farklı ...

  5. Kontrol odağı ve örgütsel muhalefet arasındaki ilişki üzerine bir araştırma

    OpenAIRE

    KAYA, Çiğdem

    2017-01-01

    Bu çalışmada çalışanların iş çevrelerindeki kontrol algılarının (kontrol odağının), örgütle ilgili anlaşmazlıklarını ve karşıt fikirlerini sözlü olarak ifade etme stratejileri (örgütsel muhalefet) ile ilişkisinin incelenmesi amaçlanmıştır. Bu amaçla, İstanbul’da çeşitli sektörlerde faaliyet gösteren firmalarda çalışan 180 beyaz yakalı çalışandan toplanan veri analiz edilmiştir. Elde edilen sonuçlar, çalışanların kontrol odaklarının yapıcı açık muhalefet, dışsal muhalefet ve sorgulayıcı açık m...

  6. Bachelard: libido, razón, conocimiento y espíritu científico. Hacia una comprensión alternativa de la noción de obstáculo epistemológico

    Directory of Open Access Journals (Sweden)

    Gerardo Andrés Perafán Echeverri

    2015-09-01

    Full Text Available En el texto se aborda un desarrollo alternativo de las categorías bachelardianas de obstáculo y ruptura epistemológica, a partir del establecimiento de algunas relaciones teóricas posibles entre Platón, Freud, Jung y Bachelard. En general, se plantea que tanto para Bachelard como para Platón el devenir del espíritu científico se explica a partir del inconsciente individual y colectivo, con lo cual la razón aparece como una función de este último. Por otro lado, se señala cómo el desprendimiento, ruptura o mutación va de la proyección de los primeros arquetipos en las “cosas”, a la función de organización o razón polémica, en lo que puede considerarse como un tipo de proyección particular, quizá más elaborada, que Bachelard llamará realización.

  7. PVC Orientado: avaliação de processo de orientação e das propriedades mecânicas em função da razão de estiramento

    Directory of Open Access Journals (Sweden)

    Felipe Albuquerque Medeiros

    2013-01-01

    Full Text Available Este artigo avalia o efeito da "orientação molecular" nas propriedades mecânicas do PVC Rígido. Introduz-se o tema associando-o à aplicação do PVC Orientado em sistemas de tubulações, considerando a importância do nível de gelificação na qualidade desses produtos. É descrito e testado um método experimental de orientação mono-axial em um extrudado e materiais com diferentes razões de estiramento são produzidos para avaliação de propriedades mecânicas. Aumentando a razão de estiramento, há ganhos principalmente no limite de resistência à tração, além do módulo elástico sob tração e tenacidade. Por outro lado, a deformação na ruptura é reduzida.

  8. Pro god uhhodjashtshii mõ jeshtsho mozhem skazat "neplohhoi". Kak nazovut god sledujushtshii?

    Index Scriptorium Estoniae

    2008-01-01

    Ida-Virumaa suuremate omavalitsuste juhid Jevgeni Solovjov, Niina Neglasson, Jelena Korshunova ja Mihhail Stalnuhhin ning Ida-Viru maavanem Riho Breivel teevad kokkuvõtteid mööduvast aastast ning heidavad pilgu algavasse aastasse

  9. U teatra "Ilmarine" takogo diploma jeshtsho ne bõlo! / Jekaterina Moskalenko

    Index Scriptorium Estoniae

    Moskalenko, Jekaterina

    2000-01-01

    Petrozavodski Rahvusvaheline Kammerlavastuste festivalil (Karjala) sai Narva linnateater "Ilmarine" näidendiga "Brõss v preispodnjuju" kaks diplomit. Muinasjutt-näidendi kohandas Helle Laasi jutustuse järgi teatrile P. Rimski. Lavastaja Juri Mihhaljov

  10. Razão peso/comprimento: um bom indicador do estado nutricional em recém-nascidos a termo? Weight/length ratio: is it a good index to assess the nutritional status of full-term newborns?

    Directory of Open Access Journals (Sweden)

    Taciana D. de A. Braga

    2002-01-01

    Full Text Available Objetivo: uma avaliação acurada do estado nutricional da criança ao nascer tem importância na identificação precoce de eventos mórbidos relacionados com a aceleração ou desaceleração do crescimento intra-útero. Os índices antropométricos resultantes das razões entre o peso e o comprimento e aqueles que resultam da razão entre o perímetro braquial e o perímetro cefálico podem ser uma alternativa, dentro da antropometria, para esse fim. O objetivo principal deste estudo foi verificar o grau de correlação entre a prega cutânea triciptal e os índices antropométricos - índice ponderal de Rohrer, índice de massa corpórea, razão peso/comprimento, razão perímetro braquial/perímetro cefálico - utilizados como critério de avaliação do estado nutricional de recém-nascidos. Métodos: realizou-se um estudo de corte transversal em 390 recém-nascidos a termo na maternidade do Centro de Atenção à Saúde da Mulher do Instituto Materno-Infantil de Pernambuco, no período de maio a julho de 1999. Os recém-nascidos foram avaliados quanto ao peso, comprimento, perímetros cefálico e braquial e prega cutânea triciptal. Resultados: os resultados mostraram que os índices antropométricos apresentaram correlação significante com a prega cutânea triciptal, tendo sido a razão simples entre o peso e o comprimento aquele que se correlacionou mais fortemente (r = 0,63; p Objective: An accurate assessment of the nutritional status of an infant at birth is very important, since it provides information on early identification of pathological events related to intrauterine growth acceleration or retardation. Anthropometric ratios such as weight/length and mid-arm circumference/head circumference may be used as alternative tools for this purpose. The main objective of this study was to verify the correlation between triceps skinfold thickness with Rohrer Index, Body Mass Index, weight/length ratio, and mid-arm circumference

  11. Razões de desmame e de introdução da mamadeira: uma abordagem alternativa para seu estudo Reasons for weaning and the introduction of bottle-feeding: an alternative approach

    Directory of Open Access Journals (Sweden)

    Marina Ferreira Rea

    1988-06-01

    Full Text Available Descrevem-se as razões alegadas pelas mães para o desmame e a introdução de mamadeira em uma amostra de 875 mulheres, de um bairro de São Paulo, que deram a luz em uma maternidade pública local, em 1985. Estas mães fizeram parte de um estudo de intervenção pró-amamentação desenvolvido nos serviços públicos de saúde por elas freqüentados até o 4º mês de vida das crianças. Discutem-se formas diferentes de coleta de dados sobre o processo de desmame e apresentam-se três maneiras distintas de analisar tais dados. Conclui-se que as razões mais alegadas pelas mães para introduzir a mamadeira, quando colhidas em várias entrevistas com elas ("entrevistas múltiplas" são: trabalho fora do lar (20,5%, nervosismo (12,5% e conveniência da mãe (11/0%. Entretanto, quando tais razões são argüidas em apenas um primeiro contacto, assim aparecem: choro do bebê (23,0%, conceitos ou suposições sobre o aleitamento (12,5% e trabalho fora do lar (11,0%. Estas diferenças no perfil de razões conforme o tipo de coleta, não aparecem evidentes no caso de razões para o desmame completo, entretanto, acreditando-se ser o desmame um processo, onde razões de introdução da mamadeira e do desmame devem ser vistas como um todo, as autoras apontam para a vantagem de se utilizar todas as respostas da mãe em diversos momentos ("entrevistas múltiplas" no sentido de melhor contribuir para a elucidação daquele processo. O agrupamento das razões conforme responsabilização pelo desmame mostra que, ao se permitir que a mãe reveja seu discurso em várias entrevistas, ao invés de em uma única, ela passa a responsabilizar mais a si própria (ato de vontade do que o bebê ou o seu próprio corpo. Apontam-se limites do sistema de saúde em interferir no processo de desmame precoce e perspectivas de intervenção de ordem mais ampla.Reasons, alleged by mothers, for early weaning and for the introduction of breast-milk substitutes were studied, in

  12. O que Determina a Tomada de Decisão Financeira: razão ou emoção?What Determines the Financial Decision-Making: reason or emotion?¿Qué es lo que Determina la Toma de la Decisión Financiera: la razón o la emoción?

    Directory of Open Access Journals (Sweden)

    SANTOS, José Odálio dos

    2011-03-01

    Full Text Available RESUMOÉ importante destacar que nem todos os investidores interpretam da mesma forma as informações relevantes divulgadas no mercado, o que pode ser explicado pelas seguintes condições divergentes: crenças, valores, qualidade do banco de dados que utilizam, nível de conhecimento técnico e importância que atribuem às informações qualitativas e quantitativas extraídas do objeto de avaliação. A pesquisa visa a compreender a lógica do processo de tomada de decisão financeira de parte do segmento de pessoas físicas no Brasil. Para isso, foi realizada uma investigação das heurísticas e dos vieses presentes na tomada de decisão dessas pessoas, considerando que o investidor e o consumidor são influenciados por diversos aspectos psicológicos e racionais. Uma pesquisa baseada em fundamentos básicos de Finanças Comportamentais foi aplicada em uma amostra demograficamente qualificada de assinantes de uma das principais editoras brasileiras de revistas. Desse total, obteve-se resposta, via Internet, de 641 brasileiros segmentados por gênero, idade, renda e escolaridade. Na pesquisa, avaliou-se, em cada grupo, a presença de heurísticas e vieses como, por exemplo, excesso de confiança, representatividade, ancoragem e procrastinação. Os resultados da pesquisa mostraram que tanto a razão quanto a emoção influenciaram nas respostas da predominância dos participantes da amostra. A maioria das pessoas considera que seu comportamento financeiro é mais racional do que o de seus pares. Como se esperava, o estudo indicou diferenças significativas no comportamento de acordo com o gênero, idade, escolaridade e renda.ABSTRACTIt is important to detach that nor all the investors interpret in the same way the relevant information divulged in the market, what can be explained by the following divergent or different conditions: beliefs, values, quality of the database that they use, level of technical knowledge and importance they attach

  13. Aleitamento materno na primeira hora de vida em um Hospital Amigo da Criança: prevalência, fatores associados e razões para sua não ocorrência

    Directory of Open Access Journals (Sweden)

    Mércia Natália Macêdo Belo

    2014-03-01

    Full Text Available Objetivos: identificar a prevalência do aleitamento materno na primeira hora de vida, os fatores associados e as razões para sua não ocorrência em um Hospital Amigo da Criança. Métodos: estudo transversal com 562 mães e recém-nascidos. Os dados foram obtidos entre outubro a novembro de 2011 mediante formulários de entrevista e consulta a prontuários. Modelo de Poisson foi ajustado para analisar a prevalência do aleitamento materno na primeira hora de vida em função das variáveis de exposição. Resultados: a prevalência do aleitamento materno na primeira hora de vida foi de 31%. Apenas o parto normal permaneceu no modelo final, apresentando razão de prevalência de 27% a mais em relação ao parto cesáreo (p=0,020. As razões para que 388 crianças não tenham sido amamentadas na primeira hora de vida foram classificadas em: problemas de saúde da criança (328, 84,5%, da mãe (241, 62,1% e atraso no resultado do teste rápido anti-HIV (199, 51,2%, 11 (2,8% não apresentaram nenhuma justificativa. Conclusões: os resultados relatados ainda estão bem abaixo das recomendações da Organização Mundial da Saúde (OMS, o que em grande parte pode ser atribuído às condições próprias de um hospital de nível terciário, cuja demanda é constituída predominantemente por casos de pacientes de médio e elevado risco obstétrico.

  14. Impossibilidade da renúncia do uso público da razão em Hannah Arendt – “Eichmann em Jerusalém, a banalidade do mal”

    Directory of Open Access Journals (Sweden)

    Edimar Inocencio Brígido

    2017-10-01

    Full Text Available O artigo pretende revisitar a definição de uso público da razão e a impossibilidade da sua renúncia segundo Hannah Arendt com base em elementos que ela identificou na obra: “Eichmann em Jerusalém, um relato sobre a banalidade do mal”. Para tanto, apresenta uma breve evolução do conceito ético-político de razão e seu uso de Sócrates até o Iluminismo e aponta a ligação do pensamento de Arendt ao de Kant, para identificar a ampliação que ela faz da análise do uso da faculdade de julgar desenvolvida por ele. Isso porque a visão oitocentista da faculdade de julgar se mostrou insuficiente para explicar os efeitos históricos que a renúncia ao uso público da razão acarreta para a civilização a partir do fim do século XIX até os dias de hoje. Isso por força da escalada dos genocídios e massacres do período. Para isso, colheu-se dados históricos, literários e de reflexões de autores, cujo pensamento é próximo ao de Arendt e recorreu-se a outras obras da autora, tudo para ilustrar e explicar que a escalada genocida e dos massacres se dá em consonância com o crescimento das sociedades de massa industrial e pós-industrial. A conclusão a que se chega é de que a renúncia à faculdade de julgar derivada do modelo econômico e social atual e leva a uma aporia: uma contraditória ameaça à vida em nome da vida.

  15. Efeito do treino isocinético excêntrico sobre a razão I/Q do torque e EMGs em sujeitos saudáveis

    Directory of Open Access Journals (Sweden)

    Heleodório Honorato Santos

    2014-06-01

    Full Text Available OBJETIVO: Avaliar os efeitos do treino isocinético excêntrico dos extensores do joelho sobre a razão Isquiotibiais/Quadríceps (I/Q do torque e do eletromiograma de superfície (EMGs, em sujeitos saudáveis. MÉTODOS: Vinte homens ativos e saudáveis com idade média 22,5±2,1 anos; massa corporal 67,8±9,5 kg; estatura 1,72±0,10 m; e índice de massa corporal (IMC de 22,5±2,0 kg/m2 foram avaliados quanto ao torque (isométrico e excêntrico a 30 e 120o/s e EMGs dos extensores e flexores do joelho, antes e após 6 semanas de treino isocinético excêntrico (30o/s dos extensores do joelho. RESULTADOS: O torque extensor do joelho aumentou em todos os modos e velocidades avaliados (P0,05. As correlações torque/EMGs mostraram-se fracas (r0,05 para todos os modos de contração, no pré- e pós-treino, porém, houve diferença (P>0,01 na comparação entre o modo excêntrico (30º e 120º/s e isométrico, pré e pós-treino. CONCLUSÕES: O treino isocinético excêntrico dos extensores do joelho aumentou a diferença na razão I/Q do torque, porém, não alterou a razão I/Q do EMGs, sugerindo que a adaptação pelo aumento do torque associado ao treino excêntrico não alterou o recrutamento das unidades motoras avaliadas pelo EMGs.

  16. Kiberataki - ugroza realnaja ili virtualnaja? / Jevgenija Garanzha

    Index Scriptorium Estoniae

    Garanža, Jevgenija, 1979-

    2008-01-01

    Autor arutleb koos kaitseministeeriumi side- ja infotehnoloogia osakonna juhataja Mihkel Tammetiga, milline on küberrünnakutest tulenev reaalne ja virtuaalne oht. Vt. samas: Ajalehe märkus NATO juures tegutseva küberkaitse keskuse kohta; Mõistest "botnet"

  17. Made in Narva ili nashi v Seule

    Index Scriptorium Estoniae

    2008-01-01

    Hiigelsuure titaanskulptuuri "Post-Mapping" valmistamisest saksa firma Trinon Titanium Narva tehases ja selle paigaldamisest tehnoloogiainstituudi hoone fuajeesse Soulis. Skulptuuri autor on arhitekt Lawrence Wallen

  18. STANDARDIZACIJA MARKETINGA: BITI ILI NE BITI

    OpenAIRE

    Šuštar, Rozana

    2007-01-01

    The article discusses the possibilities for standardizing the marketing programs of Slovenian firms which can open a door to more intensive process of internationalization of firms. The study found that environmental factors, such as political and economic stability, significantly affected the possibilities for standardization enabling firms to improve sales margins. The strategic elements for standardization of the marketing mix, consisting of price, distribution, and promotion, are also sub...

  19. Métodos para estimar razão de prevalência em estudos de corte transversal Métodos para estimar razón de prevalencia en estudios de cohorte transversal Methods for estimating prevalence ratios in cross-sectional studies

    Directory of Open Access Journals (Sweden)

    Leticia M S Coutinho

    2008-12-01

    Full Text Available OBJETIVO: Comparar empiricamente as regressões de Cox, log-binomial, Poisson e logística para estimar razões de prevalência em estudos de corte transversal. MÉTODOS: Foram utilizados dados de um estudo epidemiológico transversal (n=2.072, de base populacional, realizado com idosos na cidade de São Paulo (SP, entre maio de 2003 e abril de 2005. Diagnósticos de demência, possíveis casos de transtorno mental comum e autopercepção de saúde ruim foram escolhidos como desfechos com prevalência baixa, intermediária e alta, respectivamente. Foram utilizadas variáveis de confusão com duas ou mais categorias ou valores contínuos. Valores de referência para estimativas por ponto e por intervalo para as razões de prevalência (RP foram obtidos pelo método de estratificação de Mantel-Haenszel. Estimativas ajustadas foram calculadas utilizando regressões de Cox e Poisson com variância robusta, e regressão log-binomial. Odds ratios (OR brutos e ajustados foram obtidos pela regressão logística. RESULTADOS: As estimativas por ponto e por intervalo obtidas pelas regressões de Cox e Poisson foram semelhantes à obtida pela estratificação de Mantel-Haenszel, independentemente da prevalência do desfecho e das covariáveis do modelo. O modelo log-binomial apresentou dificuldade de convergência quando o desfecho tinha prevalência alta e havia covariável contínua no modelo. A regressão logística produziu estimativas por ponto e por intervalo maiores do que as obtidas pelos outros métodos, principalmente para os desfechos com maiores prevalências iniciais. Se interpretados como estimativas de RP, os OR superestimariam as associações para os desfechos com prevalência inicial baixa, intermediária e alta em 13%, quase 100% e quatro vezes mais, respectivamente. CONCLUSÕES: Em análise de dados de estudos de corte transversal, os modelos de Cox e Poisson com variância robusta são melhores alternativas que a regressão log

  20. PC-3 Prostat Kanser Hücreleri Üzerinde İndosyanin Yeşili Kullanarak Yapılan Fotodinamik Terapinin AO/PI Boyama Testi Sonuçları

    Directory of Open Access Journals (Sweden)

    Mustafa Kemal RUHİ

    2017-06-01

    Full Text Available Fotodinamik terapi (FDT prostat kanseri tedavisinde henüz araştırma aşamasında olan sağaltıcı bir alternatiftir. FDT, ışığa duyarlı bir kimyasal maddenin (fotosensitizan ışık ile aktive edilmesi ve aktive olan kimyasalın kanserli bölgedeki hücre canlılığını baskılayıcı etkiye neden olması prensibine dayanmaktadır. Bu yeni tedavi yöntemi hem seçiciliği hem de yan etkilerinin azlığı nedeniyle alternatifler arasında ön plana çıkmaktadır. FDT’de kullanılan fotosensitizanın ışıksız ortamda sitotoksik olmaması ve vücuttan kolay atılabilmesi istenmektedir. Ayrıca herhangi bir fotosensitizanın yakın kızılaltı ışık ile aktive olması, bu dalgaboyunun deriye ve diğer dokulara daha fazla nüfuz etmesinden dolayı tercih sebebidir. Bu özelliklere sahip olan İndosiyanin Yeşili (ISY daha çok floresans özelliği ile ön plana çıkmış ve görüntüleme amaçlı olarak kullanılmıştır. Bu in vitro çalışmada ISY-FDT’nin farklı inkübasyon süreleri sonundaki etkisi AO/PI boyama yöntemi kullanarak ortaya konmuştur. Elde edilen sonuçlar ISY-FDT’nin hücre canlılığını baskıladığını göstermektedir.

  1. Sporazumi o razgraničenju epikontinentskih pojaseva između država čije obale leže sučelice ili međusobno graniče u Sredozemlju

    Directory of Open Access Journals (Sweden)

    Marina Vokić Žužul

    2012-12-01

    Full Text Available Dvostranim sporazumima između država čije obale leže sučelice ili međusobno graniče do danas je u Sredozemnome moru konačno definirano samo deset crta razgraničenja epikontinentskih pojaseva. U ovome radu analizira se sadržaj svakog od tih ugovora i ukazuje na potrebu utvrđivanja brojnih novih granica sredozemnoga morskoga dna i podzemlja, posebice s obzirom na sve veću gospodarsku važnost njegovih prirodnih bogatstava. Toj analizi prethodi istraživanje primjene konvencijskih pravila o vanjskim granicama epikontinentskog pojasa u nacionalnim propisima obalnih država. Kao najaktivnija sredozemna zemlja u određivanju granica podmorja ističe se Republika Italija. Uz usvajanje detaljnih propisa o vanjskim granicama epikontinentskog pojasa, Italija je zaključila i pet sporazuma o njegovom razgraničenju sa susjednim državama - s bivšom Jugoslavijom, Tunisom, Španjolskom, Grčkom i Albanijom. Uz te ugovore razmatraju se i temeljne značajke dvaju sporazuma koji provode presude Međunarodnog suda pravde (Libija - Tunis i Libija - Malta te kriteriji razgraničenja epikontinentskog pojasa primijenjeni u ugovorima o jedinstvenoj morskoj granici između Bugarske i Turske te Francuske i Monaka. Predmet analize je i crta razgraničenja epikontinentskih pojaseva utvrđena sporazumom između Turske i bivšega Sovjetskog Saveza 1978., koja je devet godina kasnije postala granicom i njihovih gospodarskih pojaseva. Cilj ovoga izlaganja nije samo dati pregled svih dosada sporazumno utvrđenih granica epikontinentskih pojaseva u Sredozemlju, nego i pokušati odgovoriti na pitanje - trebaju li već postojeće granice koje su bile dogovorene za morsko dno, postati i granice voda nad morskim dnom. To je pitanje od posebne važnosti za buduće razgraničenje gospodarskog pojasa odnosno zaštićenoga ekološko-ribolovnog pojasa Republike Hrvatske sa sličnim zonama susjednih država u Jadranu. S obzirom na nedavno započeta istra

  2. O robe de Descartes: uma discussão em torno da melancolia e da origem da razão moderna [Descartes' robe: a discussion on melancholy and the origin of modern reason

    Directory of Open Access Journals (Sweden)

    Ronaldo Manzi Filho

    2017-05-01

    Full Text Available A melancolia é descrita no século XVII na Enciclopédia de Diderot e d’Alembert como um “delírio da alma” que pode ser notado por outra pessoa através do comportamento, da linguagem, do estado de humor, etc. Mas como eu mesmo poderia saber se estou delirando ou não? Esse verbete parece ter um endereço: a própria raiz da Razão moderna. Não é esse o tema central em Descartes: a fundamentação da Razão e a possibilidade da loucura? No Discurso do método e nas Meditações metafísicas, Descartes parte de situações “fictícias”: sua própria vida, sua experiência diante de uma lareira com seu robe, etc. – fictícias porque não se sabe exatamente se se trata de um delírio ou não. Sua obra é descrita como uma fábula, como ele mesmo o diz. O tempo todo ele está diante de “fantasmas”: a possibilidade da loucura, de um Gênio Maligno... Não é exatamente essa descrição da melancolia que Descartes temia – de uma possibilidade de se viver numa “doença da alma”? Este texto busca mostrar que a Razão moderna, ao invés de tentar excluir o delírio de seu interior, é credora, no fundo, de uma reflexão que leva a sério a possibilidade da loucura. [Melancholy is described in the eighteenth century in Diderot and d'Alembert’s Encyclopedia as a “delirium of the soul” that can be noticed by others through one’s behavior, language, mood, etc. But how could one know whether or not one is delirious? This entry seems to be addressing: the very root of modern reason. Is this not the central theme in Descartes: the foundation of Reason and the possibility of madness? In Discourse on the Method and Meditations on First Philosophy, Descartes starts from of a “fictitious” situations: his life, his experience in front of a fireplace with his robe, etc. Fictitious because it is not known exactly whether this is just a delusion or not. His work is described as a fable, as he himself says. All the time he is facing

  3. Kozak Yöresi Fıstıkçamı (Pinus pinea L. ormanlarında fıstık verimi ile artım ve bazı meteorolojik olaylar arasındaki ilişkiler

    Directory of Open Access Journals (Sweden)

    Dr. Mustafa BATUR

    2016-01-01

    Full Text Available Bu çalışmada, Kozak yöresindeki fıstıkçamı ormanlarında fıstık veriminin çap artımı ve meteorolojik olaylarla ilişkileri araştırılmıştır.İlişkilerin ortaya konması için 2006-2011 yılları arasındaki yıllık çap artım verileri, meteorolojik veriler ve örnek ağaçlara ait fıstık verimleri kullanılmıştır.Yapılan değerlendirmede; çap artımı ile fıstık verimi arasında önemli bir bulunamamıştır. Ancak, bazı meteorolojik olaylar ile fıstık verimi arasında ilişkilerin olduğu saptanmıştır. Özellikle, kabuklu fıstık verimi ile bir önceki yılın vejetasyon dönemindeki toplam yağış miktarı arasında R2=0,81, iki yıl önceki vejetasyon dönemindeki toplam yağış miktarı arasında R2=0,79 seviyesinde ilişki saptanmıştır. Fıstık veriminin kozalakların olgunlaştığı yıldaki meteorolojik olaylardan daha çok tozlaşma ve kozalakların büyüme dönemlerindeki meteorolojik verilerle ilişkili olduğu tahmin edilmektedir.

  4. Genel Bilişsel Yetenek Ölçümlerinde Süre ve Performans İlişkisinde A Tipi Kişiliğin Rolü(The Role of Type A Personality on the Relationship between Time and Performance in Measurement of General Cognitive Ability

    Directory of Open Access Journals (Sweden)

    Murat GÜLER

    2016-04-01

    Full Text Available Organizasyonların personel seçiminde kullanılan bilişsel yetenek ölçümlerinin, objektif ve yansız olarak yapılması, ihtiyaç duyulan uygun nitelikteki insan kaynağının temin edilmesi için önemli bir husustur. Ancak, bilişsel yetenek testlerinin kişilik özelliklerinden etkilendiğine dair bazı bulgular öne sürülmektedir. Mevcut araştırmada, genel bilişsel yetenek (GBY ölçümlerinde süre ve performans ilişkisinde A Tipi kişiliğin rolü 271 üniversite öğrencisinden elde edilen verilerle incelenmiştir. Veriler, A Tipi Kişilik Ölçeği ve Raven Standart Progresif Matrisler Testi ile toplanmıştır. Genel örneklemde ve A Tiplerinde GBY test performansı ve süresi ile A Tipi kişilik arasında anlamlı bir ilişki gözlenmezken, B Tiplerinde test süresinin ve yaşın GBY test performansının yordayıcısı olduğuna ilişkin bulgulara ulaşılmıştır. Objectively and impartially application of cognitive ability measurements that used in personnel selection of organizations, is a vital issue for providing needed appropriate human resources. But, some findings have been suggested that personality traits influence the measurement of cognitive abilities. In the current study the relationship between general cognitive ability (GCA and Type A personality (TAP was investigated with the data collected from 271 university students. The assessment instruments used were: Type-A Behavior Scale and Raven Standard Progressive Matrices Test. The findings revealed that, while there was no relationship between GCA, testing time and TAP in the general sample and Type A group, testing time and age were predictors of the GCA test performance in the Type B group

  5. Meditaciones postmodernas sobre el castigo: acerca de los límites de la razón y de las virtudes de la aleatoriedad (una polémica y un manifiesto para el siglo XXI

    Directory of Open Access Journals (Sweden)

    Bernard E. Harcourt

    2010-06-01

    Full Text Available Durante la Modernidad, el discurso sobre la pena ha girado circularmente en torno a tres grupos de interrogantes. El primero, surgido de la propia Ilustración, preguntaba: ¿En qué basa el soberano su derecho de penar? Nietzsche con mayor determinación, pero también otros, argumentaron que la propia pregunta implicaba ya su respuesta. Con el nacimiento de las ciencias sociales, este escepticismo hizo surgir un segundo conjunto de interrogantes: ¿Cuál es, entonces, la verdadera función de la pena? ¿Qué es lo que hacemos cuando penamos? Una serie de críticas ulteriores –de metanarrativas, funcionalistas o de objetividad científica- debilitaron esta segunda línea de indagación, y contribuyeron a dar forma a un tercer conjunto de interrogantes: ¿Qué nos cuenta la pena de nosotros mismos y de nuestra cultura? ¿Qué está sucediendo que nos permita ver lo que se halla tras el giro cultural? ¿Qué interrogantes podemos –nosotros, hijos del Siglo XXI– formular en relación con nuestras prácticas e instituciones punitivas? Este ensayo argumenta que debemos abandonar el desorientado proyecto de la modernidad, reconocer de una vez y definitivamente los límites de la razón, y orientarnos hacia la aleatoriedad y el azar. En todos los textos modernos llegó siempre un momento en el que los hechos empíricos se agotaron y las deducciones de principio alcanzaron su límite –o ambas situaciones a la vez– y el razonamiento simplemente continuó. Más que continuar asumiendo estas profesiones de fe, el presente ensayo argumenta que debemos reconocer los límites críticos de la razón y, cada vez que los alcancemos, confiar en la aleatoriedad. Donde los hechos se agotan, donde nuestros principios ya no nos guían, debemos dejar la toma de decisión al lanzamiento de moneda, a los dados, a la lotería –en suma, al azar. Este ensayo comienza a explorar lo que ello pueda significar en el ámbito del delito y de la pena.

  6. Meditaciones postmodernas sobre el castigo: acerca de los límites de la razón y de las virtudes de la aleatoriedad (una polémica y un manifiesto para el siglo XXI

    Directory of Open Access Journals (Sweden)

    Bernard E. Harcourt

    2010-07-01

    Full Text Available Durante la Modernidad, el discurso sobre la pena ha girado circularmente en torno a tres grupos de interrogantes. El primero, surgido de la propia Ilustración, preguntaba: ¿En qué basa el soberano su derecho de penar? Nietzsche con mayor determinación, pero también otros, argumentaron que la propia pregunta implicaba ya su respuesta. Con el nacimiento de las ciencias sociales, este escepticismo hizo surgir un segundo conjunto de interrogantes: ¿Cuál es, entonces, la verdadera función de la pena? ¿Qué es lo que hacemos cuando penamos? Una serie de críticas ulteriores –de metanarrativas, funcionalistas o de objetividad científica- debilitaron esta segunda línea de indagación, y contribuyeron a dar forma a un tercer conjunto de interrogantes: ¿Qué nos cuenta la pena de nosotros mismos y de nuestra cultura? ¿Qué está sucediendo que nos permita ver lo que se halla tras el giro cultural? ¿Qué interrogantes podemos –nosotros, hijos del Siglo XXI– formular en relación con nuestras prácticas e instituciones punitivas? Este ensayo argumenta que debemos abandonar el desorientado proyecto de la modernidad, reconocer de una vez y definitivamente los límites de la razón, y orientarnos hacia la aleatoriedad y el azar. En todos los textos modernos llegó siempre un momento en el que los hechos empíricos se agotaron y las deducciones de principio alcanzaron su límite –o ambas situaciones a la vez– y el razonamiento simplemente continuó. Más que continuar asumiendo estas profesiones de fe, el presente ensayo argumenta que debemos reconocer los límites críticos de la razón y, cada vez que los alcancemos, confiar en la aleatoriedad. Donde los hechos se agotan, donde nuestros principios ya no nos guían, debemos dejar la toma de decisión al lanzamiento de moneda, a los dados, a la lotería –en suma, al azar. Este ensayo comienza a explorar lo que ello pueda significar en el ámbito del delito y de la pena.

  7. Predicción de volatilidad de la rentabilidad diaria del mercado del azúcar y su aplicación en la razón de cobertura

    Directory of Open Access Journals (Sweden)

    Arody Ortiz Alvarado

    2016-03-01

    Full Text Available Este trabajo predice la volatilidad de la rentabilidad diaria del precio del azúcar, en el período compren­dido entre 1 de junio de 2011 y el 24 de octubre de 2013. Los datos diarios utilizados fueron los precios del azúcar, del etanol y la tasa de cambio de la moneda de Brasil (Real en dólares. Se usaron modelos multivariados de volatilidad autoregresiva condicional generalizada. A partir de la predicción de los precios del azúcar se calcula la razón de cobertura de mínima varianza. Los resultados muestran, que la razón de cobertura es 0.37, esto significa que, si un productor adverso al riesgo, que tiene la intención de eliminar un porcentaje de la volatilidad de la rentabilidad diaria del mercado mundial del azúcar, y espera vender 25 contratos de azúcar, cada uno de ellos de 50,84 toneladas (1.271 toneladas, el número de contratos optimo tomando cobertura a futuro será 9 y el número de contratos sin tomar cobertura (de contado será 16. This work predicts the volatility of the daily profitability of sugar prices for the period between 1 of June 2001 and 24th of October 2013. The daily data collected covered sugar, ethanol and the Brazilian Real and USD exchange rate information. The models used were multivariate generalized conditional autoregressive volatility. Parting from the sugar price prediction, the coverage ratio for the minimum variance is calculated. Results show that the coverage ratio is 0.37. This means that in the case of a risk adverse producer that wants to eliminate a percentage of volatility of the world´s sugar market daily profitability, and expects to sell 25 sugar contracts, 50,84 tons each, (1,271 tons, the optimal number of contracts with future cover­age will be 9 and the number of contracts without coverage (spot price will be 16

  8. Razão e emoção: uma leitura analítico-comportamental de avanços recentes nas neurociências Reason and emotion: a behavior-analytic interpretation of recent advances in neurosciences

    Directory of Open Access Journals (Sweden)

    Rosângela Araújo Darwich

    2005-08-01

    Full Text Available Achados recentes das neurociências apresentam uma visão integrada do funcionamento humano que envolve a presença de relações entre os grandes sistemas orgânicos, entre estados fisiológicos e cognitivos e entre razão e emoção. Este artigo objetiva contrastar tais estudos a aspectos centrais do modelo interpretativo skinneriano, destacando o papel de relações entre processos respondentes e operantes para a compreensão da interdependência entre razão e emoção. Investiga-se a importância de respostas emocionais e do comportamento verbal para a expressão de respostas tidas como racionais e, de uma maneira geral, para a seleção do repertório comportamental, verbal e não-verbal. Ressalta-se que o atual movimento de superação de propostas dualistas de compreensão do ser humano pelas neurociências aproxima-se da perspectiva analítico-comportamental de investigação de respostas abertas e encobertas no contexto de relações indivíduo-ambiente.Recent findings of the neurosciences present an integrated view of the human functioning, one that encompasses the relationships among the great organic systems, between physiological and cognitive states and between reason and emotion. The aim of this paper is to contrast such studies with central aspects of the Skinnerian explanatory system, highlighting the role of relations between respondent and operant processes for an understanding of the interdependence between reason and emotion. The importance of emotional responses and verbal behavior for rational responding and, moreover, for the selection of verbal and non-verbal behavioral repertoire, is discussed. It is argued that the current movement in the neurosciences towards overcoming dualistic views of the human being is compatible with the behavior-analytic approach to overt and covert responses in the context of individual-environment relations.

  9. IS THE CLIENT ALWAYS RIGHT? AN EMOTIONAL APPROACH TO SERVICES PROVIDING O cliente tem sempre razão? Uma abordagem emocional no provimento de serviços

    Directory of Open Access Journals (Sweden)

    Márcia Pitrowsky

    2011-01-01

    Full Text Available

    This essay aims at using the marketing academic frame of reference to present an approach on the emotional interaction processes that surround the supply and delivery of services in general, based on a quick analysis of the principle – not accepted by all service providers – that the client is always right.

    Este ensaio objetiva apresentar, dentro do estado da arte acadêmico do marketing, abordagem sobre a importância do comportamento humano pelo lado emocional nos processos de interação que envolvem a oferta e a entrega de serviços em geral, a partir de avaliação a respeito do princípio – do qual nem todos provedores de serviços compartilham – de que o cliente sempre teria razão.

  10. Sindérese, o intellectus principiorum da razão prática segundo Tomás de Aquino = Synderesis, the intellectus principiorum of practical reason according to Thomas Aquinas

    Directory of Open Access Journals (Sweden)

    Abertuni, Carlos Alberto

    2011-01-01

    Full Text Available Trata-se de uma investigação sobre a teoria dos primeiros princípios da razão prática na obra de Tomás de Aquino. No centro dessa teoria está o termo “sindérese”, cujo conteúdo foi elaborado nas discussões da filosofia e da teologia medievais, a partir de sua menção na Glosa de Jerônimo a Ezequiel. Tal termo designa um conceito que apresenta um caráter inovador dentro da teoria da ação moral em comparação com a ética aristotélica. Afinal, Tomás de Aquino o entende como o hábito dos primeiros princípios da moral, equivalente ao hábito dos primeiros princípios teóricos de Aristóteles. Dessa forma, o interesse é compreender como o conceito de sindérese é recebido e desenvolvido na filosofia moral de Tomás de Aquino através da análise das três questões tradicionais: de sua natureza, de sua infalibilidade e de sua extinção

  11. La internación psiquiátrica por razón penal en España: ejecución de la medida en el ámbito penitenciario

    Directory of Open Access Journals (Sweden)

    Luis Fernando Barrios Flores

    2015-04-01

    Full Text Available La inimputabilidad o semiimputabilidad del sujeto aquejado de un trastorno psíquico que comete una infracción penal, es asumida por la mayoría de las naciones desde antiguo, aunque las respuestas penales ante tal tipo de conductas difieren de manera considerable. El objetivo es analizar la ejecución de medidas de seguridad privativas de libertad (internación/internamiento en España, para sujetos inimputables del delito por razón de trastorno psíquico y para aquellos con trastorno psíquico sobrevenido a la sentencia. El Método seguido ha consistido en estudiar la normativa aplicable a dichas medidas y la práctica de su ejecución, con especial mención a la implementación de determinados programas de tratamiento. Los resultados obtenidos ponen de relieve la existencia de un aceptable marco normativo, que incluye numerosas alternativas al internamiento, y el éxito del Programa de "Salidas Terapéuticas". Se concluye que: a el marco legal es el adecuado, aunque demanda reformas en la esfera del control judicial; b es plausible continuar con el programa de salidas de pacientes, y c es preciso reforzar los mecanismos y recursos de rehabilitación social pospenitenciaria.

  12. Analysis of the representation of alcohol consumption and its prevention, from the perspective of framing theory, in the Spanish press: El País, El Mundo, Abc and La Razón

    Directory of Open Access Journals (Sweden)

    María-José Rabadán-Zaragoza

    2012-01-01

    Full Text Available This article presents the results of the analysis of 103 alcohol-related texts published from January to June, 2009, by four Spanish newspapers: El País (22, El Mundo (35, Abc (24, and La Razón (22. Two methods were used to examine the representation of alcohol: structural analysis based on Kayser’s model (1982 and content analysis based on framing theory. The latter method has been used to examine the journalistic treatment of biotechnology (Durant, Bauer, and Gaskell, 1998; Nisbet, M.C., Brossard, and Kroepsch, 2003; Rodríguez-Luque, 2009, which has been adapted to examine the subject of drugs (Paricio, 2010. A reliability of 90% was achieved in the Cohen’s Kappa coefficient test for the 67 variables examined in this study. The genre most dedicated to the subject of alcohol was news articles (66.9%, whose main theme was related conflict (19 texts, particularly the consequences of drunk driving (9 texts. The most used frames by journalists were, in decreasing order, crime (identified in 62 texts, new research results (in 11 texts, and epidemiology (in 15 texts. However, only few texts were dedicated to the prevention of alcohol consumption (a theme in only 4.85% of the sample and the legal institutions dedicated to this activity (2.91%.

  13. A justiça das vítimas: fundamento razões para agir (ou como Lewis Carroll nos ajudou a entender também os raciocínios práticos

    Directory of Open Access Journals (Sweden)

    Azevedo, Marco Antônio Oliveira de

    2007-01-01

    Na última parte do artigo, destaco algumas outras confusões acerca do significado do termo ‘dever’ tal como esse termo é empregado usualmente em conclusões de raciocínios práticos. Numa referência a Stanley Cavell, sustentarei que o termo ‘dever’ serve-nos, nessa condição, de modo de apresentação do conteúdo das premissas que temos ou das razões que oferecemos para agir de uma certa maneira. Sendo assim, o termo ‘dever’, que usamos para apresentar a conclusão de um raciocínio prático, não pode ser interpretado, de maneira simplista (tal como fazem os defensores de visões kantianas sobre a ética, como tendo o mesmo sentido que o termo ‘obrigação’, cujo significado é mais estrito

  14. Razón y Fortuna (José M.ª González, La diosa Fortuna. Metamorfosis de una metáfora política

    Directory of Open Access Journals (Sweden)

    Ruano de la Fuente, Yolanda

    2007-12-01

    Full Text Available Establishing a dialogue with last José M. González’s book, La diosa Fortuna. Metamorfosis de una metáfora política, awarded with the National Prize of Essay 2007, the present article is focused on analysing relations kept by Reason to what historically uses to appear as its perfect antagonist: Fortune as a synonym of what happens by chance and without control by man’s actions.

    En diálogo con el último libro de José M. González, La diosa Fortuna. Metamorfosis de una metáfora política, galardonado con el último Premio Nacional de Ensayo 2007, en este trabajo se analizan las relaciones mantenidas por la Razón con quien históricamente suele aparecer como su perfecto antagonista: La Fortuna, sinónimo de lo azaroso e incontrolable por parte del hombre.

  15. Temel eğitimden ortaöğretime geçiş sınavlarına ilişkin 9. sınıf öğrencilerinin görüşleri

    OpenAIRE

    Akman, Ozan

    2017-01-01

    Araştırmanın amacı, temel eğitimden ortaöğretime geçişte yapılmakta olan Temel Eğitimden Ortaöğretime Geçiş (TEOG) Sınavlarına ilişkin dokuzuncu sınıf öğrencilerinin görüşlerinin incelenmesidir. Araştırmada betimsel araştırma yöntemlerinden tarama modeli çerçevesinde nicel yöntem kullanılmıştır. Araştırmanın evrenini 2015-2016 eğitim öğretim yılında Zonguldak ili Ereğli ilçesinde devlet okullarında öğrenim gören 2715 dokuzuncu sınıf öğrencisi oluşturmaktadır. Araştırmanın örneklemini 1022 öğr...

  16. Algılanan ekonomik güçlük ve eşler arasındaki çatışma ile problem davranışlar arasındaki bağlantıda, ebeveyn-ergen ilişkilerinin aracı rolü

    OpenAIRE

    KORFAL, Ahu

    2016-01-01

    Araştırmanın temel amacı, algılanan ekonomik güçlük ve eşler arasındaki çatışma ile ergen problem davranışları arasındaki bağlantıda ebeveyn-ergen ilişkilerinin aracı rolünü incelemektir. Bu amaç çerçevesinde, anılan ilişkiler kız ve erkek ergenlerde Aile Stres Modeli çerçevesinde sınanmıştır. Araştırmanın örneklemini Ankara kent merkezinde bulunan ilköğretim 6. ve 7. Sınıflar ile ortaöğretim 9. ve 10. Sınıflara devam eden ergenler oluşturmaktadır. Çalışmamıza, 518 (%48.5...

  17. Kolobok ubegajet i vozvrashajetsja ... desjat raz!

    Index Scriptorium Estoniae

    2005-01-01

    Esmakordselt Vene Draamateater otsustas lavastada etenduse-seriaali "Kakuke", mis koosneb kümnest iseseisvast etendusest. Loo autor on J. Morozova, lavastaja A. Potuzhnõi, muusika kirjutas E. Toman ja luuletused J. Skulskaja, kunstnik on A. Korsmik

  18. ENADE 2005: perfil, desempenho e razão da opção dos estudantes pelas licenciaturas ENADE 2005: profile, performance and reasons for choosing teacher training programs

    Directory of Open Access Journals (Sweden)

    Márcia Regina F. de Brito

    2007-09-01

    Full Text Available O Exame Nacional de Desempenho dos Estudantes (ENADE é parte integrante do Sistema Nacional de Avaliação da Educação Superior e é composto da prova, do questionário de avaliação da prova, do questionário dos coordenadores e do questionário sócio-econômico com 114 questões. A partir da análise desse material e dos dados do Censo da Educação Superior, foi elaborado o presente estudo com a finalidade de analisar o perfil dos estudantes dos cursos de Licenciaturas que se submeteram ao ENADE 2005, o desempenho desses estudantes na parte de Formação Geral e as razões que apontam para a escolha de cursos de Licenciatura, além de se buscar estabelecer as relações entre algumas variáveis selecionadas procurando verificar quais as diferenças significativas. Os resultados mostraram que os estudantes de Licenciatura concentram-se em cursos noturnos de IES privadas e são oriundos predominantemente do ensino médio público; a principal razão para a escolha da Licenciatura é o desejo de ser professor. Com relação ao desempenho, os melhores resultados, tanto de ingressantes como concluintes, são da área de Física (questões objetivas e Geografia (nas questões discursivas; quando foi feita a média de ingressantes e concluintes por área verificou-se que a menor média é a obtida pela área de Pedagogia e a maior pela Geografia.The Brazilian National Student Performance Exam (ENADE is part of the National Higher Education Evaluation System and is composed of a test, a questionnaire evaluating the test, a questionnaire to be answered by the coordinators and a socio-economic questionnaire with 114 questions. The present study was elaborated from the analysis of this material and of the data from the Higher Education Census, with the purpose of analyzing the profile of the students of the teacher training programs that took the 2005 ENADE, their performance in the General Education portion of the test and the reasons they point

  19. Diabetes mellitus: razão de prevalências nas diferentes regiões geográficas no Brasil, 2002 2007 Diabetes mellitus: reasons for prevalence in different geographic regions of Brazil, 2002 2007

    Directory of Open Access Journals (Sweden)

    Juliana Chioda Ribeiro Dias

    2012-01-01

    Full Text Available Considerando o Diabetes mellitus (DM como um relevante problema de saúde no Brasil e a importância das estimativas de prevalência para planejamento e estratégias em saúde pública, propôs-se este trabalho com o objetivo de estimar a razão de prevalências do DM nos diferentes estados brasileiros nos períodos de 2002 a 2004 e 2005 a 2007. Trata-se de estudo descritivo, baseado em dados da população brasileira com diagnóstico de DM cadastrada no Sistema de Informação da Atenção Básica (SIAB junto ao Ministério da Saúde. As taxas de prevalência foram calculadas para o período de 2002 a 2004 e para 2005 a 2007, e posteriormente estimou-se a Razão de Prevalências (R por ponto e por intervalo de 95% de confiança (IC95%. Observou-se alta prevalência de DM nos estados brasileiros com aumento significativo (R>1; IC95%>1 entre os períodos em todos os estados brasileiros, com destaque para o Distrito Federal (R=1,9800; IC95%=1,97241,9876 e o estado do Maranhão (R=1,5217; IC95%=1,51981,5235. Pode-se concluir que houve aumento significativo na prevalência de DM no Brasil de 2002 a 2007, sinalizando para a necessidade de formulação de estratégias de prevenção e controle da doença.Awareness of Diabetes Mellitus (DM as a relevant health problem in Brazil and realizing the importance of estimates of prevalence for public health planning and strategies, gave rise to this work seeking to estimate the reason for the prevalence of Diabetes Mellitus (DM in different Brazilian states in the periods from 2002 to 2004 and 2005 to 2007. It involves a descriptive study based on Brazilian population data with a diagnosis of DM recorded in the Basic Care Information System (SIAB of the Brazilian Ministry of Health. The prevalence rates were calculated for the periods from 2002 to 2004 and 2005 to 2007 and the Prevalence Ratios were then estimated per location and per reliability interval of 95% (RI95%. A high prevalence of DM was observed in

  20. 5 February 2010: Romanian Former Minister of Justice V. Stoica (4th from left) visiting SM18 with, from left to right, University of Bucharest Faculty of Physics A. Costescu, DESY Hamburg C. Diaconu; Mrs Valeriu Stoica; Université de Montpellier II S. Ciulli; Technology Department Vacuum, Surfaces and Coatings group S. Ilie; Technology Department Head F. Bordry and Adviser for Russian Federation, Central and Eastern Europe T. Kurtyka.

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    5 February 2010: Romanian Former Minister of Justice V. Stoica (4th from left) visiting SM18 with, from left to right, University of Bucharest Faculty of Physics A. Costescu, DESY Hamburg C. Diaconu; Mrs Valeriu Stoica; Université de Montpellier II S. Ciulli; Technology Department Vacuum, Surfaces and Coatings group S. Ilie; Technology Department Head F. Bordry and Adviser for Russian Federation, Central and Eastern Europe T. Kurtyka.

  1. Libertad y orden en la Filosofía política kantiana. Acerca de los límites del uso público de la razón en El conflicto de las Facultades

    Directory of Open Access Journals (Sweden)

    Beade, Ileana

    2014-06-01

    Full Text Available This paper addresses a double demand formulated by Kant in The conflict of the Faculties –to wit: the demand for freedom and the demand for order– with the aim of pointing out the basic premise implicit in such demand: the idea that the public order constitutes the fundamental condition for the preservation of the civil state, as the only state within which human beings can fully exercise their innate right to freedom. We will examine the way that Kant characterizes the contest between the Faculties, stressing its essentially political meaning, and will also consider the specific function that he assigns to each of them, paying special attention to the limits he sets on the free exercise of philosophical reason.En este trabajo proponemos examinar una doble exigencia formulada por Kant en El conflicto de las Facultades –a saber, la exigencia de libertad y la exigencia del orden–, a fin de señalar la premisa básica subyacente a dicha exigencia, esto es: la idea de que el orden público constituye la condición fundamental para la preservación del estado civil, entendido como el único estado en el que los hombres pueden ejercer plenamente su derecho innato a la libertad. Atendiendo a este objetivo, examinaremos el modo en que Kant caracteriza la contienda entre las Facultades, destacando el sentido eminentemente político del conflicto, y analizaremos la función específica que asigna a cada una de las Facultades, haciendo especial énfasis en la determinación de los límites establecidos para el libre ejercicio de la razón filosófica.

  2. Temperatura de incubação e razão sexual em filhotes recém-eclodidos da tartaruga marinha Eretmochelys imbricata (Linnaeus, 1766 no município do Ipojuca, Pernambuco, Brasil

    Directory of Open Access Journals (Sweden)

    Thyara N. Simões

    2014-01-01

    Full Text Available O desenvolvimento do sexo em tartarugas marinhas é determinado pela temperatura de incubação dos ovos (TSD - Temperature-dependent Sex Determination. Para a espécie Eretmochelys imbricata, pouco se sabe a respeito da proporção sexual das desovas que ocorrem no litoral sul de Pernambuco. Diante disso, o objetivo desse estudo é analisar a relação entre o desenvolvimento sexual e a temperatura de incubação de ninhos de tartarugas-de-pente, depositados na Praia de Merepe, município do Ipojuca, Pernambuco. Os dados de temperatura foram coletados em nove ninhos, durante os meses de janeiro a junho de 2013, com auxílio de registradores de temperatura do tipo Data loggers (Modelo Onset Computer, UA-001-08. As médias registradas para os ninhos amostrados em relação ao período de incubação e temperatura foram de 54 dias e de 31,68ºC. Com base nesses resultados, os ninhos apresentaram uma forte tendência para o desenvolvimento de fêmeas, sendo a razão sexual, estimada por meio de análises histológicas, de 86,53% para fêmeas. Portanto, a Praia de Merepe possui temperaturas que propiciam uma maior diferenciação de neonatos fêmea. Entretanto, estudos mais detalhados devem ser realizados com a intenção de verificar se esses mesmos resultados podem ser obtidos para todo o litoral ipojucano.

  3. Imaginario femenino en el populismo argentino. Género y nación en La razón de mi vida, de Eva Perón

    Directory of Open Access Journals (Sweden)

    Susana Rosano

    2014-06-01

    Full Text Available En La razón de mi vida, Eva Perón ayuda a construir una imagen de sí misma profundamente atravesada por estrategias de representación melodramáticas. En contraste con la mayoría de las autobiografías femeninas o masculinas, no se trata aquí de un recuento introspectivo. Eva no relata su vida desde el comienzo, desde su infancia. No aprovecha la oportunidad para echar luz sobre las zonas oscuras de su biografía ni para aclarar ninguna de las acusaciones a las que sus reconocidos “supercríticos” la tenían acostumbrada. Se trata, por lo tanto, de una autobiografía sui generis, descentrada, híbrida: el relato de los años de lucha política junto a Perón. De esta manera, Eva se inscribe en el discurso político con una estrategia absolutamente inusual para el género. Su participación en la arena pública está registrada desde un desvío: su lucha es una historia de amor múltiple, con Perón y con “el pueblo”. El objetivo de este trabajo es analizar las tecnologías autobiográficas utilizadas en el texto en relación con los discursos de verdad e identidad femenina disponibles en la época en que fue escrito, la década del 50 en Argentina.

  4. Entre a Psicanálise e o Romantismo: a razão, o limite e a civilização = Between Psychoanalysis and Romantism: reason, limit and civilization

    Directory of Open Access Journals (Sweden)

    Eduardo Melo França

    2012-01-01

    Full Text Available O objetivo deste trabalho é contextualizar e problematizar as semelhanças e diferenças entre o modo como a Psicanálise e o Romantismo tratam a (necessidade da razão. Partindo da ideia de racionalidade e de domínio da natureza e do desejo, mostraremos como essas duas disciplinas possuem o mesmo objeto de análise, mas métodos e perspectivas diferentes de abordá-lo. Para isso, em alguns momentos será necessário situar tanto a Psicanálise quanto o Romantismo frente ao Iluminismo. Como parâmetro para o nosso estudo, tomaremos o texto A posição de Freud na moderna história das ideias, de Thomas Mann, onde o autor destaca o modo como a psicanálise ao mesmo tempo preza pela racionalidade mas não recai no naturalismo científico.The aim of this study is to contextualize and problematize the similarities and differences between the place that reason holds in the core of psychoanalytic and romantic thinking. Starting from the idea of rationality and mastery of nature and desire, we show how psychoanalysis and romanticism have the same object of analysis, but different methods and perspectives of approach. For this, at certain times it will be necessary to situate both psychoanalysis and Romanticism against the Enlightenment. As a parameter for our study, we will take the text A posição de Freud na moderna história das ideias, by Thomas Mann, where the author highlights how psychoanalysis at the same time stands for rationality but falls outside the scientific naturalism.

  5. Bower ratio-energy balance associated errors in vineyards under dripping irrigation Erros associados pela razão de bowen ao balanço de energia em parreirais sob irrigação por gotejamento

    Directory of Open Access Journals (Sweden)

    José Monteiro Soares

    2007-08-01

    Full Text Available This study was conducted at the Bebedouro Experimental Station in Petrolina-PE, Brazil, to evaluate the errors associated to the application of the Bowen ratio-energy balance in a 3-years old vineyard (Vitis vinifera, L, grown in a trellis system, irrigated by dripping. The field measurements were taken during fruiting cycle (July to November, 2001, which was divided into eigth phenological stages. A micrometeorological tower was mounted in a grape-plants row in which sensors of net radiation, global solar radiation and wind speed were installed at about 1.0 m above the canopy. Also in the tower, two psicometers were installed at two levels (0.5 and 1.8 m above the vineyard canopy. Two soil heat flux plates were buried at 0.02 m beneath the soil surface. All these sensors were connected to a Data logger 21 X of Campbell Scientific Inc., programmed for collecting data once every 5 seconds and storage averages for every 15 minutes. A comparative analysis were made among four Bowen ratio accepting/rejecting rules, according to the methodology proposed by Spano et al. (2000: betar1 - values of beta calculated by Bowen (1926 equation; betar2 - values of beta as proposed by Verma et al. (1978 equation; betar3 - exclusion of the beta values obtained as recommended by Unland et al. (1996 and betar4 - exclusion of the beta values calculated as proposed by Bowen (1926, out of the interval (-0.7 Este estudo foi conduzido na Estação Experimental de Bebedouro, Petrolina-PE, Brasil, para avaliar os erros associados com a aplicação do balanço de energia com base na razão de Bowen em um parreiral (Vitis vinifera, L com três anos de idade, conduzido em latada, sob irrigação por gotejamento. As medições foram feitas durante o ciclo produtivo de julho a novembro de 2001, que foi dividido em oito estádios fenológicos. Numa torre micrometeorológica localizada no centro do parreiral, foram instalados a 1,00 m acima do dossel da videira, os seguintes

  6. Toros sediri (Cedrus libani A. Rich. ağaçlandırmalarının gelişimi ile yetişme ortamı özellikleri arasındaki ilişkiler

    Directory of Open Access Journals (Sweden)

    Rıza KARATAŞ

    2017-07-01

    Full Text Available Bu çalışma, Eskişehir, Afyonkarahisar ve Ankara illerindeki toros sediri (Cedrus libani A. Rich. ağaçlandırmalarının boy gelişimi ile bazı yetişme ortamı özellikleri arasındaki ilişkileri belirlemek amacıyla yapılmıştır. Örneklemeler bakı, yükselti, eğim, yamaç konumu ve meşcere gelişimi bakımından farklılık gösteren 55 alanda yürütülmüştür. Her örnek alanda meşcere üst boyunda bulunan bir ağaç kesilmiş ve toprak çukuru açılarak belirlenen horizonlardan toprak örnekleri alınmıştır. Laboratuvarda toprak örneklerinin bazı fiziksel ve kimyasal özellikleri belirlenmiştir. Toros sediri ağaçlandırmalarının gelişimi ile iklim özellikleri arasındaki ilişkileri belirlemek amacıyla örnek alanlara en yakın mesafede bulunan meteoroloji istasyonu verileri kullanılmıştır. Örnek alanlardaki ağaçların üst boy değerleri ile edafik, klimatik ve fizyografik faktörler arasındaki ilişkiler korelasyon, aşamalı regresyon ve regresyon ağacı yöntemleri ile değerlendirilmiştir.Örnek alanlardaki ağaçların üst boy değerleri ile fizyografik yetişme ortamı faktörlerinden enlem ve yamaç konumu; iklim özelliklerinden ortalama yüksek sıcaklık, potansiyel evapotranspirasyon, su fazlası, en soğuk ayın ortalama sıcaklığı, en sıcak ayın ortalama sıcaklığı ve dört yaz ayının ortalama sıcaklığı; toprak özelliklerinden toz miktarı arasında istatistiksel bakımdan önemli ilişkiler bulunmuştur.Sedir ağaçlandırmalarının boy büyümesi aşamalı regresyon analizi ve regresyon ağacı tekniği kullanılarak modellenmiştir. Uygulanan bu analizler sonucunda, boy gelişimini en iyi açıklayan kestirim modeli %65,6 ile regresyon ağacı tekniği kullanılarak elde edilmiştir.

  7. Sağlık yüksekokulu öğrencilerinin evlilik dışı cinsel ilişki, istemli düşükler ve kontraseptif kullanımı konusundaki görüşleri

    Directory of Open Access Journals (Sweden)

    Burcu Tokuç

    2011-12-01

    Full Text Available Amaç: Bu çalışmanın amacı; sağlık yüksekokulu öğrencilerinin evlilik öncesi cinsel ilişki, istemli düşükler ve kontraseptif yöntem kullanımı konusunda görüşlerini belirlemek ve toplumsal değer yargılarını mesleki yaşantılarına yansıtmamaları konusunda farkındalık yaratmaktır. Yöntem: Kesitsel olarak planlanan araştırmaya, Mayıs-2008’de Trakya ve Namık Kemal Üniversitesi sağlık yüksek okullarında öğrenim gören toplam 338 ebelik ve hemşirelik öğrencisinin katılmıştır. Veriler araştırmacılar tarafından hazırlanan 25 maddelik bir soru formu ile toplanmıştır. Bulgular: Araştırmaya katılanların yaş ortalaması 20.9±1.6’dır ve %97’si kadındır. Öğrencilerin %66.9’u “evlenmeden önce cinsel ilişkiye girmek yanlıştır”; %63.6’sı “evlilik dışı ilişkiler bizim ahlaki ve kültürel değerlerimizi tahrip ediyor”; %52.1’i “istemli düşük ahlaksal olarak yanlıştır”; yalnızca %2.1’i ise “kontraseptif yöntemler ile ilgili bilgi yalnızca evli çiftlere verilmelidir” önermesine katıldıklarını belirtmişlerdir. Sonuç: Geleceğin sağlık çalışanları evlilik dışı cinsel ilişki, istemli düşükler ve kontraseptif kullanımı ile ilgili konularda toplumsal değer yargıları ve mesleki yaklaşımları arasında ikilem yaşamaktadırlar. Evlilik dışı cinsel ilişki ve istemli düşükler ahlaksal olarak yanlış bulunurken; planlanmamış bir gebelik durumunda istemli düşüğün kabul edilebileceğini ve evli olmayan genç kadınların istemli düşük hizmetlerinin, kürtajın fiziksel ve psikolojik sonuçlarını da kapsayacak şekilde verilmesi bu ikilemi açıkça göstermektedir. Sağlık alanında toplumsal değer yargılarının mesleki bağımsızlığı ve tıbbi etik yaklaşımları etkilemesi olasılığını en aza indirmek amacıyla müfredat gözden geçirilmelidir. Anahtar Kelimeler: Üreme sağlığı hizmetleri

  8. La racionalidad apasionada. Acercamiento a la relación razón y amor en la obra "Camino de Perfección" de Santa Teresa de ávila (1515-1582

    Directory of Open Access Journals (Sweden)

    Agustina Serrano P.

    2005-01-01

    Full Text Available Santa Teresa de ávila es una de las grandes figuras de la mística del Siglo de Oro Español. Pablo VI la declara Doctora de la Iglesia el 27 de septiembre de 1970. Este hecho supone que el puesto y la función de la mujer en la Iglesia quedaron afectados cuando se declaró a Santa Teresa Doctora de la Iglesia. Camino de Perfección es la primera obra impresa de Santa Teresa, en el año 1583 quiere ser un libro guía para las comunidades. Es un itinerario de conversión recorrido con una determinada "racionalidad apasionada" que desenmascara todo lo que no está al servicio del Reino. El presente estudio pretende ayudar a detectar la racionalidad teológica de Teresa desde la relación razón y amor en su obra Camino de perfección. En él se comienza a descubrir la propia sistematicidad del pensar de esta autora. Teresa ha ido vertiendo sus ideas respecto a la realidad de todo lo humano. Lo hace de un modo experiencial y sin atenerse, demasiado, a las normas de uso de los grandes conceptos en su épocaSt. Theresa of Avila is one of the great figures of the mysticism of the Spanish "Golden Age". Paul VI declared her a Doctor of the Church on September 27th, 1970. This fact presupposes that the place and function of women in the Church were influenced when St. Theresa was declared Doctor of the Church. Road of Perfection is the first printed work of St. Theresa's, in the year 1583, and was intended to be a guide for communities. It is an itinerary of conversion traveled through with a determined "passionate rationality" that unmasks everything not at the service of the Kingdom. The present study intends to help detect the theological rationality of Theresa from the reason-love relationship in her work Road of Perfection. In it the author's own systematic thought begins to be discovered, depositing her ideas in relation to the reality of all that is human. She does this in an experiential way and without overly depending upon the norms of the

  9. De la razón al juego: la teoría del conocimiento de la enfermedad en Karl Jaspers y su reconsideración desde la epistemología actual

    Directory of Open Access Journals (Sweden)

    González de Pablo, Ángel

    2002-06-01

    Full Text Available Starting with the idea of the Encompassing as a system of thinking, I have tried to describe a possible Jaspersian theory of the knowledge of illness. This theory is based on the following points: 1 The existence of two methods of knowledge of the sick person: the direct or objective (based on causality, non-contradiction, and the accuracy of language; and the indirect or unobjective (based on acausality, antinomy, and the polysemy of language. 2 The establishment of a non-syncretic articulation between the two through Reason (Vernunft. And 3 The consideration of the whole of the illness as a veiled reality, as a reality which is announced alternately in the two conected but not superimposed ways of knowing, although such a reality can never be enunciated in the form of a methodically fixed doctrine. The various points of this theory are reconsidered, in addition, from the point of view of certain concepts belonging to current epistemology, so as to evaluate the degree of presence of Jaspersian thought at the end of the 20th century.

    A partir de la idea del Envolvente en tanto sistemática del pensamiento, se intenta caracterizar una posible teoría jaspersiana del conocimiento de la enfermedad. Dicha teoría gira en torno a los siguientes puntos: 1 La existencia de dos modos de conocimiento del enfermar: el directo u objetivo (basado en la causalidad, la no contradicción y la univocidad del lenguaje; y el indirecto o inobjetivo (basado en la acausalidad, la antinomia y la polisemia del lenguaje. 2 El establecimiento de una articulación no sincrética entre ambos por intermedio de la Razón. y 3 La consideración del todo de la enfermedad como realidad velada, como realidad que se anuncia alternativamente en esos dos modos articulados y no superponibles de conocimiento, pero que —en su totalidad— no puede enunciarse objetivamente. Los distintos puntos de esta teoría se reconsideran, además, desde ciertas nociones de la actual

  10. Estudo de adulteração em méis brasileiros através de razão isotópica do carbono A study of adulteration in brazilian honeys by carbon isotope ratio

    Directory of Open Access Journals (Sweden)

    Cibele Regina de Souza-Kruliski

    2010-04-01

    Full Text Available Neste trabalho, objetivou-se analisar isotopicamente méis comercializados nas regiões Sul e Sudeste do Brasil, para a detecção de fraude. Foram colhidas amostras comerciais com registro no Serviço de Inspeção Federal, Estadual ou Municipal. As amostras foram submetidas à combustão no Analisador Elementar EA 1108 CHN e analisadas no espectrômetro de massas de razão isotópica DELTA-S (Finningan Mat. Os valores isotópicos (δ13C dos méis in natura foram comparados aos de suas respectivas proteínas (padrão interno. Foram consideradas adulteradas as amostras cuja diferença entre o valor isotópico da proteína e do mel foi igual ou inferior a -1‰. As amostras consideradas adulteradas pela análise isotópica foram submetidas a testes químicos qualitativos que não foram capazes de indicar adulteração para algumas delas. Das 61 amostras analisadas, 18,0% encontram-se adulteradas, sendo 11,5% na Região Sudeste e 6,5% na Região Sul. Ao contrário dos testes químicos, a análise isotópica mostrou-se eficaz em identificar e quantificar a adulteração de méis comerciais.The aim of this study was the isotopic evaluation of honey traded in the Southern and Southeastern Brazilian regions, to detect fraud. Commercial samples, registered in the municipal, State or Federal Inspection Service, were collected and submitted to combustion in the EA 1108 CHN Elemental Analyzer and analyzed in the DELTA-S (Finningan Mat. isotope ratio mass spectrometer. The isotopic values (δ13C of in natura honey were compared to their respective proteins (internal standard. Samples whose difference between the isotopic value of protein and honey was equal or inferior to -1‰ were considered adulterated. The samples considered adulterated were submitted to qualitative chemical tests which were unable to show adulteration for some of them. Among the 61 samples analyzed, 18.0% were adulterated; 11.5% in the Southeastern and 6.5% in the Southern region

  11. O sexo masculino vulnerável: razão de masculinidade entre os óbitos fetais brasileiros The vulnerable male, or the sex ratio among fetal deaths in Brazil

    Directory of Open Access Journals (Sweden)

    Alexandre Dias Porto Chiavegatto Filho

    2012-04-01

    Full Text Available Alguns estudos apontam para a existência de vulnerabilidades biológicas inatas masculinas, especialmente no período perinatal. Foi realizada uma análise transversal da mortalidade fetal brasileira segundo sexo, entre 2000 e 2009 (inclusive, conforme características maternas (idade, escolaridade e duração da gestação, utilizando-se dados disponibilizados pelos sistema DATASUS do Ministério da Saúde. Todos os óbitos fetais do período foram incluídos na análise, excetuando-se os casos em que o sexo do feto não foi declarado. A razão de masculinidade (RM encontrada para os óbitos fetais foi de 1,188. As categorias mais relacionadas com maior risco (idade entre 10 e 14 anos, nenhuma escolaridade e gestação com menos de 22 semanas apresentaram maior RM, sendo esses valores, em todos os casos, estatisticamente maiores do que os observados nas outras categorias analisadas (p Some studies indicate the existence of innate male vulnerabilities, especially during the perinatal period. The current study is a cross-sectional analysis of fetal mortality in Brazil according to sex from 2000 to 2009, stratified by maternal characteristics (age, schooling, and gestational age, using Ministry of Health data (DATASUS. The analysis included all fetal deaths from 2000 to 2009, except when the sex of the fetus was not recorded. The male/female sex ratio (SR for all fetal deaths was 1.188. Analysis of maternal characteristics showed that the SR was statistically higher (p < 0.01 in mothers that were younger (10-14 years, had no formal schooling, and with gestational age < 22 weeks. The study showed a statistically higher-than-expected SR (p < 0.01 for 13 underlying causes of death and a lower SR for two others. The results suggest a potential innate male vulnerability.

  12. Estoque de C e Abundância Natural de 13C em Razão da Conversão de Áreas de Floresta e Pastagem em Bioma Mata Atlântica

    Directory of Open Access Journals (Sweden)

    Denilson Dortzbach

    2015-12-01

    Full Text Available RESUMO Conversões da cobertura vegetal decorrentes do manejo podem alterar o estoque de carbono e a abundância natural de 13C. Objetivou-se avaliar o estoque de C e a abundância natural de 13C em áreas de sucessão de floresta (F e pastagem (P, com diferentes tempos de uso, na Floresta Atlântica no Estado de Santa Catarina. Sete sucessões de uso entre F e P foram definidas por fotografias aéreas tomadas em 1957, 1978 e 2008, entrevistas com moradores e escolha de áreas com florestas em estádio médio de regeneração. As sucessões foram identificadas como FFP, FPF, FFP, FPP, PFF, PPF, PPP, em que a primeira letra se refere ao uso observado em 1957; a segunda, em 1978; e a terceira, em 2008. Foram coletadas amostras de solo nas camadas de 0,00-0,10; 0,10-0,20; 0,20-0,30; 0,30-0,40; 0,40-0,50; 0,50-0,60; 0,60-0,80 e 0,80-1,00 m. Quantificaram-se os teores de carbono orgânico total (COT, abundância de C (δ13C, densidade do solo (Ds e estoque de carbono (ECOT. A conversão de F em P proporcionou aumento da Ds e reduções nos teores de COT e no ECOT do solo. O maior valor de ECOT ocorreu nas áreas atualmente ocupadas por florestas, mesmo tendo sido utilizadas como pasto anteriormente. Áreas de floresta secundária tenderam, em relação aos teores de COT, a um novo equilíbrio, dado que foram verificados teores de COT superiores aos quantificados em áreas de floresta primária. As áreas de floresta e pastagem, com diferentes idades de uso e nas diferentes profundidades de solo avaliadas, evidenciaram respostas na δ13C, resultando em diferentes assinaturas isotópicas, confirmando a mudança de uso de plantas C3 para C4. Em pastagens com 50 anos de uso, na camada de 0,00-0,10 m, 66 % do COT do solo ainda é derivado da floresta original. A análise de componentes principais (ACP indicou que o COT foi o atributo que melhor discriminou as alterações em razão do uso da terra, nas diferentes camadas de solo.

  13. Toomas Hendrik Ilves : v otnoshenii pamjatnika jeshtsho nitshego ne resheno / Toomas Hendrik Ilves ; interv. Aleksei Venediktov, Nargiz Assadova

    Index Scriptorium Estoniae

    Ilves, Toomas Hendrik, 1953-

    2006-01-01

    President Toomas Hendrik Ilves vastas Vene raadiojaama Ehho Moskvõ peatoimetaja Aleksei Venediktovi ja väljaande KommersantVlast korrespondendi Nargiz Assadova küsimustele, mis puudutasid Tallinnas Tõnismäel asuva mälestusmärgi ja vene vähemusrahvuse probleeme

  14. Determinação da razão isotópica δ13C em bebidas comerciais a base de laranja Determination of isotope ratio (δ13C in commercial orange beverages

    Directory of Open Access Journals (Sweden)

    Elvio Cardoso Queiroz

    2009-08-01

    Full Text Available Conduziu-se este trabalho, com o objetivo de quantificar a proporção de carbono de fonte C3 (suco de laranja e carbono C4 (açúcar de cana em bebidas comerciais à base de laranja. Foram analisadas isotopicamente 33 diferentes marcas comerciais de bebidas de laranja. A composição isotópica do carbono (δ13C foi determinada por espectrometria de massa de razão isotópica (IRMS. As equações empregadas para quantificar a proporção da fonte C3 e C4 de carbono nas bebidas apresentam fatores de correções baseados na concentração de açúcares redutores totais em relação aos sólidos solúveis. Os sólidos insolúveis (polpa foram usados como padrão isotópico interno do suco de laranja empregado na formulação da bebida comercial, o que permitiu a quantificação de fonte C3 nessas bebidas. As análises isotópicas das bebidas comerciais mostraram quatro adulterações, sendo uma amostra de suco de laranja integral, uma amostra de suco concentrado, duas amostras de suco adoçado de laranja. Para amostras com ausência de polpa na sua constituição, adotou-se como padrão de fonte C3 o valor isotópico de δ13C -26,19‰, proveniente da compilação de um banco de dados de 31 amostras de sucos puros de laranja provenientes de 12 regiões produtoras do Estado de São Paulo. Nas bebidas denominadas repositores energéticos, bebida mista e "frutas cítricas", o valor isotópico de 13C foi similar ao açúcar de cana (δ13C -12,48‰, indicando pouco suco de fruta em sua formulação.This study aimed at quantifying the ratio of the carbon sources C3 (orange juice and C4 (cane sugar in orange-based commercial beverages. Orange beverages of 33 different trademarks were isotopically analyzed. Isotope ratio mass spectrometry (IRMS was used to determine the carbon isotopic composition (δ13C. The equations used to quantify the source of carbon C3 and C4 presented correction factors based on the concentration of total reducing sugars in

  15. Potencial de rendimento da soja durante a ontogenia em razão da irrigação e arranjo de plantas Potential yield of soybean during the ontogeny according to water availability and plant arrangement

    Directory of Open Access Journals (Sweden)

    André Roberto Maehler

    2003-02-01

    Full Text Available Estimativas do potencial de rendimento (PR da soja podem ser feitas durante a ontogenia pela quantificação das estruturas reprodutivas, de modo a avaliar o efeito de fatores ambientais e práticas de manejo na produção e fixação dessas estruturas. O objetivo deste trabalho foi determinar o efeito da disponibilidade hídrica e arranjo de plantas no PR e seus componentes, durante a ontogenia de duas cultivares de soja. Os tratamentos constituíram-se de dois regimes hídricos (irrigado e não irrigado, duas cultivares (BRS 137 e BRS 138 e três espaçamentos entre linhas (20 cm, 40 cm e 20 e 40 cm em linhas pareadas. O PR médio foi de 15.295 kg ha-1 no estádio de florescimento; 12.325 kg ha-1 na formação de legumes; 5.508 kg ha-1 no início do enchimento de grãos e 4.315 kg ha-1 na maturação. O tratamento irrigado apresentou PR mais elevado em razão da maior produção e fixação de estruturas reprodutivas, mais grãos por legume e grãos mais pesados do que o tratamento não irrigado. Não houve diferença significativa entre espaçamentos. O PR da cultivar BRS 137 é mais elevado do que o da BRS 138, em virtude da menor abscisão de flores, grãos mais pesados e maior número de grãos por legume.The quantification of reproductive structures during the ontogeny allows to estimate soybean yield potential (YP, making possible to quantify the effect of environmental factors and management practices on the production and fixation of these structures. This work aimed to determine the effect of water availability and plant arrangement on the YP and its components, during ontogeny of two soybean cultivars. Treatments were two water availability (irrigated and non irrigated, two cultivars (BRS 137 and BRS 138, and three row spacings (20 cm, 40 cm and 20 and 40 cm in skip row. The average YP obtained was of 15,295 kg ha-1 at blooming; 12,325 kg ha-1 during legume formation; 5,508 kg ha-1 at the beginning of grain filling and 4,315 kg ha-1

  16. Sex ratio and dynamic behavior in populations of the exotic blowfly Chrysomya albiceps (Diptera, Calliphoridae Razão sexual e comportamento dinâmico em populações da espécie de mosca varejeira exótica Chrysomya albiceps (Diptera, Calliphoridae

    Directory of Open Access Journals (Sweden)

    H. Serra

    2007-05-01

    Full Text Available Sex ratio is an essential component of life history to be considered in population growth. Chrysomya albiceps is a blowfly species with a naturally biased sex ratio. In this study, we evaluated the impact of changes in sex ratio on the dynamic behavior of C. albiceps using a density-dependent mathematical model that incorporated demographic parameters such as survival and fecundity. These parameters were obtained by exponential regression, with survival and fecundity being estimated experimentally as a function of larval density. Bifurcation diagram of the results indicated the evolution of stable equilibrium points as a function of sex ratio. A continually increasing sex ratio yielded a hierarchy of bifurcating stable equilibrium points that evolved into a chaotic regime. The demographic parameters obtained by exponential regression were also changed to maximum and minimum values in order to analyze their influence on dynamic behavior with sex ratio being considered as an independent variable. Bifurcations with periodicity windows between chaos regimes were also found.A razão sexual é um componente essencial da biologia de organismos a ser considerado em crescimento populacional. Chrysomya albiceps é uma espécie de mosca varejeira que exibe um desvio na razão sexual em relação à proporção 1:1. Neste estudo avaliamos o impacto de alterações na razão sexual sobre o comportamento dinâmico de C. albiceps utilizando um modelo matemático dependente da densidade que incorpora parâmetros demográficos como sobrevivência e fecundidade. Os parâmetros foram obtidos por regressão exponencial, com sobrevivência e fecundidade sendo estimadas experimentalmente em função da densidade larval. O diagrama de bifurcação gerado pelos resultados indicou a evolução de pontos de equilíbrio estável em função da razão sexual. A sucessão contínua dos valores da razão sexual resultou em uma hierarquia de pontos de equilíbrio est

  17. Desejo de mudança: das motivações e razões que levaram à derrota do PT em Porto Alegre nas eleições de 2004 = Desire for change: the motives and reasons behind the defeat of the PT in Porto Alegre in the 2004 elections

    Directory of Open Access Journals (Sweden)

    Dias, Marcia Ribeiro

    2008-01-01

    Full Text Available O objetivo do artigo é avaliar em que medida o orçamento participativo influenciava a decisão eleitoral em Porto Alegre até 2004, último ano de governo do partido dos trabalhadores (PT naquele municiípio. Com base em dados de um survey aplicado em 3 de outubro de 2004, o artigo fez uma radiografia do eleitor naquele momento de transição, procurando investigar as razões de sua escolha eleitoral e sua percepção acerca do mecanismo essencial dos governos petistas na capital do Rio Grande do Sul: o orçamento participativo

  18. Astucias de la razón y psicología crítica: condiciones de erotismo-seducción, prácticas de tokenismo y resistencias ético-políticas Astucias de la razón y psicología crítica: condiciones de erotismo-seducción, prácticas de tokenismo y resistencias ético-políticas

    Directory of Open Access Journals (Sweden)

    Teresa Cabruja i Urach

    2003-01-01

    Full Text Available In this paper we introduce some difficult aspects for Critical Psychology, difficult because it’s still attached to the dichotomical construction of modern rationality. In that sense, we invoke relationships between critical feminist contribution postpositivist-postmodern perspectives and social and science transformation. One of the problems is the usage of Tokenism (Apfelbaum, 1979 over the “women” “feminine” ana “feminism” subject and over the “emotional”, or others aspects split from de reason. They are included as “señuelos” of change that in fact maintain the some symbolic order with an “illusion” of social mobility or with reification. We found a kind of redistribution of the regulation mechanism of irrationality in the new forms of social governance. After, we present seduction and eroticism as elements that configure the intersubjective relations, the proposals of social-political transformation and the power relations. The literary figures of Sherezade and Caperucita are used for to illustrate the possibilites of the word as action and resistence in the critical psychology.En este artículo se introducen algunos aspectos difíciles para la Psicología Crítica pues continúa heredera de las dicotomías de la racionalidad científico moderno. En este sentido, se alude a las relaciones entre las aportaciones feministas críticas, las postpositivistas-postmodernas y el socioconstruccionismo para una transformación social y del conocimiento. Uno de los problemas se refiere a la práctica del tokenismo (Apfelbaum, 1979 que se realizaría sobre “lo femenino”, “las mujeres” y “el feminismo”, así como sobre lo “emocional” u otros aspectos escindidos de la “razón”. Su inclusión los utiliza como “señuelos” de cambio que mantienen el orden simbólico establecido a partir de la “ilusión de movilidad” o los reifica. Encontránndonos con una especie de redistribución del dispositivo de

  19. Eğitim yöneticilerinin hizmetkâr liderlik yeterlikleri ile farklılıkları yönetme becerileri arasındaki ilişki [The relationship between servant leadership competences and diversity management skills among education managers

    Directory of Open Access Journals (Sweden)

    Refik BALAY

    2014-04-01

    Full Text Available Bu çalışmanın amacı, öğretmen ve yönetici görüşlerine göre eğitim kurumlarında görev yapan yöneticilerin hizmetkâr liderlik yeterlikleri ile farklılıkları yönetme becerileri arasındaki ilişkiyi belirlemektir. Araştırma, tarama modelinde desenlenmiştir. Çalışmada veriler, Hizmetkâr Liderlik Ölçeği (HLÖ ve Farklılıkların Yönetimi Ölçeği (FYÖ ile toplanmıştır. Araştırmanın örneklemi 90 yönetici ve 172 öğretmen olmak üzere 262 kişiden oluşmaktadır. Araştırmada, yöneticilerin hizmetkâr liderlik yeterlikleri ile farklılıkları yönetme becerilerinin orta düzeyde olduğu belirlenmiştir. Araştırma sonucunda katılımcı algılarına göre, eğitim yöneticilerinin hizmetkâr liderlik yeterliklerinin, görev türü ve yaş değişkenlerine göre anlamlı düzeyde farklılık gösterdiği; farklılıkları yönetme becerilerinin ise cinsiyet, görev türü, yaş, mesleki hizmet yılı ve kurumda bulunan çalışan sayısı değişkenlerine göre anlamlı düzeyde farklılık gösterdiği tespit edilmiştir. Son olarak, yöneticilerin hizmetkâr liderlik yeterlikleri ile farklılıkları yönetme becerileri arasında ortanın üstünde, yüksek düzeye yakın pozitif yönde bir ilişkinin olduğu belirlenmiştir.

  20. Kendini değerlendirme ve sınav performansı arasındaki ilişki ile sınav kaygısının sınav performansını yordama etkisinin incelenmesi

    OpenAIRE

    Dalkıran, Esra

    2015-01-01

    Bu araştırma, kendini değerlendirme yöntemini kullanarak öz yeterlik düzeyleri gözlemi yapmak ve sınav kaygısının kendini değerlendirme performansı üzerine etkisini tespit etmek amacıyla yapılmıştır. Bu araştırma, çalgı eğitiminde performansın değerlendirilmesi ile öğrencinin kendini değerlendirmesi arasındaki ilişkiyi ve sınav kaygısının sınav performansını yordama etkisini belirlemeyi amaçlamaktadır. Çalışmanın araştırma grubunu 2014-2015 güz yarıyılında Müzik Öğretmenliği Bölümünde öğrenim...

  1. Sobre la razón, la educación y el amor de las mujeres: mujeres y hombres en la España y en la Francia de las Luces

    Directory of Open Access Journals (Sweden)

    Isabel MORANT DEUSA

    2009-11-01

    Full Text Available RESUMEN: En 1772, la publicación de la obra de A. L. Thomas. lissai sur le caractère, les moeurs et l'esprit des femmes dans les différents siècles suscitò la respuesta de una ilustrada francesa. Mme. d'Épinay, a partir de cuya vida y obra podemos percibir el modo en que el siglo XVIII repensó y estableció la diferencia de los sexos. Años más tarde otra ilustrada, en este caso española, Josefa de Amar y Borbón, hizo su propia lectura de Thomas al implicarse en la polémica sobre la admisión de mujeres en la Sociedad Económica de Amigos del País de Madrid. Su defensa práctica de la presencia social femenina en ese ámbito la llevó a producir un discurso sobre la razón de las mujeres. El recorrido por los textos de una y otra muestra los encuentros y desencuentros de dos culturas. En dos contextos sociales y culturales diferentes, produjeron discursos que hemos hecho entrar en diálogo en la medida en que coincidían en la defensa de las mujeres. Ello nos remite a estrategias intelectuales femeninas que desbordan el discurso de los textos morales y normativos al uso, que utilizan todos los recursos culturales a su alcance, todas las fisuras que los textos les permiten, para producir su propia versión de las cosas. Su ejercicio literario las lleva a oponerse o a ignorar a los autores con los que no pueden componer ningún tipo de acuerdo sin apartarse de la estrategia de defender y de ampliar los espacios culturales y de vida en los que se desenvuelven. Su empeño teórico es, a la vez, una estrategia vital que reclama para las mujeres todas aquellas posibilidades y espacios que los hombres exigen para ellos: la escritura y la participación en la gestión de la vida pública. Así, tanto Mme. d'Épinay como Josefa Amar publicaron, valoraron y aceptaron el reconocimiento público y se mezclaron con los hombres en los círculos culturales y las instituciones reformistas. Al mismo tiempo, no obstante, estas historias paralelas nos

  2. Produção de cultivares de tomateiro em hidroponia e fertirrigação sob razões de nitrogênio e potássio Production of tomato cultivars in hydroponics and fertigation with different ratios between nitrogen and potassium

    Directory of Open Access Journals (Sweden)

    Gláucio C Genuncio

    2010-12-01

    Full Text Available Os cultivos protegidos de tomate apresentam elevada demanda por potássio para altas produções e qualidade de frutos, não tendo sido estudada suficientemente a relação de aplicação entre nitrogênio e potássio que proporcione tais resultados. Avaliou-se a produção e qualidade de frutos de quatro cultivares de tomateiro em sistemas de cultivo hidropônico e fertirrigado sob duas razões entre N e K fornecidas às plantas. Dois experimentos foram conduzidos simultaneamente em casa de vegetação, em esquema fatorial 4x2 com quatro repetições, combinando quatro genótipos (cvs. Cereja 261, San Marzano, Santa Clara e o híbrido Cereja Chipano com duas razões N:K (1:1,5 e 1:2 no hidropônico, e 1:2 e 1:3 no fertirrigado. A produção média de frutos comerciais foi de 2,5 e 1,8 kg/planta no sistema hidropônico e fertirrigado, respectivamente, atingindo 3,3 kg/planta na cv. Santa Clara em hidroponia. Em hidroponia, as razões N:K não afetaram a produção de frutos comerciais e o teor de sólidos solúveis, apesar de um aumento de 6,5% na produção na razão N:K 1:2. A razão N:K 1:2 em hidroponia aumentou a massa e o diâmetro médio dos frutos comerciais, reduzindo a concentração de K nos frutos. No sistema fertirrigado, a razão N:K 1:3 estimulou o crescimento vegetativo do tomateiro, mas não afetou a produção e a qualidade dos frutos. As cultivares San Marzano e Santa Clara tiveram maior produção de frutos nos dois sistemas. A produção de frutos e o teor de sólidos solúveis das cvs. San Marzano e Santa Clara foram maiores no sistema hidropônico em comparação ao fertirrigado. O sistema hidropônico propiciou maior produção de frutos que o sistema fertirrigado para as cultivares San Marzano e Santa Clara e, em hidroponia a razão N:K 1:2 forneceu frutos de maior qualidade comercial.Protected tomato cultivation presents a high potassium demand for obtaining high fruit yield and quality, but the ratio between nitrogen

  3. Influência do agente de cloração do catalisador à base de veodímio e da razão molar Cl: Nd na polimerização do butadieno Influence of the chlorinating agent of neodymium based catalysts and Cl: Nd molar ratio on butadiene polymerization

    Directory of Open Access Journals (Sweden)

    Cintia N. Ferreira

    2009-06-01

    Full Text Available Neste trabalho foi utilizado um sistema catalítico composto por hidreto de diisobutilalumínio (DIBAH, versatato de neodímio (NdV e um agente de cloração para avaliar a influência da fonte de cloro e da razão molar Cl:Nd nas características da reação de polimerização (conversão e constante de velocidade de propagação e do polibutadieno (massa molecular e microestrutura. Os agentes de cloração estudados foram cloreto de t-butila (t-BuCl, sesquicloreto de etilalumínio (EASC e cloreto de dietilalumínio (DEAC. As razões molares Cl:Nd utilizadas foram: 1:1, 3:1 e 5:1 para o t-BuCl; 0,5:1, 1:1 e 3:1 para o EASC e 1:1, 1,5:1, 3:1 e 5:1 para o DEAC. Foi observada a existência, para cada agente de cloração, de um valor ótimo de razão molar Cl:Nd para o qual a conversão foi máxima. O DEAC apresentou uma maior conversão em relação aos outros agentes de cloração; em contrapartida, o t-BuCl produziu polibutadienos com maior teor de unidades 1,4-cis e maior massa molecular (n e wIn this work catalyst systems consisting of diisobutylaluminium hydride (DIBAH, neodymium versatate (NdV and a chlorinating agent were employed to study the influence of the chloride source and Cl:Nd molar ratio on 1,3-butadiene polymerization and polybutadiene's characteristics (molecular weight and microstructure. The chloride sources studied were t-butyl chloride, ethylaluminium sesquichloride (EASC and diethylaluminium chloride (DEAC. The Cl:Nd molar ratios used were 1:1, 3:1 e 5:1 for t-butyl chloride; 0.5:1, 1:1 and 3:1 for EASC and 1:1, 1.5:1, 3:1 and 5:1 for DEAC. A maximum value of Cl:Nd molar ratio exists. Moreover, DEAC showed to be more reactive than EASC and t-BuCl but t-BuCl produced higher molecular weight and cis-1,4 units contents.

  4. Mersin-Kadıncık Havzası’ndaki Sedir (Cedrus libani A. Rich. ve Karaçam (Pinus nigra Arnold. ağaçlandırmalarının boy gelişimi ile bazı yetişme ortamı özellikleri arasındaki ilişkiler

    Directory of Open Access Journals (Sweden)

    Dr. Sevda POLAT

    2014-12-01

    Full Text Available Mersin Orman Başmüdürlüğü Toprak Muhafaza ve Mera Islâhı Tatbikat Grup Müdürlüğü’nce hazırlanan Kadıncık Su Toplama Havzası Ön Etüt Raporu ve Tatbikat Raporu (OGM, 1968 uyarınca Kuzboğazı Dere Havzası ağaçlandırmıştır. Bu çalışma, Türkiye’nin en eski, Mersin ilinin ilk ağaçlandırmalarından biridir. Havzada sedir ve karaçam türlerinin farklı yükselti/iklim kuşağı, bakı, anakaya ve farklı meşcere kuruluşlarındaki boy gelişmeleri değerlendirilerek yetişme ortamı özellikleri ile ilişkileri araştırılmıştır. Kuzboğazı Dere Havzası’nda sedir ve karaçamların üst boyu ile bakı, toprakların bir m³ hacimdeki değerlerinden kum miktarı, ince toprak miktarı, iskelet hacmi, organik karbon ve tüm azot miktarları arasında önemli ilişkiler bulunmuştur. Havzada güney bakı grubundaki sedir ve karaçamların üst boyları kuzey bakı grubundaki sedir ve karaçamlara göre daha fazladır. Kuzboğazı Dere Havzası’nda 38 yaşındaki meşcerelerde sedirin ulaştığı en yüksek üst boy; orta sedir kuşağında, dolomitik kireç taşlarından oluşmuş topraklarda, güney bakı grubundaki karaçam ile karışık meşcerede 15,10 m’dir. Karaçamda ise; orta sedir kuşağında, kalkşist anakayasından oluşmuş topraklarda, güney bakı grubunda ve sedir ile karışık meşcerede 14,45 m’dir. Kuzboğazı Dere Havzası ağaçlandırmasında 38. yılın sonunda ortalama hacim 197,11 m³/ha olarak hesaplanmıştır. Yıllık hacim artımı 5,19 m³/ha’dır. Araştırmaya göre; Doğu Akdeniz Bölgesi’nde deniz etkisine açık, 1500-2000 m yükseltide, eğimin > % 40 olduğu, dolomitik kireç taşı ve kalkşist anakayalarından oluşmuş topraklarda yapılacak ağaçlandırma çalışmalarında, kuzey bakılarda karaçam, güney bakılarda sedirin tercih edilmesi önerilmektedir.

  5. Em contato com as doenças genéticas: a norma e a razão como tradições culturais presentes no discurso de profissionais médicos do Instituto Fernandes Figueira, Fundação Oswaldo Cruz, Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Martins Antília Januária

    2004-01-01

    Full Text Available O estudo buscou captar a influência de tradições culturais arraigadas na construção do discurso que médicos do Instituto Fernandes Figueira/Fundação Oswaldo Cruz produzem acerca das crianças com doenças genéticas associadas a malformações congênitas e ao retardo mental, assim como, as reflexões que o atendimento/convívio profissional com tais doenças ensejaram. Os dados foram coletados através de entrevistas orais do tipo narrativa conversada e do material analisado semioticamente. Os resultados apontaram para quatro tradições culturais muito presentes no discurso médico: a norma, a razão, a família e a religiosidade judaico-cristã. Este artigo, contudo, atém-se as duas primeiras, grifando como as dismorfias e as malformações congênitas associadas às doenças genéticas, cujo prognóstico é sempre encarado como ruim, desafiam as normas arraigadas de perfeição, beleza e produtividade, despertando sentimentos de estranheza, impotência e frustração, e como a razão, uma das principais tradições culturais organizadoras do pensamento moderno, modula o discurso médico sobre as síndromes genéticas associadas ao retardo mental.

  6. Portret : dotsh ili mat? / Valeria Bobõleva

    Index Scriptorium Estoniae

    Bobõljova, Valeria, 1945-

    2003-01-01

    Moskvas Pushkini-nimelises Kujutava Kunsti Muuseumis oleva Henry Francois Viollier (1750-1829) miniatuurmaalist tundmatu autori poolt maalitud koopia atributsioon. Autor jõuab järeldusele, et maalil on Natalja Ivanovna Gontsharova asemel kujutatud Euphrosine Ulrika von Liphart-Posset

  7. Dálník čili ekomobil

    Czech Academy of Sciences Publication Activity Database

    Ireinová, Martina

    2003-01-01

    Roč. 86, č. 4 (2003), s. 222-223 ISSN 0027-8203 Institutional research plan: CEZ:AV0Z9061902 Keywords : Czech denomination of cab- motorcycle * spoken language * linguistics Subject RIV: AI - Linguistics

  8. Bright environments vision of the Intelligent Lighting Institute (ILI)

    NARCIS (Netherlands)

    Özçelebi, T.

    2014-01-01

    The Bright Environments research program of the Eindhoven University of Technology Intelligent Lighting Institute aims to find new methods of intelligent lighting control and human interaction. We present a summary of the institute’s work on this research field and the research vision of the Bright

  9. Povorot ljubimoi mõsli, ili Zhenshtshina na trone

    Index Scriptorium Estoniae

    2003-01-01

    Moskva Noorsooteatri lavastused : A. Thehhovi "Ivanov ja teised", lavastaja H. Janovskaja ; show-paroodia "Good-bye, America!" S. Marshaki luuletuse "Mister Twister" ainetel, lavastaja H. Janovskaja ; K. Ginkase Tshehhovi tõlgendus "Must munk". Venemaa ajakirjanduse põhjal

  10. Zamok krassotõ ili tsarstvo duhha / Tamara Unanova

    Index Scriptorium Estoniae

    Unanova, Tamara

    2005-01-01

    14. veebr. andsid Maria Teatri balletisolistid Tallinna Linnahallis galakontserdi. Esinesid teatri solistid Natalja Sologub, Darja Pavlenkova, Igor Kolb, Anton Korsakov ja tõmbenumbrina reklaamitud Farukh Ruzimatov

  11. Akademie čili nevěstinec

    Czech Academy of Sciences Publication Activity Database

    Cidlinská, Kateřina

    (2015) ISSN 0862-5921 Institutional support: RVO:68378025 Keywords : Library of the Czech Academy of Sciences * exhibition * nudes Subject RIV: AO - Sociology, Demography http://www.lidovky.cz/akademie-cili-nevestinec-08h-/kultura.aspx?c=A151106_165942_ln_kultura_ELE

  12. Ironija sudbõ, ili S ljogkim piarom! / Julia Larina

    Index Scriptorium Estoniae

    Larina, Julia

    2007-01-01

    Eldar Rjazanovi menufilmi "Saatuse iroonia ehk Hüva leili!" (1975) järjefilm "Saatuse iroonia: lugu läheb edasi" ("Ironija sudbõ. Prodolzhenije") : režissöör Timur Bekmambetov : Venemaa 2007. Arvamust avaldavad ka filmi produtsent ja stsenaariumi kaasautormAnatoli Maksimov ja stsenarist Aleksei Slapovski

  13. Pobjeda ratom ili pobjeda pravdom? Vijaya i dhammavijaya

    OpenAIRE

    Ježić, Mislav

    2016-01-01

    Indijski vladar Aśoka (273/269.–232. pr. Khr.) ostavio je znatan korpus natpisa na širokome prostoru svojega carstva o načelima svoje vladavine. Njegovi su pretci osvojili gotovo čitavu Indiju i područja današnjega Afghanistana i dijela Irana. On je vodio samo jedan rat u Kaliṅgi za istočnu obalu Indije. Strašne posljedice toga rata jasno je opisao na vlastitim natpisima. Potom je obustavio ratovanje i odlučio osvajati svijet načelima (buddhističke) pravednosti. Održavao je diplomatske odnose...

  14. Romantitsheskaja utopia, ili Progulka s fotokameroi / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2007-01-01

    Fotonäitus "The Belarusian Identity cArt" Tallinna Kunstihoone galeriis. Eksponeeritud on Artur Klinovi (Klinau) fotoseeria "Minsk - unenägude päikeselinn", Igor Savtshenko fotoseeria "Kommenteeritav maastik" ja Andrei Liankevitshi fotod

  15. Industrialnõi mir sadov : utopija ili realnost? / Jevgeni Kapov

    Index Scriptorium Estoniae

    Kapov, Jevgeni

    2002-01-01

    Kohtla-Järve põlevkivimuuseumis avatud näitusest "Aedade industriaalmaailm": organiseerisid Bauhaus Dessau (saksa arhitektuuri- ja disainikool) töötajad. Esitatud on tööstuskeskkonna ümberkujundamise projekte

  16. Roskosh ili sredstvo dlja võzhivanija / Andrei Sokolov

    Index Scriptorium Estoniae

    Sokolov, Andrei

    2004-01-01

    Maailmas kasutusel olevatele standarditele MRP II/ERP vastavad ettevõtte juhtimissüsteemid on jõudnud Eesti ettevõtete juhtide ja omanike huviorbiiti. Tabel: ERP-süsteemi maksumus sõltuvalt ettevõtte aastakäibele

  17. Imperatritsa ili sovetskaja zhenshtshina? / Aleksandr Vassiljev ; interv. N. Rumjantseva

    Index Scriptorium Estoniae

    Vassiljev, Aleksandr

    2002-01-01

    Kunstnik ja moeajaloolane oma intervjuust kuulsa baleriini Maia Plissetskajaga (1925), mille ta tegi detsembris Monte-Carlos esilinastuva baleriini portreefilmi jaoks. Telekanali "Arte" filmi stsenarist on Kristian Lvovski ja stsenarist krahvinna Jelizaveta Kapnist

  18. CREDERE I KREDIT: DVA SRODNA ILI SUPROTSTAVLJENA POJMA?

    Directory of Open Access Journals (Sweden)

    Gabrijela Mihelčić

    2016-01-01

    Full Text Available Proučavajući ugovore o kreditu osigurane stvarnopravnim osiguranjima, a koji se u praksi većinom sklapaju u potrošačkim odnosno B2C odnosima, autorice u radu dolaze do spoznaja o mnogobrojnim problemima u hrvatskoj sudskoj praksi, ali i zakonodavstvu. Isti su primarno posljedica kompleksnog procesa usklađivanja izvornih nacionalnih odredaba s europskim acquisom u tom području, a koji pored ispravnog preuzimanja EU propisa u nacionalno zakonodavstvo zahtijeva i ispravnu primjenu i ujednačeno tumačenje harmo- niziranog nacionalnog prava sukladno istima. U tom smislu, poteškoće nastu- paju već samim određenjem ugovornih strana, odnosno glede pitanja tko je potrošač, a tko trgovac odnosno vjerovnik u B2C ugovorima o kreditu. Isti se nastavljaju u određenju predmeta ugovora, odnosno pronalaženju odgovora na pitanje, što je potrošački kredit te na kreditiranje čega se on točno odnosi. Nejasnoće postoje i o pitanju određenja bitnih sastojaka ugovora o potrošačkom kreditu, glede kojih jasne odgovore ne daje ni praksa Suda EU-a, niti domaća sudska praksa. Problemi postoje i u razumijevanju same dužnosti sudova i drugih primjenjivača prava o tumačenju i primjeni pozitivnoga nacionalnog prava sukladno acquisu odnosno u načinu provedbe iste dužnosti u praksi. Sva navedena pitanja dodatno se usložnjavaju kada su tražbine takvih kredita stvarnopravno osigurane. Imajući u vidu osobite poteškoće u tumačenju i praktičnoj primjeni harmoniziranih nacionalnih odredaba koje se odnose na potrošačko kreditiranje i pravo potrošača općenito, autorice u radu nastoje dati jasne i koncizne odgovore na brojna ključna pitanja o kojima ovisi ispravna primjena spomenutog zakonodavstva.

  19. Evaluating ILI Advanced Series through Bloom's Revised Taxonomy

    OpenAIRE

    MAHDIPOUR, Nasim; SADEGHI, Bahador

    2015-01-01

    Abstract. This study investigated Iran Language Institute Advanced Series in terms of learning objectives based on Bloom's Revised Taxonomy. It examined the cognitive, affective and psychomotor domains to see how the critical thinking skills are used and to what extent these books are different from each other. For these purposes, the frequencies, percentages and Standard Residual were analyzed. Results revealed that the lower-order cognitive skills (i.e. remembering, understanding and applyi...

  20. Hedzh-fondõ : istotshnik riska ili likvidnosti / Fuad Rasulov

    Index Scriptorium Estoniae

    Rasulov, Fuad

    2007-01-01

    Järg 14. märts lk. 37. G7 riikide rahandusministrid tegid FSF-ile (Financial Stability Forum) ülesandeks teha ettekanne ohtudest, mis tulenevad hedge-fondidest, et selle põhjal võtta vastu fondide tegevust reguleerivate seadusandlike dokumentide pakett. Vt. samas: Mis on hedge-fond?

  1. Bogi i monstrõ, ili biografija Supermena / Olga Marsheva

    Index Scriptorium Estoniae

    Marsheva, Olga

    2007-01-01

    Ameerika tuntuimad koomiksikunstnikud Larry Hama, Stan Lee, Jerry Seagel, Bob Kain, Frank Miller ja nende loodud tegelaskujud. Ka briti kirjanik Alan Moore, kellele ei meeldi oma kangelastest tehtud ekraniseeringuid vaadata

  2. Svjaz : s obshtshestvennostju ili s korruptsijei? / Virkko Lepassalu

    Index Scriptorium Estoniae

    Lepassalu, Virkko, 1971-

    2008-01-01

    Randvere tee detailplaneeringu lugu ja selle võimalik seos Tallinna abilinnapea nõuniku Ivo Parbuse korruptsioonisüüdistusega. Piir korruptsiooni ja seadusliku tegevuse vahel võib olla eristamatu. Lisa: Spravka "DD"

  3. Narnija, ili V platjanoi shkaf i obratno / Nikolai Karajev

    Index Scriptorium Estoniae

    Karajev, Nikolai, 1978-

    2005-01-01

    Ekraniseering C.S. Lewise 1950.a. ilmunud romaanist "Narnia lood : Lõvi, nõid ja riidekapp" ("Chronicles of Narnia : The Lion, the Witch and the Wardrobe") : režissöör Andrew Adamson : Ameerika Ühendriigid 2005

  4. Võsokaja moda : v muzei ili na prodazhu? / Marina Radina

    Index Scriptorium Estoniae

    Radina, Marina

    2006-01-01

    Kõrgmoenädalast kevad/suvi 2006 Pariisis. Tuntud disainerite ja moemajade Jean Paul Gaultier', John Galliano (Christian Diori moemaja), Chaneli, Valentino, Christian Lacroix', Elie Saab'i kollektsioonidest. Chaneli moemaja demonstratsioonil osales ka Carmen Kass

  5. Liberalnõi imperializm, ili Missija Rossii v XXI veke

    Index Scriptorium Estoniae

    2003-01-01

    Venemaa valmistub parlamendi- ja presidendivalimisteks. Tuntud poliitik Anatoli Tshubais esines hiljuti Peterburis, põhiteemaks Venemaa ajalooline missioon XXI sajandil, poliitiline know-how - liberaalne imperialism

  6. Integrating ILI data with publicly available mapping solutions

    Energy Technology Data Exchange (ETDEWEB)

    Coleman, Grant A.; Miller, Scott J. [BJ Pipeline Inspection Services, Calgary, AB (Canada)], email: gcoleman@bjservices.ca, email: smiller@bjservices.ca

    2010-07-01

    With the improvement of the technology, in line inspection tools now incorporate accurate Inertial Mapping Units (IMU) which provide spatial coordinates for the features comprised within a pipeline. Geographic information systems (GIS) can be used to display the data, however some companies do not have such systems and novices cannot navigate easily within the application. The aim of this paper is to present the use of universally available packages to display GIS style data. Case studies are presented in which Google Earth imagery is used to display IMU data. This study showed that universally available packages such as Google Earth do not match the accuracy and functionality of GIS systems but they can be a convenient and easy to use way to display data in a portable format. Organizations that do not have a GIS system could thus benefit from the use of those packages.

  7. Teatr v kino ili kino v teatre? / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2008-01-01

    Võimalusest jälgida Metropolitan Opera lavastusi kinolavalt Tallinna kobarkinos ja Tartu kinos Ekraan. The Metropolitan Operas 26. IX etendunud R. Straussi ooperist "Salome", lavastaja J. Flimm, dirigent P. Summers, peaosas K. Mattila.

  8. Psihushka, ili Poljot nad Berlinale? / Lauri Kärk

    Index Scriptorium Estoniae

    Kärk, Lauri, 1954-

    2007-01-01

    57. Berlinalelt avamise järel : Eldar Rjazanovi "Andersen. Elu ilma armastuseta", korealase Park Chan-wooki "Olen küborg, aga muidu OK", festivali avafilm - Olivier Dahani "La Mõme" prantsuse lauljast Edith Piafist. Rain Tolk esindab Eestit Euroopa noorte näitlejate tutvustuspromotsioonis Shooting Star

  9. Shagrenevaja kozha pjatogo elementa, ili Klassika kak zrelishtshe / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2001-01-01

    Klassikalavastused - Mati Undi "Graal" (lav. Peeter Jalakas), Mihhail Bulgakovi "Meister ja Margarita" (lav. Mati Unt), W. Shakespeare'i "Kuningas Lear" (lav. Priit Pedajas), Pedro Calderoni "Elu on unenägu" (lav. Ingo Normet)

  10. Benzin iz rapsa : utopija ili realnaja perspektiva? / Oleg Samorodni

    Index Scriptorium Estoniae

    Samorodni, Oleg, 1961-

    2006-01-01

    Suurärimees Rein Kilgi eesmärgiks on viia Lõuna Toiduainetööstus Lõuna-Eesti juhtivaks ettevõtteks, seepärast käib ka võitlus rapsitööstuse Werol Tehased ostmise ümber ärimeeste Oliver Kruuda ja Urmas Sõõrumaaga

  11. Glaz da glaz ili gaz da gaz? / Jevgenija Garanzha

    Index Scriptorium Estoniae

    Garanža, Jevgenija, 1979-

    2005-01-01

    Euroopa Liidu ja Venemaa tippkohtumisest Londonis, kõnealusteks teemadeks lihtsustatud viisarežiim, piirilepingud Eesti ja Lätiga, vähemusrahvuste olukord nendes riikides, põhiteemaks kujuneb Euroopa sõltuvus Venemaa gaasist ja naftast

  12. Two New Types of Detector for X- or Gamma-Ray Cameras; Deux Nouveaux Types de Detecteurs pour Camera a Rayons X ou {gamma}; O dvukh novykh tipov detektorov dlya rentgenovskikh ili gamma-kamer; Dos Nuevos Tipos de Detector para Camaras de Rayos X o Gamma

    Energy Technology Data Exchange (ETDEWEB)

    Kellershohn, C.; Desgrez, A. [Departement de Biologie, Service Hospitalier Frederic Joliot (France); Lansiart, A. [Departement d' Electronique, Centre d' Etudes Nucleaires de Saclay (France)

    1964-10-15

    Electric Valve, que actua como obturador. Una parte de la luz que penetra en el dispositivo optico es recibida por un fotomultiplicador que rige la apertura del tubo obturador por mediacion de un selector de amplitudes. Este artificio permite efectuar la seleccion entre la luz debida a la senal y la debida al ruido del tubo de Thomson. Solo la primera ocasiona La apertura del tubo obturador. Como la duracion de dicha apertura es sumamente corta, el cociente senal/ruido de este conjunto detector es suficientemente alto para obtener una imagen de la pantalla terminal del tubo obturador por medio de un aparato fotografico abierto constantemente. En la memoria se discuten las caracteristicas de esos dos tipos de detector y los primeros resultados obtenidos. (author) [Russian] Kamery dlja ren t genovskih ili gamma-luchejsozd aju t sja glavnym o br a zom na osnove sovmeshhennogo s detektorom stenopirovannogo ili s etch atogo opticheskogo ustrojstv a. Avtory predlagajut dva tipa detektorov, polnost'ju otlichajushhihsja ot pribora A n g era, kotoryj do p o sl edn e go vremeni byl edinstvennym priborom tak o goroda. Pervyj p redstavlja et soboj kameru s samovoznikajushhej scintilljaciej. Jeta kamera, 2 0 sm v diametre i zapolnennaja redkim g a zom (argonom ili ksenonom), predstavljaet soboj katod i dve s etk i . Katod i vtoraja s etk a nahodjatsja pod raznost'ju potenciala v neskol'ko kilovol't, nemnogo nizhe probojnogo naprjazhenija. Pervoe prostranstvo mezh du k atodom i s etk oj sluzhit istochnikom jel ek tr on ov , p oluchaemyh pod vozdejs tv i em ren t genovskih ili gamma-fotono v slaboj jen er gi i . Mozhno takzhe ispol'zovat' naklejku na katodizmetalla s povyshennym chislom Z, libo kristallicheskij scintilljator, sovmeshhennyj s fotokatodom. Rezk i j vybros zarjadov v rezul' tat e razmnozhenija jelektronov v lavine Taunsenda privodit posle sootvetstvujushhego usilenija k chetko lokalizovannoj scintilljacii s opozdaniem v kak ujuto doljumksek. Izobrazhenie p oluchaet sja s

  13. A nnals of the Academ y of Romanian Scientists Series on History and Arch a eology ISSN 2067 - 5682 Volume 9 , Number 1 / 201 7 79 OF THE AUST RIA - HUNGARIAN SAFETY STRUCTURES IN THOSE OF THE GREAT ROMANIA. CASE OF THE ARAD OFFICER ILIE MIŞCUŢIA (1913 - 1924

    Directory of Open Access Journals (Sweden)

    Mihai D. Drecin

    2018-05-01

    Full Text Available Ilie Miscutia (1893 -? was born in the city of Jula (Bichisghiula, Gyula -today in Hungary, at the border with Romania considered until today “the great city of the Romanians” a Romanian-Serbia family. A graduate of the trade Hungarian School in Lipova; in 1913, he is recruited by the Austria-Hungary army where he attends a Special Course of information. During the Austro -Hungarian-Serbia war (1914-1915, he will be infiltrated as a spy within the Serbia geographical territory. In 1918, along with the decomposition of the Austria- Hungary he joins the political forces in Transylvania that will prepare the Unification from Alba Iulia. We find him, as an officer in the Romanian military units in Prague, then in Budapest in close to the Romanian Central National Council, and in Arad becomes “the guard body” for Stefan Cicio-Pop. He accompanies the delegation of the Transylvanian Romanians that shall submit to the King Ferdinand, in Bucharest, the act of Unification of Transylvania with the Romanian Kingdom. Within theframework of the Diligent Council in Sibiu, the secretary dr.Eugen Bianu is appointed as the head of the Safety Service in Transylvania and Banat. Since 1 January 1919, he is incorporated in the Romanian Army in the framework of the Organizational Section of the Body VII Sibiu Army, named with the rank of sub -lieutenant in the Intelligence Service of the same Army Body. Between 1918-1920 he takes part to the defense of the city and the Committee of Arad and the Committee Bichis (Bekes today in Hungary, against the Hungarian nationalist guards and of the French army of occupation which were playing the game of the governments in Budapest, watching even keeping the Romanian west in the Hungarian state. In the period March 1920 -September 1924 he is part, as officer, of the Police Prefecture in Arad. He withdraws by his resignation, remaining as civil, a known personality in Arad, in dealing with the management of his own

  14. Razões entre componentes da variabilidade de características quantitativas simuladas com efeitos genéticos de dominância e sobredominância Ratios between variability components of simulated quantitative traits with genetic effects of dominance and overdominance

    Directory of Open Access Journals (Sweden)

    Elizângela Emídio Cunha

    2009-10-01

    Full Text Available Foram avaliadas as razões entre componentes da variabilidade de características quantitativas simuladas a partir de genoma incorporando efeitos genéticos não-aditivos em populações de acasalamento ao acaso e de seleção fenotípica a curto prazo. Estudaram-se uma característica de baixa (h² = 0,10 e outra de alta herdabilidade (h² = 0,60 influenciadas por 600 locos bialélicos. Cinco modelos de ação gênica foram simulados, dos quais quatro incluíram dominância completa e positiva para 25, 50, 75 e 100% dos locos (D25, D50, D75 e D100, respectivamente; e um modelo incluiu sobredominância positiva para 50% dos locos. Todos os modelos incluíram efeitos aditivos dos alelos para 100% dos locos. As principais razões quantificadas foram d² (variância de dominância/variância fenotípica e d²a (variância de dominância/variância aditiva. Para as duas características, d² e d²a aumentaram de acordo com o acréscimo na variância de dominância, decorrente da inclusão crescente de locos com desvio da dominância e sob sobredominância. No mesmo modelo, ambas as razões, sobretudo d², são mais elevadas sob alta herdabilidade, o que indica que os efeitos da dominância explicam a maior parte da variabilidade total dessa característica sob seleção.Ratios were assessed between variability components of quantitative traits simulated from the genome incorporating non-additive genetic effects in random mating populations and short-term phenotypic selection. A trait of low (h² = 0.10 heritability and another of high (h² = 0.60 heritability were studied, both influenced by 600 bi-allelic loci. Five gene action models were simulated, of which four included complete and positive dominance for 25, 50, 75 and 100% of the loci (D25, D50, D75 and D100, respectively; and one model included positive overdominance for 50% of the loci. Every model included additive effects of the alleles for 100% of the loci. The main quantified ratios were

  15. Análise de sensibilidade dos métodos de estimativa da evapotranspiração de referência e razão de Bowen em cultura da cana-de-açúcar Sensitivity analysis of methods for estimating reference evapotranspiration and sugarcane evapotranspiration

    Directory of Open Access Journals (Sweden)

    Bruce K. N Silva

    2011-10-01

    Full Text Available A técnica de análise de sensibilidade de modelos foi aplicada nos dados obtidos em experimento de campo conduzido no ano de 2009, na Destilaria Miriri, localizada no município de Capim, PB, e aos dados de evapotranspiração de referência (ETo, obtidos pela equação de Penman-Monteith (FAO/56, e da evapotranspiração da cultura da cana-de-açúcar (ETc, obtidos pelo balanço de energia com base na razão de Bowen. As análises de sensibilidade e de erros foram aplicadas ao método da razão de Bowen para os intervalos de medição de 15, 30, 60 e 120 minutos enquanto o método de Penman-Monteith foi aplicado para a escala diária durante o ano de 2009. Os resultados evidenciam que o saldo de radiação é a variável mais sensitiva no cálculo do balanço de energia, enquanto o fluxo de calor no solo oferece a menor contribuição; já os erros relativos de todas as variáveis envolvidas do cálculo balanço de energia baseado na razão de Bowen aumentaram significativamente com o aumento do intervalo de amostragem. A variável mais sensível na determinação da ETo pelo método de Penman-Monteith é o saldo de radiação seguida da umidade relativa, velocidade do vento a 2m de altura e a temperatura média do ar.The sensitivity analysis technique of models was applied to the data obtained from field experiment carried out during 2009 at Distillery Miriri, Capim, PB. This technique was applied to the reference evapotranspiration (ETo by Penman-Monteith (FAO/56 and the sugarcane evapotranspiration (ETc by energy balance equation based on Bowen ratio. The sensitivity analysis and errors were applied to the Bowen ratio method in measurement intervals of 15, 30, 60 and 120 min; however Penman-Monteith approach was applied on daily basis throughout the 2009 year. Results showed that the net radiation is the most sensitive variable in the energy equation balance and soil heat flux offers the lowest contribution. On the other hand, the relative

  16. Florivory and sex ratio in Annona dioica St. Hil. (Annonaceae in the Pantanal at Nhecolândia, southwestern Brazil Florivoria e razão sexual em Annona dioica St. Hil. (Annonaceae no Pantanal da Nhecolândia, Brazil

    Directory of Open Access Journals (Sweden)

    Hipólito Ferreira Paulino Neto

    2006-06-01

    Full Text Available Annona dioica St. Hil. is a species that grows to approximately 2 m tall and is very widespread in the cerrados. Individual plants of this androdioecious species produce numerous hermaphroditic or male flowers, but few fruits. The aim of this study was to determine the sex ratio among the plants and to compare the frequency of herbivory between male and hermaphroditic flowers. The fieldwork was done by studying flowering plants in grasslands used as pasture for cattle at Fazenda Nhumirim. One hundred and forty-seven male plants and 71 hermaphroditic plants were examined and produced a total of 194 and 94 flowers, respectively, during the study period. The male:hermaphrodite sex ratio was 2.07:1, and was similar to the male:hermaphrodite flower ratio of 2.06:1. The frequency of florivory rate in hermaphrodites was significantly higher than in male flowers (33.0%, n = 31, and 25.7%, n = 50, respectively; G = 14.83; d.f. = 1; p Annona dioica é uma espécie arbustiva de até dois metros de altura, amplamente distribuída nos cerrados. Esta espécie é conhecida por oferecer muitas flores, mas produzir poucos frutos. Enquadra-se como androdióica, possuindo indivíduos machos e hermafroditas na população. O objetivo deste estudo foi registrar a razão sexual e comparar a taxa de florivoria entre flores masculinas e hermafroditas. A coleta de dados ocorreu em campos de pastagem da Fazenda Nhumirim, consistindo na observação de arbustos floridos. Foram registrados 147 indivíduos masculinos e 71 hermafroditas, os quais apresentavam um total de 194 e 94 flores durante o período de estudo, respectivamente. A razão sexual observada foi de 2,07 indivíduos masculinos para cada hermafrodita, bem como 2,06 flores masculinas para cada flor hermafrodita. A taxa de florivoria foi significativamente maior em flores hermafroditas que em masculinas, com 33,0% (n = 31 e 25,7% (n = 50, respectivamente (G = 14,83; 1gl; p < 0,001. A média do peso fresco de 50

  17. Razões técnicas e efeitos simbólicos da incorporação do "progresso tecnocientífico": reprodução assistida e adoção de crianças

    Directory of Open Access Journals (Sweden)

    Martha Ramírez-Gálvez

    2011-12-01

    Full Text Available As opções tecnológicas são também políticas, mas as implicações políticas das opções tecnológicas são obscurecidas por discursos, práticas e decisões que se apresentam como razões estritamente técnicas. Ao considerar o caso da reprodução assistida (RA, observamos que a busca pelo desenvolvimento técnico responderia, em principio, a razões meramente técnicas que buscariam a satisfação de um desejo "natural e atávico" de vivenciar a experiência corporal da gravidez, parto e amamentação, ancorado na naturalização do desejo de reprodução. No entanto, tais questões são reconsideradas neste artigo, em função da especificidade e singularidade do campo. Para a realização de tal análise, se coloca em perspectiva o campo da RA e de adoção de crianças. Resultados preliminares indicam que o uso de procedimentos de RA tiveram outros desdobramentos para além da consecução de um filho, ganhando um novo nicho de mercado: a função simbólica de elaboração de luto pelo filho biológico, considerada necessária para o amadurecimento do projeto de adoção de crianças.Technological options are also political options, but the political implications of technological options are obscured by discourses, practices and decisions that present themselves as strictly technical. When considering the case of assisted reproduction (AR, we observe that the scientific development is presented as a technical response to a "natural and atavistic" wish to go through the bodily experience of pregnancy, childbearing and nurturing, anchored in the naturalization of the desire for reproduction. However, such questions are reconsidered in this article due to the specificity and singularity of the field. For our analysis, we examine AR and adoption. Preliminary results show that AR procedures have had further developments besides the acquirement of a child, gaining a new market niche: the symbolic function of elaborating the mourning for

  18. Análise das necessidades hídricas da vegetação Tamarisk através da razão de Bowen e do modelo SEBAL Water demand analysis of the Tamarisk vegetation through of the Bowen ratio and SEBAL model

    Directory of Open Access Journals (Sweden)

    Carlos Antonio Costa dos Santos

    2011-03-01

    Full Text Available O objetivo desse estudo foi determinar a evapotranspiração real diária (ETr da vegetação tamarisk utilizando dados micrometeorológicos e o modelo SEBAL. Foram utilizados dados provenientes do método da razão de Bowen, além do modelo SEBAL aplicado a imagens do Landsat 5 - TM, na obtenção da ETr diária da vegetação tamarisk do Baixo Rio Colorado, CA/EUA. Na obtenção da evapotranspiração de referência (ET0 foi utilizado o método da FAO/Penman-Monteith. Os resultados mostram características de forte advecção de ar, e que a radiação solar é o componente de maior influência na obtenção da ET0. Verifica-se também, que a vegetação tamarisk tem alto consumo hídrico e a sua rápida expansão poderá trazer impactos negativos para os rios da região. As estimativas da ETr pelo modelo SEBAL são similares aos valores medidos na torre micrometeorológica pelo método da razão de Bowen, demonstrando a aplicabilidade do modelo SEBAL na obtenção da distribuição espacial da evapotranspiração real diária.The objective of this study was to determine the daily actual evapotranspiration (ETr of the tamarisk vegetation using micrometeorological data and SEBAL model. Data originating from the Bowen ratio method were used, besides the SEBAL model applied to TM Landsat 5 image for obtaining the daily ETr of the tamarisk vegetation of Lower Colorado River, CA/USA. For obtaining the reference evapotranspiration (ET0 the FAO/Penman-Monteith method was used. The results show characteristics of strong air advection and that the solar radiation has the largest influence in obtaining ET0, as well as, that the tamarisk vegetation has high water demand and its fast expansion can bring negative impacts for the rivers of the area. The estimates of ETr through the SEBAL model are similar to the measured values on the micrometeorological tower by the Bowen ratio method, demonstrating the applicability of the SEBAL model to obtain the spatial

  19. Analogia humeana entre a ação moral e o movimento mecânico: uma interpretação para a relação entre as paixões e a razão

    Directory of Open Access Journals (Sweden)

    Andreh Sabino Ribeiro

    2012-03-01

    Full Text Available O objetivo deste artigo consiste em apresentar a analogia que David Hume (1711 – 1776 estabelece entre a açáo moral e o movimento mecânico como indicativo claro de sua compreensáo acerca da relaçáo entre a razáo (direçáo e as paixões (força na conduta humana. Estendendo-se desde a epistemologia moral de Hume até sua moral social, a noçáo que carrega a referida analogia serviria para endossar a tese de que o filósofo escocês almejava ser uma espécie de “Newton das ciências morais”. Isto significava pensar a filosofia moral dentro dos limites da natureza e permitir-lhe uma autonomia investigativa, especialmente em relaçáo à instância religiosa. O próprio projeto filosófico de Hume seria performático da imagem do movimento, enquanto formado por uma composiçáo indissociável entre o impulso do conteúdo de tendência sentimentalista, na esteira de Shaftesbury e Hutcheson, e o direcionamento metodológico do rigor empirista de origem baconiana-newtoniana.

  20. Propuesta de protocolo de valoración de la acidez ambiental en salas y vitrinas de la exposición temporal El último viaje de la fragata Mercedes. La razón frente al expolio (Museo Naval, Madrid

    Directory of Open Access Journals (Sweden)

    Javier Peña Poza

    2015-12-01

    Full Text Available En este trabajo se ha realizado la valoración ambiental, tanto en salas como en el interior de vitrinas, en la exposición temporal El último viaje de la fragata Mercedes. La razón frente al expolio, celebrada en el Museo Naval de Madrid. El estudio se realizó mediante un protocolo de seguimiento de la acidez ambiental que utiliza sensores ópticos. Los resultados obtenidos demostraron que los valores promedio de pH se situaban cercanos a la neutralidad teórica (riesgo de choque ácido bajo, excepto en algunas vitrinas en las que se detectaron valores ligeramente ácidos. Los datos indicaron que los sistemas de ventilación y los materiales empleados en salas y vitrinas (p. ej. pinturas, barnices, adhesivos, etc. eran adecuados ya que no provocaron valores de pH perjudiciales para la correcta conservación de las colecciones.

  1. Estetização da política vs. formação da opinião pública: uma aporia da razão comunicacional? = Aesthetization of politics vs. public opinion formation: an wasteland of communicational reason?

    Directory of Open Access Journals (Sweden)

    Trevisan, Amarildo Luiz

    2007-01-01

    Full Text Available Quando Benjamin debate a tese de estetização da política, feita pelo fascismo, introduz um problema importante para o agir comunicacional. Ao escrever a obra de arte na época de sua reprodutividade técnica,ele termina apontando para o comunismo como uma entidade capaz de ainda se contrapor ao movimento fascista, acenando com a resposta de politização da arte. No entanto, no momento em que fenecerem as esperanças escatológicas depositadas no comunismo, como superar o eclipse da política pela sua transformação em mero espetáculo? É nesse contexto que pretendo debater o encobrimento da política tornando fim em si mesmo, que se reflete fora de si apenas enquanto preocupação com a imagem, e a alternativa de formação da opinião pública proposta pela razão comunicacional

  2. Sağlık politikaları ile meslek ahlakı arasında ilişki var mı? Bursa Tabip Odası’na yapılan başvurular örneğinde bir değerlendirme

    Directory of Open Access Journals (Sweden)

    Kayıhan Pala

    2016-12-01

    Full Text Available Amaç:Hekimlik pratiğine dair meslek örgütüne yansıyan ihlal iddialarını ve belirleyenlerini incelemektir. Yöntem:Araştırma, Bursa Tabip Odası (BTO Yönetim Kurulu’nun 1991-2014 yılları arasındaki tüm kayıtlarının, Onur Kurulu dosyalarının ve bilgisayar kayıtlarının taranmasıyla gerçekleştirilmiştir.Bulgular:İncelenen dönemde BTO’ya yapılan 593 başvuruda toplam 623 ihlal iddiası bulunmaktadır. İhlal iddialarının %46.2’si Onur Kurulu’na iletilmiş ve %29.5’ine yaptırım uygulanmasına karar verilmiştir. Başvurular en çok hasta, hasta yakını ya da hastanın vekili tarafından yapılmıştır (%34.1. Hakkında başvuru yapılan hekimlerin %75.7’si uzman,  %23.3’ü pratisyen, %1.0’i asistan hekimdir. En sık üç ihlal iddiası sırasıyla; tanıtım kurallarının ihlali, haksız kazanç/rekabete aykırılık (%24.8, tıbbi uygulama hatası (%21.4 ve gerçek dışı belge/rapor düzenlemektir (%18.2. ‘Gerçek dışı belge/rapor düzenlemek’, ‘Hasta haklarına saygısızlık’ ve ‘Aracılık, yönlendirme, çıkar ilişkisi’ eylemlerinin Sağlıkta Dönüşüm Programı (SDP sonrasında anlamlı derecede arttığı saptanmıştır. Zorunlu Mesleki Sorumluluk Sigortası sonrasında tıbbi uygulama hatası iddialarının sayısında ve bu iddia sonucunda yaptırıma uğratılan hekim sayısında anlamlı bir artış saptanmamıştır. Sonuç:Bu çalışma ile hekimlik uygulamalarına dair meslek ahlakı ihlallerini anlayabilmek ve sorunları saptayabilmek açısından önemli çıkarımlar elde edilmiş, bulgular SDP ile uygulamaya konulan politikaların mesleki yükümlülüklerin yaşama geçirilmesini güçleştirebileceği yönünde yorumlanmıştır.Anahtar kelimeler:Hekim, meslek ahlakı, etik, tabip odası, onur kurulu

  3. Master-klass v kotorõi raz / Eteri Kekelidze

    Index Scriptorium Estoniae

    Kekelidze, Eteri, 1944-

    2003-01-01

    Sankt-Peterburgi Noorsooteatri kunstilise juhi G. Kozlovi ja tema õpilase R. Ibragimovi näitlejatreeningu meistriklassid Vene Kultuurikeskuses jätkamaks Eesti venekeelse loomingulise noorsoo haridusprogrammi

  4. Razširjena resničnost: Augmented reality:

    OpenAIRE

    Pucer, Patrik

    2011-01-01

    Today we can obtain in a simple and rapid way most of the information that we need. Devices, such as personal computers and mobile phones, enable access to information in different formats (written, pictorial, audio or video) wheneverand wherever. Daily we use and encounter information that can be seen as virtual objects or objects that are part of the virtual world of computers.Everyone, at least once, wanted to bring these virtual objects from the virtual world of computers into real enviro...

  5. Hugo Chaves v otsherednoi raz progrozil SShA

    Index Scriptorium Estoniae

    2005-01-01

    Naftaeksportöör Venezuela sõlmis 13 Kariibi mere riigiga energeetikakoostöö leppe, mis tugevdas president Hugo Chavezi poliitilist positsiooni USA mõju vastu regioonis. USA ja Venezuela suhetest

  6. Loucura e razão: produzindo classes interativas

    Directory of Open Access Journals (Sweden)

    Andrea Cristina Scisleski

    2014-09-01

    Full Text Available The article proposes a discussion of some present configurations of madness, reviewing, in the first moment, the ideas of Ian Hacking, in order to think this existence mode as an operative effect of a matrix that constitutes social interactive classification and categories. In a second moment, the discussion incorporates Michel Foucault's problematizations, especially those presented in his classical book, The history of madness in the Classical Age, aiming to think the displacements in the matrix that makes the idea of madness. Foucault's work does not display a linearity of speeches about madness, but otherwise shows discontinuities that conform and legitimate existence's forms, that are classified as suitable or not, depending on the truth regime. The authors discuss critically the madness classification practices and referentials, searching for possibilities to promote less rigid and deterministic insertions. We emphasize that the classificatory practice, as the psychological and psychiatrical diagnoses, does not only interact with the ones classified, but also reverberate the limitations of the work of its own classifier agents.

  7. Razón y ser de los tipos

    Directory of Open Access Journals (Sweden)

    González Blanco, F.

    2006-09-01

    Full Text Available Fisac’s oeuvre has traditionally been defined in terms of its individualism, its non-association with any school or movement whatsoever. A deeper analysis of one of his best known lines of research, the hollow forms of prestressed concrete (his famous “bones”, reveals a host of engineers, practitioners and businessmen united around a common core of friendship and ingenuity whose work crystallized in an evolutionary process interesting in its own right.This text is, therefore, a tribute not only to Miguel Fisac, but to all those who participated in this story, which lasted a mere ten years (the nineteen sixties: a story of risk, success and failure, where the architect often stood in solitude in the midst of a densely populated circle of engineers, quantity surveyors, contractors and inventors.Tradicionalmente se ha destacado de Fisac su carácter individualista, no atado a escuela o movimiento alguno. Profundizando en una de sus líneas investigadoras más conocidas como son las formas huecas de hormigón pretensado, sus famosos “huesos”, es inmediato encontrarse con una nube de técnicos, prácticos o empresarios unidos por un hilo común de amistad e ingenio, cuyo trabajo conjunto cristalizó en un proceso evolutivo ya de por sí interesante.Es por ello extensible este texto homenaje no sólo a la figura de Miguel Fisac, sino a todos aquellos que en el corto periodo de una década (los años sesenta participaron de esta historia. Una historia de riesgos, de aciertos y de errores, donde la figura del arquitecto queda en muchas ocasiones aislada entre la densidad de ingenieros, aparejadores, constructores o inventores.

  8. La persona: razón de ser del derecho

    Directory of Open Access Journals (Sweden)

    Jaime Baquero de la Calle

    2008-01-01

    Full Text Available Todo ordenamiento jurídico se propone alcanzar el bien común. Dentro de este marco institucional, la justicia es el valor supremo que procura garantizar la autoridad competente. ¿Cuándo es posible decir que se está actuando según la justicia? Encontrar una respuesta requiere remontarse a los principios fundamentales que han dado origen a toda formulación jurídica. Y detrás de tales principios se encuentra la persona, destinatario final del ordenamiento. La norma escrita no se funda –por lo menos, no debería ser así– en el azar o las ideas políticas del gobierno de turno. Ante la inminente presencia de una Asamblea Constituyente, es imperativo volver sobre los fundamentos últimos de todo Estado de Derecho.

  9. Moradas de la razón sensible

    Directory of Open Access Journals (Sweden)

    María Eugenia Boito

    2012-03-01

    Full Text Available “Jirones de piel, ágape insumiso” establece relaciones entre la reflexión epistemológica, la estética y la normatividad en catorce apartados que –como jirones– pueden interpretarse como “pequeñas porciones de un todo”; fragmentos de telas (tramas discursivas que recorren y se detienen en la interrogación de la compleja madeja que reúne los tópicos antes referidos. Pero “jirón” tiene otro significado en el campo de la heráldica que en mi lectura, está asociada a las figuras que produce el texto: “jirón” es una forma triangular que desde el borde del escudo, llega hasta el centro o corazón de este. Claudio Martyniuk afirma “no ensancha escribir, no ensancha leer, apenas salva del extravío y de la tristeza vacías”. Sin embargo los jirones de su escritura ensayística (el ensayo como género que pretende “un despliegue que tense los entumecidos polos de la sensibilidad y el pensamiento” se orientan a proteger como escudo –pero a la vez interrogar– lo que se encuentra el corazón de los recorridos de la obra: los ejercicios de violencia cotidiana sobre nuestra piel. Por esto además de salvar del extravío y de la tristeza, la escritura de Martyniuk señala –y asila, da regazo– a la piel como instancia de expresión de nuestra sensibilidad.

  10. Rozhdestvenski blagovest prozvutshal v desjatõi raz

    Index Scriptorium Estoniae

    2005-01-01

    2004. a. jõulupreemiad "Rõõmukuulutus" pälvisid teiste hulgas Vene Draamateatri näitleja I. Nartov, loomingulise ühenduse "Teine Teater" asutaja ja produtsent N. Matshenene ja ajakirjanik ning teatrikriitik E. Kekelidze

  11. Loucura e razão: produzindo classes interativas

    Directory of Open Access Journals (Sweden)

    Andrea Cristina Scisleski

    2008-01-01

    Full Text Available The article proposes a discussion of some present configurations of madness, reviewing, in the first moment, the ideas of Ian Hacking, in order to think this existence mode as an operative effect of a matrix that constitutes social interactive classification and categories. In a second moment, the discussion incorporates Michel Foucault's problematizations, especially those presented in his classical book, The history of madness in the Classical Age, aiming to think the displacements in the matrix that makes the idea of madness. Foucault's work does not display a linearity of speeches about madness, but otherwise shows discontinuities that conform and legitimate existence's forms, that are classified as suitable or not, depending on the truth regime. The authors discuss critically the madness classification practices and referentials, searching for possibilities to promote less rigid and deterministic insertions. We emphasize that the classificatory practice, as the psychological and psychiatrical diagnoses, does not only interact with the ones classified, but also reverberate the limitations of the work of its own classifier agents.

  12. Balanço de energia e estimativa da evapotranspiração em culturas irrigadas de maracujazeiro pelo método da razão de Bowen Energy balance and estimative of the evapotranspiration of irrigated passionfruit crops by the Bowen ratio method

    Directory of Open Access Journals (Sweden)

    Tonny J. A. Silva

    2007-08-01

    Full Text Available A cultura do maracujazeiro-amarelo tem tido grande expansão da área cultivada no Estado de São Paulo e, apesar da importância da irrigação para a cultura, há poucos estudos sobre sua utilização. Este trabalho foi realizado na área experimental de irrigação, na Fazenda Areão, do Departamento de Engenharia Rural, da Escola Superior de Agricultura "Luiz de Queiroz" - ESALQ/USP (Piracicaba - SP. Foram coletados dados de saldo de radiação, fluxo de calor no solo, gradientes de temperatura e pressão de vapor do ar com o objetivo de avaliar a partição da energia disponível e a evapotranspiração em cultivo de maracujazeiros em dois sistemas de plantio (linhas de cultivo norte-sul e leste-oeste. O método da razão de Bowen foi utilizado na determinação dos fluxos de calor sensível e latente. O saldo de radiação não foi influenciado pelo sistema de plantio, sendo equivalente a 60% da radiação global. O componente de maior contribuição no balanço de energia foi o calor latente de evaporação ocorrendo imediatamente após a chuva ou irrigação. A utilização do modelo de análise e exclusão de intervalos em que o método da Razão de Bowen falha, melhora a estimativa da evapotranspiração.Passionfruit crop has been having great expansion in the cultivated area of São Paulo State and beside the irrigation importance for crop; there are few studies about its utilization. This work was carried out at the experimental irrigation farm of the Engineering Department - College of Agriculture "Luiz de Queiroz" - ESALQ/USP, in Piracicaba, São Paulo State, Brazil. Were collected micrometeorological data from net radiation, soil flux heat, temperature and vapor pressure gradient with the aim to evaluate the partition of available energy and evapotranspiration of passionfruit crop planted under two row directions (North-South and East-West. The Bowen ratio method was used to determine both sensible and latent fluxes. The net

  13. Determinação da razão ótima de espermatozóides por ovócitos de piabanha Brycon insignis (pisces - characidae Determination of the optimum ratio of spermatozoa per oocyte of the piabanha Brycon insignis

    Directory of Open Access Journals (Sweden)

    E. Shimoda

    2007-08-01

    Full Text Available Determinou-se a razão ótima de espermatozóides por ovócitos da piabanha Brycon insignis, utilizando-se dois machos e duas fêmeas da espécie, submetidos ao procedimento de desova induzida. Os gametas foram extrusados manualmente 200 horas-grau após a aplicação do extrato bruto de hipófise. Os ovócitos foram misturados e deste pool retiraram-se amostras com 2g de ovócitos (701 ovócitos/g. O sêmen do pool foi diluído em solução de NaCL 1,2% de tal forma que, após a adição de 1ml do sêmen diluído aos ovócitos, fossem obtidas as seguintes razões espermatozóides por ovócitos em cada tratamento: T1=86.662, T2=173.324, T3=259.986, T4=346.648 e T5=433.310. A taxa de fertilização do sêmen não diluído usado como controle foi de 65,3%. Após ativação espermática com NaHCO3 1% e fecundação, os ovos foram transferidos para as incubadoras e nelas foram observadas as seguintes percentagens de fertilização em relação à do grupo-controle: T1=35,7%, T2=53,1%, T3=79,1%, T4=93,4% e T5=87,8%. A percentagem de fertilização (em relação ao controle aumentou de forma linear, segundo a equação de regressão: Y=15,55+0,0002297X (PThe optimum spermatozoa:oocyte ratio of piabanha Brycon insignis was studied. Two males and two females were induced to spawn, and the gametes were stripped after 200 hourgrades starting from the application of carp pituitary gland. Oocytes from two females were mixed, and samples of 2g (701 oocytes/g were collected from the obtained pool and placed into plastic cups. The semen from the two males, after mixed to compose a pool, was diluted in NaCl solution (1.2% so that, after the addition of 1ml of diluted sperm into the oocytes, the following spermatozoa:oocyte ratios (tri-replicated were obtained: T1=86,662, T2=173,324, T3=259,986, T4=346,648 and T5=433,310. After the activation using 1% NaHCO3 and fertilization, the eggs were transferred to incubators, and observed the percentages of fertilization

  14. Evaluation of the generalized likelihood ratio test of hypotheses on the genetic control of continuous traits/ Avaliação da razão de verossimilhança generalizada em teste de hipóteses sobre o controle genético de características contínuas

    Directory of Open Access Journals (Sweden)

    Daniel Furtado Ferreira

    2004-05-01

    Full Text Available Studies of genetic control in plants are carried out to characterize genetic effects and detect the existence of a major gene and/or genes of minor effects (polygenes. If the trait of interest is continuous, the likelihood can be constructed based on a model with mixtures of normal densities. Once exact tests are not evident with such models, the likelihood ratio test is generally used, using the chi-square approximation. This work aimed at evaluating such test statistic using computer simulation. Data sets were simulated using generations typical in plant studies, under two conditions of null hypothesis, without a major gene, and without polygenes. The power of the test was evaluated with both types of genes present. Different sample sizes and values of heritability were considered. Results showed that, although the empirical densities of the test statistic departed significantly from a chi-square distribution, under null hypotheses, there was a reasonable control of type I error, with a significance level of 5%. The power of the test was generally high to detect polygenes and major genes. Power is low to detect a major gene only when it explains a low fraction of genetic variation.Estudos de herança genética em plantas são realizados para caracterizar os efeitos genéticos e verificar a existência de um gene de efeito maior e/ou de genes de pequeno efeito (“poligenes”. Quando a característica de interesse é contínua, a verossimilhança é baseada em modelos de misturas de densidades normais. Uma vez que não há testes exatos evidentes para julgar a existência de um gene de efeito maior, a razão de verossimilhança generalizada é em geral utilizada, considerando a aproximação de qui-quadrado. Este trabalho objetivou avaliar esta estatística de teste através de simulação em computador. Dados foram simulados, considerando particularidades de genealogia típicas de tais estudos, e duas condições sob a hipótese de nulidade

  15. Confiando en la confianza Contra toda razón Confiando en la confianza Contra toda razón

    Directory of Open Access Journals (Sweden)

    Burkard Sievers

    2007-12-01

    Full Text Available The importance of trust is heavily emphasized in contemporary organization theory and management practice. Although I am convinced that trust is a good thing and necessary constituent of the social fabric, I am interested in understanding the social (and political thinking underlying the current academic and non academic view of trust. My working hypothesis is that: management attempts to engineer trust reflect an underlying denial of the loss of hope regarding both the relatedness between organizational members and the value and meaning of organizations. The experience of non-relatedness and lack of trust cannot be acknowledged by management, therefore the loss of hope has to be hidden behind the propagation of the importance of trust (and relatedness. The denial of the loss of hope is an expression of psychotic thinking concomitant with inability to see a reality and to mourn loss. The engineered propagation of trust thus becomes a substitute for trust itself.La importancia de la confianza tiene un fuerte énfasis en la teoría organizacionalcontemporánea y en la práctica administrativa. A pesar de estar convencido que laconfianza es buena y constituye una parte necesaria del tejido social, mi interés escomprender el pensamiento social (y político que subyace en la visión académica yno-académica sobre la confianza. Mi hipótesis de trabajo es esta: los intentos de losdirectivos de las organizaciones por crear confianza reflejan una profunda negación dela pérdida de esperanza con respecto a la relación entre los miembros de la organizacióny el valor y sentido de las organizaciones. Los directivos no reconocen tal falta derelaciones y confianza y por tanto, la pérdida de esperanza es escondida tras el discursosobre la importancia de la confianza (y las relaciones. La negación de la pérdida deesperanza es una expresión del pensamiento psicótico concomitante con la incapacidadpara ver la realidad y hacer duelo a la pérdida. La propagación artificial de la confianzase convierte así en un sustituto de la confianza en sí misma.

  16. Sexual ratio and floral biology of the dioecious Neea theifera Oerst. (Nyctaginaceae in a cerrado rupestre of central Brazil Razão sexual e biologia floral de Neea theifera Oerst. (Nyctaginaceae, uma espécie dióica na vegetação de um cerrado rupestre no Brasil Central

    Directory of Open Access Journals (Sweden)

    Felipe Wanderley Amorim

    2011-12-01

    íduos masculinos e femininos. Este sistema evoluiu muitas vezes entre as Angiospermas e está amplamente distribuído entre as distintas famílias. É visto como uma estratégia reprodutiva para reduzir a endogamia e otimizar a alocação diferencial de recursos entre as funções sexuais masculinas e femininas. Neea theifera é uma espécie comum no Cerrado, área de Savana Neotropical no Brasil, mas informações acerca de sua biologia reprodutiva são incompletas. Para investigar se as condições ambientais afetam espécies dióicas, foi estudada sua biologia floral, a razão sexual e distribuição espacial dos morfos ao longo de um gradiente de solo-altitude. A razão sexual da população não diferiu da razão esperada de 1:1. Porém, a abundância de flores estaminadas na população foi significativamente maior. Os indivíduos femininos foram maiores que os masculinos e o tamanho das plantas correlacionou-se negativamente com a altitude, apesar de não diferirem entre os morfos sexuais. A população não apresentou segregação espacial dos morfos sexuais e os indivíduos masculinos apresentam maturação sexual precoce em relação aos femininos. Flores estaminadas foram maiores que as pistiladas, além de apresentarem alta viabilidade polínica. Abelhas Meliponini, pequenas moscas e tripes foram os potenciais polinizadores, entretanto o sucesso de polinização foi muito baixo. A dioicia em N. theifera corrobora muitas características gerais desta estratégia reprodutiva, como hábito lenhoso, flores inconspícuas, polinização por pequenos insetos generalistas e alocação diferencial de recursos entre indivíduos masculinos e femininos. Porém, a reprodução nesta espécie é aparentemente afetada por limitação de polinizadores. Os resultados mostram que o gradiente de solo-altitude influencia o padrão de crescimento da espécie e pode ter um importante papel na biologia reprodutiva da planta, mas não afeta diretamente a dioicia.

  17. Health-promoting lifestyles and related factors among pregnant women/Gebelerde sağlıklı yaşam biçimi davranışları ve ilişkili faktörler

    Directory of Open Access Journals (Sweden)

    Güliz Onat

    2014-08-01

    açısından özellikle gebelik sürecinde oldukça önemlidir. Bu çalışmada gebe kadınlaın sağlıklı yaşam biçimi davranışları ve ilişkili faktörlerinin araştırılması amaçlanmıştır. Yöntem: Tanımlayıcı nitelikte olan bu çalışma, Uşak’ta 255 gebe kadın üzerinde gerçekleşmiştir. Çalışmada Sağlıklı Yaşam Biçimi Davranışları Ölçeği-II (SYBDÖ-II kullanılmıştır. İstatistiksel değerlendirmede sıklık ve yüzdelik dağılım, t test, Mann Whitney U test and ANOVA kullanılmıştır. Bulgular:Kadınların yaş ortalaması 26.7±5.1 ve gestasyonel yaşı 25.2±10.9 haftadır. Toplam SYBDÖ-II puanı 130.7.±20.0 idi. Ölçeğe ait en düşük puan “fiziksel aktivite” alt grubuna, (14.4±5.0 en yüksek puan ise “manevi gelişim” e aittir (26.1±4.2. Gebelik öncesi sigara içme sıklığı %16.9 iken, gebelikte bu oran %3.9’dur (ortalama 4 sigara/gün. Kadınların gebelikte beslenme alışkanlıkları iyileşmiştir; öte yandan halen sigara içen gebeler bulunmaktadır ve fiziksel aktivitelerindeki değişimler yetersizdir. Ayrıca kadınlar gebelik ve doğum hakkında bilgi alma gereksinimindedir. Sonuç: Gebe kadınlarda SYBDÖ-II puanı üst-orta seviyededir. Eğitim seviyesi düşük, işsiz ve gebeliğini sonlandırmak isteyen kadınların, sağlıksız davranışlar açısından risk grubunda olduğu belirlenmiştir. Bu bulgular, doğum öncesi kliniklerde çalışan sağlık personeline riskli grubu belirleme açısından ipuçları sunar. Sağlık bakımı sunanların, sağlıklı yaşam biçimi davranışları açısından belirlenen riskli grubu daha dikkatli değerlendirilmesi önerilmektedir.Anahtar Kelimeler: Sağlıklı Yaşam Biçimi Davranışları; gebe kadınlar; Sağlıklı Yaşam Biçimi Davranışları Ölçeği-II

  18. Biometria, razão sexual e dimorfismo sexual de Trachemys dorbigni (Duméril & Bibron 1835 (Testudines, Emydidae em um açude no município de São Gabriel, Rio Grande do Sul, Brasil

    Directory of Open Access Journals (Sweden)

    Melise Lucas Silveira

    2012-04-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2012v25n3p187   Com o intuito de se estudar a estrutura de uma população de Trachemys dorbigni, foram realizadas coletas durante o período de março de 2009 a fevereiro de 2010, em um açude (30º20’16,03”S e 54º15’46,68”W, no município de São Gabriel, Rio Grande do Sul, Brasil. Foram coletados 44 indivíduos, sendo 34 fêmeas, sete machos e três juvenis. A razão sexual encontrada foi diferente de 1:1 (4,85 fêmeas:1 macho. O comprimento médio da carapaça dos adultos foi igual a 190,50 ± 22,81mm (N=41 e a massa média foi igual a 1,210 ± 420g (N=37. Os machos apresentaram comprimento médio da carapaça de 179,10 ± 18,60mm (N=7 e as fêmeas, de 192,90 ± 23,10mm (N=34. As fêmeas mostraram-se significativamente maiores do que os machos em seis medidas das onze obtidas e menores em apenas uma medida, comprimento da base da cauda ao orifício cloacal. A análise discriminante mostrou diferenças morfológicas significativas entre machos e fêmeas (P<0,05; F3.37=21,02; Wilks’ lambda=0,36, indicando a distância terminal entre a carapaça e o plastrão, o comprimento curvilíneo da carapaça e o comprimento da base da cauda ao orifício cloacal como variáveis importantes na diferenciação entre os sexos.

  19. Estimativa do balanço de energia em cambarazal e pastagem no norte do Pantanal pelo método da razão de Bowen Estimate of energy balance in cambarazaland pasture in the north of Pantanal by Bowen ratio method

    Directory of Open Access Journals (Sweden)

    Marcelo Sacardi Biudes

    2009-06-01

    Full Text Available O estudo do balanço de energia de uma superfície vegetada e a atmosfera é importante para caracterizar o microclima local, identificar interações entre variáveis ambientais e a vegetação, e identificar efeitos das atividades antropogênicas. O objetivo deste trabalho foi estimar a variação sazonal do balanço de energia pelo método da razão de Bowen em uma área de vegetação monodominante de Cambará na RPPN SESC-Pantanal e uma área de pastagem na Fazenda Experimental da UFMT. Os componentes do balanço de energia apresentaram sazonalidade, com maiores médias na estação chuvosa nas duas áreas de estudo. No cambarazal houve maior variação do fluxo de calor latente da estação seca para a chuvosa que na pastagem. Entretanto, a variação sazonal do fluxo de calor sensível foi menor no cambarazal que na pastagem, devido ao efeito termo-regulador do cambarazal, em função da maior biomassa. A energia disponível aos dois sítios foi destinada prioritariamente em fluxo de calor latente, 80,0% no cambarazal e 56,6% na pastagem, seguido pelo fluxo de calor sensível, 19,1 e 42,9%, e pelo fluxo de calor no solo, 0,3 e 7,2%.The energy balance study of a vegetated surface and atmosphere is important to characterize the local microclimate, identify interactions among environmental variables and the vegetation and to identify anthropogenic activities effects. The objective of this work was estimate the seasonality of energy balance by Bowen ratio method in a monodominant vegetation of Cambará area in the RPPN SESC-Pantanal and a pasture area in UFMT's Experimental Farm. The energy balance components presented seasonality, with larger averages at the rainy station in two areas of study. In the cambarazal was a higher variation of the latent heat flux of the dry season for the rainy season that in the pasture. However, the seasonal variation of the sensible heat flux in the cambarazal was lower than in the pasture, due to the thermo

  20. Probabilidade de resposta da cana-de-açúcar à adubação potássica em razão da relação K+ (Ca2++Mg2+ -0,5 do solo Probability of sugarcane response to potassium fertilizer as a function of soil K+ (Ca2++Mg2+ -0,5 ratio

    Directory of Open Access Journals (Sweden)

    Roberto dos Anjos Reis Junior

    2001-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a probabilidade de resposta da produção de cana-de-açúcar à adubação potássica, em razão da relação K+ (Ca2++Mg2+ -0,5 no solo. Foram compilados dados de 106 experimentos de adubação potássica na cana-de-açúcar. Em cada experimento foi registrado o ciclo de cultivo (cana-planta ou cana-soca, os teores de K, Ca e Mg do solo antes da adubação potássica, a relação K+ (Ca2++Mg2+ -0,5, e se houve, ou não, resposta estatisticamente significativa da produção à adubação potássica. Foi utilizado o método estatístico de regressão logística, efetuado pelo procedimento CATMOD do Statistical Analysis System. A característica ciclo de cultivo foi eliminada do modelo, pois esta se apresentou como não-significativa no ajuste estatístico. A relação K+ (Ca2++Mg2+ -0,5 do solo influenciou a probabilidade de resposta da produção de cana-de-açúcar à adubação potássica. À medida que a relação K+ (Ca2++Mg2+ -0,5 aumentou, a probabilidade de resposta da produção de cana-de-açúcar à adubação potássica diminuiu. A relação K+ (Ca2++Mg2+ -0,5 no solo foi classificada em baixa (0,3349. A relação K+ (Ca2++Mg2+ -0,5 no solo deve ser usada como mais um critério para orientar a adubação potássica na cultura da cana-de-açúcar.This study was carried out to evaluate the effect of soil K+ (Ca2++Mg2+ -0.5 ratio on sugarcane yield response probability to potassium fertilizer. Results of 106 experiments of potassium fertilizer on sugarcane and their soil exchangeable K+, Ca2+ and Mg2+ were studied, evaluating the K+ (Ca2++Mg2+ -0.5 ratio in each experiment. The statistical method of logistic regression was used, carried out through CATMOD procedure of Statistical Analysis System. There was no difference of behavior of this ratio between plant cane and ratoons; therefore this characteristic was not significant during the adjustment of the statistical model. Soil K+ (Ca2++Mg2+ -0

  1. Escala Razões para Fumar Modificada: tradução e adaptação cultural para o português para uso no Brasil e avaliação da confiabilidade teste-reteste Modified Reasons for Smoking Scale: translation to Portuguese, cross-cultural adaptation for use in Brazil and evaluation of test-retest reliability

    Directory of Open Access Journals (Sweden)

    Elisa Sebba Tosta de Souza

    2009-07-01

    Full Text Available OBJETIVO: Traduzir, fazer a adaptação cultural e testar a confiabilidade teste-reteste de uma versão em língua portuguesa da Escala Razões Para Fumar Modificada (ERPFM para uso no Brasil. MÉTODOS: Uma versão em língua inglesa da ERPFM foi traduzida por médicos brasileiros com profundo conhecimento sobre a língua inglesa. Uma versão de consenso foi obtida por grupo multidisciplinar composto por dois pneumologistas, um psiquiatra e um psicólogo. Essa versão foi traduzida de volta ao inglês por um tradutor americano. A avaliação da adaptação cultural da versão final foi efetuada em uma amostra de 20 fumantes saudáveis. A avaliação da confiabilidade teste-reteste foi feita pela aplicação da versão traduzida da escala em 54 fumantes saudáveis em duas ocasiões separadas por 15 dias. RESULTADOS: Essa versão traduzida da ERPFM exibiu excelente identidade cultural, sendo bem compreendida por 95% dos fumantes. Os graus de concordância das respostas em duas ocasiões distintas foram quase perfeito para duas questões, substancial para dez questões, moderado para oito questões e discreto para uma questão. Os valores dos coeficientes de correlação intraclasse dos fatores motivacionais em duas ocasiões, empregando-se modelos teóricos previamente publicados, foram superiores a 0,7 em seis dos sete domínios. CONCLUSÕES: A presente versão da ERPFM exibe identidade cultural e confiabilidade teste-reteste satisfatórias, podendo ser de utilidade no tratamento e na avaliação de tabagistas em nosso meio.OBJECTIVE: To translate the Modified Reasons for Smoking Scale (MRSS to Portuguese, to submit it to cross-cultural adaptation for use in Brazil and to evaluate the test-retest reliability of the translated version. METHODS: An English-language version of the MRSS was translated to Portuguese by Brazilian doctors who have thorough knowledge of the English language. A consensus version was produced by a multidisciplinary group

  2. raz školy na akademický úspěch: TIMSS 2011 jako sonda do reformy v České republice/ School emphasis on academic success in TIMSS 2011 as a window on curricular reform in the Czech Republic

    Directory of Open Access Journals (Sweden)

    Dominik Dvořák

    2015-04-01

    Full Text Available V šetření TIMSS 2011 se objevil index nazvaný „důraz školy na studijní úspěch“ (SEAS. Cílem článku je osvětlit skutečnost, že české školy vykazují poměrně nápadné hodnoty tohoto indexu. Dále pomocí SEAS analyzuje vztah mezi postoji českých škol k reformě a znalostmi a dovednostmi jejich žáků. Teoretický úvod popisuje konstrukt akademický optimismus a index SEAS zavedený v šetření TIMSS. Následně je provedena explorativní sekundární analýza dat o úrovni složek SEAS v případě českých škol se zaměřením na nápadné odchylky hodnot. Práce vychází z výsledků žáků čtvrtých ročníků v matematickém testu TIMSS 2011 a z odpovídajících učitelských a ředitelských dotazníků. Pro analýzu vztahů v datech jsou použity základní prostředky popisné a inferenční statistiky. Zjištění ukazují na disproporčně nízkou důvěru ředitelů ve snahu žáků ve škole dobře prospívat, která je společná regionálnímu klastru zemí. Dále analýza přinesla nečekaná zjištění o vztahu mezi postoji ředitelů a učitelů ke kurikulární reformě a výsledky jejich žáků v matematice. Z literatury známá i naše původní zjištění o komponentách indexu SEAS v podmínkách českých škol přinášejí zajímavé pohledy mj. na vnímání reformních procesů v českých školách a doplňují tak literaturu o implementaci, resp. recepci reformy.

  3. Causas de morte e razões para eutanásia de cães da Mesorregião do Centro Ocidental Rio-Grandense (1965-2004 Causes of death and reasons for euthanasia in dogs from the midland region of the Midwest of Rio Grande do Sul State, Brazil (1965-2004

    Directory of Open Access Journals (Sweden)

    Rafael A. Fighera

    2008-04-01

    Full Text Available Este estudo teve como objetivo principal determinar a prevalência das doenças que culminam em morte ou que fazem com que os cães da Mesorregião do Centro Ocidental Rio-Grandense sejam submetidos à eutanásia. Para isso, foram revisados todos os protocolos de necropsia de cães, arquivados no Laboratório de Patologia Veterinária (LPV da Universidade Federal de Santa Maria (UFSM, realizadas entre janeiro de 1965 e dezembro de 2004. Nos arquivos do LPV-UFSM foram encontrados 4.844 protocolos de necropsia de cães. A distribuição dos casos em relação às categorias de doenças diagnosticadas foi a seguinte: doenças infecciosas e parasitárias (1.693 [35,0%], neoplasmas (378 [7,8%], distúrbios causados por agentes físicos (369 [7,6%], doenças degenerativas (342 [7,1%], intoxicações e toxiinfecções (112 [2,3%], eutanásia por conveniência (101 [2,1%], doenças metabólicas e endocrinológicas (97 [2,0%], distúrbios iatrogênicos (83 [1,7%], distúrbios do desenvolvimento (25 [0,5%], doenças imunomediadas (10 [0,2%] e doenças nutricionais (6 [0,1%]. Outros distúrbios, que incluem doenças multifatoriais ou idiopáticas, contribuíram com 80 (1,6% casos. Dos 4.844 casos, em 1.548 (32,0% não foi possível estabelecer a causa da morte ou a razão para a eutanásia. Doenças infecciosas e parasitárias (principalmente cinomose, parvovirose e verminose intestinal, neoplasmas (principalmente neoplasmas mamários e linfoma, distúrbios causados por agentes físicos (principalmente atropelamento por veículos automotivos e doenças degenerativas (principalmente insuficiência renal crônica, cirrose e insuficiência cardíaca congestiva foram as principais categorias de doenças relacionadas com morte ou eutanásia de cães dessa mesorregião. Entretanto, quando os cães são avaliados de acordo com suas idades, tais categorias possuem prevalências diferentes. As principais causas de morte em filhotes foram as doenças infecciosas e

  4. Razão de perdas de terra e fator C da cultura do cafeeiro em cinco espaçamentos, em Pindorama (SP Soil loss ratio and C factor for coffee plantations in five spacings in Pindorama, State of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Daniel Prochnow

    2005-02-01

    Full Text Available hídrica em culturas perenes, embora tais dados sejam imprescindíveis ao planejamento conservacionista e estudos de modelagem de erosão. Dados de um experimento de perdas de terra e água sob chuva natural em Pindorama (SP, de julho de 1960 a junho de 1972, foram usados para o cálculo da razão de perdas de terra (RPT e do fator C da equação universal de perdas de solo, em cinco espaçamentos na cultura do cafeeiro (Coffea arabica L.. Foram estabelecidas parcelas com espaçamentos de 3,0 x 0,5 m, 3,0 x 1,0 m, 3,0 x 2,0 m, 3,0 x 3,0 m e 4,0 x 2,0 m em um Argissolo Vermelho-Amarelo eutrófico textura arenosa/média com declividade média de 0,100 m m-1. O ciclo da cultura foi dividido em dois estádios: do plantio aos 60 meses e dos 60 aos 144 meses. Os resultados mostraram que: (a as perdas anuais de terra e água para a cultura do cafeeiro foram de 4 Mg ha-1 e 18 mm respectivamente; (b os valores de RPT para o cafeeiro foram de 0,1346, 0,0883, 0,1015, 0,1422 e 0,1001 Mg ha-1 Mg-1 ha, para os espaçamentos 3,0 x 0,5 m, 3,0 x 1,0 m, 3,0 x 2,0 m, 3,0 x 3,0 m e 4,0 x 2,0 m respectivamente; (c a magnitude do fator C, para os referidos espaçamentos, foi, respectivamente, de 0,1354, 0,0866, 0,0995, 0,1412 e 0,1004 Mg ha-1 Mg-1 ha; (d as RPTs e os fatores C variaram amplamente entre os espaçamentos, bem como e, mais expressivamente, entre os estádios da cultura, indicando forte efeito do espaçamento e da cobertura vegetal; (e o espaçamento 3,0 x 1,0 mostrou-se mais eficiente na redução da erosão hídrica na cultura do cafeeiro.Brazilian literature lacks data on soil and water loss by water erosion in perennial crops although such data would be essential for conservation planning and erosion modeling studies. Data of soil and water loss under natural rainfall (July 1960 to June 1972 in Pindorama, State of São Paulo, Brazil, were used to calculate the soil loss ratio (SLR and C factor for the Universal Soil Loss Equation (USLE in coffee

  5. Escala Razões para Fumar da Universidade de São Paulo: um novo instrumento para avaliar a motivação para fumar University of São Paulo Reasons for Smoking Scale: a new tool for the evaluation of smoking motivation

    Directory of Open Access Journals (Sweden)

    Elisa Sebba Tosta de Souza

    2010-12-01

    Full Text Available OBJETIVO: Desenvolver uma nova escala voltada para a avaliação da motivação para fumar, incorporando questões do 68-item Wisconsin Inventory of Smoking Dependence Motives (WISDM-68, Inventário Wisconsin dos Motivos de Dependência ao Fumo, de 68 itens na Modified Reasons for Smoking Scale (MRSS. Escala Razões para Fumar Modificada. MÉTODOS: Nove questões do WISDM-68 relativas à associação estreita, exposição a gatilhos/processos associativos e controle de peso foram incorporadas às 21 questões da MRSS. Um total de 311 fumantes (214 homens; idade média = 37,6 ± 10,8 anos; média de cigarros consumidos ao dia = 15,0 ± 9,2 responderam a nova escala, o Fagerström Test for Nicotine Dependence (FTND, Teste de Fagerström para Dependência de Nicotina e outras questões. Empregamos a análise fatorial exploratória para determinar a estrutura fatorial da escala. A influência de algumas características clínicas nos escores da solução fatorial final foi também avaliada. RESULTADOS: A análise fatorial revelou uma solução com 21 questões agrupadas em nove fatores: dependência, prazer de fumar, redução da tensão, estimulação, automatismo, manuseio, tabagismo social, controle de peso e associação estreita. Para a escala como um todo, o coeficiente alfa de Cronbach foi de 0,83. As mulheres exibiram maiores escores para dependência, redução da tensão, manuseio, controle de peso e associação estreita do que os homens. Os escores do FTND correlacionaram-se positivamente com dependência, redução da tensão, estimulação, automatismo, tabagismo social e associação estreita. O número de cigarros fumados ao dia se associou com dependência, redução da tensão, estimulação, automatismo, associação estreita e manuseio. Os níveis de CO exalado mostraram associações positivas com dependência, automatismo e associação estreita. CONCLUSÕES: A nova escala fornece um quadro aceitável dos fatores motivacionais

  6. Coincidence scanning with positron-emitting arsenic or copper in the diagnosis of focal intracranial disease; Exploration par coincidences avec l'Arsenic ou le Cuivre Emetteurs de Positrons dans le Diagnostic des Maladies intracraniennes localisees; Raspoznavanie ochagovykh vnutricherepnykh zabolevanij putem podscheta (skanirovaniya) sovpralenij s primeneniem mysh'yaka ili medi, vydelyayushchikh pozitrony; Exploracion por coincidencia con arsenico o cobre emisores de positrones en el diagnostico de enfermedades intracraneanas localizadas

    Energy Technology Data Exchange (ETDEWEB)

    Sweet, William H; Mealey, John Jr; Brownell, Gordon L; Aronow, Saul [Departments of Surgery and Medicine, Harvard Medical School, and Neurosurgical Service and Physics Research Laboratory of Massachusetts General Hospital, Boston, MA (United States)

    1959-07-01

    suficiente para proceder a la reseccion quirurgica, quizas sea esta la contribucion mas importante del metodo hasta la fecha. En cambio, los resultados con tumores subtentoriales fueron menos satisfactorios, pues se fracaso en 23 de 39 casos, es decir en el 59 por ciento. En el grupo de enfermedades benignas, el arsenico permitid localizar 7 de 8 hematomas subdurales, mientras que la exploracion mediante cobre no dio ningun resultado positivo en tres casos. En cuatro casos sobre cinco el empleo del arsenico permitio localizar coagulos intracerebrales diagnosticados. La totalidad de los 10 abscesos estudiados fue diagnosticada mediante el arsenico, y 3 de cada 4 mediante el cobre. En los tres pacientes que sufrian de leucoencefalopatia, la exploracion mediante arsenico indico las zonas principales de desmielinizacion. De 10 pacientes que hablan sido sometidos a un total de 16 exploraciones, y a los que posteriormente se efectuo una craneotomia exploratoria con resultado negative, no hubo mas que dos en los cuales la exploracion (mediante arsenico y cobre respectivamente) habia permitido diagnosticar una anormalidad localizada y bien definida. (author) [Russian] Nastoyashchij doklad posvyashchen podschetu metodom sovpadenij v chelovecheskom organizme parnykh annigilyatsonny kh gamma-luchej, vydelyaemykh pri pozitroniem raspade izotopov medi i mysh'yaka. V nem rassmatrivaets ya biologicheskoe pove denie neorganicheskoj soli mysh'yakovoj i mysh'yakovistoj kisloty ili mednogo versenata, a takzhe rezul'taty ispol'zovaniya veshchestv pri provedenii issledovanij s pomoshch'yu avtomaticheski rabotayushchej apparatury v tselyakh lokalizatsii vnutricherepnykh mass. Radioaktivnost' glavnykh normal'nykh golovnykh tkanej, a takzhe razlichnykh novoobrazovanij , krovyanykh opukholej (gematom), gnojnikov (abstsessov) i zon razrusheniya mielina byla analizirovana metodom biopsii. Pri primenenii mysh'yaka koehffitsient sootnosheniya mezhdu zakhvatom izotopa v mozgovoj opukholi i ego

  7. Tarihi Yeniden Kurma Kuramı: Kılıç Dede Bağlamında Kılıçlar Köyünün Kuruluşu ve Kılıç Dede’nin Efsanevi Kişiliği Historic Restoration Theory: In the Context of Establisment of Kılıçlar Villages and Legendary Personality of Kılıç Dede

    Directory of Open Access Journals (Sweden)

    Gülperi MEZKİT

    2013-03-01

    onlarla mukayese edildiğinde dahaaz tesirli olaylar sözlü tarihin hafızaya dayalı belleğinde muhafazaedilmiştir. Yerel tarih bilgisinin büyük çoğunluğu yazıyageçmemiş/geçememiş ve halkın hafızasına emanet edilmiştir. Bubağlamda, Ankara Çubuk ovasında vuku bulan Ankara Savaşı(1402sırasında Çubuk’a bağlı olan(daha sonra ayrılıp Kazan ilçesinebağlanan Çelençler Köyü’nde(daha sonra adı Kılıçlar olarakdeğiştirilmiştir yaşanan, Yıldırım Bayezid’in esir edilmesinin, halküzerinde yarattığı derin teessürün etkisiyle gölgelenen bir hadiseninyöre halkı tarafından sözlü hafızada saklanarak ve dilden dileaktarılarak korunmuş hikâyesi üzerinde durulacaktır. YıldırımBayezid’in ordusunda yer alan ve şehit düşen Kılıç Dede’nin köykuruculuğu ve etrafında gelişen anlatmaların köyün tarihini yenidenkurmasındaki rolü tartışılacaktır. Gerçekten yaşayan sıradan biraskerin kahramanı olduğu hadisenin ve bu hadise içinde şehitdüşmesinin köylü üzerinde yarattığı etkiler neticesinde efsaneleşmesi,kişiliği etrafında oluşan anlatmalarla bir köyün tarihinin yeniden nasılinşa edildiği mütalaa edilecektir.

  8. Maternal ve fetal MBL2 genotiplerinin preterm doğumlarla ilişkisi

    OpenAIRE

    Taneri, Ayşe

    2009-01-01

    Yenidoğan döneminde, immün sistemin tam olarak gelismemesine bağlı karsılasılan komplikasyonlara ek olarak, yenidoğanın “prematüre” olması prenatal mortalite ve morbidite hızını arttıran baslıca faktördür. Görülme sıklığının %9 olması nedeni ile, günümüz perinatal tıbbının çözmeye çalıstığı ve çevresel, tıbbi ve kalıtsal faktörlerin rol oynadığı çoklu değisimlere bağlı bir yenidoğan sorunudur. Patogenezi aydınlatmaya yönelik yapılan çalısmalarda inflamasyonun gestasyonel sür...

  9. Vizantiiskoje zerkalo. Novõi rossiiski agitprop ili otsherednaja strashilka? / Pavel Kuzenkov ; interv. Sergei Bõtshkov

    Index Scriptorium Estoniae

    Kuzenkov, Pavel

    2008-01-01

    Isa Tihhoni autorlusena valminud Venemaa dokumentaalfilm "Impeeriumi hukk. Bütsantsi õppetunnid" ("Gibel imperii. Uroki Vizantii"). Filmi ideestikust, mis suunatud tänase Venemaa suunas, räägib filmi teaduslik konsultant

  10. Industrija 4.0 - sadašnjost ili budućnost u Hrvatskoj

    OpenAIRE

    Matejak, Nedeljko

    2017-01-01

    Tehnološki razvoj generator je dinamičnih promjena gotovo u svim područjima koje dotiče. Jedno od područja koje prolazi kroz intenzivnu tranziciju je industrijska proizvodnja. U prilog tome govori transformacija iz treće industrijske revolucije u četvrtu, dok zapravo dio globalne ekonomije nije napravio potpunu transformaciju u treću industrijsku revoluciju. Pojam Industrija 4.0 opisuje što se nalazi na putu transformacije postojeće industrijske proizvodnje u novu, primarn...

  11. Planeta Zemlja - matritsa ili nash metafizitsheski dom? / Peeter Liiv ; tõlk. Marina Tervonen

    Index Scriptorium Estoniae

    Liiv, Peeter, 1953-

    2005-01-01

    Metafüüsika nõrkusest Eesti kultuuris. Kannatuse ja rõõmu religioonidest, valgustumisest, "Brahma ööst" ja "Brahma päevast", miks ja kuidas on Jumal maailma loonud. Osho, Ken Wilberi, Maharishi Mahesh Yogi jt. mõtteid

  12. Za vsjo horosheje - finansovaja udavka ili Aleksandr Kaljagin protiv Marinõ Dmitrijevskoi / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2007-01-01

    Vastasseisust Venemaa Teatritegelaste Liidu esimehe Aleksandr Kaljagini ja Peterburi teatriajakirja "Peterburgski teatralnõi zhurnal" peatoimetaja Marina Dmitrijevskaja vahel. Aleksandr Kaljagin ähvardab lõpetada ajakirja finantseerimise

  13. Kak eto nam poljubitsa, ili Ljubov i nenavist Timofeja Sopoleva / Timofei Sopoljov ; interv. Boris Tuch

    Index Scriptorium Estoniae

    Sopoljov, Timofei

    2006-01-01

    William Shakespeare'i "Kuidas teile meeldib", lavastaja Timofei Sopoljov, muusika autor helilooja Aleksei Shelõgin. Lavastaja meenutab ka oma teatriõpinguid lavastaja ja teatripedagoogi Andrei Gontsharovi käe all

  14. Žalovanje ili melankolija?: psihoanaliza i ekonomski problem Derridina marksizma

    OpenAIRE

    Jukić, Tatjana

    2011-01-01

    Autorica predlaže kritičko čitanje studije Sablasti Marxa: stanje duga, rad žalovanja i nova Internacionala Jacquesa Derride s pozicije s koje Derridino dovođenje u vezu žalovanja i Marxove političke ekonomije evidentno računa na spregu žalovanja i ekonomije kod Freuda, posebno u “Trauer und Melancholie”. Kod Freuda se žalovanje i ekonomija sprežu tek nakon što se žalovanje stavi u relaciju prema melankoliji, pri čemu melankolija dovodi u pitanje upravo ono što psihoanaliza ...

  15. Zametjat li v Pekine estonskii flag ili jego otsutstvije? / Viktoria Savtshuk, Susanna Berezina

    Index Scriptorium Estoniae

    Savtshuk, Viktoria

    2008-01-01

    Euroopa Liidu infokeskuses toimunud debatist, kus teemaks oli Pekingi olümpiamängude võimalik boikoteerimine seoses hiljutiste sündmustega Tiibetis. Debatis osalesid Riigikogu Tiibeti toetusrühma liige Silver Meikar ja parlamendiliige ning Eesti Olümpiakomitee asepresident Jüri Tamm

  16. Kventin Tarantino + Robert Rodriges = Grainhaus, ili Kinonostalgija po-amerikanski / Andrei Sozinov

    Index Scriptorium Estoniae

    Sozinov, Andrei

    2007-01-01

    Filmiprojekt "Grindhouse" koosneb Robert Rodrigueze retroõudukast "Grindhouse : Õuduste planeet" ("Planet Terror") ja Quentin Tarantino 70-ndatest inspireeritud õudusfilmist "Surmakindel" ("Death Proof") : Ameerika Ühendriigid 2007

  17. Pipeline mapping and strain assessment using ILI (In-line Inspection) tolls

    Energy Technology Data Exchange (ETDEWEB)

    Purvis, Brian [GE PII Pipeline Solutions, Rio de Janeiro, RJ (Brazil); Huewener, Thomas [E.ON Ruhrgas AG, Essen (Germany)

    2009-07-01

    GE PII IMU Mapping inspection system measures pipeline location coordinates (x, y, z) and provides data for determining pipeline curvature and consequential pipeline bending strain. The changes in strain can be used in the application of structural analyses and integrity evaluation of pipeline systems. This paper reviews the Inertia Measuring Unit (IMU) system and field investigation works performed on a high-pressure gas pipeline for E.ON Ruhrgas AG. The Inertial Measuring Unit of the pipeline inspection tool provides continuous measurement of the pipeline centreline coordinates. More than one inspection run was performed which allowed a more accurate strain comparison to be made. Repeatability is important to establish the reasons for increasing strain values detected at specific pipeline sections through in-line inspection surveys conducted in regular intervals over many years. Moreover, the flexibility resulting from a combination of different sensor technologies, makes it possible to provide a more complete picture of the overall situation. This paper reviews the work involved in detecting, locating and determining the magnitude and type of strain corresponding to the pipeline movement in field. (author)

  18. Negociace čili vyjednávání

    Czech Academy of Sciences Publication Activity Database

    Krausová, Alena

    2001-01-01

    Roč. 38, č. 4 (2001), s. 45-51 ISSN 1212-5326. [Jazyk jako fenomén na přelomu tisíciletí. Setkání mladých jazykovědců /2./. Olomouc, 15.05.2001-16.05.2001] R&D Projects: GA MŠk LN00A023 Institutional research plan: CEZ:AV0Z9061902 Keywords : pragmatics * semantics * neology Subject RIV: AI - Linguistics

  19. Takova zhizn, ili nash tshelovek v Pompidu / Ene Rämmeld ; interv. Boris Tuch

    Index Scriptorium Estoniae

    Rämmeld, Ene, 1947-

    2004-01-01

    Pariisis elav näitlejanna esitles oma autobiograafilist raamatut "C'est la vie. Elu on selline", milles juttu kolmest kunstnikust : L. Laiusest, E. Hermakülast ja V.G. Karassev-Orgussaarest - kuidas nad kõik mõjutasid näitlejanna arengut. Ka oma elust ja elufilosoofiast praegu

  20. Letnii otpusk Barrossu, ili Uravnenije s 25 neizvestnõmi / Marko Saaret

    Index Scriptorium Estoniae

    Saaret, Marko

    2004-01-01

    Euroopa Komisjoni juht Jose Manuel Durao Barroso seisab raske valiku ees - kuidas jagada 25 portfelli 25 esitatud kandidaadi vahel. Liikmesriikide poolt Euroopa Komisjoni voliniku kohale esitatud kandidaadid

  1. Uroki mastera, ili Fantazii na temõ Andersena / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2007-01-01

    Eldar Rjazanovi eluloofilm muinasjutuvestja Hans Christian Anderseni elust "Andersen. Elu ilma armastuseta" ("Andersen. Zhizn bez ljubvi"): stsenarist Irakli Kvirikadze : nimiosas Vanja Haratjan, Stanislav Rjadinski, Sergei Migitsko : Venemaa, 2006

  2. 3D molecular cartography using LC-MS facilitated by Optimus and 'ili software.

    Science.gov (United States)

    Protsyuk, Ivan; Melnik, Alexey V; Nothias, Louis-Felix; Rappez, Luca; Phapale, Prasad; Aksenov, Alexander A; Bouslimani, Amina; Ryazanov, Sergey; Dorrestein, Pieter C; Alexandrov, Theodore

    2018-01-01

    Our skin, our belongings, the world surrounding us, and the environment we live in are covered with molecular traces. Detecting and characterizing these molecular traces is necessary to understand the environmental impact on human health and disease, and to decipher complex molecular interactions between humans and other species, particularly microbiota. We recently introduced 3D molecular cartography for mapping small organic molecules (including metabolites, lipids, and environmental molecules) found on various surfaces, including the human body. Here, we provide a protocol and open-source software for 3D molecular cartography. The protocol includes step-by-step procedures for sample collection and processing, liquid chromatography-mass spectrometry (LC-MS)-based metabolomics, quality control (QC), molecular identification using MS/MS, data processing, and visualization with 3D models of the sampled environment. The LC-MS method was optimized for a broad range of small organic molecules. We enable scientists to reproduce our previously obtained results, and illustrate the broad utility of our approach with molecular maps of a rosemary plant and an ATM keypad after a PIN code was entered. To promote reproducibility, we introduce cartographical snapshots: files that describe a particular map and visualization settings, and that can be shared and loaded to reproduce the visualization. The protocol enables molecular cartography to be performed in any mass spectrometry laboratory and, in principle, for any spatially mapped data. We anticipate applications, in particular, in medicine, ecology, agriculture, biotechnology, and forensics. The protocol takes 78 h for a molecular map of 100 spots, excluding the reagent setup.

  3. A vinculação dos conhecimentos: entre a razão mediada e a razão leve

    Directory of Open Access Journals (Sweden)

    Maria Nelida Gonzalez de Gómez

    2006-10-01

    Full Text Available Durante séculos, existiam poucas dúvidas acerca da validade e da qualidade dos princípios que colocavam juntos conhecimentos, textos, documentos, conteúdos disciplinares e suas respectivas literaturas. No século XX, não se poderia manter esse otimismo, confrontado com a pluralidade e a diversificação das especialidades, assim como a fragilização das fronteiras entre as ciências e as não-ciências e entre disciplinas. A questão, agora, seria acerca da extensão e da qualidade dessas mudanças e do entendimento de seu significado na esfera social. Palavras-chave: Conhecimento, informação, vinculações.

  4. Radiation-pulse transmission via a long cable without a preamplifier and/or a pulse transformer; Transmission d'impulsions de rayonnement par cable long sans l'adjonction d'un preamplificateur ou d'un transformateur d'impulsions; Peredacha impul'snykh izluchenij no kabelyu na dal'nie rasstoyaniya bez predvaritel'nogo usileniya i/ili bez preobrazovaniya impul'sov; Transmision de impulsos por cables de gran longitud sin preamplificador y/o transformador de impulsos

    Energy Technology Data Exchange (ETDEWEB)

    Miwa, H; Tohyama, T [Kobe Kogyo Corporation, Okubo, Akashi, Hyogo (Japan)

    1962-04-15

    kompleksnoe soprotivlenie usilitelya No. 2 budet sootvetstvovat' kharakteristike kabelya pri pomoshchi vklyuchennogo kompleksnogo i menyayushchegosya soprotivleniya. Takim obrazom, ustrojstvo vida No. 2 bylo v shirokoj mere prisposobleno k nashemu yadernomu pribornomu oborudovaniyu, kak naprimer k nejtronnomu izmeritelyu vlazhnosti pochvy (schetchik BF{sub 3}) analizatoru sostava pochvy (stsintillyatsionnyj spektrometr), tolshchinomeru snega (schetchik Gejgera-Myullera) i distantsionnym kontrol'nym dozimetricheskim priboram. Otsutstvie predvaritel'nykh usilitelej i preobrazovatelej impul'sov delaet vozmozhnym primenenie ehtikh detektorov na mestnosti v osobykh usloviyakh, kak naprimer, pri vysokikh ili nizkikh temperaturakh, bystrom potoke nejtronov (gamma-izluchenij) i t.d. Nalichie tol'ko odnogo koaksial'nogo kabelya uproshchaet rabotu detektorov na dal'nem rasstoyanii. Peredacha impul'sov po kabelyu na dal'nie rasstoyaniya svyshe 500 metrov ne povliyala na stsintillyatsionnuyu spektroskopiyu gamma-izluchenij. (author)

  5. Possible influences of pacific decadal oscillation in the ten day based radio between actual and potential evapotranspiration in the region of Campinas, São Paulo State, Brazil Possível influência da oscilação decadal do pacífico na razão decendial entre a evapotranspiração real e potencial na região de Campinas (SP, Brasil

    Directory of Open Access Journals (Sweden)

    Gabriel Constantino Blain

    2009-09-01

    Full Text Available Considering the importance of the ratio between the actual and potential evapotranspiration (AE/PE for agricultural purposes, the present study estimated the 10-day based AE/PE, aiming to evaluate possible influences of the Pacific Decadal Oscillation (PDO, on temporal variability series, in the region of Campinas, São Paulo State, Brazil. The shapes of the beta probability density function of the AE/PE series for four periods (two in the cold PDO phase and two in the warm PDO phase do not show differences between the PDO phases. In this sense, the use of "average periods" to obtain a standard climatology for agrometeorological purposes (such as the climate normal of the 1961-1990 period, which encompasses sixteen years of the cold PDO phase and fourteen years of the warm PDO phase should not result in significant errors in the region of Campinas, SP. However, considering academic/scientific purposes, the analyses of the autocorrelation functions of the residual AE/PE series for the four periods show differences in the persistence between the two phases of the PDO.Tendo em vista a importância agrícola da razão entre a evapotranspiração real e potencial (ETR/ETP, estimou-se esta relação (em escala decendial, a fim de verificar possíveis influências da Oscilação Decadal do Pacífico (PDO sobre a variabilidade temporal desse parâmetro agrometeorológico na região de Campinas, Estado de São Paulo, Brasil. Pelas formas da função de densidade de probabilidade Beta das séries de ETR/ETP para quatro períodos (dois na fase fria, e dois na fase quente não se observam diferenças significativas (influência entre as fases da PDO. Nesse aspecto, sob o ponto de vista agrometeorológico, o uso de um determinado "período médio" (tal como a normal climatológica de 1961-1990, que compreende dezesseis anos da fase fria e catorze da fase quente, para caracterização de séries temporais de ETR/ETP, não deve resultar em grandes erros. No

  6. EPISTEMOLOGIA AMBIENTAL: A crise ambiental como uma crise da razão

    Directory of Open Access Journals (Sweden)

    Matheus Silva De Gregori

    2013-04-01

    Full Text Available O presente estudo tem como objetivo analisar a crise do meio ambiente sob uma abordagem epistemológica, ou seja, a partir do conhecimento produzido em relação à natureza. Verifica-se que o pensamento ocidental, manifestado pelos paradigmas da Ciência Moderna, está ligado à organização dos sistemas econômicos que reconheceram historicamente a natureza apenas como recurso e potencial de produção de capital, vindo a encontrar, por esta via, o limite entrópico da biosfera e, por conseguinte, do crescimento. Abordou-se o processo de construção do conhecimento, questionando-se a possibilidade de concepção de outras perspectivas, fundadas na inseparabilidade entre sujeito-objeto, ação-pensamento e homem-natureza. É percebida a necessidade do ser humano de se re-significar no mundo, conhecendo a complexidade da natureza e pensando além da crise ecológica.

  7. Una experiencia de la sin razón/An experience on the unreason

    Directory of Open Access Journals (Sweden)

    Mauro Marchese

    2010-03-01

    Full Text Available En este trabajo pongo en consideración si corresponde o no afirmar que el psicoanálisis nació como empresa de medicalización del cuerpo sexual y por ello participa de una filiación disciplinaria. Para esto tomo en cuenta algunas reflexiones de Frédéric Gros acerca del concepto de sexualidad en la obra de Foucault, ciertos pasajes de Historia de la locura en la época clásica, El poder psiquiátrico y Entre filosofía y literatura, para confrontarlos con otras consideraciones que hiciera J. Derrida sobre el lugar y el rol del psicoanálisis en el proyecto foucaultiano de una historia de la locura. In this work I consider the question whether corresponds to affirm that Psychoanalysis was born as an enterprise with the purpose of medicalising the sexual body, and thus it is part of a discipline. For this analysis I take into account some of the thoughts by Frédéric Gros about the concept of sexuality in the work of Foucault, some fragments of History of Madness, Psychiatric Power and Dits et écrits, to confront them with other considerations by J. Derrida about the place and role of the Psychoanalysis on Foucault´s project for a history of madness.

  8. La racionalidad del sentimiento, el sentimiento de la razón

    Directory of Open Access Journals (Sweden)

    Acanda González, Jorge Luis

    2008-12-01

    Full Text Available Unlike other universal languages, Spanish has been subpected to a permanent perfomance of concepts wich has led to the specificity that the work of self-consciousness, moment of every tought, has acquired in thinking produced in this language, in America and in Spain both in the everyday conciousness as in the philosophical thinking, thinking the essence has involved a sense of trascendence that has always needed sense of history and memory of the struggles. Hence the unity of philosophy, poetry and history in our tradition.A diferencia de otros idiomas universales, el español ha estado sometido a una labor de resemantización de los conceptos, lo cual ha conducido a la especificidad que la labor de autoconciencia, momento de todo pensamiento, ha adquirido en el pensamiento producido en este idioma, tanto en América como en España. Tanto en la conciencia cotidiana como en el pensar filosófico, pensar la esencia ha implicado un sentido de la trascendencia que ha necesitado siempre sentido de la historia y memoria de las luchas. De ahí la unidad de filosofía, poesía e historia en nuestra tradición.

  9. La racionalidad del sentimiento, el sentimiento de la razón

    OpenAIRE

    Acanda González, Jorge Luis

    2008-01-01

    Unlike other universal languages, Spanish has been subpected to a permanent perfomance of concepts wich has led to the specificity that the work of self-consciousness, moment of every tought, has acquired in thinking produced in this language, in America and in Spain both in the everyday conciousness as in the philosophical thinking, thinking the essence has involved a sense of trascendence that has always needed sense of history and memory of the struggles. Hence the unity of philosophy, poe...

  10. Reglas claras o presunciones: el derecho de reserva a razón de la franquicia

    OpenAIRE

    Cornejo Sota, Lourdes Pamela

    2015-01-01

    Cuando uno habla de franquicia se viene a la mente negocios con reconocido nombre, ya sea a nivel nacional como internacional, y es así que muchos se sienten atraídos por incursionar en este mundo y obtener un contrato de franquicia que tenga prestigio para poder operarlo de igual manera. Si bien las franquicias han sido utilizadas a nivel internacional desde hace mucho tiempo atrás, las franquicias nacionales datan recién desde el año 1992, las cuales tienden a crecer dados...

  11. As diferentes faces da razão (II. Risco, ciência e peritos

    Directory of Open Access Journals (Sweden)

    C. M. Novais Madureira

    2012-10-01

    Full Text Available Em texto anterior argumentou-se contra os excessos do cientismo com que, na linha de Sokal e Bricmont, António Manuel Baptista ataca as análises sociológicas dos processos e produtos da ciência, nomeadamente as posições de Boaventura de Sousa Santos. Neste outro texto, pretende-se contestar AMB e os sokalistas no seu próprio campo, o da ciência pura e dura, mostrando que eles próprios não compreendem o estatuto das suas ciências, e tentando ponderar afirmações menos precisas, frequentes na análise da sociogénese da ciência. Trazendo a discussão para o nosso tempo, abordaremos também uma problemática não tratada no texto anterior, a do estatuto dos cientistas e tecnólogos enquanto peritos nas instâncias de decisão. Por último, tratará de analisar-se como as controvérsias entre peritos, hoje tão frequentes, são vividas no seio da comunidade científica e qual a evolução que geram na própria prática pericial.

  12. La idea de una razón pública

    Directory of Open Access Journals (Sweden)

    Rawls, John

    1994-04-01

    Full Text Available Not available.

    El presente artículo asume que la pluralidad de razonables doctrinas religiosas, filosóficas y morales propias de las sociedades democráticas es un rasgo permanente de la cultura pública y no una mera condición histórica que pasará pronto. Supuesto esto, se pregunta: ¿cuándo pueden los ciudadanos, por su voto, ejercer propiamente su poder político coercitivo unos respecto de otros cuando las cuestiones fundamentales están en juego? A esta cuestión responde el liberalismo político así: nuestro ejercicio del poder político es propia y consiguientemente justificable sólo si se realiza de acuerdo con una constitución, la aceptación de cuyas esencias pueda razonablemente presumirse de todos los ciudadanos a la luz de principios e ideales admisibles por ellos como razonables y racionales. Este es el principio liberal de legitimidad.

  13. Zarplatõ tshinovnikov mogut razlitshatsja v neskolko raz / Kaire Uusen

    Index Scriptorium Estoniae

    Uusen, Kaire

    2008-01-01

    Vahed ametnike palkades on erinevatel põhjustel, vaatamata säästuajale, üha suuremaks paisunud. Vt. samas: Kantslerite palk; Ministeeriumiametnike astmepalgad kuus (kroonides); Keskmine palk (kroonides); Vt. samas intervjuud Siim Suklesega

  14. "Esta cosita que hablamos nosotros" ou as razões por que um poeta traduz

    Directory of Open Access Journals (Sweden)

    Daniel Samoilovich

    2013-06-01

    Full Text Available Traducir es, entre otras cosas, un hecho político. Cuando, hacia 1850, Sarmiento quiere explicar en un salón madrileño que no piensa que la cultura de los nuevos países de América sea dependiente de la de España, lo primero que dice es: “Traducimos nosotros mismos. No los necesitamos a ustedes para traducir”. Con lo cual está mostrando que traducir en América es un punto fuerte en la construcción de la independencia. Esto no implica que sea necesario traducir hiperlocalmente. Pero traducir en América, y defender nuestras traducciones, pensando cuidadosamente el universo léxico y las formas verbales, tiene que ver con defender un cierto nivel de autonomía y de color de nuestra lengua en el concierto del español. Además de este aspecto político, traducir poesía es para un poeta un ámbito de aprendizaje técnico y un espacio para la definición de su propia poética. Estos aspectos son los que se desarrollarán en la ponencia, apoyándose en la experiencia del ponente como traductor del inglés (Shakespeare, Enrique IV, partes I y II, latín (Horacio, Odas, Libro III e italiano (Carlo Emilio Gadda, Il libro primo delle favole.

  15. La Flota, razón de ser de la Armada

    Directory of Open Access Journals (Sweden)

    Balbás Otal, José Antonio

    2002-10-01

    Full Text Available Not available

    El título de este artículo expresa con suficiente claridad el alcance de su contenido. La Flota es la expresión material del poder naval con que cuenta la Armada. Sus dotaciones, buques de superficie, submarinos, aeronaves, medios de guerra de minas, fuerzas de Infantería de Marina, centros de adiestramiento e instalaciones navales en tierra, constituyen el núcleo fundamental de la Fuerza Naval. A lo largo de su exposición, el Almirante de la Flota nos describe detalladamente la organización, composición y cometidos de las diferentes unidades, agrupaciones y dependencias que están bajo sus órdenes, poniendo especial énfasis en sus capacidades, estructura operativa y participación en ejercicios y operaciones de carácter nacional e internacional. Asimismo, hace referencia a la contribución a la OTAN y a otras fuerzas multinacionales, y a la participación más reciente de unidades de la Flota en operaciones reales. El artículo es una excelente síntesis para quien desee conocer cómo es y qué hace la Flota, cuál es su futuro en cuanto a incorporación de nuevas unidades, y qué procesos de reestructuración se están llevando a cabo, incluida la reciente creación de un Cuartel General Marítimo de Alta Disponibilidad, dentro de la estructura de fuerzas de la OTAN.

  16. Notas sobre a forma e a razão dos conflitos no mercado de consumo

    OpenAIRE

    Bevilaqua, Ciméa

    2001-01-01

    Explorando a perspectiva proposta por Marcel Mauss, este artigo apresenta algumas reflexões sobre a coexistência entre as lógicas do dom e do mercado na sociedade brasileira, tomando por base uma pesquisa etnográfica realizada em Curitiba (PR) sobre conflitos decorrentes de relações de consumo. A etnografia indica que a premissa da equivalência entre os parceiros - que evoca a economia do dom, na qual as trocas vinculam sujeitos enquanto sujeitos por meio de objetos - não é, de modo algum, um...

  17. Razón de un Homenaje Profesor Dr. Gonzalo Esguerra Gómez

    Directory of Open Access Journals (Sweden)

    Mario Camacho Pinto

    1993-04-01

    Full Text Available

    La voluntad unánime y espontánea de la Academia Nacional de Medicina, su Junta Directiva y en especial la Comisión Permanente de Biblioteca y Publicaciones convirtió en grata realidad la idea de consagrar con una edición especial de “MEDICINA” la gallarda existencia de su benemérito ex presidente e ilustre académico quien enalteciera la Institución nacional creada y destinada por la Ley para velar por la salud y la educación médica del pueblo colombiano, así como para fomentar el desarrollo de las ciencias médicas y su práctica ética, lo que en síntesis constituyó el paradigma vital en la obra realizada por Gonzalo Esguerra Gómez.

    Llegó con su bonhomía y estructura profesional sólida a la más altas posiciones de calificado médico, al sitial cimero de hombre de ciencia, de cultor y pionero de la radiología en Colombia, cuyo estelar prestigio rebasó las fronteras patrias.

    En efecto, es admirable y ejemplarizante comprobar que su vocación heredada y su consagración adquirida le permitieron dedicarse precozmente al estudio y cultivo de las ciencias médicas, podría decirse que biológicamente dotado para esta misión, porque aparte de su ambiente privilegiadamente favorable, por su estirpe y tradición médica de alcurnia, tuvo cualidades sobresalientes de inteligencia investigativa, porte señorial y sensibilidad social que le dieron calidad de varón ilustre, exponente genuino de hidalgo santafereño que pudo aunar y manifestar sus excelsas virtudes, noble personalidad de ciudadano ejemplar por su reciedumbre moral e intachable rectitud, aptitud para la cultura universal y el ejercicio cívico que al mismo tiempo traducía en espontáneo fervor por la capacitación científico-docente en alto grado hasta llegar a constituirse en modelo de profesional médico, digno de imitación...

  18. Espiritualidad, razón y discordias: el budismo ahora y aquí

    OpenAIRE

    Arroyo Moliner, Liliana

    2013-01-01

    Esta tesis trata sobre el trasplante del Budismo a España desde la óptica de los agentes adaptadores o los otros significantes. El estudio de la religión es un tema clásico en la Sociología desde sus comienzos y, durante décadas, se ha concebido como un pilar autónomo y relativamente separado de otras esferas sociales. El presente estudio parte de una perspectiva sociológica amplia, donde la religión no es una cuestión separable del resto de la sociedad. Especialmente en las últimas décadas l...

  19. Razón de un Homenaje Profesor Dr. Gonzalo Esguerra Gómez

    OpenAIRE

    Mario Camacho Pinto

    1993-01-01

    La voluntad unánime y espontánea de la Academia Nacional de Medicina, su Junta Directiva y en especial la Comisión Permanente de Biblioteca y Publicaciones convirtió en grata realidad la idea de consagrar con una edición especial de “MEDICINA” la gallarda existencia de su benemérito ex presidente e ilustre académico quien enalteciera la Institución nacional creada y destinada por la Ley para velar por la salud y la educación médica del pueblo colombiano, así como para fomentar el des...

  20. Para uma Crítica da Razão Psicométrica

    Directory of Open Access Journals (Sweden)

    Patto Maria Helena Souza

    1997-01-01

    Full Text Available A partir da presença de testes e de laudos psicológicos na escola pública de 1º grau, o artigo discute, no marco teórico do materialismo histórico, aspectos epistemológicos e políticos do psicodiagnóstico.

  1. Razón y democracia: La potencial renovación del concepto de aristocracia

    Directory of Open Access Journals (Sweden)

    Pedro José Izquierdo

    2012-12-01

    Full Text Available Existe una relación entre diferentes clases de discusión y losroles que ésta juega en las instituciones del gobierno representativo. Esposible distinguir tres tipos de discusión, que caen en una escaladecreciente según su afinidad con estándares racionales de toma dedecisiones. El argumento es que mientras más se ajuste una discusión aestándares racionales, menos democrática será. Esta tensión entredemocracia y discusión racional es en realidad la tensión entredemocracia y aristocracia, y sugiere un camino para reintroducir laaristocracia como concepto significativo hoy. Sólo admitiendo lanaturaleza aristocrática de la discusión racional es posible preservar elcarácter democrático de una institución.

  2. Razširitev metode kalkuliranja stroškov na podlagi sestavin dejavnosti

    OpenAIRE

    Bole, Borut

    2017-01-01

    Zaradi uveljavitve proizvodnje vedno številčnejših serij se v organizacijah pojavlja več posrednih stroškov, katerih upravljanje je zahtevnejše od neposrednih. Kot rešitev tega so se pojavile primernejše metode za celotno obvladovanje organizacije, ki vključujejo tudi metode za natančnejše kalkuliranje posrednih stroškov. Skupaj s tem se je razvila ideja o managementu organizacije, ki temelji na sestavinah dejavnosti in z njo združljiva ideja o kalkuliranju stroškov na podlagi sestavin dejavn...

  3. "Oceživat' komara" ili "proglatyvat' verbljada"?  Biblejskie frazeologizmy v russkom i datskom jazykach

    DEFF Research Database (Denmark)

    Steen, Oxana

    2007-01-01

    I artiklen præsenteres en model for en kontrastiv analyse af fraseologiske udtryk i to forskellige sprog (russisk og dansk). Modellen indeholder 8 niveauer og starter med niveau 0 (fuldstændig isomorfi; fuldstændig ækvivalens) og slutter med niveau 7 (ækvivalentsløse idiomer). De mellemste niveauer...... udgør russiske og danske idiomer, som udviser forskellige grader afvigelser af strukturel og/eller semantisk karakter....

  4. Biti ili ne biti žena? Percepcija visokoobrazovanih žena o rodnoj jednakosti na radnom mjestu

    OpenAIRE

    Pološki Vokić, Nina; Sinčić Ćorić, Dubravka; Obadić, Alka

    2017-01-01

    Polazišna točka rada je da visokoobrazovane žene trpe manje nejednakosti na radnom mjestu. Kako bismo to testirali, provedena su primarna i sekundarna istraživanja. Sekundarni podatci odnose se na područje obrazovanja, sudjelovanje u aktivnostima koje se temelje na znanju, statusu u hijerarhiji i razlici u plaćama visokoobrazovanih žena u odnosu na plaće muškaraca u odabranim europskim zemljama, dok primarni podatci prikazuju percepcije visokoobrazovanih žena o kontekstualnim čimbenicima koji...

  5. Leadership as social identity management: Introducing the Identity Leadership Inventory (ILI) to assess and validate a four-dimensional model

    OpenAIRE

    Steffens, Niklas K.; Haslam, S. Alexander; Reicher, Stephen D.; Platow, Michael J.; Fransen, Katrien; Yang, Jie; Ryan, Michelle K.; Jetten, Jolanda; Peters, Kim O.; Boen, Filip

    2014-01-01

    Although nearly two decades of research has provided support for the social identity approach to leadership, most previous work has focused on leaders’ identity prototypicality while neglecting the assessment of other equally important dimensions of social identity management. However, recent theoretical developments have argued that in order to mobilize and direct followers’ energies, leaders need not only to ‘be one of us’ (identity prototypicality), but also to ‘do it for us’ (identity adv...

  6. Influenza in outpatient ILI case-patients in national hospital-based surveillance, Bangladesh, 2007-2008.

    Directory of Open Access Journals (Sweden)

    Rashid Uz Zaman

    2009-12-01

    Full Text Available Recent population-based estimates in a Dhaka low-income community suggest that influenza was prevalent among children. To explore the epidemiology and seasonality of influenza throughout the country and among all age groups, we established nationally representative hospital-based surveillance necessary to guide influenza prevention and control efforts.We conducted influenza-like illness and severe acute respiratory illness sentinel surveillance in 12 hospitals across Bangladesh during May 2007-December 2008. We collected specimens from 3,699 patients, 385 (10% which were influenza positive by real time RT-PCR. Among the sample-positive patients, 192 (51% were type A and 188 (49% were type B. Hemagglutinin subtyping of type A viruses detected 137 (71% A/H1 and 55 (29% A/H3, but no A/H5 or other novel influenza strains. The frequency of influenza cases was highest among children aged under 5 years (44%, while the proportions of laboratory confirmed cases was highest among participants aged 11-15 (18%. We applied kriging, a geo-statistical technique, to explore the spatial and temporal spread of influenza and found that, during 2008, influenza was first identified in large port cities and then gradually spread to other parts of the country. We identified a distinct influenza peak during the rainy season (May-September.Our surveillance data confirms that influenza is prevalent throughout Bangladesh, affecting a wide range of ages and causing considerable morbidity and hospital care. A unimodal influenza seasonality may allow Bangladesh to time annual influenza prevention messages and vaccination campaigns to reduce the national influenza burden. To scale-up such national interventions, we need to quantify the national rates of influenza and the economic burden associated with this disease through further studies.

  7. Türkiye’de Enflasyon nisbi Fiyat Değişkenliği ilişkisi

    OpenAIRE

    YAMAK, Prof. Dr. Nebiye; TANRIÖVER, Arş. Gör. Banu

    2013-01-01

    In the literature of economics the hypothesis which implies the positive relationship between inflation rate and relative price variability is called the variability hypothesis The purpose of this study is to investigate the validity of the variability hypothesis separately for each one of the expenditure groups and cities in Turkey Relative price variability for each of the expenditure groups and cities is constructed by using the consumer price index of ten expenditure groups in nineteen...

  8. Delo o 15 millionah dollarov, ili Istorija s kontrabandoi, krazhami, obmanom i podozrenijem v ubiistve / Tatjana Jurassova

    Index Scriptorium Estoniae

    Jurassova, Tatjana

    1998-01-01

    Nikolai Hardzhijevi (1903-1996) arhiivi saatusest. Arhiivi kunsti-osa moodustasid Malevitshi, Larionovi, Tatlini, Gontsharovi, Lissitski jt. (1355 eks.) tööd. N. Hardzhijev oli teadlane, vene avangardi (kunstnikud, poeedid) parim tundja

  9. OBRTNIČKE ILI UMJETNIČKE DEKORACIJE ANTIČKIH JAVNIH SPOMENIKA GRADA PULE? SLAVOLUK SERGIJEVACA

    OpenAIRE

    DŽIN, Kristina

    2010-01-01

    U izboru antičkih javnih spomenika Pule (Colonia Iulia Pola) iz carskog Augustovog vremena, posebna pozornost se u članku daje slavoluku obitelji Sergijevaca, jednom od najljepših djela antičkog kamenoklesarstva i dometa dekorativnih elemenata izrađenih izuzetnim obrtničkim umijećem pod utjecajem helenističke umjetnosti.

  10. Relationships between vertical and horizontal individualism/collectivism self construal’s and autonomous, relatedness, autonomous-related self at university studentÜniversite öğrencilerinde benlik kurguları, yatay ve dikey bireycilik/toplulukçuluk ile ilişkisel, özerk, özerk-ilişkisel benlik arasındaki ilişkiler

    OpenAIRE

    Uçar, Mehmet Ertuğrul

    2017-01-01

    Most of the relevant research and conceptualization has occurred within individualism-collectivism. Kagitcibasi suggests that self can be defined as autonomous, relatedness, and autonomous-related self in Turkish cultural contexts. Triandis make the distinction between vertical and horizontal individualism/collectivism.  Vertical collectivism includes perceiving the self as a part of a collective and accepting inequality. Horizontal collectivism includes perceiving the self as a part of the c...

  11. Uletajet poslednjaja staja : [luuletused] / Mihhail Jasnov

    Index Scriptorium Estoniae

    Jasnov, Mihhail

    2002-01-01

    Sisu: "V zeljonom tumane rastajav..." ; "Poka jeshtsho zhizn ne sgustilas do tutshi..." ; "Vospominaju o davnei minute..." "Ja gljadel na tebja poutru..." ; "Proshloje na to i mjagtshe voska..." ; "Ottogo, tshto ne derzhal zastoli..." ; "Vovsju svistjat - a vse v snegu, vse golo..." ; "Zhizn predpologajet odinotshestvo..." ; "Kazhdõi den obrõvajetsja s krovju..."

  12. Muusa ; "Siin möödus Pushkini eksiili algus..." ; Looming ; "Ma halvustan eleegiat ja oodi..." ; Esimene kaugelaskekahur Leningradis ; "Hauad on aeda kaevatud..." ; "Eks nüüd koputa väikese käega..." ; "Kui uks on suletud ja ühtki häält ei k

    Index Scriptorium Estoniae

    Ahmatova, Anna, pseud., 1889-1966

    2006-01-01

    Orig.: Muza ; "Zdes Pushkina izgnanje natshalos (Kavkazskoje) ; Tvortshestvo ; "Mne ni ktshemu oditsheskije rati..." ; Pervõi dalnoboinõi v Leningrade ; "Shtsheli v sadu võrõtõ..." ; "Postutshis kulakom - ja otkroju..." ; "Kogda lezhit luna lomtem tshardzhuiskoi dõni..." ; "Mnogoje jeshtsho, naverno, hotshet..." ; "I kak vsegda bõvajet v dni razrõva..."

  13. Nashei strane Shariki ne nuzhnõ / Silver Meikar

    Index Scriptorium Estoniae

    Meikar, Silver, 1978-

    2008-01-01

    Vastukaja 14. novembril ajalehes Den za Dnjom ilmunud Vladimir Velmani artiklile "Inostrantsõ, immigrantõ, okkupantõ... teper jeshtsho i Sharikovõ?", mis oli omakorda vastukaja novembrikuu ajalehes KesKus ilmunud Silver Meikari artiklile "Kas Shaarik on juba eestlane?"

  14. SPLETNO OGLAŠEVANJE S POUDARKOM NA SOCIALNIH OMREŽJIH: PRIMER SPLETNE TRGOVINE ZOO MARKET REX

    OpenAIRE

    Duh, Tjaša

    2012-01-01

    V diplomskem seminarju z naslovom Spletno oglaševanje s poudarkom na socialnih omrežjih smo se osredotočili na metode spletnega oglaševanja, raziskali prednosti in slabosti ter teoretična izhodišča povezali s primerom spletne trgovine Zoo Market Rex. V današnjem sodobnem in konkurenčnem okolju postaja elektronsko poslovanje vse bolj razširjena oblika poslovanja. Najpogostejši obliki sta spletna trgovina in spletno oglaševanje. Internet je medij prihodnosti in prav s tega vidika je smiselna vz...

  15. ABSENTIZEM IN FLUKTUACIJA V OBČINI ŠKOFJA LOKA

    OpenAIRE

    Hafner, Urban

    2014-01-01

    V diplomskem delu smo raziskali absentizem in fluktuacijo v občini Škofja Loka. Diplomsko delo je sestavljeno iz teoretičnega in empiričnega dela. V teoretičnem delu smo s pomočjo literature razložili strokovne pojme s poudarkom na absentizmu in fluktuaciji. Predstavili smo organizacijo in s formulami za izračun stopnje absentizma in fluktuacije izračunali vrednosti teh dveh pojmov za leta 2011, 2012 in 2013. V empiričnem delu smo kot orodje uporabili anketni vprašalnik, ki smo ga raz...

  16. Del caos de la maravilla al orden de la razón. Los sistemas de la naturaleza y los límites de la razón en el siglo XVIII

    Directory of Open Access Journals (Sweden)

    Gómez López, Susana

    1999-01-01

    Full Text Available Not available.Partiendo de una comparación entre los primeros museos de objetos naturales surgidos en el siglo XVI y los gabinetes de historia natural del siglo XVIII, el presente trabajo se concentra en la transformación producida en aquel periodo en los modos de «ordenar» y «clasificar» la naturaleza. El gusto por lo exótico y maravilloso que caracterizó a las colecciones e historias, naturales del Renacimiento y del Barroco fue perdiendo fuerza a medida que aumentaba el interés por ordenar la naturaleza según «sistemas». Los nuevos modos de clasificación natural, que tuvieron su momento cumbre con la obra del Linneo, dieron origen a una intensa polémica sobre el carácter natural o artificial de los sistemas naturales y a un debate sobre su sentido y su utilidad. Las críticas de los enciclopedistas del siglo XVIII al espíritu sistemático de Linneo y su convicción en la necesidad de crear una estructura abierta y didáctica del saber se reflejaron también en la disposición y finalidad de los gabinetes naturalistas.

  17. El jardín de la república. Museo y razón (poscolonial

    Directory of Open Access Journals (Sweden)

    Natalia Sacchi

    2014-10-01

    Full Text Available ¿Qué es la descolonización y qué tiene que ver con la modernidad? ¿Cómo se injerta el “nosotros” exclusivo, etnocéntrico, con el “nosotros inclusivo” –la patria para todos– que proyecta la descolonización? ¿Cómo hemos pensado y problematizado, desde aquí y ahora, el presente colonizado y su superación? Silvia Rivera Cusicanqui (2010: pp. 60.El artículo indaga sobre el museo de arte moderno como matriz disciplinar del es-tado nación (poscolonial en Argentina. Y como el museo, en tanto que representación y materialidad, figura el ideal del proyecto de construcción nacional del Estado Argentino generando una serie de significantes que nos permiten desentrañar las relaciones entre representación estética, ficciones narrativas hegemónicas sobre la “otredad” y regulación de la población a través de la racialización y la desigualdad sexo genérica. Para mentar estas relaciones me centro en tres figuraciones narrativas, el desierto como espacio de “ausencia de civilización”, el jardín como el orden moderno de las personas y las representaciones y el pabellón como mecanismo de disciplinamiento.

  18. Razões para o utilitarismo: uma avaliação comparativa de pontos de vista éticos

    Directory of Open Access Journals (Sweden)

    Cláudio F. Costa

    2002-01-01

    Full Text Available O trabalho apresenta os três principais pontos de vista éticos que são predominantes, hoje, nas discussões da filosofia moral, a saber, a ética de virtudes, a deontologia e o conseqüencialismo. Ele revela os principais traços de cada teoria apontando os seus pontos positivos e negativos. Posteriormente, ele argumenta em favor de um enfoque conseqüencialista, isto é, por uma forma particular de utilitarismo.

  19. Arautos da razão: a paralisia no debate sobre transgênicos e meio ambiente

    Directory of Open Access Journals (Sweden)

    Marcelo Leite

    2007-07-01

    Full Text Available A polarização do debate público sobre alimentos transgênicos ultrapassou o ponto em que a controvérsia acarreta um incentivo para a produção de conhecimento empírico capaz de fazê-la avançar, como fica evidente nas disputas travadas dentro da CTNBio (Comissão Técnica Nacional de Biossegurança desde 1998. O epicentro dessa paralisia reguladora se encontra numa noção restritiva de ciência e de análise de riscos que, segundo Hugh Lacey e Denise Caruso, impede a adequada consideração de riscos para a saúde humana (como alergias e o meio ambiente (poluição genética, surgimento de superpragas e danos a espécies circundantes. Tal impasse só poderá ser desfeito por iniciativa de setores da comunidade científica que não se encontrem já prisioneiros daquele conceito de pesquisa descontextualizada, sem espaço para investigar questões de sustentabilidade socioambiental.The polarized public debate on transgenic foods has reached the point where controversy ceases to bring an incentive to generate empirical knowledge in order to make it advance, as becomes manifest from disputes flared in Brazil's Technical National Commission on Biosafety (CTNBio since 1998. The epicenter of the regulatory paralysis is located in a restrictive conception of science and risk analysis, which according to Hugh Lacey and Denise Caruso prevent an adequate consideration of risks related to human health (such as allergies and the environment (genetic pollution, creation of superweeds and damage to surrounding species. Such impasse can only be undone under the leadership of sectors in the scientific community that have not already been captured by that notion of decontextualized research, which leaves no room for investigating issues pertaining social and environmental sustainability.

  20. El viejo y su tiempo. Hacia una ética de la razón cordial

    Directory of Open Access Journals (Sweden)

    Dr. M. Carlos Trejo

    2012-01-01

    Actualmente, la ética referida a la ancianidad está fuertemente reducida a la etiqueta, al modo de trato o a la consideración para con ellos. Por todo lo anterior se hace necesario e imprescindible mejorar la autoestima que los ancianos tengan de sí, proporcionándoles la oportunidad de participación en la sociedad, con una cuota de responsabilidad con ellos mismos, procurando llegar a la edad del adulto mayor en buenas condiciones físicas y psicológicas. El adulto mayor debe vivir su vida dentro de sus capacidades y esta es una tarea personal y social. La vinculación ética con los ancianos es un compromiso de afecto. En otras palabras, el motor de las actitudes son los afectos, la verdad por sí misma carece de poder suficiente para superar los afectos a no ser que sea asumida como afecto. Las sociedades se motivan más por las emociones que por las razones. En síntesis, demográficamente el grupo de la tercera edad se hace más significativo, y, por lo mismo, resulta urgente que la sociedad resuelva una relación con este grupo etario, más fecunda, participativa y ennoblecedora.

  1. Razão, história e justificação da lei civil segundo Thomas Hobbes

    Directory of Open Access Journals (Sweden)

    Wladimir Barreto Lisboa

    2008-09-01

    Full Text Available O autor procura analisar a relação existenteentre lei natural e lei civil em Thomas Hobbes.Para isso analisa sua crítica à história e ao commonlaw enquanto incapazes de fundar a racionalidadedo poder civil. Mostra-se igualmente de que modoo poder soberano encontra seu fundamento nas leismorais. Por fim, indica-se como a igualdade de direitos,tal como pensada na modernidade, sobretudoem Hobbes, parece inviabilizar a idéia de direitoscujos titulares seriam grupos e não indivíduos.Abstract: The author analyzes the relationbetween natural law and civil law in ThomasHobbes, pointing out Hobbes’ argument thatneither history or common law are able to foundcivil’s power rationality. The article shows, aswell, how sovereign power is founded by themoral law and how the equality of rights inHobbes seems to undermine the idea that ispossible for groups to be subject of rights insteadindividuals.

  2. "Nuestra América": José Martí ante la Razón Moderna

    Directory of Open Access Journals (Sweden)

    Pedro Pablo Rodríguez

    2015-09-01

    Full Text Available Este artículo es un acercamiento al difícil y singular diálogo con el pensamiento moderno y sus procedimientos del escritor, pensador y político cubano José Martí. La tesis es que el ideario de Martí expresó los intereses y la perspectiva de los pueblos de Hispanoamérica, a la que llamó Nuestra América, por oposición, según escribió “a la otra América, que no es nuestra”. Plenamente consciente de que la identidad de la región se sustentaba en una cultura nueva, mestiza de lo aborigen y lo español, el cubano dedicó su ensayo “Nuestra América” a explicar los factores internos que mantenían las estructuras sociales, políticas y de pensamiento de la época colonial, así como el peligro que representaba el creciente poderío de Estados Unidos.   This article aims to approach Cuban writer, thinker and politician José Martí's harsh, singular dialogue with modern thinking and its procedures. It argues that Martí's set of ideas expressed the interests and viewpoint of the peoples of Hispanic America, which he called Our America, as opposed to, according to his own texts, "the other America, the one that is not ours". Fully conscious of the fact that the region's identity was based on a new culture, resulting from a mix of the indigenous and the Spanish, Martí used his essay "Our America" (originally, "Nuestra América" to explain the internal factors that maintained the colonial social, political and ideological structures, in addition to expressing the threat the growing power of the United States represented.

  3. Confesionalismo y razón de estado en la Edad Moderna. El caso de la Valtellina (1637-1639

    Directory of Open Access Journals (Sweden)

    Maffi, Davide

    2005-12-01

    Full Text Available The control of the Valtelline passes in the early Seventeenth Century play a relevant role in the Spanish strategy and in the European politic, but the question was no more a mere strategic problem. The religious aspect was also fundamental: the inhabitants of the region were Catholics and the Grisons, with the valley to belong from the early Sixteenth Century, Protestants. In 1637, after the expulsion of the French Army from the valley, a large debate to interest the Spanish Council of State on the possibility, for a catholic State, to sign a formal treaty of alliance with a heretic people.

    El control de los pasos de la Valtellina al principio del siglo XVII jugó un papel llave en la estrategia española y en la política europea, pero el problema no era simplemente de origen estratégico. Sin embargo los aspectos religiosos tuvieron también una importancia fundamental: los vecinos de la valle eran católicos y los Grisones, los dueños de los pasos desde el principio del siglo XVI, protestantes. En 1637, después de la expulsión del ejército francés de la región, un largo debate interesó el Consejo de Estado sobre la posibilidad, por una potencia católica, de poder firmar una alianza formal con un país de herejes.

  4. Mulheres e Suas Histórias: Razão, Sensibilidade e Subjetividade no Empreendedorismo Feminino

    Directory of Open Access Journals (Sweden)

    Jane Mendes Ferreira

    2013-07-01

    Full Text Available The purpose of this article is to identify the elements that allow understanding the subjectivity of women entrepreneurs according to González Rey’s theory (2009. Subjectivity is a configuration of subjective sensesoriginating from individual and social levels. Thus, a subjective constitution is formed by different forces that remain constantly changing throughout subjects’ history. The methodology used to achieve the objective of this paper follows Qualitative Epistemology. This is a qualitative approach that uses a set of specific proceduresspecifically designed to reveal the indicators which form the subjective configuration. The results indicate that women’s subjective entrepreneurship configuration rests on subjective meanings associated with the trajectories, context and culture within which the activity is developed. Entrepreneurship in this research appears as an individual characteristic that is formed in childhood. However, these women exist as entrepreneurs throughout their histories; especially when they have to deal with adverse conditions in the business world, which is seen assexist. In this context, a company’s opening is an event that strongly marks these women’s histories, with asymbolic nature that becomes an integral part of their subjectivities. Similarly, the multiplicity of roles and competition between social spaces highlight how family interferes with business dynamics, as well as how businesses are present in the home. Also, the way they undertake entrepreneurial activities is delimited by the concrete conditions in which they lived / live.

  5. Crime do feminicídio. Morte violenta de mulheres por razões de gênero

    OpenAIRE

    Munévar M, Dora Inés

    2012-01-01

    El propósito de este artículo es reflexionar sobre el femicidio, considerado como un delito que ocurre por razones de género. Ofrece un análisis feminista para comprender las dimensiones conceptuales del tipo penal; incluye los principales argumentos conducentes a su penalización en países de América Latina; examina diferentes aspectos defendidos por feministas y activistas del movimiento de mujeres; tiene en cuenta la existencia de algunas reacciones desencadenadas por la idea de una tipific...

  6. Lo peculiar de los seres humanos no es la razón, sino la voluntad libre

    Directory of Open Access Journals (Sweden)

    PASCUAL F. MARTÍNEZ-FREIRE

    2015-02-01

    Full Text Available Mi tesis es que los seres humanos son agentes racionales pero no pueden ser definidos como los agentes racionales. Las ciencias cognitivas (psicología y neurociencia, y también la inteligencia artificial nos dicen que algunos animales y algunas máquinas son asimismo agentes racionales. En mi opinión el rasgo más característico de mujeres y hombres no es su dimensión racional sino su dimensión volicional, es decir, su aspecto de ser agentes libres. Es precisamente en este aspecto volicional donde encontramos los procesos mentales que muy probablemente son no-físicos (y quizás espirituales.

  7. Culto a la Santa Efigenia: la razón étnica y la utopía social

    OpenAIRE

    Arroyo Aguilar, Sabino

    2014-01-01

    This study is about the ways of the culture identification and the ethnic legitimation through the reinvention of the Santa Efigenia’s Wroship, as the only «Santa Morena» from the Cañete valley, from Lima-Perú and, that these last years is incoming as a cultural force or as a religious icon, associated to the history of the afroperuanos fron colonial origin and of the contemporany Andean inmigrants. Likewise, this study explain now the archetypes works in the act escenary in order to ask for ...

  8. La dialéctica de fe y razón en el mundo contemporáneo

    Directory of Open Access Journals (Sweden)

    H. C. F. Mansilla

    2007-06-01

    Full Text Available El optimismo del pensamiento moderno pronosticó el fin de la religión, considerándola un mero fetiche de la ignorancia e incapacidad humana. Una mera ilusión que alienaba a las masas del mundo terrenal por una fantasía celeste. Sin embargo la religión logró capear las tormentas cientificistas hasta la década del sesenta del siglo XX. Paulatinamente la religión comenzó a ser vista como una institución humana que se vivificaba como nunca antes, trayendo esperanza, consuelo y confianza al ser humano ante los desencanto de la modernización incumplida de la política y la economía.

  9. Razón y secreto en los registros notariales virreinales. Madrid, Lima y Santiago de Chile (1670-1720

    Directory of Open Access Journals (Sweden)

    Aude Argouse

    2016-04-01

    Full Text Available What was at stake in the process of notarial registration? Through the analysis of three situations that arose during the Catholic Monarchy between 1670 and 1720 in the territories of Spain, Peru and Chile, this article explores diverse social and cultural tensions perceived in the process of recording notarial documents and in the circulation of records and persons. It reveals a range of distances among facts, truth and the administration of justice. The writing appears to be a dialogue: the will of the grantors — either individual or collective strategies to express sentiments and decisions— are mixed with the ink of the clerks who were transcribing, co-authors whose identity is unknown but whose mark can nonetheless be seen in the documentation.

  10. Lo peculiar de los seres humanos no es la razón, sino la voluntad libre

    OpenAIRE

    PASCUAL F. MARTÍNEZ-FREIRE

    2015-01-01

    Mi tesis es que los seres humanos son agentes racionales pero no pueden ser definidos como los agentes racionales. Las ciencias cognitivas (psicología y neurociencia, y también la inteligencia artificial) nos dicen que algunos animales y algunas máquinas son asimismo agentes racionales. En mi opinión el rasgo más característico de mujeres y hombres no es su dimensión racional sino su dimensión volicional, es decir, su aspecto de ser agentes libres. Es precisamente en este aspecto volicional d...

  11. Razón «débil» y Educación «light»

    Directory of Open Access Journals (Sweden)

    Enrique GERVILLA CASTILLO

    2009-11-01

    Full Text Available The «strong» reason, which characterises the theocentric and anthropological philosophical systems of the middle ages and modernity, has been broken faced with the «un-reason» seen in the disasters of manking: war, hunger, armaments, social inequality... In consequence «weak» reason which belongs to the postmodernity is now prevalent in a large part of our society. Ontological fragmentation and «weak» thought have engendered a new way of living whose influence is seen in education which is based on relativism and individualism. The causes of this change and its positive and negative aspects are critically analyzed in this article.

  12. Razões maternas para colocar ou não o bebê na creche

    Directory of Open Access Journals (Sweden)

    Cesar Augusto Piccinini

    2016-01-01

    Full Text Available El estudio investigó las razones maternas para inscribir o no al hijo en la guardería en el primer año. El estudio incluyó a 69 madres y sus hijos, de los cuales 26 estaban entrando en los centros de atención y 43 continuarían siendo cuidados por la madre u otros cuidadores. Se entrevistó a las madres sobre la maternidad y la elección de cuidado. El análisis de contenido reveló que la decisión de inscribir o no al hijo en los centros de atención en los primeros seis meses fue influenciada por razones relacionadas con el bebé, sus madres/padres y la red de apoyo. Además de eso, se verificó que las razones maternas para elegir cualquier cuidado estuvieron relacionadas con las necesidades de los hijos. En cuanto a los centros de atención, las madres destacaron su importancia para el desarrollo social y cognitivo, mientras que los otros cuidados, las madres enfatizaron la atención más individualizada. Independiente de las razones específicas, estas estaban involucradas en un proceso complejo y dinámico.

  13. A razão ética e poética nos poemas de Ana Martins Marques

    OpenAIRE

    Pietrani,Anélia Montechiari

    2015-01-01

    Na obra da jovem poeta mineira Ana Martins Marques, autora de A vida submarina e Da arte das armadilhas, a sensibilidade feminina e a disciplina estética são marcas significativas. Ler seus poemas, especialmente seus metapoemas, e a arquitetura de seus textos faz-nos situar a novíssima poesia brasileira na atualidade do século XXI, de modo a refletir sobre o papel, o valor e o lugar da poesia na contemporaneidade, como potência e busca de significados em que confluem ...

  14. Razão e sensibilidade: olhares sobre viver, trabalhar, lutar no Oeste do Paraná

    Directory of Open Access Journals (Sweden)

    Davi Félix Schreiner

    2007-12-01

    Full Text Available No início de 2007, dentre os ingressantes no Programa de Pós Graduação Stricto Sensu /Mestrado em História, cinco se propõe a implementar Projetos de Pesquisa relacionados à Linha de Pesquisa Trabalho e Movimentos Sociais. Durante o transcorrer do ano referido faz-se possível perceber significativo amadurecimento intelectual por parte dos proponentes das investigações, expresso na definição de problemáticas fundamentadas em referenciais teóricos e metodológicos pertinentes, para o quê, evidentemente, conjuga-se o esforço individual, as indicações dos orientadores e o cursar das disciplinas. Este artigo, neste sentido, tem como escopo uma breve explanação acerca das cinco pesquisas referidas, pontuando os nexos entre os estudos em desenvolvimento e os eixos temáticos que definem a Linha.

  15. Prispevek k poznavanju razširjenosti in pogostosti alfonzovega slepega brzca (Anophthalmus alphonsi) (Coleoptera: Carabidae: Trechinae):

    OpenAIRE

    Kofler, Bojan

    2002-01-01

    The geographical distribution and frequency of Anophthalmus alphonsi, an endemic hypogean beetle species from Škofjeloško Hribovje (north-western Slovenia) was studied. A long term search in the classical finding-places and also in newly discovered caves, abysses and shafts in the region was made. The abyss Brezno na Malem Lubniku on Mt. Lubnik, the cave Flančenk near the village Pevno, and the old shafts near the town Železniki are the new findings sites.

  16. Reflexiones: Las pupilas de la universidad o el principio de razón y la idea de la universidad

    Directory of Open Access Journals (Sweden)

    Mariela Suárez

    2015-10-01

    Full Text Available La Universidad, es centro de múltiples debates en el Planeta Tierra, esta institución ha venido respondiendo al desarrollo de las ciencias y es epicentro de reflexión de los grandes problemas de la sociedad moderna. Como proyecto histórico de la sociedad, requiere adelantar ese proceso de reajuste institucional y organizacional. Paralelamente, debe construir con diversos puntos de vista su dinámica y roles Inter-extra institucionales, afín de fortalecer su eje social profesional, mirando su perfil profesional, competencias profesionales y escenarios de praxis.AbstractThe University is the center of multiple discussions on planet Earth, this institution has been responding to the development of science and is epicenter of reflection of the great problems of modern society. As historical society project, it requires to get ahead this process of institutional and organizational realignment. At the same time, the university must build with different points of view its dynamics and extra-inter institutional roles, to strengthen its professional social axis, taking into account its professional profile, professional skills and settings of practice.

  17. Por Que Tenho Razão: branquitude, Estudos Culturais e a vontade de verdade acadêmica

    Directory of Open Access Journals (Sweden)

    SOVIK, Liv

    2005-12-01

    Full Text Available This article discusses our academic “wills to truth” (Foucault, from within the zone of influence of Stuart Hall and his “Cultural Studies and its cultural legacies”. It presents reflections on the research process in a study of whiteness in the Brazilian media and mass culture, especially popular music, and on the contexts in which papers were commissioned and findings were made public. Some results are described: conceptualizations of Brazilian whiteness, a proposal for the rediscussion of the meaning of mestiçagem, the traditional description of Brazilian racial identity, and a reflections on what can be won from the comparison, which seems almost obligatory in discussions of race relations, between Brazilian and US race relations. Finally, it analyses some papers that focus specifically on white identities in popular music and proposes a discussion of the metaphors for producing truths in communications research in Brazil.

  18. "Nuestra América": José Martí ante la Razón Moderna

    OpenAIRE

    Pedro Pablo Rodríguez

    2015-01-01

    Este artículo es un acercamiento al difícil y singular diálogo con el pensamiento moderno y sus procedimientos del escritor, pensador y político cubano José Martí. La tesis es que el ideario de Martí expresó los intereses y la perspectiva de los pueblos de Hispanoamérica, a la que llamó Nuestra América, por oposición, según escribió ¿a la otra América, que no es nuestra¿. Plenamente consciente de que la identidad de la región se sustentaba en una cultura nueva, mestiza de lo aborigen y lo esp...

  19. As razões de flexibilização dos efeitos da decisão de Inconstitucionalalidade.

    OpenAIRE

    CABRAL, M. F.

    2008-01-01

    Trata do estudo da questão da decisão de inconstitucionalidade e sua eficácia no tempo proferida pelo Supremo Tribunal Federal no exercício do controle de constitucionalidade abstrato. Inicia, no Capítulo 1, uma abordagem acerca do Constitucionalismo e da Constituição, destacando, dentre suas características, a imortalidade normativa e a indisponibilidade política. Após, no Capítulo 2, introduz considerações acerca da jurisdição constitucional e alguns modelos de controle de constitucionalida...

  20. Etičeskaja «dyra» v centre naučnoj paradigmy «publikujsja ili umri»

    Czech Academy of Sciences Publication Activity Database

    Kravjar, J.; Hladík, Marek

    2016-01-01

    Roč. 2016, č. 1 (2016), s. 29-31 ISSN 1994-2443 Institutional support: RVO:68081758 Keywords : academic publishing * publishing ethics * predatory publishing * scientists * publishers * open access * evaluation of science Subject RIV: AF - Documentation, Librarianship, Information Studies OBOR OECD: Information science (social aspects)

  1. Energy efficiency: Reality or just the wish? What should Croatia do?; Energetska efikasnost: Stvarnost ili samo zelja? Sto Hrvatska treba uciniti?

    Energy Technology Data Exchange (ETDEWEB)

    Granic, G [Energetski institut Hrvoje Pozar, Zagreb (Croatia)

    1997-12-31

    During work the problem of efficiency has been analysed as a part of sustainable development and environment protection strategy. Interrelations within the complex procedure of setting an organised energy sector in which the energy efficiency will be one of the fundamental tasks, have been worked out. Based on the experience of European Union countries the model for Croatia has been made. The activities, institution and steps necessary to be taken in order to start the process of efficient energy management as permanent care of all those who are in any way included in energy sector, have been recognised. (author). 2 tabs., 4 figs., 5 refs.

  2. Tko su za nas Turci / Osmanlije? Ili kako su predstavljeni u hrvatskim udžbenicima povijesti i sintezama / pregledima hrvatske povijesti

    Directory of Open Access Journals (Sweden)

    Damir Agičić

    2015-08-01

    Turcy osmańscy w późnym średniowieczu i wczesnej epoce nowożytnej mieli istotny wpływ na historię Europy, w tym także na historię Chorwacji. Zarówno w podręcznikach, jak w poddanych analizie syntezach historii Chorwacji widoczne są dwie przeciwstawne wizje stosunków turecko-chorwackich, jak zresztą i innych momentów narodowej historii: pierwsza, etnocentryczna, wyolbrzymia własną przeszłość i charakteryzuje się w wielu miejscach nietolerancją w stosunku do innych, szczególnie sąsiadów, druga natomiast jest bardziej nowoczesna, otwarta i wyważona. W artykule wymienione są przykłady, które wizje te potwierdzają.

  3. Litva na puti k jenergeticheskoj samostojatel'nosti: opyt ili uroki? [Lithuania on the way to energy independence: an experience or a lesson?

    Directory of Open Access Journals (Sweden)

    Kretinin Gannady

    2010-01-01

    Full Text Available The article considers the steps taken by Lithuania towards gaining energy independence in the interbellum and the Soviet periods. The author analyses the peculiarities of the republic's energy policy after achieving independence in the early 1990s and estimates the methods of diversifying energy supply in Lithuania.

  4. Medyanın profesyonellik ideolojisi ve toplumsal çevresi ile olan ilişkisi üzerine sosyolojik bir değerlendirme

    OpenAIRE

    Ali Arslan

    2006-01-01

    Media Professional Ethics & A Sociological Evaluation on the Relationship Between the Media and Its SocialEnvironmentThere are two opposing ideas about the influence of media: media are “passive transmitters” or “activeinterveners” in the shaping of messages. According to pluralist approach, media professionals behave in accordancewith their ideology. Pluralists also presume that ultimate control of the production process in the media is on the handsof the media pr...

  5. Yeni bir TSH reseptör aktive edici mutasyon ile ilişkili ailevi hipertiroidi: Beş vaka takdimi

    NARCIS (Netherlands)

    K. Demir (Korcan); Tunç, S. (Selma); A.A.A. van Mullem (Alies); T.J. Visser (Theo)

    2015-01-01

    textabstractFamilial non-autoimmune hyperthyroidism, a rare disorder that results from activating germline mutations in the TSH receptor gene, is inherited in an autosomal dominant fashion and has a variable age at onset. Here, we present a family, five members of which were determined to have

  6. Türkiye’deki iç Denetim Profilinin Belirlenmesine ilişkin Bir Araştırma

    OpenAIRE

    MEMİŞ, Arş. Gör. Dr. Mehmet Ünsal

    2013-01-01

    In recent year internal auditing has been taken into account more importantantly because of some company failures and bankrupcies such as seen in giant firms Enron Worldcom and Parmalat Accordingly by the help of efficient working internal auditing system the flaws of the firms may be predetermined and necessary precuations may be held to prevent the failures Owing to the vital importance of internal auditing for the firms the internal auditing profile in Turkey has been evaluated Key...

  7. Sakyamuni Buda'nın Tarihsel Kişiliği Ve Öğretisinin Yeni Bir Din Haline Geliş Süreci

    Directory of Open Access Journals (Sweden)

    Hüsamettin Karataş

    2013-06-01

    Full Text Available Sakyamuni Buda, Hindu kast sistemindeki yönetici sınıfa mensup bir prenstir. O, yaşadığı bir takım hayat tecrübelerinden hareketle, var olan anlayışların yetersiz olduğunu düşünerek kendi gerçeğinin peşine düşmüş tarihsel bir şahsiyettir. Sakyamuni Buda, çeşitli yollar deneyerek sonunda mutlak kurtuluşa erdiğini, yani aydınlandığını iddia eden bir din kurucusudur. Onun kurduğu dinî ve felsefi sistemin adı Budizm'dir. Budizm, ortaya çıktığı dönemdeki politeist yapıya, aşırı çileci veya hazcı ahlak ilkelerine, kurtuluş yolunun formalitelerine ve kast sistemine tepki göstermiştir. Bunun yanı sıra var olmaya çalıştığı bölgedeki dinlerin en belirgin özelliklerini de bünyesinde barındırmış, bazı öğreti ve uygulamaları aynen sürdürmüş, kültürel ve toplumsal hayata dair konularda ise devamlı surette esnek bir yol takip etmiştir. Budizm uzun tarihsel süreç içerisinde dünyanın çok farklı bölgelerine yayılmış ve günümüzün en çok taraftara sahip dinlerden biri haline gelmiştir

  8. Maliyet liderliği stratejisi, toplam kalite yönetimi uygulamaları ve finansal performans ilişkisi

    OpenAIRE

    Kurt, Ali; Zehir, Cemal

    2016-01-01

    Firms need to implement some competition strategies and total quality management applications to overcome the fierce competition among others. The purpose of this study is to show the relationship between cost leadership strategy, total quality management applications and firms’ financial performance with literature review and empirical analysis. 449 questionnaires were conducted to the managers of 142 big firms. The data gathered was assessed with AMOS. As a result, the relationship between ...

  9. Çocuklarda görülen ayak deformitelerinin hérédité ile ilişkisi

    OpenAIRE

    SARI, Fzt.Zübeyir; OTMAN, Fzt.A. Saadet; AKMAN, Dr.M.Nafİz

    2015-01-01

    Ayak deformiteleri, çocukluk çağında en sık görülen kas-iskelet patolojilerinden birisidir. Erken tam ve tedavi, gelişebilecek daha ciddi problemleri önlemek için büyük önem taşır. Çalışmamız, basit tesadüfi örnekleme yöntemi ile seçilen 221 öğrenci ve bunların yakın akrabalarından oluşan toplam 1105 olgu üzerinde gerçekleştirilmiştir. Çalışmamıza Nörolojik kökenli ve kas kuvvet dengesizliğinden kaynaklanan ayak deformitelerine sahip olgular dahil edilmemiştir. Yapılan istatistiksel incelemel...

  10. Razón práctica y teoría del derecho: a propósito del oficio del jurista

    OpenAIRE

    Gabriel Mora Restrepo

    2006-01-01

    En este escrito se exploran, en primer término, algunos elementos de crítica frente a la teoría tradicional del derecho (fuentes del derecho, interpretación jurídica, dignidad humana y razonamiento práctico), los cuales sirven para mostrar la necesidad de abordar el oficio del jurista desde unas coordenadas más realistas y ajustadas a la realidad contemporánea. En segundo lugar, el autor da cuenta de las razones que le llevaron a escribir la obra que es objeto de esta presen...

  11. Likelihood ratio (razón de verosimilitud): definición y aplicación en Radiología

    OpenAIRE

    C. Silva Fuente-Alba; M. Molina Villagra

    2017-01-01

    Los parámetros de medición de validez más conocidos en las pruebas diagnósticas son la sensibilidad, la especificidad y los valores predictivos (positivo y negativo). Las razones de verosimilitud o likelihood ratio conforman otra herramienta que resume la precisión de una prueba diagnóstica, permitiendo un uso clínico más intuitivo.

  12. La Ciudad de Dios desde la perspectiva de la razón: la cuarta politeia de la antigüedad

    Directory of Open Access Journals (Sweden)

    Óscar Velásquez

    2011-01-01

    Full Text Available Este artículo reflexiona acerca de la relación entre los conceptos de politeia, res publica y civitas en cuatro grandes obras: República de Platón, Política de Aristóteles, República de Cicerón y Ciudad de Dios de san Agustín, poniendo especial atención en esta última, en la medida en que se inserta en una tradición en la que Cicerón ocupa un lugar privilegiado de enlace con el pensamiento griego, y que, en fin, tuvo profundas repercusiones en la visión de mundo en occidente.This article reflects on the relationship between the concepts of politeia, res publica and civitas in four major works: The Republic by Plato, Politics by Aristotle, Republic by Cicero and City of God by Saint Augustine, with special attention on the latter, insofar as it is inserted in a tradition in which Cicero occupies a privileged position of a link with Greek thought, and which, in the end, had profound repercussions on the Western world view.

  13. A narração do médico em "Corpo Fechado" de Guimarães Rosa: razão e encantamento.

    Directory of Open Access Journals (Sweden)

    Maria Carolina de Godoy

    2016-01-01

    Full Text Available A análise do conto “Corpo fechado” de Guimarães Rosa pretende ressaltar, neste trabalho, a importância da nar-ração de um médico que contribui para a ambiguidade da crença na eficácia da magia, episódio central da história. A narrativa constrói-se a partir de duas visões de mundo: a primeira, mais científica ou citadina, representada pelo médico; a segunda, proveniente da viva imaginação do protagonista ao contar seus causos. O narrador apresenta, no primeiro momento, sua descrição de Laginha, suas cren-ças e valores, propiciando condições para a credibilidade do leitor; no segundo momento, surge o episódio do corpo fechado, principal experiência testemunhada pelo médico e que satisfaz sua curiosidade e expectativa em relação ao lugar. Destaca-se, também, a importância da magia para a transformação do protagonista em herói. Para o estudo desse encontro de visões distintas em torno da temática da magia serão abordados conceitos da teoria da narrativa, sobretudo de Gérard Genette (1995. Palavras-chave: narração, médico, magia. ABSTRACT The analysis of the short story “Corpo fechado” by Guim-arães Rosa intends to highlight, in this paper, the importance of the narration of a doctor who contributes to the ambiguity of the belief in the effi cacy of magic, central episode in the story. The narrative is built from two points of view: the fi rst one, more scientifi c, is represented by the doctor; the second one, which comes from the live imagination of the main character when telling his stories. The narratorpresents, at fi rst,his descripti on ofLaginha, his beliefsand values providing conditi ons forthe credibilityof the reader;then, in a second moment, it comesthe episode of theclosed body, main experiencewitnessedby the doctor which sati sfi eshis curiosity andexpectati onover theplace. It is noteworthy, also, the importance ofmagic totransformthe protagonistinto a hero. To study this two different views around the magic theme, we will approach the concepts of the narrative theory, especially Gérard Genette (1995. Keywords: narration, doctor, magic

  14. Ética y medio ambiente. La descomposición y recomposición de la razón práctica

    Directory of Open Access Journals (Sweden)

    García Gómez-Heras, José M.

    2005-06-01

    Full Text Available Nowadays, everybody is worried about an in questionable fact, that is, the environmental deterioration of our planet Earth. In addition, many people are able to recognize that human action has a lot to do with that deterioration. Therefore, the following question seems unavoidable: are human beings responsible for the ecological crisis? If the answer to the question is affirmative, then, we would have to face a very important problem. In the past, philosophy built different models of practical rationality according to the problems which mankind had to face at each moment of their history. So, after multiple attempts to reconstruct «Practical rationality», it seems relevant to suggest a reconstruction of ethics in the present. This reconstruction should give priority to the case of the moral dimension of human action on nature. This essays addresses that case.

    Todos observamos con inquietud un hecho incuestionable: el deterioro medioambiental de nuestro planeta «tierra». Muchos, además, reconocemos que la acción del hombre tiene mucho que ver con tal deterioro. Surge, por tanto, una pregunta ineludible: ¿Somos responsables de la crisis ecológica? Ésta, en ese caso, nos emplazaría ante un grave problema moral. En el pasado, la filosofía construyó los diferentes modelos de racionalidad práctica en función de los problemas a los que la humanidad tuvo que enfrentarse en un determinado momento de su historia. De ahí que, tras los múltiples intentos de reconstruir aquella racionalidad, parezca pertinente hoy en día reivindicar una reconstrucción de la ética priorizando en ella el problema de la dimensión moral de la acción humana sobre la naturaleza. Éste es el problema que aborda el presente ensayo.

  15. Como os brasileiros escolhem os governadores? Desvendando as razões do voto para os executivos estaduais no Brasil em 2014

    Directory of Open Access Journals (Sweden)

    Oswaldo E. do Amaral

    Full Text Available Resumo Apesar da importância das disputas para os governos estaduais na política brasileira, pouco se sabe a respeito dos fatores que levam às escolhas dos eleitores para esses pleitos. Existem fatores comuns que ajudam a explicar a escolha dos eleitores em todo o país para os governos estaduais? Qual é o peso da avaliação do governo federal e da percepção sobre o desempenho da economia do país nas eleições nas unidades da federação? Candidatos à reeleição ou apoiados pelo governador são beneficiados pela avaliação positiva do governo federal? A preferência partidária importa na hora de escolher os candidatos a governador? Essas são as perguntas que buscamos responder, ainda que de maneira preliminar, neste artigo. Para isso, realizamos análises multivariadas a partir dos dados de nível individual produzidos pelo Estudo Eleitoral Brasileiro (Eseb de 2014. Os resultados indicam que a preferência partidária, assim como nas eleições presidenciais, é importante elemento de escolha nos pleitos para os governos estaduais, e que a disputa entre PT e PSDB no plano nacional acaba por influenciar também o âmbito estadual.

  16. El placer espiritual germina más allá de la razón y la emoción

    OpenAIRE

    Luis Peralvo, Gloria

    2016-01-01

    Cuerpo y espíritu no son una dualidad a pesar de lo que nos dice la tradición judeocristiana. Somos una totalidad y en nuestra existencia está implícita la capacidad de trascendencia. Para mí es importante que podamos nombrar el placer espiritual en una relación (ya sea amorosa, de amistad, política, etc.). Cuando me implico y me pongo en juego en una relación, eso me lleva más allá, me permite atravesar lo momentáneo y me orienta hacia la trascendencia, a una vivencia que no deja fuera mi se...

  17. raz „nebo“ jako signál sebeopravy v mluvené češtině

    Czech Academy of Sciences Publication Activity Database

    Mrázková, Kamila

    -, č. 1 (2017), s. 45-56 ISSN 1805-367X R&D Projects: GA ČR GA15-01116S Institutional support: RVO:68378092 Keywords : repair * self-repair * Conversation Analysis * projection * syntactic projection * paratactic conjunction * language corpora Subject RIV: AI - Linguistics OBOR OECD: Linguistics https://ncds.ff.cuni.cz/cs/magazin/2017-1/

  18. La introducción del hormigón armado en España: razón constructiva de su evolución

    OpenAIRE

    Domouso de Alba, Francisco José

    2016-01-01

    España se incorporó a la técnica del hormigón armado con más de dos décadas de retraso respecto a Francia o Alemania. En 1890, en Europa se construían ya estructuras de hormigón armado de cierta envergadura y complejidad. En España hubo que esperar hasta 1893 para la primera obra en hormigón armado, que fue un sencillo depósito descubierto en Puigverd (Lérida), ejecutado por el ingeniero militar Francesc Macià con patente Monier. En 1898, de la mano de Hennebique, se empezó la construcción ...

  19. Escravidão "suave" no Brasil: Gilberto Freyre tinha razão? "Soft" slavery in Brazil: was Gilberto Freyre right?

    Directory of Open Access Journals (Sweden)

    Flávio Rabelo Versiani

    2007-06-01

    Full Text Available This article examines the question of the supposedly benign character of Brazilian slavery in contrast with North America slavery. In economic analyses of slavery, coercion toward slaves is viewed as a means to achieve maximum output, especially in large-scale agriculture. In small slave holdings, however, coercion was generally inefficient for that purpose, and positive incentives tended to be preferred. It is argued that, as recent evidence on Brazil has shown that small slave holdings prevailed in various regions and periods, this may lend empirical support to the notion of a relatively benign slavery, using more incentives than coercion.

  20. Razão e sensibilidade: ambigüidades e transformações no modelo hegemônico de masculinidade

    Directory of Open Access Journals (Sweden)

    Daniel Domith Vicente

    2014-07-01

    Full Text Available Studies on masculinity are growing on numbers in several areas of human sciences, and even natural sciences. Studies on masculinities are demonstrating that, unlike some decades ago, when the patriarchy was the main reference, today, the references are many and also contradictory. The objective of this research was to identify the aspects of contemporary masculinities that are changing, according to the view of the participants. The data were collected through semi-structured interviews with 20 participants, 10 men and 10 women, aged between 23 and 30 years old, all of them had college degree or were in college. The interviews focused the themes of sensibility, rationality and sexuality. Results indicated that tendencies of change occurred mostly inside the theme of sexuality. Strong conservative views, however, are still associated with the supposed male rationality and female sensibility, notions related to the patriarchy.

  1. “Canto porque la guitarra / tiene sentido y razón”: folklore and politics in the music of Víctor Jara (1966-1973

    Directory of Open Access Journals (Sweden)

    NATÁLIA AYO SCHMIEDECKE

    2013-01-01

    Full Text Available The present paper is dedicated to analyze the political and cultural discourse identified to the Chilean New Song Movement through the musical work of the singer, composer and theater director Víctor Jara (1932-73. Despite his premature death - due to the coup of 1973 - Jara left a varied artistic legacy which constitutes a privileged source for thinking about the Chilean context of the 1960s and 1970s, a period marked by the strong presence of social movements that had as background the growing of the political polarization. Affiliated to the Communist Party, the musician used the communicative and expressive potential of music to defend the need to promote structural political changes in the country, which necessarily pass through the sphere of culture. Asking for the presence of identity elements in his musical work, we will analyze the dialogue established by the artist with the national political context, indicating the heterogeneity of the repertoire enclosed under the term Chilean New Song Movement.

  2. Antony Flew Del ateísmo al teísmo por la razón científica

    Directory of Open Access Journals (Sweden)

    Javier Monserrat

    2015-01-01

    Full Text Available Nos hemos referido principalmente en los últimos números de Pensamiento a lo que se ha venido en llamar en la última década el Nuevo Ateísmo, representado por Richard Dawkins, Daniel Dennett, Sam Harris y Christopher Hitchens. Stephen Hawking no pertenece a este grupo, pero sus ideas han sido comentadas con frecuencia en relación a la cuestión de Dios. Por ello, hemos abordado también una discusión de su idea del universo y su referencia a Dios. El Nuevo Ateísmo da por supuesto que la ciencia moderna excluye taxativamente la existencia de Dios. Sin embargo, estos no son los únicos ateos. Tanto desde el campo de la ciencia (vg. Steven Weinberg, Carl Sagan, el mismo Roger Penrose, como igualmente desde el campo de la filosofía en los últimos siglos y en la actualidad, numerosos pensadores han llenado las filas del ateísmo. La filosofía clásica de la modernidad dogmática fue atea en gran parte; de ahí la dificultad, mantenida durante siglos, de que se entablase un diálogo entre el teísmo cristiano antiguo y aquel ateísmo dogmático de la modernidad.

  3. Simulação de fraturamento hidráulico usando elementos finitos de elevada razão de aspecto com acoplamento hidromecânico

    OpenAIRE

    Cleto, Pedro Rogério [UNESP

    2016-01-01

    A técnica de fraturamento hidráulico é amplamente utilizada na indústria petrolífera para aumentar a permeabilidade da rocha-reservatório numa região próxima ao poço e permitir a extração, e consequente produção, de hidrocarbonetos armazenados em seus poros. Primeiramente a rocha é perfurada criando-se um poço e então injeta-se fluido a uma pressão suficientemente alta para fraturar a rocha. A injeção contínua de fluido permite que as fraturas se propaguem pelo reservatório, formando ass...

  4. Produção e qualidade de rosas em razão de doses de boro aplicadas no substrato

    Directory of Open Access Journals (Sweden)

    Luiz Antônio Zanão Júnior

    2014-04-01

    Full Text Available Muitos trabalhos têm demonstrado os efeitos da aplicação do boro (B em variadas culturas; entretanto, poucos registros demonstram seus efeitos na produção de rosas. Objetivou-se com este experimento avaliar os efeitos de doses de B na produção e qualidade de rosas (Rosa hybrida cv. Shiny Terrazza® em vaso. Os tratamentos foram cinco doses de B (0, 1, 4, 8 e 16 mg kg-1, aplicadas no substrato, em delineamento de blocos casualizados, com cinco repetições. Foram avaliados: número de flores por planta; número de folhas por haste floral; produção de matéria seca de raízes, folhas e flores; altura da planta; número de dias para o florescimento; comprimento do botão floral; e diâmetro e longevidade floral. Além disso, foram determinados os teores foliares de clorofila total e B e os sintomas de toxidez desse elemento. Verificou-se efeito significativo das doses de B na maioria das variáveis avaliadas, excetuando-se a altura das plantas, o número de flores por planta, a longevidade floral e a produção de matéria seca de raízes. O teor foliar de B aumentou linearmente em função das doses desse elemento. Houve incremento na produção e qualidade das flores com a aplicação do B, com redução do número de dias para o florescimento. Foram verificados sintomas de toxidez causado pelo B a partir da dose de 4 mg kg-1. Esses sintomas foram caracterizados por manchas do tipo encharcamento, iniciando nas margens do limbo foliar, com essas evoluindo para clorose e posterior necrose; na maior dose ocorreu queda de folhas. Essa queda foi responsável pela diminuição do número de folhas por haste no final do ciclo, a partir da dose de 8 mg kg-1 de B. As plantas com sintomas de toxidez apresentaram teores foliares de B acima de 200 mg kg-1, enquanto as sadias (controle, de 65 a 89 mg kg-1.

  5. La razón y el lenguaje, principios para entender la regeneración desde la lengua: Miguel Antonio Caro

    Directory of Open Access Journals (Sweden)

    Diana Paola Guzmán

    2014-01-01

    Full Text Available El presente trabajo intenta reflexionar y proponer el siglo XIX como un sistema de representación, en donde la actividad retórica lideraba el escenario político, el histórico y el social. Por tal motivo, estos sistemas enunciativos exponen, de manera clara y radical, una suerte de regímenes de representación, que evidenciaban, no sólo a través de la praxis del discurso sino también de su estudio y normatización, enfrentamientos en donde el sistema de jerarquización de la palabra, jugaba un papel fundamental de estudio y comprensión de la lengua como elemento de poder e identidad.

  6. Razões para banir o conceito de raça da medicina brasileira Reasons for banishing the concept of race from Brazilian medicine

    Directory of Open Access Journals (Sweden)

    Sérgio D. J. Pena

    2005-08-01

    Full Text Available O conceito de 'raça' faz parte do arcabouço canônico da medicina, associado à idéia de que cor e/ou ancestralidade biológica são relevantes como indicadores de predisposição a doenças ou de resposta a fármacos. Essa posição decorre de uma visão tipológica de raças humanas. O baixo grau de variabilidade genética e de estruturação da espécie humana é incompatível com a existência de raças como entidades biológicas e indica que considerações de cor e/ou ancestralidade geográfica pouco ou nada contribuem para a prática médica, especialmente no cuidado do paciente individual. Mesmo doenças ditas 'raciais', como a anemia falciforme, decorrem de estratégias evolucionárias de populações expostas a agentes infecciosos específicos. Para Paul Gilroy, o conceito social de raça é 'tóxico', contamina a sociedade como um todo e tem sido usado para oprimir e fomentar injustiças, mesmo dentro do contexto médico.As part of medicine's canonical framework, the concept of race has been associated with the idea that color and/or biological ancestry are relevant indicators of a predisposition to a certain disease or reaction to drugs. This stance derives from a typological view of human races. The low level of genetic variability and of structuring of the human species is incompatible with the existence of races as biological entities and tells us that color and/or geographic ancestry have little or nothing useful to contribute to medical practice, particularly when it comes to caring for an individual patient. We show that even so-called racial diseases like sickle cell anemia are really the product of evolutionary strategies used by populations exposed to specific infectious agents, whose territories have no unequivocal relation with either color or continental origin. Furthermore, in the words of sociologist Paul Gilroy, the social concept of race is "toxic," contaminating society as a whole, and it has been used to oppress and to foster injustice, even within a medical context.

  7. Atraindo novos funcionários para empresas de alta performance: uma crítica às razões dos profissionais de recursos humanos

    Directory of Open Access Journals (Sweden)

    Filipe Augusto Silveira de Souza

    Full Text Available Os chamados sistemas de trabalho de alta performance refletem a necessidade de organizações fortalecerem o envolvimento do trabalhador para que este responda mais rapidamente às demandas por resultados. Apesar de as práticas de alta performance promoverem uma gradual intensificação no trabalho e o aumento do nível de stress dos trabalhadores, e, portanto, restringirem a qualidade de vida e o bem-estar no trabalho, empresas de alta performance exercem grande poder de atração nos profissionais qualificados, o que enseja a indagação sobre os mecanismos que promovem essa atratividade. Para investigar esta questão, este estudo se debruça sobre os discursos proferidos por profissionais que atuam na área de recursos humanos de empresas de alta performance atuantes no Brasil. A pesquisa foi realizada por meio de entrevistas em profundidade com esses profissionais, com perguntas amplas sobre as atividades de recrutamento e seleção de funcionários. Os argumentos e motivos que permeiam os discursos desses profissionais foram analisados à luz do repertório conceitual da Teoria Crítica, particularmente o debate sobre as racionalidades que orientam a ação social. O exame dos discursos aponta para uma comunicação instrumentalmente orientada e para a distorção sistemática do processo comunicativo no interior das organizações, em detrimento do equilíbrio entre vida e trabalho e do bem-estar individual e interpessoal.

  8. Razões para a falta de rendimento esportivo do Comercial F.C. Reasons for the lack of sports performance of Comercial F.C.

    Directory of Open Access Journals (Sweden)

    Cesar Machado Carvalho

    2012-04-01

    Full Text Available The international football, according to the report of the Plan for Modernization of the Brazilian Football FGV (2000 annual turnover of approximately $ 250 billion, while Brazil represents only 1% of the total. The Commercial F. C. headquartered in the city of Ribeirão Preto (SP, had its poly auctioned sports stadium partially forbidden for 23 years and not disputed the series A1, A3series being relegated to the Campeonato Paulista in 2009. This study aimed to identify those factors that hinder sports performance of the Commercial F. C., to do so, we studied its history, its relations with the government and legislation, market performance, partnerships established, administrative structures and results in the tournaments played between 2007 and 2008 to discuss their management problems. The methods used were research-explanatory and qualitative semi-structured interview to build a case study. We conclude that the gap between the formal structure and practice of members of the answers as a key element in the absence of the club's sports performance. O futebol internacional, segundo o relatório do Plano de Modernização do Futebol Brasileiro da FGV (2000, movimenta anualmente cerca de 250 bilhões de dólares, sendo que o Brasil participa com apenas 1% desse total. O Comercial F. C., sediado na Cidade de  Ribeirão Preto (SP, teve seu poliesportivo leiloado, estádio parcialmente interditado, e, há 23 anos, não disputava a série A1, sendo rebaixado para série A3 no Campeonato Paulista, em 2009. Este trabalho buscou identificar quais são os fatores que dificultam o rendimento esportivo do Comercial F. C., para tanto, foi estudada sua história, suas relações com o governo, sua legislação, seu mercado de atuação, suas parcerias realizadas, suas estruturas administrativas e seus  resultados  nos campeonatos disputados entre 2007 e 2008, a fim de discorrer sobre seus problemas de gestão. Os métodos utilizados foram a pesquisa qualitativo-explicativa e a entrevista semiestruturada para se construir o estudo de caso. Conclui-se que o descompasso entre a estrutura formal e a prática dos membros da organização responde como elemento fundamental na falta de rendimento esportivo do clube. 

  9. Diários de viagem de Anísio Teixeira: razões e sentidos de uma escrita de "si" e do "outro"

    Directory of Open Access Journals (Sweden)

    Silmara Fátima Cardoso

    Full Text Available Tem por pretensão analisar dois diários produzidos por Anísio Teixeira em suas viagens à Europa em 1925 e aos Estados Unidos em 1927. O viajante lança mão da escrita diária para registrar o cotidiano a bordo, ações de sujeitos, aspectos das cidades, suas reflexões em relação à vida, a si, à política, à educação, à religião católica, à América, além dos objetivos e propósitos de suas viagens. Utilizando esses diários como fonte privilegiada de estudo, a autora busca compreender como Anísio Teixeira representa e projeta na sua escrita uma imagem de "si" e do "outro" e explicita estar consciente das dificuldades em analisar e interpretar essas fontes, já que, conforme afirma Umberto Eco, "um texto é um universo indefinidamente aberto em que o intérprete pode descobrir interligações infinitas", sendo a linguagem "incapaz de apreender um sentido único e preexistente".

  10. A incorporação de corredores de conectividade no manejo de florestas industriais utilizando a heurística da RazãoR

    Directory of Open Access Journals (Sweden)

    José Mauro Magalhães Ávila Paz Moreira

    2010-06-01

    Full Text Available Modelos de planejamento florestal com restrições espaciais resultam em problemas matemáticos combinatoriais de difícil resolução. O procedimento mais apropriado, neste caso, é desenvolver métodos heurísticos, em vez das técnicas tradicionais de programação linear. O objetivo deste trabalho é aplicar, aprimorar e avaliar o desempenho da heurística denominada RazaoR (NOBRE e RODRIGUEZ, 2005, desenvolvido para a solução de problemas de planejamento florestal formulados integralmente com variáveis binárias e de acordo com o modelo Tipo I (JOHNSON e SCHEURMAN, 1977 apud CLUTTER et al., 1992, p. 281. O método incorpora restrições espaciais de conectividade entre os fragmentos de vegetação nativa adjacentes às florestas de produção. O déficit de conectividade das soluções foi avaliado a partir de um algoritmo recursivo baseado na Teoria de Grafos e em técnicas de programação dinâmica. Como estudo de caso, utilizou-se uma fazenda de uma empresa de celulose do estado de São Paulo. A heurística foi eficaz e eficiente no número de iterações necessárias para encontrar medidas viáveis para o problema, mostrando-se ineficiente apenas no tempo computacional exigido. Os valores da função objetivo das soluções encontradas variaram de 99,71% a 99,83% do valor da solução ótima, com uma média de 48 iterações.Planning models that connect natural forests through corridors formed by industrial forests result in combinatorial mathematical problems that are difficult to solve and demand special techniques. The main objective of this paper is to apply, improve and evaluate the performance of a heuristic method named R-ratio (NOBRE and RODRIGUEZ, 2005, developed to solve forest planning problems that consider exclusively binary variables and are formulated as a model Type I harvest scheduling problem (JOHNSON and SCHEURMAN, 1977 apud CLUTTER et al., 1992, p. 281. The solution's connectivity deficit was evaluated by a recursive algorithm based on the Graph Theory and dynamic programming techniques. A farm of industrial forest that supplies round wood to a pulp wood company in the State of São Paulo was used as a study case. The method was effective in creating feasible solutions after a few number of interactions, showing inefficiency only in the computational time required. The objective function values of the solutions provided by the heuristic vary from 99.71% to 99.83% of the optimal solution found by a mixed integer linear programming, with an average of 48 interactions.

  11. ¿Tenía razón Coleman? Acerca de la relación entre capital social y logro educativo

    OpenAIRE

    Jorge Ramírez Plascencia; Eduardo Hernández González

    2012-01-01

    Las redes sociales no son estructuras estáticas; son recursos para el logro de diversos fines por parte de los actores. Estos recursos han sido comprendidos de modo general con el término de capital social. Hace más de un cuarto de siglo que la teoría sobre este término surgió en el marco de los estudios sobre la educación y de la mano de Bourdieu y Coleman. El propósito de este artículo es hacer una revisión de una de las hipótesis centrales sobre esta teoría, formulada por Coleman, a saber,...

  12. Razão e sensibilidade: ambigüidades e transformações no modelo hegemônico de masculinidade

    Directory of Open Access Journals (Sweden)

    Daniel Domith Vicente

    2006-01-01

    Full Text Available Studies on masculinity are growing on numbers in several areas of human sciences, and even natural sciences. Studies on masculinities are demonstrating that, unlike some decades ago, when the patriarchy was the main reference, today, the references are many and also contradictory. The objective of this research was to identify the aspects of contemporary masculinities that are changing, according to the view of the participants. The data were collected through semi-structured interviews with 20 participants, 10 men and 10 women, aged between 23 and 30 years old, all of them had college degree or were in college. The interviews focused the themes of sensibility, rationality and sexuality. Results indicated that tendencies of change occurred mostly inside the theme of sexuality. Strong conservative views, however, are still associated with the supposed male rationality and female sensibility, notions related to the patriarchy.

  13. René Andioc tenía razón: la Continuación del Semanario de Salamanca (1800

    Directory of Open Access Journals (Sweden)

    Pedro ÁLVAREZ DE MIRANDA

    2012-05-01

    Full Text Available Este trabajo está destinado a resolver uno de los «enigmas histórico- literarios» que René Andioc planteó en uno suyo de 1992. Había indicios de que el Semanario de Salamanca, publicación supuestamente concluida en 1798 (no se conocían ejemplares posteriores, había tenido una continuidad posterior, puesto que esos indicios sugerían que un artículo relacionado con Moratín se había publicado en el número del 19 de abril de 1800 de dicho periódico. Aquí se da a conocer la existencia de tres ejemplares (uno de ellos de desigual extensión frente a los otros dos de una Continuación del Semanario de Salamanca (enero a junio de 1800, en cuyo número del 19 de abril figura, en efecto, un escrito firmado por «P. OzerínJáuregui y Z.» que es una réplica al Examen en que Cristóbal Cladera había criticado la traducción del Hamlet por Moratín

  14. Razão de sexo e considerações sobre o sistema de acasalamento em Nothura maculosa (Temminck, 1815 (Aves, Tinamidae

    Directory of Open Access Journals (Sweden)

    João Aldair Menegheti

    1988-01-01

    Full Text Available In the presente study on the mating of Nothura maculosa (Temminck, 1815 the tertiary and quaternary sex ratios were joined together The sex ratio was 1:1 or when deviated, favouring females When such deviations occur, they are probably due to quaternary sex ratio The inversion of sexual rôles could be responsible for the larger number of females, since males are more exposed to mortality risks The mating system in the Tinamidae is simultaneous poliginy for the male and sequential poliandry for the female, Emlen & Oring, 1977 Such complexity in the mating system results in a greater share among all individuals in the reproduction effort in relation to poliginy The sexual inativity of males for at least around 24 days after the begining of incubation, allows new males to participate in the reproductive effort The assumption that some of the females wuld be excluded from the reproductive effort when sex ratio is deviated in their favour, probably can not be held as true Bump & Bump, 1969, reported that 95% of the eggs examined (114 eggs, were fertile There are reasons to believe that neariy all females will successfully copulate under these circunstances

  15. Crítica à razão gestionária na educação: o ponto de vista do trabalho

    Directory of Open Access Journals (Sweden)

    Wanderson Ferreira Alves

    2014-01-01

    Full Text Available l objetivo de este texto es cuestionar las ambiciones de gestión de la educación en relación con el trabajo humano y algunas de las iniciativas que – em el ámbito de la educación escolar– tratan de gobernarlo y dimensionarlo. Este es un estudio teórico que utiliza las aportaciones de los estudios en educación y las disciplinas que tienen el trabajo como un objeto de estudio, especialmente las contribuciones de la ergonomía. El artículo se divide en cuatro apartados, distribuídos em la siguiente en la secuencia: un informe de una realidad concreta, el caso de las escuelas públicas de São Paulo, la reflexión sobre la circulación de herramientas de gestión desde el sector privado al sector público, las contradicciones y los límites de dichas herramientas de gestión –y cuáles son las contradicciones y los límites– ante la complejidad del trabajo humano. Se concluye con un breve resumen de los temas, que apunta hacia la necesidad de ubicar el trabajo, sus condiciones y su contenido en el centro de la discusión.

  16. La Posibilidad de Revisión del Mérito del Acto Administrativo Discrecional, en Razón de los Principios Constitucionales

    Directory of Open Access Journals (Sweden)

    Juventino de Castro Aguado

    2015-12-01

    Full Text Available Este artículo tiene como objetivo examinar la posibilidad de revisar los méritos de los actos administrativos discrecionales por el Poder Judicial con los principios constitucionales. Estos actos tienen elementos no regrados en el sistema legal, que dependen de la sentencia de la conveniencia y oportunidad del administrador público. Estos elementos se llaman méritos del acto administrativo. Antes, guardián de la libertad completa, ya que no se rige por la ley, que actualmente sufre más restricciones, la necesidad de respetar los principios del derecho, especialmente los que figuran en la Constitución, en el artículo 37. En consecuencia, aumenta la posibilidad de control judicial. El poder judicial tendrá un Consejo de control de la legalidad en su conjunto, incluyendo el mérito administrativo, si es provocado correctamente por el legítimo y respetando los límites impuestos por la propia Constitución. En un Estado democrático de derecho, donde la revisión judicial del acto administrativo es necesario para que  sea  posible  el  fiel  cumplimiento  de  los  objetivos  constitucionales  prestados  a  la República.  Para  el  desarrollo  de  la  investigación  se  utilizó  la  metodología  analítico- deductiva,  haciendo  uso  de  libros,  revistas,  artículos  publicados  en  los  sitios  web,  la legislación ordinaria, la Constitución y la Jurisprudencia.

  17. Brouwer y Zubiri. La eficacia del intuicionismo lógico en el logos y la razón sentientes

    Directory of Open Access Journals (Sweden)

    Ramírez Voss, Jesús

    2016-08-01

    Full Text Available This article deals with Zubiri and logic. Which conception of logic was most related to his academic training and his interests as a philosopher? Why did Zubiri opt for Poincare and Brouwer intuitionism from a very young age and to what extent did they both contribute to the development of his philosophy. Here, an original topic, until now neglected in the research on this contemporary Spanish thinker, is presented.Este artículo trata de Zubiri y la Lógica. ¿Qué concepción de la Lógica fue más afín con su formación y con sus intereses como filósofo? Me pregunto por qué Zubiri desde bien joven se decidió por el intuicionismo de Poincare, de Brouwer y en qué medida contribuyeron ambos en el desarrollo de su filosofía centrada en la descripción de lo real en la inteligencia sentiente. Presento un asunto original y desatendido hasta ahora en la investigación sobre este pensador español contemporáneo.

  18. El lugar de la razón práctica en los discursos de aplicación de normas jurídicas

    Directory of Open Access Journals (Sweden)

    Velasco, Juan Carlos

    1999-11-01

    Full Text Available Not available

    Argumentar constituye un quehacer cotidiano para los diferentes operadores jurídicos y, de modo especial, para quienes desempeñan la función judicial. Dado que las decisiones de los jueces están sometidas a un cierto control de racionalidad, es posible concebir las argumentaciones jurídicas empleadas en la aplicación del derecho como un modo institucionalizado de ejercitar la racionalidad práctica. Sin embargo, esto no implica, en contra de lo que a menudo se suele afirmar, que los procesos argumentatívos jurídicos estén sujetos en exclusiva a las leyes de la lógica deductiva. Cabe sostener el carácter racional de la aplicación del derecho sin caer en un logicísmo a ultranza ni en una defensa de las artes de la retórica y de la tópica: ahí está, entre otras, la vía defendida por la teoría discursiva de la argumentación jurídica elaborada por Robert Alexy a partir de presupuestos básicamente habermasianos, así como las correcciones contextualistas de la misma llevadas a cabo por Klaus Günthcr,

  19. Nová mapa extrémních nárazů větru v České republice

    Czech Academy of Sciences Publication Activity Database

    Pop, Lukáš; Sokol, Zbyněk

    2016-01-01

    Roč. 69, č. 3 (2016), s. 90-95 ISSN 0026-1173 Institutional support: RVO:68378289 Keywords : extreme value analysis * Gumbel distribution * wind measurements * wind gusts * Czech Republic Subject RIV: DG - Athmosphere Sciences, Meteorology

  20. El principio de igualdad y no discriminación por razón de orientación sexual en el contexto europeo

    OpenAIRE

    Navarro Otero, Carlos

    2016-01-01

    Traballo Fin de Grao en Dereito Internacional Público e Relacións Internacionais. Curso 2016/2017 La función principal del Derecho internacional de los derechos humanos es la de otorgar protección a los individuos frente al ejercicio del poder por los Estados. Por ello, las consecuencias de la Segunda Guerra Mundial marcan un punto de inflexión en este ámbito, dirigiendo el interés de la comunidad internacional en la promulgación de instrumentos y declaracion...

  1. Razón anamnética, sufrimiento ajeno y teodicea: Claves de lectura, logros y límites de la obra de Johann Baptist Metz

    Directory of Open Access Journals (Sweden)

    Matías Omar Ruz

    2008-01-01

    Full Text Available El presente artículo ofrece, por una parte, un panorama genético-sistemático del conjunto de la obra de Johann Baptist Metz, por otra, brinda, mediante una mirada los más atenta posible a gran parte de su bibliografía personal y a algunos de los principales trabajos internacionales hoy existentes sobre el teólogo alemán, claves de lectura a partir del tratamiento de los principales conceptos del autor. El artículo concluye con un breve análisis de sus innegables logros y méritos y, especialmente, de sus múltiples limitaciones y preguntas abiertas, en particular las referidas a su cristología.The present article offers, on the one hand, a genetic-systematic panorama of the work of Johann Baptist Metz; it also offers some keys for reading from the analysis of the main concepts of the author, through a study of great part of its personal bibliography and of the main existing international works today on the Germán theologian. The article concludes with a brief analysis of its undeniable achievements and merits and, especially, of its limitations and open questions, particularly those concerned with his Christology.

  2. Análisis de la influencia de la razón de transmisión en la velocidad específica de deslizamiento

    Directory of Open Access Journals (Sweden)

    Orestes González-Quintero

    2010-01-01

    Full Text Available Las transmisiones por engranajes pueden sufrir múltiples deterioros durante su funcionamiento y entre las fallas más comunes, propia de las transmisiones no lubricadas, se encuentra el desgaste, que se caracteriza por la disminución del espesor del diente en la zona de la cabeza y del pie, que es donde mayor velocidad de deslizamiento existe. En este trabajo se exponen las ecuaciones básicas para el cálculo de las velocidades de deslizamiento, de desplazamiento y específica de deslizamiento, finalmente, utilizando un programa elaborado en una Hoja de Cálculo de Excel y con el auxilio del software AutoCAD fueron evaluados cuatro casos de transmisiones por engranajes cilíndricos de dientes rectos, para determinar la influencia de la relación de transmisión en la velocidad específica de deslizamiento en ruedas dentadas cilíndricas de dientes rectos.Gear transmissions can suffer multiple fails during their operation, being wear one of the most common, this fail is characteristic of the not lubricated transmissions, and it is characterized by the decrease of the thickness of the tooth up and down the tooth height that is where main sliding velocity exists. In this work the essential equations for the calculation of the sliding, displacement and specific sliding velocity, are exposed, finally, using a program elaborated in a EXCEL spreadsheet and with the employment of the software AutoCAD, four cases of spur gear transmissions were evaluated, to determine the influence of the velocity ratio in the specific sliding velocity.

  3. "Canto porque la guitarra / tiene sentido y razón": folclore e política na música de Víctor Jara * “Canto porque la guitarra / tiene sentido y razón”: folklore and politics in the music of Víctor Jara (1966-1973

    Directory of Open Access Journals (Sweden)

    NATÁLIA AYO SCHMIEDECKE

    2013-08-01

    Full Text Available Resumo: O presente artigo se dedica a analisar o discurso político e cultural identificado com o movimento da Nova Canção Chilena através da obra musical do cantor, compositor e diretor de teatro Víctor Jara (1932-73. Apesar da morte prematura – decorrente do golpe de Estado de 1973 –, Jara deixou um legado artístico variado que se constitui em fonte privilegiada para pensar o contexto chileno dos anos 1960 e 1970, período marcado pela forte atuação de movimentos sociais que tinham como plano de fundo uma crescente polarização política. Filiado ao Partido Comunista, o músico se valeu do potencial comunicativo e expressivo da canção para defender a necessidade de se promoverem mudanças políticas estruturais no país, as quais necessariamente passariam pela esfera da cultura. Perguntando pela presença de elementos identitários em sua obra musical, analisaremos os diálogos estabelecidos pelo artista com a conjuntura política nacional, apontando para a heterogeneidade do repertório englobado sob o termo Nova Canção Chilena.Palavras-chave: Víctor Jara – Nova Canção Chilena – Unidade Popular. Abstract: The present paper is dedicated to analyze the political and cultural discourse identified to the Chilean New Song Movement through the musical work of the singer, composer and theater director Víctor Jara (1932-73. Despite his premature death - due to the coup of 1973 - Jara left a varied artistic legacy which constitutes a privileged source for thinking about the Chilean context of the 1960s and 1970s, a period marked by the strong presence of social movements that had as background the growing of the political polarization. Affiliated to the Communist Party, the musician used the communicative and expressive potential of music to defend the need to promote structural political changes in the country, which necessarily pass through the sphere of culture. Asking for the presence of identity elements in his musical work, we will analyze the dialogue established by the artist with the national political context, indicating the heterogeneity of the repertoire enclosed under the term Chilean New Song Movement.Keywords: Víctor Jara – Chilean New Song Movement – Popular Unity.

  4. THE METHOD TO KEFELİ HÜSEYİN’S RAZ-NAME NAMED BOOK SUMARY / KEFELİ HÜSEYİN’İN RAZ-NAME ADLI ESERİNDE NÜSHA AİLESİ KURMADA İZLENEN YÖNTEM

    Directory of Open Access Journals (Sweden)

    Assoc. Prof. Dr. İsmail Hakkı AKSOYAK

    2007-08-01

    Full Text Available Kefeli Hüseyin names his book Sevânihü’t-tefe'ül which is a collection of fortune-telling stories. He writes his book in Kefe and dedicates it to II. Gazi Giray. The author goes on collecting fortune-telling stories after Sevânihü’t-tefe'ül. He constitutes his book, Razname, by omutting some of the stories and adding some new one. Sevânihü’t-tefe'ül has two copies, one is in Süleymaniye Library and the other is in İzmir National Library. It is claimed that the one in Süleymaniye Library is author’s original manuscript. In this paper it is explained how to get a healty critical text of Razname.

  5. Examining Secondary School Students' Safe Computer and Internet Usage Awareness: An Example from Bartin Province=Lise Ögrencilerinin Güvenli Bilgisayar ve Internet Kullanim Farkindaliklarinin Incelenmesi: Bartin Ili Örnegi

    Science.gov (United States)

    Yilmaz, Ramazan; Karaoglan Yilmaz, F. Gizem; Özturk, H. Tugba; Karademir, Tugra

    2017-01-01

    Information and Communication Technologies (ICT) have been rapidly prevailed among the children and youths. Personal technologies facilitating the students to gain some learning experiences both in and out of the schools also include many threats. It is important for students to have high awareness of safe internet and computer use to overcome…

  6. Sosyal Ağlarda Eğlence Faktörü Kullanımının Marka Kişiliğine Etkisi: Starbucks Türkiye Örneği

    OpenAIRE

    Kale, Gözde Öymen

    2016-01-01

    Teknolojik alanda yaşanan gelişmeler her alanda olduğu gibi eğlence endüstrisinde de çok çeşitli değişimlere yol açmaktadır. Bu çalışmada geniş bir uygulama alanına sahip eğlence endüstrisi, sosyal medyada kullanımı itibarıyla ele alınmaktadır. Bu bağlamda, yaratıcı görseller kullanarak kendini ifade etme ve iletişim kurmaya yardımcı olmaya yarayan bir sosyal medya aracı olan Instagram, Starbucks Türkiye hesabında bulunan fotoğraflar aracılığıyla analiz edilmiştir. Öncelikle fotoğraflar Ginsb...

  7. Yenilikçiliğe Yönelik Devlet Uygulamaları ve AB Karşılaştırması(Government Applications Towards Innovation and Comparison with European Union

    Directory of Open Access Journals (Sweden)

    Bernur AÇIKGÖZ ERSOY

    2008-01-01

    Full Text Available Innovation which includes all processes activating new or improved products, services, systems or programs is considered a fundamental component of entrepreneurship and business success. Innovation has been widely recognized as the key driver of economic growth and sustainable development. So, in many countries, firstly the developed ones, innovation became a focus element to governmental policies. Enabling the appropriate conditions needed for innovation In line of these policies became one of the most important missions of the governments. This paper aims to show the innovation profile of Turkey, basing on EU countries’ progresses and to bring up a road map to make a progress.

  8. Historizace devadesátých let. Když je v dokumentech něco jiného, než jsme zažili

    Czech Academy of Sciences Publication Activity Database

    Gjuričová, Adéla

    2018-01-01

    Roč. 34, č. 2 (2018), s. 25-28 ISSN 1211-9938 Institutional support: RVO:68378114 Keywords : Czech poiltics in the 1990s * history and memory Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  9. Servikal nöral foraminal bölge ve uncinate çıkıntının embriolojik gelişimi ve anatomisinin klinikle ilişkilendirilmesi

    OpenAIRE

    BROHİ, Recep Ali

    2012-01-01

    Servikal bölge ile ilgili yapılan anatomik ve morfometrik çalışmaların büyük çoğunluğunda erişkin kadavra ve kemikleri kullanılmıştır. Servikal bölgenin ve bu bölge ile patolojilerde önemli rol oynayan uncinate proses ve servikal nöral foramen ile ilgili çalışmalar literatürde bulunsa da bu iki yapının embriolojik gelişimi yeterin...

  10. Al-Isyârât al-Kauniyyah fi al-Hurûf al-Muqatha’ah Awâili al-Suwar ‘Inda Thanthawi Jauhari

    Directory of Open Access Journals (Sweden)

    Ilham Habibullah

    2017-07-01

    Full Text Available Muslim scholars have different views about the meaning and interpretation of the letters of Muqatha'ah in the Qur'an. This issue also received special attention from the orientalists, as they saw that the letters of Muqatha'ah belonged to the deficiency of the Qur'an. According to Thanthawi Jauhari the different views among Muslim scholars includes three points: first, the letters need not be interpreted because the real meaning of Muqotha’ah is only Allah knows (Mutasyâbihât; second, the letters have related meaning to Asma Allah SWT or related to the names of surah in al- Qur'an; third, the letters are codes containing messages to read the Greatness of Allah SWT in this universe. That is the reason why according to Thanthawi "alif lâm mîm" has a close correlation with "alam taro", that alif lâm and mîm lead to verses that read "alam" which are both derived from the lâm and mîm alif letters. This paper discusses about the third point, which is exploring the meanings of the letters of Muqhata'ah that related to this universe according to Thanthawi Jauhari. Namely all the verses that discuss about alam (nature, such as geography and astrology referring to "alif lâm mîm". Thanthawi tries to bring his interpretation to the current reality, that the letters of muqhata'ah are symbols of all modern science, such as psychology, military, organization and political science. But of course Thanthawi is very observant and careful in relating the verse that according to the Muslim scholars are included in the mutasyâbihât discussion, so Thantawi always tries to provide clear evidence. But Thanthawi insists that the verses in the Qur'an have a very dominant scientific message or Isyârât.

  11. Phylogenetic Analysis of C Type Lectin from Toxocara canis Infective Larvae and Comparison with the C Type Lectin Fam-ily in the Immune System of Mouse and Human

    Directory of Open Access Journals (Sweden)

    Fazeleh ETEBAR

    2018-03-01

    Full Text Available Background: C type lectin (CTL family is a type of calcium-dependent proteins found in vertebrates and invertebrates. The objective of this study was to perform a comparative analysis and phylogenetic inferring for understanding the similarities and differences of carbohydrate recognition domain (CRD domain of Toxocara canis CTL and other nematodes, and similar C type lectin involved in the immune system of mouse and human as their host.Methods: The female T. canis was retrieved from the 2-6 months puppies (Department of Parasitology, Faculty of Veterinary Medicine, University of Tehran, 2015. To collect T. canis eggs, the worms were cultured for 5 d until they were embryonated. The hatching process was accelerated for collecting the stage 2 larvae, and the larvae were cultured for a week. A cDNA library was made from the total mRNA of T. canis infective larvae. The PCR amplification for C type lectin gene was performed and the amino acids were analyzed using the alignment method and the construction of phylogenetic tree.Results: The suspension sample maintained at 30 ºC for four weeks could embryonate 90%-100% of eggs. T. canis CTL gene was 657 bp in length and encoded a protein with 219 amino acids. The CTL of species of Strongylida order were closely placed in the tree, whereas the members of Ascaridida orders were located in a separate branch. High levels of similarity (36%-44% and conservation of C type lectin from T. canis with mouse and human C type lectins. Its C type lectin showed a higher similarity with asialoglycoprotein receptor (ASGPR, macrophage lectin, dendritic cell-specific intercellular adhesion molecule 3-grabbing nonintegrin (DC-SIGN, MINCLE receptor of mouse and human.Conclusion: Analysis of CRD domain of C type lectin protein could make a better understanding of their role in the interaction of nematode parasite with their hosts.

  12. Transobturator tape operasyonu sonrası ağrılı ilişki, benzer semptomları ancak farklı yönetimleri olan iki vakanın sunumu

    OpenAIRE

    Selçuk, İlker; Boyraz, Gökhan; Tuncer, Selçuk

    2014-01-01

    The risk of stress urinary incontinence (SUI) is tremendously increasing in adult females. Midurethral slings (MUS) are the preferred way of treatment for SUI. Transobturator tape (TOT) and transvaginal tape (TVT) operations are the types of MUS procedures and they can be performed with high success rates. Dyspareunia, pain, mesh exposure and vaginal erosion, infection and voiding dysfunction are all possible complications of synthetic slings. Mesh exposure and erosion is the greatest reason ...

  13. Seyahat acentelerinde örgüt kültürü ve liderlik arasındaki ilişki: Kuşadası bölgesinde bir araştırma

    OpenAIRE

    TÜTÜNCÜ, Özkan; AKGÜNDÜZ, Yılmaz

    2012-01-01

    The purpose of this study is to reveal the relationship between the organizational culture and leadership in travel agencies. In order to achieve this goal, a survey that contains the measure of organizational culture adapted from that of Deshpande et al. by Ogbonna and Harris and the measure of perceived leadership style adapted from that of House and House and Dessler by Ogbonna and Harris. The organization culture of each travel agency and leadership styles of managers were measured by thi...

  14. "Od toho dne, kdy jsme ruku v ruce vykročili do zasněžených ulic Leningradu". Dopisy Magdy N. Ivanu Málkovi z let 1951-1970

    Czech Academy of Sciences Publication Activity Database

    Franc, Martin

    2009-01-01

    Roč. 2, č. 2 (2009), s. 125-140 ISSN 1803-411X R&D Projects: GA AV ČR KJB800770701 Institutional research plan: CEZ:AV0Z80770509 Keywords : Málek, Ivan * history of science Subject RIV: AB - History

  15. As razões do laissez-faire: uma análise do ataque ao mercantilismo e da defesa da liberdade econômica na Riqueza das Nações

    Directory of Open Access Journals (Sweden)

    Laura Valladão de Mattos

    2007-01-01

    Full Text Available The reasons of the laissez-faire: an analysis of the attack to mercantilism and of the defense of economic liberty in The Wealth of Nations. The main reasons presented in The Wealth of Nations to advocate the system of economic liberty and reject mercantilism are analyzed. These two systems are evaluated considering basically their impact on the annual product, and the degree of liberty and justice they engender. Based on his views of man and of capital hierarchy, Smith defends the superiority of economic liberty in what concerns the growth of the annual product. This system is also considered superior to mercantilism in terms of justice since it does not privilege any sector of society and allows a great level of liberty to the individuals.

  16. “Acoso y Violencia Política en Razón de Género”: afectan el trabajo político y gestión pública de las mujeres

    Directory of Open Access Journals (Sweden)

    María Eugenia Rojas Valverde

    2012-01-01

    Full Text Available Apunta las causas que originaron la creación de la Asociación de Concejalas de Bolivia ACOBOL, que tiene como fin agrupar y organizar a todas las concejalas, exconcejalas, alcaldesas y exalcaldesas con la perspectiva de defender sus intereses y derechos políticos. Antes de su creación, la presencia de mujeres en el ámbito municipal no constituía parte de la agenda pública de las mujeres de Bolivia, no era parte de la agenda gubernamental ni de la de los movimientos sociales femeninos o feministas. La labor principal de la Asociación es la de denunciar los casos de acoso y violencia que se produjeron y producen en diferentes municipios rurales de Bolivia.

  17. Redução de haste verde e retenção foliar na soja em razão de maior disponibilidade de nitrogênio pelo tratamento de sementes

    Directory of Open Access Journals (Sweden)

    Fernando Fávero

    2014-10-01

    Full Text Available Problemas relacionados à retenção foliar e maturação desuniforme na cultura da soja têm sido relatados em várias regiões do país, inclusive no Estado do Paraná, desafiando pesquisadores brasileiros. Várias hipóteses já foram levantadas sobre o desequilíbrio nutricional das plantas e intensificação do problema, porém nenhuma com conclusão definitiva. Com o objetivo de avaliar como a disponibilidade de N via inoculação e uso de Co e Mo no tratamento de sementes, associado ao uso de fungicida e inseticida, pode minimizar a retenção foliar e haste verde, instalou-se um ensaio no campo da Estação Experimental da Copacol, em Cafelândia, PR. Oito combinações de produtos foram usadas no tratamento de sementes de soja, considerando a presença ou ausência de Co e Mo, inoculante e inseticida/fungicida. Avaliaram-se o teor de N foliar, a frequência de plantas anormais por ocasião da colheita, a porcentagem de vagens, com 0, 1, 2, 3 e 4 grãos formados, o peso de 1000 grãos, o teor de umidade, a impureza na colheita e o rendimento de grãos. O uso do Co e Mo e a inoculação de sementes promoveram aumento do teor de N foliar na soja e reduziram o número de plantas anormais, refletindo positivamente no rendimento e seus componentes. Os resultados evidenciaram efeito positivo da melhor nutrição das plantas de soja com relação ao N na redução de haste verde e reafirmaram a necessidade do uso do Co e Mo e da inoculação de sementes.

  18. Educação em valores: um possível caminho para a superação da razão instrumental rumo à formação do cidadão

    Directory of Open Access Journals (Sweden)

    Natalia Branco Lopes Krawczun

    2014-01-01

    Full Text Available O trabalho tem como objetivo propor uma reflexão a respeito da introdução de valores na ação educativa institucional, cujo objetivo volta-se à implementação de um espaço profícuo ao desenvolvimento do cidadão. Para isso, a partir das obras da filósofa espanhola Adela Cortina e do filósofo alemão Jürgen Habermas busca-se estabelecer um raciocínio a respeito da inevitável inserção de valores na ação, destinada a provocar os educandos à incorporação de uma postura participativa, que é essencial para elevá-los à condição de cidadão. Para isso, parte-se inicialmente da análise das diferentes formas de estabelecimento das relações interpessoais. A partir das considerações de Cortina acerca dos estudos de Jonathan Sacks e Thomas Hobbes, realiza-se um cotejo entre aliança e contrato, demonstrando que embora os direitos e deveres do cidadão estejam estabelecidos por meio de um contrato, os seus fundamentos e a garantia de seu funcionamento consubstanciam-se na aliança. Outro aspecto abordado, refere-se à superação da ação instrumental, considerada por Cortina como nefasta à formação do sujeito autônomo. Destaca-se a contribuição da educação escolar, em todos os seus níveis, no tocante ao desenvolvimento de uma sociedade democrática que conta com a participação ativa de seus sujeitos pertencentes e conscientes de suas alianças. Aponta-se que para que esse projeto aproxime-se da realidade é fundamental que os educadores, bem como os demais agentes vinculados às instituições educacionais, articulem em sua práxis os valores mínimos destacados por Adela Cortina, quais sejam: liberdade, igualdade, respeito ativo, solidariedade e o diálogo.

  19. Crescimento radicular de soja em razão da sucessão de cultivos e da compactação do solo Soybean root growth as affected by previous crop and soil compaction

    Directory of Open Access Journals (Sweden)

    Rosemeire Helena da Silva

    2002-06-01

    Full Text Available O objetivo do experimento foi avaliar o crescimento radicular e produção de matéria seca da parte aérea da soja (Glycine max (L. Merrill cultivada após diversas espécies vegetais, em solo com diferentes níveis de compactação. O trabalho foi realizado em vasos contendo amostras de um Latossolo Vermelho, textura franco arenosa, com camada de 3,5 cm (profundidade de 15 a 18,5 cm compactada até as densidades 1,12, 1,36 e 1,60 Mg m-3, onde cultivaram-se anteriormente aveia-preta, guandu, milheto, mucuna-preta, soja, sorgo granífero e tremoço-azul, e um tratamento sem planta (pousio. Essas espécies se desenvolveram por 37 a 39 dias, foram cortadas ao nível do solo, picadas em partes de aproximadamente 3 cm e deixadas sobre a superfície do vaso por 40 dias. Após esse período, cultivou-se a soja até 28 dias após a emergência, quando, então, as plantas foram colhidas. Foram avaliados produção de matéria seca da parte aérea e de raízes, e comprimento e diâmetro radicular da soja. O cultivo anterior com aveia-preta, guandu e milheto favoreceu o crescimento radicular da soja abaixo de camadas compactadas do solo. Independentemente do nível de compactação, o cultivo anterior com qualquer das espécies estudadas beneficiou a produção de matéria seca da parte aérea da soja.This study aimed at evaluating root growth and shoot dry matter production of soybean (Glycine max (L. Merrill cropped after different vegetal species, in a soil with different compaction levels. The experiment was conducted in pots containing a Dark-Red Latosol (Acrortox, loamy sand, and the pots had a layer 3.5 cm (15 to 18.5 cm thick and 15 cm deep compacted to 1.12, 1.36 and 1.60 Mg m-3. Before soybean, the pots were cropped with black oat, pigeon pea, pearl millet, black mucuna, soybean, grain sorghum and lupin, plus a treatment without plants. These species were grown for 37 to 39 days, when they were cut at soil level, prick in particles of approximately 3 cm length, and left on the soil surface for 40 days. After this, soybean was planted in the pots and was allowed to grow for 28 days after plant emergence. The soybean shoot dry matter weight, root length, diameter and dry matter were evaluated. The previous crop with black oat, pigeon pea and pearl millet favored the soybean root growth below compacted layer soil. Regardless soil compaction, the soybean shoot dry matter was favored by the previous crop.

  20. La maquinaria social y las ciencias humanas. Pensionados de la Junta para la Ampliación de Estudios en la Europa de la razón tecnocrática

    Directory of Open Access Journals (Sweden)

    Guijarro Mora, Víctor

    2015-06-01

    Full Text Available The establishment of the JAE and the scholarship policy supported by this institution promoted not only the well-known scientific renovation, but other values related in this case to the technocratic views of social problems. The present study is aimed at exploring this second effect, a relatively unattended topic, by the examination of the concerns and purposes of various scholarship holders who traveled between 1909 and 1932 to Germany, England, Belgium, Switzerland, and France.La creación de la JAE y su política de pensiones promovió no solo los elementos integrantes del discurso oficial, sino otros intereses ligados a los enfoques tecnocráticos de los problemas sociales difundidos en la Europa de la modernidad. En este estudio exploramos este segundo efecto, no reconocido suficientemente, mediante el examen de la trayectoria y propuestas de diversos pensionados que viajaron entre 1909 y 1932 a Alemania, Inglaterra, Bélgica, Suiza y Francia.

    1. Řečí poznávat a řečí tvořit. K fenomenologii jazykových výrazů

      Czech Academy of Sciences Publication Activity Database

      Puc, Jan

      2017-01-01

      Roč. 5, č. 1 (2017) ISSN 2336-1824 R&D Projects: GA ČR(CZ) GJ16-00994Y Institutional support: RVO:67985955 Keywords : phenomenology * speech * expression * language * Husserl * Merleau-Ponty Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.kuv.upol.cz/index.php?seo_url=aktualni-cislo&casopis=12&clanek=156

    2. Crescimento, metabolismo do carbono e partição de assimilados, em resposta à manipulação da razão fonte:dreno, em Coffea arabica L. sob condições de campo

      OpenAIRE

      Cunha, Roberto Lisboa

      2007-01-01

      Alterações no crescimento vegetativo, nas trocas gasosas, nos parâmetros de fluorescência da clorofila a, no metabolismo de carboidratos e no particionamento do 14carbono, em resposta à manipulação da relação fonte:dreno, foram investigadas em plantas de café cultivadas em campo. Essas manipulações foram realizadas por meio de desfrutificação e desfolhamento controlados, visando-se induzir alterações na capacidade fotossintética das folhas. Os tratamentos consistiram de: (i) remoção de todos ...

    3. Hotéis paulistanos: das razões da hospedagem urbana na cidade de São Paulo e as notícias em Almanaques e Memoriais do século XIX

      Directory of Open Access Journals (Sweden)

      Airton José Cavenaghi

      2011-05-01

      Full Text Available

      Este artigo, além de resgatar a produção existente relacionada a história da hotelaria na cidade de São Paulo, procura discutir a divulgação dos meios de hospedagem na cidade de São Paulo pelo uso de Almanaques e Memoriais publicados durante o século XIX. Analisa as informações divulgadas por estes veículos de informação e também estabelece diretrizes metodológicas diferenciadas para a interpretação desta documentação existente, pelo uso das técnicas historiográficas de pesquisa e análise. Pretende, desta forma, demonstrar que a história dos meios de hospedagem na cidade de São Paulo faz parte de um todo analítico vinculado a um cotidiano moldado pelas leituras possíveis do imaginário cultural do período. Procura, assim, abrir uma linha de trabalho interpretativo necessário a perceber a hotelaria paulistana pelo víeis de suas significações como instituições formadas na lógica de uma memória e de uma identidade histórica.

    4. Capacidade máxima de adsorção de fósforo e constante de energia em Latossolo Bruno em razão de diferentes ajustes do modelo Langmuir

      Directory of Open Access Journals (Sweden)

      Clovisson Menotti Boeira de Oliveira

      2014-12-01

      Full Text Available A capacidade máxima de adsorção de fósforo (CMAP é um parâmetro bastante útil para caracterizar a capacidade de adsorção de fósforo (P do solo e, por isso, o modelo de Langmuir, que possibilita essa estimativa, é bastante difundido. Porém, se o ajuste da equação for realizado por modelos não lineares ou linearizados, ou se forem escolhidos modelos de região única ou múltiplas, nem sempre os valores estimados da CMAP e da constante de energia de ligação (k são semelhantes. O objetivo deste trabalho foi avaliar o efeito do uso de diferentes métodos de ajuste do modelo de Langmuir sobre os valores estimados de CMAP e k. Para isso, utilizouse um único solo de alta capacidade de adsorção de P, o qual foi misturado a quantidades crescentes de areia lavada, construindo-se sistemas com capacidades de sorção crescentes, mas com a fase sólida constituída da mesma mineralogia. Foi utilizado solo do horizonte B de um Latossolo Bruno com 800 g kg-1 de argila, o qual foi misturado com areia em quantidades para obterem-se solos artificiais com 0, 200, 400, 600 e 800 g kg-1 de argila. Esses solos artificiais foram incubados por 30 dias com calcário para elevar o pH(H2O até 6,0 e, após, foram secos em estufa e peneirados. Foram realizadas as isotermas de adsorção e os dados ajustados pelo modelo de Langmuir, usando os seguintes métodos: NLin - não linear com região única; L-1R - linearização com região única; L-2RG - linearização com duas regiões, ajuste gráfico; L-3RG - linearização com três regiões, ajuste gráfico; L-2RE linerização com duas regiões, ajuste estatístico. Os resultados evidenciaram que todos os métodos utilizados estimaram valores de CMAP proporcionais ao teor de argila dos solos e poderiam ser usados para caracterizar os solos. Contudo, quando utilizados ajustes com mais de uma região de adsorção, os valores da CMAP para a última região foram sensivelmente superiores àqueles observados após a incubação do solo com doses de P em um teste adicional. Isso indica que a CMAP da última região deve ser evitada como caracterizadora da capacidade de adsorção do solo. Conforme era esperado, os valores de k foram proporcionais aos teores de argila do solo na primeira (ou única região dos modelos linearizados; contudo, não seguiram essa tendência no modelo não linear, recomendando-se cautela na interpretação da constante k ajustada por modelos não lineares.

    5. Causas de morte e razões para eutanásia de cães da Mesorregião do Centro Ocidental Rio-Grandense (1965-2004)

      OpenAIRE

      Fighera, Rafael A.; Souza, Tatiana M.; Silva, Marcia C.; Brum, Juliana S.; Graça, Dominguita L.; Kommers, Glaucia D.; Irigoyen, Luiz F.; Barros, Claudio S.L.

      2008-01-01

      Este estudo teve como objetivo principal determinar a prevalência das doenças que culminam em morte ou que fazem com que os cães da Mesorregião do Centro Ocidental Rio-Grandense sejam submetidos à eutanásia. Para isso, foram revisados todos os protocolos de necropsia de cães, arquivados no Laboratório de Patologia Veterinária (LPV) da Universidade Federal de Santa Maria (UFSM), realizadas entre janeiro de 1965 e dezembro de 2004. Nos arquivos do LPV-UFSM foram encontrados 4.844 protocolos de ...

    6. Erradicação da poliomielite: razões e maneiras de pôr em prática : uma análise teórica

      OpenAIRE

      Barreiros, Ana Filipa Correia

      2012-01-01

      Mestrado em Desenvolvimento e Saúde Global Prevenir e curar uma doença é um grande desafio e um grande feito, ao permitir apoiar o desenvolvimento pessoal de um indivíduo protegendo-o do grande peso para a vida humana que a doença representa. Este raciocínio aplica-se em particular à poliomielite, uma condição debilitante e já invisível no mundo desenvolvido, graças à introdução e disseminação de duas vacinas efectivas contra o poliovírus durante a década de 1950. A possibilidade de err...

    7. Viabilidade agroeconômica da consorciação do taro com feijão-vagem indeterminado em razão da época de plantio

      Directory of Open Access Journals (Sweden)

      Janiele Cássia Barbosa Vieira

      2014-04-01

      Full Text Available A consorciação de culturas é um sistema de cultivo que tem como objetivos principais alcançar alta produtividade por unidade de área e promover a sustentabilidade do sistema de produção. Objetivou-se com este trabalho avaliar a viabilidade agronômica e a rentabilidade econômica do consórcio do taro (Colocasia esculenta com feijão-vagem (Phaseolus vulgaris de hábito de crescimento indeterminado. O experimento foi conduzido a campo, na horta do Departamento de Fitotecnia da Universidade Federal de Viçosa, no período de outubro/2011 a junho/2012. Constou de sete tratamentos resultantes de três cultivos consorciados do taro com feijão-vagem, estabelecidos aos 0, 21 e 42 dias após o plantio do taro, e de quatro monoculturas, sendo três do feijão-vagem, estabelecidas nas mesmas épocas dos cultivos consorciados com o taro, e de uma do taro. O delineamento experimental utilizado foi o de blocos casualizados, com quatro repetições. Como material propagativo, utilizou-se o clone 'Japonês' e o cultivar de feijão-vagem 'Estrela'. A determinação dos custos de produção dos cultivos foi realizada com base no custo operacional de produção. Todos os sistemas consorciados foram agronomicamente viáveis, por apresentar Uso Eficiente da Terra (UET acima de um. Dentre esses destacam-se os consórcios do feijão-vagem com o taro implementados a 0 e 21 dias após o plantio do taro, por proporcionarem maior renda líquida e vantagem monetária corrigida.

    8. Estrutura populacional, razão sexual e abundância de Podocnemis sextuberculata (Testudines, Podocnemididae na Reserva de Desenvolvimento Sustentável Mamirauá, Amazonas, Brasil

      Directory of Open Access Journals (Sweden)

      Augusto Fachín-Terán

      2003-01-01

      Full Text Available We studied turtles in the focal area of the Reserva de Desenvolvimento Sustentável Mamirauá from September 1996 through August 1998. The reserve is located in the western part of the Brazilian Amazon, between the Japurá, Solimões, and Auti-Paraná rivers, near the city of Tefé, in the state of Amazonas. In this study the population structure, sex ratio and abundance of Podocnemis sextuberculata were investigated. We intensively studied the population of turtles in the Jarauá river basin in order to determine population structure. We sampled turtles in different sectors in the focal area of the reserve for one month each year during July and August of 1997 and 1998. We captured the turtles using flag gill nets and trammel nets. The type of net and the size of the nets used influenced the size of the turtles captured. The nets used by the local fishermen were sexually selective in the capture of the turtles. Sevent-two percent of the P. sextuberculata captured were adults; 13% juveniles and 14.7% subadults. During the second year of the study we found a lower density of turtles in the five areas wich we sampled each years. The sex ratio of captured P. sextuberculata was 1.87 males per female.

    9. A estratégia de kant para a fundamentação da metafísica dos costumes e o fato da razão

      OpenAIRE

      Santos, Melissa Regina Lentz dos

      2006-01-01

      Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Filosofia e Ciências Humanas. Programa de Pós-Graduação em Filosofia. A presente pesquisa tem como proposta fundamental a investigação do argumento de Immanuel Kant (1724 # 1804) para a Fundamentação da Metafísica dos Costumes (1785), obra na qual, vemos o esforço do filósofo em explicitar e fundamentar o princípio ético por ele adotado, a saber, o imperativo categórico. Temos nas duas primeiras seções uma apresenta...

    10. A importância relativa da emoção e da razão no processo de tomada de decisão do consumidor

      OpenAIRE

      Alves Cardoso, Adelino

      2012-01-01

      Tesis Doctoral leída en la Universidad Rey Juan Carlos de Madrid en 2012. Directores de la Tesis: Dr. Ferreira Cascão y Dr. Mónica Segóvia Pérez The consumer decision-making models evolved essentially from a perspective rationally based to emotions integration in the decision process. The Homo Economicus, that makes objective choices and that finds the necessary information about each alternative, has given up the place to the thinking man that is able to process cognitively the collected ...

    11. Causas de óbito e razões para eutanásia em uma população hospitalar de cães e gatos

      Directory of Open Access Journals (Sweden)

      Sílvia Manduca Trapp

      2010-10-01

      Full Text Available To determine the main causes of death in a population of dogs and cats from a University Veterinary Hospital, data from clinical records obtained from July, 2005 to July, 2009 were analyzed. During that period, 2,243 animals were taken to the hospital, 2,075 dogs and 168 cats. The percentage of death was 10.6% (220/2.075 in dogs, and 8.92% (15/168 in cats. The median age at death was 59.97 months for dogs and 82.79 months for cats. The main causes of death and reasons for euthanasia in dogs were infectious or parasitic diseases, diseases caused by physical agents and neoplasia. Except by their age, all other characteristics described did not have an effect on life expectancy or death causes in dogs. In cats, physical agents and urinary diseases were the main cause of mortality. The results observed in this work identify the need for prophylactic measures that will enable a better life expectancy, and consequently, change the frequency of the main causes of death and reasons for euthanasia in dogs and cats.

    12. A razão do diagnóstico em torno do ideal científico e a ruptura ética da psicanálise

      Directory of Open Access Journals (Sweden)

      Márcia Cristina Maesso

      Full Text Available Esse artigo visa sustentar uma posição acerca do diagnóstico em referência à ética da psicanálise proposta por Lacan, que é orientada pelo real posto na praxis e não pelo ideal científico. Partindo dos conceitos estabelecidos na psicanálise, situa o diagnóstico como ato de mestria no discurso médico, formulando que o avesso desse discurso constitui a possibilidade de conceber o diagnóstico na psicanálise como semi-dizer do impasse experimentado na clínica.

    13. Efecto del fotoperiodo y la razón camarón:macroalga en la remoción de nitrógeno amoniacal total por Gracilaria vermiculophylla, en cultivo con Litopenaeus vannamei, sin recambio de agua

      Directory of Open Access Journals (Sweden)

      Adolfo Sánchez-Romero

      2013-11-01

      Full Text Available Se evaluó el efecto del fotoperiodo y la relación de biomasa camarón:macroalga en la remoción de nitrógeno amoniacal total (NAT, por la macroalga Gracilaria vermiculophylla, en cultivo con camarón Litopenaeus vannamei, sin recambio de agua. Se evaluaron cuatro fotoperiodos: 12:12, 14:10, 16:08 y 24:00 h de luz:oscuridad y dos relaciones de biomasa camarón:macroalga, 1:4 y 1:8. El diseño experimental fue factorial de 4x2 con cuatro réplicas por tratamiento. Las menores concentraciones de NAT (0,55 ± 0,17 mg L-1, N-NO² (0,145 ± 0,29 mg L-1 y N-NO3 (3,13 ± 0,73 mg L-1 se registraron en la relación 1:8. Las mayores tasas de crecimiento de la macroalga (3,07 ± 1,44% día-1 se obtuvieron con fotoperiodo de 24:00 h y relación de biomasa 1:8. La mayor tasa de incorporación de N en la macroalga (0,31 ± 0,12 mg N L-1 día-1 ocurrió en las mismas condiciones. El crecimiento del camarón fue similar al reportado en sistemas tradicionales de recirculación. La integración de G. vermiculophylla en el sistema sin recambio, fue capaz de mantener los niveles de compuestos nitrogenados tóxicos en niveles favorables para el crecimiento de L. vannamei.

    14. Sobre un argumento meta-ético y un argumento político en La religión dentro de los límites de la mera razón

      Directory of Open Access Journals (Sweden)

      Macarena Marey

      2017-04-01

      Full Text Available En este trabajo, me propongo reconstruir dos tesis de importancia metaética, jurídica y política que Kant expone en Die Religion innerhalb der Grenzen der bloβen Vernunft. Se trata de dos tesis (con sus respectivas argumentaciones que mantienen una sólida consistencia con dos de los núcleos temáticos de la Rechstlehre, lo que nos permite proponer que el texto de 1793 puede ser considerado una suerte de crítica propedéutica para la metafísica jurídico-política de Kant. La primera de estas tesis será analizada en la sección I y atañe a la concepción metaética de la libertad que Kant presenta en Religion a propósito del análisis del mal radical. La segunda, analizada en la sección II, a la serie de diferencias trazadas entre el estado de naturaleza y la comunidad éticos, por un lado, y el estado de naturaleza y la comunidad jurídico-políticos, por el otro. En una sección III, presentaré el sentido que estas tesis obtienen respecto de la recepción crítica que Kant hace de las teorías modernas iusnaturales.

    15. Mais que uma razão econômica: apontamentos sobre a constituição do mercado de títulos da dívida pública brasileira

      Directory of Open Access Journals (Sweden)

      Ana Carolina Bichoffe

      2016-11-01

      dívida pública brasileira através de uma leitura da manifestação do risco de crédito soberano. Para isso são analisados dois momentos políticos considerados marcadores relevantes da constituição desta morfologia econômica e financeira. As disputas e tensões que estes dois momentos revelam, se mostram enquadramentos interessantes para entender a constituição inicial da estrutura de mercado brasileiro e o aparato cultural que lhe baliza. Recorre-se, portanto, à sociologia crítica, no qual a trama financeira é posta em perspectiva pelo viés histórico e cultural. Espera-se com este artigo contribuir para um referencial analítico que rompa com a forte inclinação economicista que domina as explicações e problematizações sobre o tema.

    16. Facelift rozjasňuje tvář a dává jí příjemně optimistický výraz

      Czech Academy of Sciences Publication Activity Database

      Lišková, Michaela

      2016-01-01

      Roč. 95, č. 5 (2016), s. 312-312 ISSN 0042-4544 Institutional support: RVO:68378092 Keywords : exemplification * monolingual dictionary * lexicography Subject RIV: AI - Linguistics OBOR OECD: Linguistics https://vesmir.cz/cz/casopis/archiv-casopisu/2016/cislo-5/facelift-rozjasnuje-tvar-dava-ji-prijemne-optimisticky-vyraz.html

    17. Retenção do fungicida triadimenol em latossolos em razão da calagem e da fosfatagem Retention of the fungicide triadimenol in Latosol due to lime and phosphate applications

      Directory of Open Access Journals (Sweden)

      Júlio César Azevedo Nóbrega

      2005-05-01

      Full Text Available O objetivo deste trabalho foi avaliar o efeito da calagem e da fosfatagem na retenção do triadimenol em um Latossolo Vermelho-Amarelo distrófico (LVAd e em um Latossolo Vermelho distrófico (LVd em microcolunas de solo. Calagem e fosfatagem, realizadas em conjunto, reduziram a retenção do produto nas amostras do LVAd (7,7% e 8,6%, respectivamente, para a dose de 2,67 e 10,68 kg ha-1 do princípio ativo. No LVd, a calagem e fosfatagem, quando realizadas isoladamente, causaram menor retenção do produto (calagem 7,2% e 3,9%, fosfatagem 10,1% e 6,8%, respectivamente, para as doses de 2,67 e 10,68 kg ha-1 em relação às amostras controle. Apesar da quantidade do produto na solução do solo ser inferior a 1% da dose aplicada, valores mais elevados do produto foram encontrados nas amostras de solo tratadas com calcário e fosfato, isoladamente ou não, no LVAd e, isoladamente, no LVd.The objective of this work was to evaluate the effect of liming and phosphate applications on the retention of triadimenol in microcolumns of soil material of a distrophic Red-Yellow Latosol (Typic Hapludox and a distrophic Red Latosol (Typic Hapludox. Lime and phosphate applications decreased retention of triadimenol on LVAd samples (7.7% and 8.6%, respectively, for 2.67 and 10.68 kg ha-1 of the active principle. Lower retention of triadimenol was observed on LVd samples when lime and phosphate were applied separately (liming 7.2% and 3.9%, phosphate fertilization 10.1% and 6.8%, respectively, for 2.67 and 10.68 kg ha-1 of the compound. In spite of the amount of the chemical in soil solution being inferior to 1% of the dose applied, higher values of the chemical were found in the samples with lime and phosphate, singly or not in the LVAd and singly in the LVd.

    18. Razão e sensibilidade no ensino de administração: a literatura como recurso estético Sense and sensibility in management teaching: literature as an aesthetic resource

      Directory of Open Access Journals (Sweden)

      Tânia Fischer

      2007-10-01

      Full Text Available Este artigo problematiza o uso da literatura como recurso estético durante o processo de ensino da administração, com base em uma análise multidisciplinar dos trabalhos acadêmicos publicados, com a finalidade de: refletir sobre literatura e o papel da ficção no ensino, articulando a literatura com a existência humana; abordar a pesquisa em organizações e o uso de gêneros e estilos literários na produção do conhecimento; e discutir sobre os usos dos textos literários em ensino, pelo relato e discussão de práticas que utilizam a literatura. Tem especial destaque a dimensão estratégica da atividade de ensino que usa a literatura como recurso estético. A conclusão é de que o texto literário é um poderoso recurso de aprendizagem, pois tem como matéria-prima a palavra, o discurso, que é a essência da administração. E, também, que a integração entre administração e literatura pode ser uma estratégia fecunda, favorecendo criatividade e descoberta, pois possibilita o desenvolvimento de capacitações para sentir e conhecer.The goal of this article is to challenge the use of literature as an aesthetic resource in management teaching-learning. The research is based on a multidisciplinary literature review in order to: think about fiction and its role in teaching, articulating fiction with human existence; explore organizational research and the use of literary genres and styles in knowledge production, and discuss about the use of literary texts in teaching through the presentation and discussion of practices using and capitalizing on fiction. Special attention is given to the strategic dimension of teaching activity that uses fiction as an aesthetic resource. The research's conclusion suggests that literary text is a powerful learning resource because it has as primary source accounts and discourse, these being the essence of management. Another conclusion is that the relationship between management and literature translates into a rich strategy, encouraging creativity and discovery as it allows the development of capabilities to feel and to know.

    19. Estudio de la segregación ocupacional por razón de género en el sector turístico de México

      Directory of Open Access Journals (Sweden)

      Denisse Gómez Bañuelos

      2017-01-01

      Full Text Available El sector turismo, uno de los mayores generadores de riqueza y empleo del mundo, ofrece a las mujeres casi el doble de oportunidades de convertirse en empresarias que cualquier otro sector económico. En los países en desarrollo, el turismo es una oportunidad potencial de empleo para ellas, por las escasas barreras para trabajar, la flexibilidad de los horarios de trabajo, el trabajo a tiempo parcial y los bajos niveles educativos requeridos. De ahí, que el turismo sea uno de los sectores que cuenta con mayor participación femenina. Sin embargo, es una realidad, que el trabajo femenino concentra los empleos más precarios, peor pagados y de baja cualificación. Por ello, los objetivos del presente trabajo son cuantificar el grado de segregación ocupacional existente y su variación en los últimos diez años (2005-2014, así como la clasificación ocupacional y su distribución jerárquica. La base de datos utilizada es la Encuesta Nacional de Ocupación y Empleo. Los resultados muestran que la segregación ocupacional del sector turístico representa sólo la tercera parte de la segregación existente a nivel nacional y que las mujeres siguen manteniendo las categorías ocupacionales con los salarios más bajos de la población. to.

    20. Ciencia y Razón en la Economía Política desde la teoría del cierre categorial. Los conceptos de composibilidad y rotación recurrente

      OpenAIRE

      Armesilla Conde, Santiago Javier

      2016-01-01

      En este artículo proponemos una definición alternativa para la Economía Política, de disciplina encargada del estudio de la "administración de los recursos escasos" a la de disciplina racional tecnológica con un campo propio encargada del estudio de la composibilidad de factores dentro de ese campo con vistas a la rotación recurrente de dichos factores en las sociedades políticas y las interacciones entre ellas derivadas e influidas por estas composiciones y esa rotación. Para ello, desde el ...

    1. La discriminación por razón de la edad en el mercado laboral y el problema específicos de las nuevas profesiones tecnológicamente dependientes (2015

      Directory of Open Access Journals (Sweden)

      Ana Sofia de Magalhães e Carvalho

      2017-12-01

      Full Text Available El artículo en cuestión se propone a analizar, a partir del foco jurídico, la situación de la discriminación por edad como factor impeditivo de acceso y/u permanencia en el mercado de trabajo. Internacionalmente considerase el factor etario como un componente discriminatorio en el mercado de trabajo, principalmente en lo que dice respeto a personas con edad más elevada que son excluidas y substituidas por personas más jóvenes. Por ello, serán examinados los acuerdos y convenciones internacionales, además de las legislaciones y medidas adoptadas por los Estados Unidos de América y Unión Europea – particularmente  por Portugal – con el objetivo de erradicar dicha discriminación el  ámbito laboral. Igualmente serán observadas las cuestiones referentes a las nuevas profesiones tecnológicamente dependientes y sus relaciones con la discriminación por edad y los elementos que dificultan el ingreso y permanencia de personas mayores de cuarenta y cinco años de edad en tales profesiones.

    2. K původu a vývoji českých výrazů vinohrad a vinice v areálovém kontextu

      Czech Academy of Sciences Publication Activity Database

      Villnow Komárková, Jana

      2016-01-01

      Roč. 64, č. 2 (2016), s. 65-76 ISSN 1803-7410 R&D Projects: GA ČR(CZ) GP14-01768P Institutional support: RVO:68378092 Keywords : etymology * areal linguistics * viticulture terminology Subject RIV: AI - Linguistics http://hdl.handle.net/11222.digilib/136174

    3. El control fiscal y la revisoría fiscal en las entidades públicas: frente al dictamen sobre los estados contables, ¿quién tiene la razón?

      OpenAIRE

      Castillo, Jesús Iván

      2008-01-01

      El control fiscal y la revisoría fiscal hacenparte de los mecanismos de control externo diseñados porel Estado para la vigilancia de la gestión fiscal de la administracióny para el aseguramiento del buen uso y conservaciónde los recursos públicos y privados, de conformidadcon las normas legales, que dadas las características y naturalezafuncional, presentan similitudes, pero también marcadasdiferencias.El control fiscal es una función pública, mediante la cual serealiza vigilancia sobre la fo...

    4. Pessimismo da razão, otimismo da vontade: a Escola de Frankfurt, Gramsci e os desdobramentos teóricos de duas concepções críticas díspares

      Directory of Open Access Journals (Sweden)

      Igor S. Machado

      2016-06-01

      Full Text Available A influente obra hodierna, de um lado, de Ernesto Laclau e Chantal Mouffe, e, de outro, de Jürgen Habermas, é um dentre os muitos sinais da proficuidade das obras, respectivamente, de Antonio Gramsci e da primeira geração da escola de Frankfurt no início do século XX. Buscando adequar a crítica marxista da sociedade ao contexto de seu tempo, esses autores desenvolveram interpretações originais da sociedade e seus modos de produção de bens culturais e consensos políticos que são até hoje trazidos à tona como relevantes para a Sociologia. Contudo, se partem quase que de uma mesma questão teórica, Gramsci e os primeiros pensadores da escola de Frankfurt, nem por isso, deixam de trilhar caminhos intelectuais quase avessos: enquanto Gramsci, mesmo no cárcere, constrói uma teoria positiva voltada à transformação social pondo em destaque o potencial revolucionário das transformações da sociedade capitalista, os teóricos de Frankfurt destacam em chave negativa o potencial dominador e totalitarista dessas mesmas mudanças. Assim, o presente artigo tem como escopo uma análise comparativa dessas duas correntes teóricas ressaltando suas semelhanças e diferenças e destacando, em cada um dos polos da comparação, seus pontos fortes e fracos na construção de uma teoria social crítica.

    5. De la razón jurídica hacia una ética peculiar. A propósito del informe mundial sobre el derecho a la educación de personas con discapacidad De la razón jurídica hacia una ética peculiar. A propósito del informe mundial sobre el derecho a la educación de personas con discapacidad

      Directory of Open Access Journals (Sweden)

      Carlos Skliar

      2010-03-01

      Full Text Available Este texto se plantea una relectura ética acerca del derecho a la educación de las personas con discapacidades, con un énfasis prioritario de la situación en América Latina. A partir de considerar los sistemas jurídicos, los modos de financiamiento políticos, los porcentajes de inclusión y los programas de seguimiento de la población con discapacidad en edad escolar, se deriva toda una serie de discusiones sobre la idea de formación educativa, el estar junto a otros y las responsabilidades éticas en la tarea de educar.This paper raises the need of an ethical re interpretation of the right to education of people with disabilities, with a strong emphasis in Latin America. By considering juridical systems, political fundings, inclusion percentages and monitoring programmes focused on people with dissabilities in school age, a series of discussions is proposed: about the idea of educational training, about living and being with others and about the ethical responsabilities in the task of teaching.

    6. Basic performance metrics of in-line inspection tools

      Energy Technology Data Exchange (ETDEWEB)

      Timashev, Sviatoslav A. [Russian Academy of Sciences (Russian Federation). Ural Branch. Science and Engineering Center

      2003-07-01

      The paper discusses current possibilities and drawbacks of in-line inspection (ILI) in detecting, identifying, locating and sizing of all types of defects in oil and gas pipelines. A full set of consistent and universal ILI tool performance metrics is constructed. A holistic methodology that extracts maximum value from the ILI measurements in defect detecting, locating, identifying, sizing and verifying the results of ILI is presented. The outlined approach is being implemented as a software component of a multi-purpose HR MFL ILI tool and is proposed for the new API 1163 ILI Qualification Standard. (author)

    7. Electronic Sentinel Surveillance of Influenza-like Illness. Experience from a pilot study in New Zealand.

      Science.gov (United States)

      Adnan, Mehnaz; Peterkin, Donald; Lopez, Liza; Mackereth, Graham

      2017-02-01

      Electronic reporting of Influenza-like illness (eILI) from primary care was implemented and evaluated in three general medical practices in New Zealand during May to September 2015. To measure the uptake of eILI and to identify the system's strength and limitations. Analysis of transactional data from the eILI system; comparative study of influenza-like illness cases reported using manual methods and eILI; questionnaire administered to clinical and operational stakeholders. Over the study period 66% of total ILI cases were reported using eILI. Reporting timeliness improved significantly compared to manual reporting with an average of 24 minutes from submission by the clinician to processing in the national database. Users found the system to be user-friendly. eILI assists clinicians to report ILI cases to public health authorities within a stipulated time period and is associated with faster, more reliable and improved information transfer.

    8. Türk Yazınından Seçili İki Romanda Göç ve Göçmen Olgusunun Paydaşlık Bağlamında Yansımaları

      Directory of Open Access Journals (Sweden)

      Birkan KARGI

      2017-09-01

      Full Text Available Nazan Bekiroğlu’nun 2012 yılında yayınlanan Nar Ağacı romanı ve Ali Arslan’ın 2003 yılında yayınlanan Ama Sevgi Kalmalı adlı romanda, anlatıcılar kendi köklerini ve kendilerinden önceki kuşakların göç yazgılarının izlerini sürerler. Bu yapıtlarda biri batıdan doğuya, diğeri ise doğudan batıya evlerinden ayrılarak göç etmek zorunda kalan protogonistlerin yaşam öyküleri ele alınmıştır. Nar Ağacı romanında protogonistin göç serüveni İran’ın Tebriz kentinden başlayıp Tiflis, Bakü, Batum ve Trabzon zincirinde gelişirken, Ama Sevgi Kalmalı adlı roman da protogonistin göç serüveni Hannover’in Linden bölgesinden Filistin’e oradan da Anadolu’ya, Egenin Seki köyüne kadar devam eder. Yapıtların arka dokusunu Rus işgali, Birinci Dünya Savaşı, Milli Mücadele ve sonrası oluşturur. Göç serüveninde, göçmenlerin kimlikleri bölünür, parçalanır ve kendilerini yeniden gerçekleştirmek zorunda hissederler. Bu bağlamda Hans’ın Sofiya’ya, Settarhan’ın Zehra’ya olan aşkları protogonistler için varoluşsal bir işlev görür. Aslında her iki yapıttaki protogonistlerin göç nedenlerini, kurulu düzene ‘karşı olma’ ve kendi farklılıklarını ortaya koyma üzerine kuruludur. Derrida’nın da vurguladığı gibi, kimlikler ancak kendi farklılıklarıyla var olabilir ve bir anlamda her kimlik ötekidir. Benzer şekilde Laclau’ya göre de tüm kimliklerin temelinde antagonizma ve dışlanma bulunur. Hans, savaş karşıtı duruşuyla Almanya’da ötekidir. Settarhan ise gelenek ve törelere karşı duruşuyla öteki olmak durumuna düşmüştür. Her ikisi de göç nedeniyle yeniden varlık sorunlarını biçimlendirmeye çalışırlar. Her iki yapıtta da göç, benzer nedenlere dayanmaktadır. Bu benzerlik, batı ve doğu dünyasının karşıtlığında ortaya çıkar. Avrupa’da Aydınlanma anlayışının gelişim sürecinde egemen olan modernite, bir yandan insanlara özgürlük sağlarken öte yandan insanın varlığını derin bir baskı altına almıştır. Adorno da, Batılı anlayışın, ahlâkî ve insanî sorumluluktan yoksun olduğunu vurgular. Hans da işte bu nedenden ötürü savaş karşıtı olarak göçe zorlanır. Öte yandan gelenek ve göreneklerin hâkim olduğu doğu dünyasında Settarhan öç ve intikam duygusuna direndiği için yollara düşer. Karşıtlıklar ‘ insanı her şey için ölçü alan’ hümanizmde birleşir.

    9. Investigation of the relationship between high school students’ academic procrastination behaviors and their use of social media

      Lise öğrencilerinin akademik erteleme davranışları ve sosyal medya kullanımları arasındaki ilişkilerin incelenmesi

      OpenAIRE

      Ercan Gürültü; Levent Deniz

      2017-01-01

      The main aim of this study is to investigate the relationship between high school students’ academic procrastination and their use of social media. The sample of this study consisted of 473 students From 6 different schools of Eyüp district in İstanbul in 2014-2015 academic year. To indentify students’ academic procrastination behaviors, ‘Academic Procrastination Scale’, developed by Çakıcı (2003), was applied. A twelve item questionnare, which was developed by researchers, was used in order ...

    10. A case study on the vicarious epitomes of the lifecycles in poems and folk songsYaşam dönemlerinin şiir ve türkülerle eşleştirilerek incelenmesine ilişkin örnek bir çalışma

      OpenAIRE

      Kılıç, Ilgım; Kılıç, Mustafa

      2016-01-01

      Each individual is both influenced by and has an impact on his/her culture of birth. Consequently, culture describes life to a certain extent and can penetrate almost all spheresof life. In this study, poems and folks songs related to life periods and development psychology sub-branches such as childhood, adolescence, adulthood and old age and concept of death are examined connectively. In this regard, this study is first and only in its field. “Factual qualitative” data has been used in ...

    11. Výzkum hodnotové orientace u studentů středních škol a odborných učilišť a navržení intervenčního programu.

      OpenAIRE

      JANDOVÁ, Romana

      2013-01-01

      Thesis deals with the value orientation of students in secondary schools and secondary vocational schools. The aim is to map their value system and then based on the results of research to design an intervention program to promote internalization of values desired. The theoretical part includes a systematic search of the available literature values and their hierarchy, the age period of adolescence, the ways and possibilities of educating students given age period and the role of schools in s...

    12. Současný krizový management středních odborných škol - vliv poklesu stavu žáků na středních odborných školách a odborných učilištích v Praze

      OpenAIRE

      Tuška, Pavel

      2012-01-01

      TITLE: The current risk management at secondary vocational schools - effect of the decline of students in secondary vocational schools and vocational schools in Prague. AUTHOR: Bc. Pavel Tuška DEPARTMENT: The Centre of the educational management SUPERVISOR: RNDr. Jana Marková ABSTRACT: The prosperity of every secondary vocational school and vocational school is primarily based on the demand for their service which also depends on the behaviour of the school in times of crisis. The rapid demog...

    13. Programlamaya ilişkin Öz Yeterlilik Algısı Ölçeğinin Türkçe Formunun Güvenirlik ve Geçerlik Çalışması

      Directory of Open Access Journals (Sweden)

      Arif ALTUN

      2012-12-01

      Full Text Available The purpose of this study is to adapt “Computer Programming Self-Efficacy Scale”, developed by Ramalingam and Wiedenbeck (1998, to Turkish and to examine individuals’ programming self-efficacy scores across demographic variables. The study group is consisted of 152 undergraduate students from different academic departments who have taken at least one programming course earlier. The original scale was a 7-likert type with 32 items in 4 factors (independence and persistence, ability to perform simple programming tasks, ability to perform complex programming tasks, self-regulation. In the adapted version, the scale was finalized with 9 items in 2 factors (ability to perform simple programming tasks and ability to perform complex programming tasks in Turkish form. Cronbach alpha coefficient was found to be .928 and McDonald’s  (omega, which is proposed as being more appropriate for congeneric measurement, was found to be .956. As a result of explanatory factor analysis, two factors have explained 80,814 % of the variance together and this factor structure has been confirmed with confirmatory factor analysis, which showed a valid and reliable scale to measure programming self efficacy.

    14. Güney-Batı Anadolu Bölgesindeki kızılçam (Pinus brutia Ten. kültür ormanlarında değişik silvikültürel uygulamalara göre artım ve büyüme ilişkileri

      Directory of Open Access Journals (Sweden)

      Dr. Neşat Erkan

      2017-11-01

      Full Text Available Bu çalışma ile sıklık çağına gelmiş kızılçam ağaçlandırma alanlarında yapılacak değişik dozdaki ayıklamaların ve aralamaların, meşcere artım ve büyümesi üzerine olan etkilerinin incelenmesi amaçlanmıştır. Araştırma, 1982-2016 yılları arasında Kaş-Tekircik ve Eğirdir-Aşağı Narlı kızılçam ağaçlandırma alanı olmak üzere iki yerde yürütülmüştür. Rastlantı blokları deneme deseni kullanılmış; Kaş ve Eğirdir deneme alanlarında toplam 5 blok ve 35 parselden elde edilen veriler değerlendirilmiştir. Araştırmada aralama şiddeti işlem olarak; 1 kontrol, 2 mutedil aralama ve 3 şiddetli aralama şeklinde üç işlemli bir uygulama yapılmıştır. Deneme parsellerinde, kontrol parselleri hariç olmak üzere, 1990 ve 2004 yıllarında, meşcerenin ihtiyaç gösterdiği parsellerde ve düzeyde aralamalara devam edilmiştir. Araştırma sonucu; Meşcereye müdahale edilen parsellerde, 1985, 1990 ve 2004 yıllarında yapılan ölçme sonuçlarına göre Ortalama çapın, belirgin bir şekilde arttığını göstermiştir. Yine her iki yerde, toplam 5 blok üzerinden yapılan varyans analiz sonucunda, aralamaların göğüs yüzeyi ve kalan meşcere hacmi üzerinde p<0,05 anlamlılık düzeyinde etkili olduğu anlaşılmıştır. Parsellerde 44. yaşında, kalan meşcere hacmi için yapılan varyans analizi sonuçlarına göre, aralama şiddetinin kalan meşcere hacmi üzerinde etkili olduğu gözlenmiştir. Genel meşcere hacminin ise, yapılan istatistik analizler sonucunda p<0,05 anlamlılık düzeyinde, aralamalardan etkilenmediği sonucuna ulaşılmıştır. Sonuç olarak, kızılçam ormanlarında, işletme amaçları çerçevesinde, büyümeyi kaliteli gövdeler üzerinde toplamaya yönelik olarak, büyümenin hızlı olduğu genç yaşlarda, ekonomik açıdan da uygun olacağı düşüncesi ile müdahale sıklığını azaltmak ve bunun için de şiddetli aralama ile göğüs yüzeyinin %35-40’ının alınması şeklinde aralamanın yapılabileceği önerilebilir.

    15. Kamu personelinde algılanan örgütsel desteğin örgütsel bağlılık ve örgütsel özdeşleşme düzeyleri ile ilişkisini belirlemeye yönelik bir araştırma

      OpenAIRE

      Barutcu, Kürşad

      2015-01-01

      Algılanan örgütsel destek (AÖD) bireylerin örgüte olan katkılarının ne derece önemsendiği, refahlarının ne derece dikkate alındığı ve üyesi oldukları örgütlerinin kedilerini ne derece destekleyip güvende hissetmelerini sağladıklarına olan inançlarıdır. Bireylerin örgütsel destek algılarının olumlu olduğu ortamlarda bireylerin karşılık olarak bir takım olumlu tepkilerde bulunacakları literatürde yer alan birçok araştırmada ifade edilmiştir. Bu kapsamda değerlendirildiğinde örgüt...

    16. The relation between the level of professional guidance of national education inspectors given to class teachers and the teacher motivationsMaarif müfettişlerinin sınıf öğretmenlerine mesleki rehberlik yapma düzeyleri ile öğretmen motivasyonu arasındaki ilişki

      OpenAIRE

      Çiçek Sağlam, Aycan; Demir, Murat

      2015-01-01

      The aim of is this research is to determine both the views of teachers on the guiding level of inspectors to class teachers, how their approaches motivate them and the relationship between the behaviours of inspectors considering their vocational guidance and the level of their motivational effect. The center of this research is constituted by the primary school teachers who have been working at 31 different primary schools that located in center of Uşak during 2014-2015 educational year. In ...

    17. Yeni Çevresel Paradigma Ölçeği ile organik gıda tüketicilerinin çevreye yönelik tutumlarının değerlendirilmesi: Ankara ili örneği

      OpenAIRE

      ATALAY, Ceyda

      2016-01-01

      Bu tezin temel amacı, araştırma kapsamındaki tüketicilerin organik gıda tüketirken çevreye yöneliktutumlarının “Yeni Çevresel Paradigma Ölçeği” ile incelenmesidir. Ayrıca, tüketicilerin organik gıdatüketimleri konusunda bilgileri, bu ürünleri tüketip tüketmeme nedenleri, organik gıda satın alırken tercihettikleri yerlerin seçimi ve bu gıdaları tüketirken çevreye duyarlı olup olmadıkları da araştırılmıştır.Araştırma Ankara’nın Çankaya ve Yenimahalle ilçelerindeki organik gıda satan 3 ...

    18. 11. sınıf öğrencilerinin düşünme stilleri, öğrenme stratejileri ve düşünme stilleri ile öğrenme stratejileri arasındaki ilişki

      OpenAIRE

      Çelik, Diren

      2016-01-01

      Toplumların geleceği, düşünebilen, yaratıcı ve muhakeme gücü yüksek bireyler yetiştirilmesiyle yön bulacaktır. Değişime uğrayan yaşam koşulları eğitim sistemine farklı bir bakış açısı kazandırmıştır. Günümüzde eğitimin amacı sadece bilginin kazandırılması, bilginin sorgulanmadan kabul edilip, davranışların bu doğrultuda sergileyen bireylerin yetiştirilmesi olmaktan çıkmıştır. Bunun yerine edinilen bilgiyi özümseyen, kendi tarzına uygun bir şekilde biçimlendiren, bağımsız düşünme becerilerine ...

    19. Manisa İli'nde özkıyım girişimlerine ilişkin özellikler: Beş yıllık verinin değerlendirilmesi/Retrospective evaluation of attempted suicides based on a register in the province of Manisa: Age and gender based variations of methods and reasons

      Directory of Open Access Journals (Sweden)

      Hatice Şimşek

      2014-04-01

      Full Text Available ÖzetAmaç: Manisa’da 2007-2011 yılları arasındaki özkıyım girişiminde bulunan olguların özelliklerinin cinsiyete göre incelenmesidir. Yöntem: Tanımlayıcı tipteki araştırma, Manisa Halk Sağlığı Müdürlüğü’nün intihar girişimleri kayıt formlarının incelemesiyle yapılmıştır.  Bulgular: Toplam 6827 olgunun 5311’i (%77.8 kadındır. Özkıyım girişiminde bulunan olguların %57.3’ü 15-24 yaş grubunda, %51.6’sı bekar, %62.2’si ilköğretim mezunudur. Olguların %95.8’inin özkıyım girişimi yöntemi zehirleyici maddedir. En yaygın özkıyım nedeni genel toplamda ve kadınlarda aile geçimsizliği-evlilik-çocuklarken, erkeklerde ruhsal hastalıktır. Özkıyım nedeni en sık, 15 yaş altında ve 15-24 yaş grubunda ebeveyn çatışmaları, 25-64 yaş grubunda aile geçimsizliği-evlilik-çocuklar, 65 yaş ve üzerinde ruhsal ve bedensel hastalıktır. Sonuç: Özkıyım girişiminde bulunan olguların çoğunluğu kadın, ergen/genç yaş grubu, ilköğretim mezunu olanlar, çalışmayanlardır. Başlıca özkıyım girişimi yöntemi ilaç ve zehirleyici madde kullanımıdır. Nedenler de yaş grubu ve cinsiyete göre değişmektedir.Anahtar Kelimeler: Özkıyım,  özkıyım girişimi, epidemiyoloji, risk etmeniAbstractObjective: The study determined, by gender and age group, the characteristics of individuals who had attempted suicide in Manisa between the years 2007-2011.Method: This was a descriptive study conducted by retrospective research of "suicide attempt entry forms". Results:A total of 6827 suicides were evaluated. 5311 (77.8% were women, 57.3% were aged 15-24 years, 51.6% were single, 62.2% had graduated from primary schools. In 95.8% of the suicides the method of suicide was self-poisoning with drugs. The most common reasons for the suicide attempts in total and among women were family problems, marriage and children; mental illness among men. The most frequent reasons for the suicide attempts among those who were 15-24 years of age were conflicts with parents; among the age group of 25-64 the reasons were family problems, marriage or children, and among those who were 65 years and over the reasons were mental or physical illnesses.Conclusion: The main determinants of suicide attempts were female gender, adolescents and/or young adults, primary school as an educational level, unemployed individuals. The most frequent suicide method was self-poisoning. Reasons of attempts displayed variation based on age group and gender.Key words:  suicide, suicide attempt, epidemiology, risk factor  

    20. Nacrt geneze pojma stila u starijoj teorijsko-umetničkoj misli ili, prilog oblikovanju povesnog prostora umetnosti / The Scheme of Genesis of the Concept of Style in Older Theoretical and Artistic Thought or Addition to the Forming of Historical Space of Art

      Directory of Open Access Journals (Sweden)

      Radovan Popović

      2012-12-01

      Full Text Available During the course of its historical-intellectual shaping, the style, gradually but obviously and positively shifting from one framework of onto-logical deliberation – within which it was being constituted on the margin of what Plato determined to be the essence of mind as the essence in mind or, in other words, idea – to another, assuming the form of probable knowledge or the knowledge of things presumed, being the ability of creative imagination which reveals but does not make evident (ars inveniendi, the importance of which is pointed out in man’s practical self-accomplishment as a community-being, which disposes not only of the truth of apodictic reasoning but also of convictions and truisms (loci communes which, transposed into the canons of rhetoric, represent since Hellenism and the period of Roman domination (Cicero, Seneca, etc. not only a stronghold of variability and expressive abundance of dialectical argumentation but also a generic basis which gives to understand originality and irreducibility to normativity (Quintillian as motivators of the overall progress of civilization. Having considered that, and also reaching anew for the sources of antiquity, the uomini universali from the period of European history which we traditionally name the Renaissance assuming to their spiritual sensibility founded upon the religious experience of Christian subjectivity the heritage of logical and axiological structure of hellenico-roman pattern of thinking, form a notion or at least an idea of style which is then, probably for the first time, beginning to be brought in relation to literature and pictorial art as their differentia specifica, in opposition to philosophy, theology and jurisprudence. Until the end of the eighteenth century however, the style remains more or less firmly attached to purely contemplative aesthetic deliberations which tend to draw from the inexhaustible wealth of concretizations of style in the artistic creation examples to illustrate their proposed theses. The consideration of style outside aesthetics as a philosophical discipline emerges about the mid-nineteenth century and especially at the end of the nineteenth and the beginning of the twentieth century when, in the works of theorists such as Heinrich Wölfflin and Max Dvořák, the style assumes its role of analytical and critical category on the one hand, and the frameworks in which art acquires its own worth and importance on the other.

    1. Interstitial lung involvement in rheumatoid arthritis

      Directory of Open Access Journals (Sweden)

      David Vladimirovich Bestaev

      2014-01-01

      Full Text Available Rheumatoid arthritis (RA is a systemic autoimmune rheumatic disease of unknown etiology, characterized by chronic erosive arthritis and extraarticular manifestations. Pulmonary involvement is one of the common extraarticular manifestations of RA and may show itself as bronchial tree lesions, rheumatoid nodules, Caplan's syndrome, and lesions in the pleura or pulmonary interstitium (interstitial lung involvement (ILI. High-resolution computed tomography allows the diagnosis of ILI in RA in nearly 70% of cases although the incidence of ILI may be lower (4 to 30% depending on diagnostic methods and patient selection criteria. There are several histopathological types of ILI, the differential diagnosis of which can be troublesome. Usual interstitial pneumonia (UIP and nonspecific interstitial pneumonia are major types of RA-associated ILI. UIP-pattern ILI has a more severe course than ILI with other histological patterns. The clinical presentation of ILI may be complicated by the likely toxic effect of a number of disease-modifying antirheumatic drugs (DMARDs used to treat RA, such as methotrexate and leflunomide, and biological agents (BAs, tumor necrosis factor-α (TNF-α inhibitors. The pathogenesis of pulmonary involvement in RA and the role of synthetic DMARDs and BAs in the development of ILI call for further investigations.An extraarticular manifestation, such as ILI, affects the choice of treatment policy in patients with RA.The relevance of a study of ILI is beyond question. The paper discusses the state-of-the-art of investigations in this area.

    2. Emergency department and 'Google flu trends' data as syndromic surveillance indicators for seasonal influenza.

      Science.gov (United States)

      Thompson, L H; Malik, M T; Gumel, A; Strome, T; Mahmud, S M

      2014-11-01

      We evaluated syndromic indicators of influenza disease activity developed using emergency department (ED) data - total ED visits attributed to influenza-like illness (ILI) ('ED ILI volume') and percentage of visits attributed to ILI ('ED ILI percent') - and Google flu trends (GFT) data (ILI cases/100 000 physician visits). Congruity and correlation among these indicators and between these indicators and weekly count of laboratory-confirmed influenza in Manitoba was assessed graphically using linear regression models. Both ED and GFT data performed well as syndromic indicators of influenza activity, and were highly correlated with each other in real time. The strongest correlations between virological data and ED ILI volume and ED ILI percent, respectively, were 0·77 and 0·71. The strongest correlation of GFT was 0·74. Seasonal influenza activity may be effectively monitored using ED and GFT data.

    3. Influenza-like illness in a Vietnamese province: epidemiology in correlation with weather factors and determinants from the surveillance system.

      Science.gov (United States)

      Minh An, Dao Thi; Ngoc, Nguyen Thi Bich; Nilsson, Maria

      2014-01-01

      Seasonal influenza affects from 5 to 15% of the world's population annually and causes an estimated 250,000-500,000 deaths worldwide. The World Health Organization (WHO) recommends 'sentinel surveillance' for influenza-like illness (ILI) because it is simple and calls for standardized methods at a relatively low cost that can be implemented throughout the world. In Vietnam, ILI is a key priority for public health also because of its annually recurring temporal pattern. Two major factors, on which the spread of influenza depends, are the strain of the virus and its rate of mutation, since flu strains constantly mutate as they compete with host immune systems. In the context of global climate change, the role of climatic factors has been discussed, as they may significantly contribute to the cause of large outbreaks of ILI. 1) To describe the epidemiology of ILI in Ha Nam province, Vietnam; 2) to seek scientific evidence on the association of ILI occurrence with weather factors in Ha Nam province; and 3) to analyze factors from the Ha Nam ILI surveillance system that contribute to explaining the correlation between the ILI and the weather factors. A data set of 89,270 monthly reported ILI cases from 2008 to 2012 in Ha Nam was used to describe ILI epidemiological characteristics. Spearman correlation analyses between ILI cases and weather factors were conducted to identify which preceding period of months and weather patterns influenced the occurrence of ILI cases. Ten in-depth interviews with health workers in charge of recording and reporting ILI cases at different levels of the ILI surveillance system were conducted to gain a deeper understanding of factors contributing to explaining the relation between the ILI and the weather factors. The results indicated that the ILI occurred annually in all districts of the Ha Nam province in the five studied years. An epidemic occurred in 2009 with the number of cases three times higher than the average threshold. There was a

    4. Influenza-like illness in a Vietnamese province: epidemiology in correlation with weather factors and determinants from the surveillance system

      Directory of Open Access Journals (Sweden)

      Dao Thi Minh An

      2014-12-01

      Full Text Available Background: Seasonal influenza affects from 5 to 15% of the world's population annually and causes an estimated 250,000–500,000 deaths worldwide. The World Health Organization (WHO recommends ‘sentinel surveillance’ for influenza-like illness (ILI because it is simple and calls for standardized methods at a relatively low cost that can be implemented throughout the world. In Vietnam, ILI is a key priority for public health also because of its annually recurring temporal pattern. Two major factors, on which the spread of influenza depends, are the strain of the virus and its rate of mutation, since flu strains constantly mutate as they compete with host immune systems. In the context of global climate change, the role of climatic factors has been discussed, as they may significantly contribute to the cause of large outbreaks of ILI. Objectives: 1 To describe the epidemiology of ILI in Ha Nam province, Vietnam; 2 to seek scientific evidence on the association of ILI occurrence with weather factors in Ha Nam province; and 3 to analyze factors from the Ha Nam ILI surveillance system that contribute to explaining the correlation between the ILI and the weather factors. Design: A data set of 89,270 monthly reported ILI cases from 2008 to 2012 in Ha Nam was used to describe ILI epidemiological characteristics. Spearman correlation analyses between ILI cases and weather factors were conducted to identify which preceding period of months and weather patterns influenced the occurrence of ILI cases. Ten in-depth interviews with health workers in charge of recording and reporting ILI cases at different levels of the ILI surveillance system were conducted to gain a deeper understanding of factors contributing to explaining the relation between the ILI and the weather factors. Results: The results indicated that the ILI occurred annually in all districts of the Ha Nam province in the five studied years. An epidemic occurred in 2009 with the number of

    5. Intermedilysin induces EGR-1 expression through calcineurin/NFAT pathway in human cholangiocellular carcinoma cells

      International Nuclear Information System (INIS)

      Susilowati, Heni; Okamura, Hirohiko; Hirota, Katsuhiko; Shono, Masayuki; Yoshida, Kaya; Murakami, Keiji; Tabata, Atsushi; Nagamune, Hideaki; Haneji, Tatsuji; Miyake, Yoichiro

      2011-01-01

      Research highlights: → ILY leads to the accumulation of [Ca 2+ ]i in the nucleus in HuCCT1 cells. → ILY induced activation of NFAT1 through a calcineurin-dependent pathway. → Calcineuri/NFAT pathway is involved in EGR-1 expression in response to ILY treatment. -- Abstract: Intermedilysin (ILY) is a cholesterol-dependent cytolysin produced by Streptococcus intermedius, which is associated with human brain and liver abscesses. Although intrahepatic bile duct cells play a valuable role in the pathogenesis of liver abscess, the molecular mechanism of ILY-treated intrahepatic bile duct cells remains unknown. In this study, we report that ILY induced a nuclear accumulation of intracellular calcium ([Ca 2+ ]i) in human cholangiocellular cells HuCCT1. We also demonstrate that 10 ng/ml ILY induced NFAT1 dephosphorylation and its nuclear translocation in HuCCT1 cells. In contrast to the result that ILY induced NF-κB translocation in human hepatic HepG2 cells, ILY did not affect NF-κB localization in HuCCT1 cells. Dephosphorylation and nuclear translocation of NFAT1 caused by ILY were prevented by [Ca 2+ ]i calcium chelator, BAPTA/AM, and calcineurin inhibitors, cyclosporine A and tacrolimus. ILY induced early growth response-1 (EGR-1) expression and it was inhibited by the pre-treatment with cyclosporine A, indicating that the calcineurin/NFAT pathway was involved in EGR-1 expression in response to ILY. ILY-induced calcineurin/NFAT1 activation and sequential EGR-1 expression might be related to the pathogenesis of S. intermedius in human bile duct cells.

    6. Intermedilysin induces EGR-1 expression through calcineurin/NFAT pathway in human cholangiocellular carcinoma cells

      Energy Technology Data Exchange (ETDEWEB)

      Susilowati, Heni [Department of Oral Microbiology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan); Okamura, Hirohiko [Department of Histology and Oral Histology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan); Hirota, Katsuhiko, E-mail: hirota@dent.tokushima-u.ac.jp [Department of Oral Microbiology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan); Shono, Masayuki [Support Center for Advanced Medical Sciences, The University of Tokushima, Tokushima 770-8504 (Japan); Yoshida, Kaya [Department of Fundamental Oral Health Science, School of Oral Health and Welfare, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan); Murakami, Keiji [Department of Oral Microbiology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan); Tabata, Atsushi; Nagamune, Hideaki [Department of Biological Science and Technology, Life System, Institute of Technology and Science, The University of Tokushima Graduate School, Tokushima 770-8506 (Japan); Haneji, Tatsuji [Department of Histology and Oral Histology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan); Miyake, Yoichiro [Department of Oral Microbiology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima 770-8504 (Japan)

      2011-01-07

      Research highlights: {yields} ILY leads to the accumulation of [Ca{sup 2+}]i in the nucleus in HuCCT1 cells. {yields} ILY induced activation of NFAT1 through a calcineurin-dependent pathway. {yields} Calcineuri/NFAT pathway is involved in EGR-1 expression in response to ILY treatment. -- Abstract: Intermedilysin (ILY) is a cholesterol-dependent cytolysin produced by Streptococcus intermedius, which is associated with human brain and liver abscesses. Although intrahepatic bile duct cells play a valuable role in the pathogenesis of liver abscess, the molecular mechanism of ILY-treated intrahepatic bile duct cells remains unknown. In this study, we report that ILY induced a nuclear accumulation of intracellular calcium ([Ca{sup 2+}]i) in human cholangiocellular cells HuCCT1. We also demonstrate that 10 ng/ml ILY induced NFAT1 dephosphorylation and its nuclear translocation in HuCCT1 cells. In contrast to the result that ILY induced NF-{kappa}B translocation in human hepatic HepG2 cells, ILY did not affect NF-{kappa}B localization in HuCCT1 cells. Dephosphorylation and nuclear translocation of NFAT1 caused by ILY were prevented by [Ca{sup 2+}]i calcium chelator, BAPTA/AM, and calcineurin inhibitors, cyclosporine A and tacrolimus. ILY induced early growth response-1 (EGR-1) expression and it was inhibited by the pre-treatment with cyclosporine A, indicating that the calcineurin/NFAT pathway was involved in EGR-1 expression in response to ILY. ILY-induced calcineurin/NFAT1 activation and sequential EGR-1 expression might be related to the pathogenesis of S. intermedius in human bile duct cells.

    7. Analogia humeana entre a ação moral e o movimento mecânico: uma interpretação para a relação entre as paixões e a razão

      Directory of Open Access Journals (Sweden)

      Andreh Sabino Ribeiro

      2011-06-01

      Full Text Available The aim of this paper is to show the analogy that David Hume (1711 - 1776 makes between moral action and the mechanical movement as a clear indication of his understanding of the relationship between reason (direction and passions (force in human conduct. Stretching from Hume's moral epistemology to his social theory, the notion that carries this analogy would serve to endorse the view that the Scottish philosopher was trying to become a sort of "Newton of the moral sciences." This meant thinking about moral philosophy within the limits of nature and allowing an independent research, especially in relation to the religious tradition. Hume´s philosophy could be also a performative image of the movement, while an inseparable composition made of the impulse of the contents of sentimental trend, according to Shaftesbury and Hutcheson, and the direction of the empirical methods come from Francis Bacon and Isaac Newton.

    8. Impacto no ativo imobilizado em razão da convergência dos padrões internacionais de Contabilidade aplicada ao Setor Público: uma pesquisa-ação na Câmara Municipal de Santa Bárbara D’Oeste

      OpenAIRE

      Borges, Alex

      2015-01-01

      A Contabilidade Aplicada ao Setor Público no Brasil está sendo elevada a um novo nível por meio da convergência aos padrões internacionais. Este processo de convergência tem como objetivo a adoção das IPSAS (International Public Sector Accounting). A partir desse processo foi resgatado no setor público brasileiro o foco patrimonial que possibilitou a introdução de novos procedimentos de contabilização do ativo, tais como reavaliação, redução ao valor recuperável (impairment) e depreciação. Se...

    9. Causas de morte e razões para eutanásia de cães da Mesorregião do Centro Ocidental Rio-Grandense (1965-2004) Causes of death and reasons for euthanasia in dogs from the midland region of the Midwest of Rio Grande do Sul State, Brazil (1965-2004)

      OpenAIRE

      Rafael A. Fighera; Tatiana M. Souza; Marcia C. Silva; Juliana S. Brum; Dominguita L. Graça; Glaucia D. Kommers; Luiz F. Irigoyen; Claudio S.L. Barros

      2008-01-01

      Este estudo teve como objetivo principal determinar a prevalência das doenças que culminam em morte ou que fazem com que os cães da Mesorregião do Centro Ocidental Rio-Grandense sejam submetidos à eutanásia. Para isso, foram revisados todos os protocolos de necropsia de cães, arquivados no Laboratório de Patologia Veterinária (LPV) da Universidade Federal de Santa Maria (UFSM), realizadas entre janeiro de 1965 e dezembro de 2004. Nos arquivos do LPV-UFSM foram encontrados 4.844 protocolos de ...

    10. Production of basic potato seed minitubers in substrate and different nitrogen rates Produção de minitubérculos de batata-semente básica em substrato em razão de doses de nitrogênio

      Directory of Open Access Journals (Sweden)

      Carla de Bem dos Santos Souza

      2012-12-01

      Full Text Available The optimal dose of nitrogen (N in potato crop depends on the production system. The objective of this study was to determine the optimal dose of N for the production of basic potato seed minitubers and evaluate the effect of N rates on physiological and nitrogen indices in the youngest fully developed leaf (fourth leaf and in the oldest leaf of the plants at 60 days after planting. The experiment was conducted in a greenhouse at the Departamento de Fitotecnia da Universidade Federal de Viçosa. The treatments consisted of five N rates (0, 45, 90, 180 and 360 mg dm-3, with 10% of each dose applied at planting and the remainder through irrigation water, daily, for 30 days. The nitrogen rates positively influenced the physiological indices (length, width, leaf area, number of leaves, fresh mass and dry mass and nitrogen (level and content of N and N-NO³ in the dry mass and SPAD both in the fourth leaf and in the oldest leaf. Likewise, the N rates positively influenced the number and mass of harvested tubers. The largest number (5.44 tubers/plant and the maximum mass of tubers (243.5 g/plant were obtained with 360.0 and 332.9 mg N dm-3, respectively. Therefore, the mass and number of tubers were not optimized by the same N rate. The critical SPAD index was 38.8 in the fourth leaf, which was more sensitive to the effect of N rates than the oldest leaf.A dose ótima de nitrogênio (N na cultura da batata depende do sistema de produção. O objetivo deste trabalho foi determinar a dose ótima de N para a produção de minitubérculos de batata-semente básica e avaliar o efeito de doses de N sobre índices nitrogenados e fisiológicos determinados na folha mais jovem completamente desenvolvida (quarta folha e na folha mais velha da planta, aos 60 dias após o plantio. O experimento foi realizado em ambiente protegido, no Departamento de Fitotecnia da Universidade Federal de Viçosa. Os tratamentos foram constituídos por cinco doses de N (0, 45, 90, 180 e 360 mg dm-3, sendo 10% de cada dose aplicada em pré-plantio e o restante via água de irrigação, diariamente, por 30 dias. As doses de N influenciaram positivamente os índices fisiológicos (comprimento, largura, área foliar, número de folíolos, massas de matérias fresca e seca e nitrogenados (teor e conteúdo de N e N-NO3 na matéria seca e índice SPAD tanto na quarta folha quanto na folha velha. Da mesma forma, doses de N influenciaram positivamente o número e a massa de tubérculos colhidos. O maior número (5,44 tubérculos/planta e a máxima massa de tubérculos (243,5 g/planta foram obtidos com 360,0 e 332,9 mg dm-3 de N, respectivamente. Portanto, número e massa de tubérculos não foram otimizados pela mesma dose de N. O índice crítico SPAD na quarta folha foi 38,8, sendo essa mais sensível ao efeito de doses de N do que a folha mais velha.

    11. Princípio de razão e o “conhecimento das causas”: considerações sobre o valor fundamental da verdade e o seu sentido = Principle of reason and “knowledge of causes”: considerations on the inner value of truth and its meaning

      Directory of Open Access Journals (Sweden)

      Moraes, Dax

      2013-01-01

      Full Text Available As críticas nietzscheanas dos valores e da verdade dirigem-se a um tipo da vontade que exige do mundo uma causa universal que lhe sirva como explicação. O presente ensaio concentra-se no significado fundamental desse sentimento comum à ciência e à religião enquanto resposta à total ausência de sentido, uma vez que o sentido de cada coisa, na existência, não se deve a nada mais senão à nossa própria criação

    12. “Qual a razão de eu, Schopenhauer, continuar leal a Mozart e Rossini?” Tentativa duma explicação. A estética musical de Schopenhauer como solução à dicotomia dos Enciclopedistas franceses Rameau e Rousseau

      Directory of Open Access Journals (Sweden)

      Cristóvão S. Marinheiro

      2012-08-01

      Full Text Available http://dx.doi.org/10.5007/1677-2954.2012v11nesp1p273 A estética musical schopenhaueriana é geralmente interpretada à luz da leitura que dela fizeram R. Wagner e F. Nietzsche. O seu grande mérito reside porém não na influência que ela veio a exercer, mas sim na capacidade que mostrou Schopenhauer em recolher e sobretudo em conciliar as posições antagonistas do século das Luzes com a sua intuição primeira de Vontade. A esse efeito propomos uma interpretação do § 52 da primeira edição do Mundo à luz de Rousseau, Rameau e Diderot, Wackenroder e Tieck. Estes autores enquadraram desde logo o pensamento de Schopenhauer, que se nos apresenta com duas analogias; a primeira, explícita, entre música e mundo, a segunda entre música e linguagem universal, ritmando o nosso artigo. Na sua primeira analogia, levantamos os “erros de compreensão” feitos por Schopenhauer, que nos levam à compreensão do enraizamento do seu pensamento musical no “baixo subentendido” de Rameau. A segunda analogia revela-se como uma ideia já presente nos pré-românticos Wackenroder e Tieck, i.e. a superioridade da música instrumental sobre a música vocal, da qual Schopenhauer soube tirar uma mais-valia metafísica ligando-a ao seu conceito de vontade. Esperamos com esta análise histórica de teoria musical oferecer elementos de resposta a um dos maiores enigmas da história da estética musical do século XIX: a incompreensão de Schopenhauer para com os músicos por ele inspirados.

    13. O Dissecador de Passarinhos e a Idade da Razão – Reflexões sobre a relação entre recepção e criação na produção literária

      Directory of Open Access Journals (Sweden)

      Kleber Pereira dos Santos

      2009-10-01

      Full Text Available From a previous study on the importance of sartrean intertext during the writing and rewriting of the novel O Ventre of Carlos Heitor Cony, this article intends to reflect on the relationship between creation and reception in the literature.  

    14. As razões da escola médica: sobre professores e seus valores. Os valores dos médicos e os impasses da escola médica Medical school and its reasons: on professors and their values. Physicians' values and impasses in medical school

      Directory of Open Access Journals (Sweden)

      Lucia Grando Bulcão

      2003-06-01

      Full Text Available Este trabalho teve por objetivo conhecer o professor médico, no que diz respeito a seus valores e comportamentos profissionais, a partir da hipótese de que os mesmos são elementos presentes no chamado currículo oculto ao longo do curso médico. Pressupõe-se, sobretudo, que tais elementos apresentam estreita relação com a formação médica, compondo, ao final, uma cultura adquirida na escola, ao longo do processo de socialização do estudante. Este processo é tão importante para a identidade profissional, para sua pertinência à corporação, quanto a aquisição de habilidades e conteúdos cognitivos relativos ao exercício técnico da profissão. Com este objetivo, o trabalho analisou a história de vida profissional de alguns docentes em uma escola pública do Rio de Janeiro, privilegiando as categorias de autonomia, ideal de serviço, mentalidade clínica e relacionamento interpares da Sociologia das Profissões, além de apreender os relatos específicos sobre a trajetória do médico que se torna professor. Optou-se pela história oral obtida de entrevistas com docentes de diferentes especialidades, em um total de onze entrevistas. Concluiu-se que os professores estão nostálgicos de um passado em que sua profissão apresentava uma situação de prestígio inquestionável e um tanto perplexos frente às novas situações, principalmente de restrições à autonomia liberal. Sem um projeto político para a escola e para a corporação, estão menos motivados do que no passado, e isto pode se constituir como fator negativo na socialização e na formação de valores éticos entre seus alunos.This study focuses on medical school professors and their professional values and behaviors, based on the hypothesis that the latter are present in the so-called hidden curriculum in medical education. The primary supposition is that such elements bear a close relationship to medical training, ultimately comprising a culture acquired in medical school over the course of the student's socialization process. This process is as important for professional identity (or belonging to the medical corporation as the acquisition of skills and technical contents related to the actual exercise of the medical profession per se. The study thus analyzed the life histories of several professors from a public medical school in Rio de Janeiro, concentrating on the categories of autonomy, service ideal, clinical reasoning, and inter-peer relations as defined in the Sociology of Professions, in addition to recording specific reports on the careers of physicians who had become professors. We used oral histories obtained through eleven interviews with professors from different specialties. The article concludes that medical professors feel nostalgia for a past in which their profession bore unquestionable prestige, meanwhile expressing bewilderment at new situations, especially restrictions over their autonomy as liberal professionals. Lacking a policy proposal for either the teaching school or the medical corporation, they are less motivated than in the past, and this may constitute a negative factor in the socialization and formation of ethical values among their students.

    15. A los tuyos con razón o sin ella Redes de poder, candidaturas y recomendaciones en el estado soberano de Santander (1859-1886). El caso de la red del general Solón Wilches Calderón

      OpenAIRE

      Guerra, Adriano Israel

      2015-01-01

      Esta investigación busca primero, a manera de balance, presentar los textos realizados sobre el tema específico del General Solón Wilches Calderón en el Estado Soberano de Santander. Luego se profundiza en el concepto central que estamos utilizando: Redes de poder, sin dejar de definir otros aspectos teóricos. El primer capítulo tiene por objetivo principal dibujar el mapa político durante el Estado Soberano de Santander estableciendo sus principales actores, grupos, conflictos y sus proyecto...

    16. Análisis de la influencia de la razón de transmisión en la velocidad específica de deslizamiento // Analysis of the influence of the transmission reason in the specific speed of slip

      Directory of Open Access Journals (Sweden)

      Orestes González-Quintero

      2010-01-01

      Full Text Available ResumenLas transmisiones por engranajes pueden sufrir múltiples deterioros durante su funcionamiento yentre las fallas más comunes, propia de las transmisiones no lubricadas, se encuentra el desgaste,que se caracteriza por la disminución del espesor del diente en la zona de la cabeza y del pie, que esdonde mayor velocidad de deslizamiento existe. En este trabajo se exponen las ecuaciones básicaspara el cálculo de las velocidades de deslizamiento, de desplazamiento y específica dedeslizamiento, finalmente, utilizando un programa elaborado en una Hoja de Cálculo de Excel y conel auxilio del software AutoCAD fueron evaluados cuatro casos de transmisiones por engranajescilíndricos de dientes rectos, para determinar la influencia de la relación de transmisión en lavelocidad específica de deslizamiento en ruedas dentadas cilíndricas de dientes rectos.Palabras claves: Engranajes, velocidad de deslizamiento, velocidad de desplazamiento, velocidadespecífica de deslizamiento, desgaste.________________________________________________________________________AbstractGear transmissions can suffer multiple fails during their operation, being wear one of the mostcommon, this fail is characteristic of the not lubricated transmissions, and it is characterized by thedecrease of the thickness of the tooth up and down the tooth height that is where main slidingvelocity exists. In this work the essential equations for the calculation of the sliding, displacementand specific sliding velocity, are exposed, finally, using a program elaborated in a EXCELspreadsheet and with the employment of the software AutoCAD, four cases of spur geartransmissions were evaluated, to determine the influence of the velocity ratio in the specific slidingvelocity.Key words: Gearing, sliding velocity, displacement velocity, specific sliding velocity, wear

    17. Saúde, razão prática e dimensão simbólica dos usos da internet: notas etnográficas sobre os sentidos da reprodução Health, practical reason and symbolic dimension of internet usages: ethnographic notes on the meanings attributed to reproduction

      Directory of Open Access Journals (Sweden)

      Eliane Portes Vargas

      2010-03-01

      Full Text Available Este trabalho buscou analisar os usos da internet tendo em vista a difusão de valores sociais associados à popularização da temática da reprodução humana em websites de saúde. Resulta de uma pesquisa etnográfica mais ampla sobre casais inférteis, realizada no Rio de Janeiro entre 2004e 2006, que contemplou as reverberações da não reprodução involuntária do ponto de vista de casais dos estratos médios superiores, a partir de suas trajetórias de vida. Este artigo circunscreve-se à análise de tópico específico relativo aos usos da internet no acesso às informações sobre o tema da infertilidade conjugal. Mediante a diversidade de perspectivas teóricas no estudo da internet em diferentes campos disciplinares, a análise comporta breves considerações sobre as particularidades da utilização da abordagem antropológica relacionada ao tema. Os resultados indicam as conexões entre a popularização da temática analisada na internet, seus usos e as condutas sociais. Predominam concepções naturalizadas sobre a reprodução e o impacto da não reprodução involuntária entre os casais apontam significativas diferenças relativas ao gênero. Os usos da internet refletem o caráter auto-reflexivo na constituição dos sujeitos e identidades sociais e apontam os nexos entre a medicalização do social, a dimensão reprodutiva do corpo, particularmente o corpo feminino, e o fenômeno da individualização na cultura ocidental moderna.This work analyses the usages of the internet in view of the diffusion of social values associated with the popularization of the human reproduction theme in health websites. These reflections are the result of a broader ethnographic research on 'infertile couples', developed in Rio de Janeiro (2004/2006, which approached the repercussions of involuntary non-reproduction from the viewpoint of upper middle-class couples, having as a starting point their life trajectories. Semi-structured interviews were conducted, as well as the observation of each interview's context, with 16 coupled individuals, all of them employed university graduates with some kind of difficulty in having children. The analytical corpus included the monitoring of internet discussion groups on the subject. This article is circumscribed to the analysis of specific topic relative to the usages of the internet for access to information on the theme of couple's infertility. Due to the diversity of theoretical perspectives on the study of the internet in different disciplinary fields, the analysis provides brief considerations about the particularities of the use of the anthropological approach to the theme. The results show the connection between the popularization of the analyzed theme on the internet, its uses and social conducts. The naturalized conceptions of reproduction are predominant, and the impact of involuntary non-reproduction among couples points to significant gender-related differences. The uses of the internet indicate a self-reflective character in the constitution of individuals and social identities, and point to the connections between the medicalization of the social sphere, the body's reproductive dimension, particularly the feminine body, and the phenomenon of individualization in modern western culture.

    18. Eventos catastróficos associados ao tratamento da comunicação interatrial tipo ostium secundum: razões para não se subestimar este tipo de cardiopatia congênita Catastrophic events associated to the surgical treatment of ostium secundum atrial septal defects: reasons for not underestimating this type of congenital cardiopathy

      Directory of Open Access Journals (Sweden)

      Paulo Roberto B. Evora

      2004-12-01

      Full Text Available OBJETIVO: O presente trabalho clínico foi motivado pela frustrante experiência de quatro pacientes operados para o tratamento cirúrgico da comunicação interatrial tipo ostium secundum (CIA-II, que vieram a falecer em condições extremamente dramáticas. MÉTODO: Estudo retrospectivo embasado em dados de prontuários. As pesquisas bibliográficas incluíram: tromboembolismo paradoxal (cerebral, pulmonar ou mesentérico, malformações vasculares do sistema nervoso central e conexões anômalas das veias cavas. Estas pesquisas da literatura foram embasadas em possíveis eventos, inesperados e catastróficos, que levaram quatro pacientes ao óbito. RESULTADOS: Os quatros pacientes, todos do sexo feminino, foram submetidos a atriosseptorrafia com tempo de parada cardíaca isquêmica inferior a 20 minutos, em circulação extracorpórea. As causas de óbito foram: isquemia intestinal não-oclusiva, ruptura de aneurisma cerebral de artéria comunicante anterior, cor pulmonale com hipertensão arterial e tromboembolismo e um provável tromboembolismo cerebral em uma criança que precisou ser reoperada pela drenagem da veia cava inferior em átrio esquerdo. CONCLUSÃO: A lição final deste trabalho é: "Não subestime a comunicação interatrial em cirurgia cardíaca!".OBJECTIVE: The present article was motivated by the frustrating experiences with four patients who underwent surgical treatment of ostium secundum atrial septal defect (ASD-II and who died in extremely dramatic circumstances. METHOD: This is a retrospective study based on clinical data. The bibliographical researche included: paradoxical thromboembolism (cerebral, lung or mesenteric, central nervous system vascular malformations and anomalous vena cava connections. This research was based on possible events, unexpected and catastrophic, that could have directly caused the patients' deaths. RESULTS: All patients were female, the operations were performed under cardiopulmonary bypasses with less than 20 minutes of aortic cross-clamping. The causes of death were: non-occlusive intestinal ischemia, rupture of a cerebral aneurysm of the anterior communicating artery, cor pulmonale associated with pulmonary arterial hypertension and thromboembolism and probable cerebral thromboembolism in a child that needed to be reoperated to correct anomalous inferior vena cava drainage into the left atrium. CONCLUSION: Even being technically easy to treat, death due to atrial septal defects in extremely dramatic circumstances is possible, so "Do not underestimate the atrial septal in congenital heart surgery".

    19. É a educação um direito humano?: em busca de razões suficientes para se justificar o direito de formar-se como humano = Is education one of our human rights?: to find enough reasons to justify the right to form themselves as humans

      Directory of Open Access Journals (Sweden)

      Andrade, Marcelo

      2013-01-01

      Full Text Available A educação é um direito humano? Se é, quais são as justificações racionais que podemos estabelecer para fundamentar axiologicamente tal direito no marco jurídico que organiza nossas sociedades? A partir dessas questões, o artigo examina três tensões distintas e articuladas. Num primeiro momento, apresenta a concepção de educação como uma tensão entre a socialização e a humanização. No segundo momento, aprofunda-se na tensão entre as expressões jurídica e axiológica do direito à educação. Por fim, argumenta sobre as forças e as fragilidades do processo educacional como uma tensão na qual deve-se entender as potencialidades sobre a educação como direito humano. Utilizando referenciais como Kant, Durkheim, Arent, Freire, Brandão e Cortina, o artigo apresenta uma fundamentação ético-filosófica para a educação como um direito humano

    20. Intuición, razón y cálculo en el análisis estructural en la bóveda de crucería de la capilla de San Antonio en Candás (Asturias

      Directory of Open Access Journals (Sweden)

      Suárez, F.

      2015-12-01

      Full Text Available The dismantling of a simple chapel of the late XVI century and the study of its formal constitution are the starting point of this analytical study of the structural design criteria. This course will compare the fundamentals of each methodology, from a geometric concept, through the concept of balance and reaching analysis methods based on the elastic stiffness. The precision of FEM software and its visual power cause the forgetfulness of the traditional design parameters. We often forget that the materials and building systems are difficult to evaluate by means of elastic concepts, which makes them statically indeterminate systems of order which change with time. The different analytical methods mean that none of them is exclusive against the others as actually they are complementary. The fact that sometimes the calculation precision of establishing a particular stress state cannot make us forget that the existence of a historic construction which has been able to find a working mechanism, will have had its starting point in a formal design, far from the necessity of accuracy.El análisis de sistemas constructivos tradicionales está comenzando a confiarse a potentes medios de simulación numérica. La precisión de cálculo y su expresividad visual son un reclamo al que resulta difícil sustraerse. El empleo de estos medios no puede olvidar el hecho de que estos sistemas constructivos y sus materiales constituyentes resultan difícilmente evaluables desde conceptos elásticos, convirtiéndose en sistemas hiperestáticos de orden creciente. El desmontaje de la bóveda de crucería de una capilla del siglo XVI ha permitido conocer con precisión esa serie de factores geométricos y de composición material que tantas veces resultan simples supuestos. Este conocimiento permite abordar un análisis comparado de las diferentes metodologías empleadas a lo largo de la historia. Analizar los resultados de las arcaicas razones de proporción geométrica, con metodologías como las de rigidez elástica o las de equilibrio fundamental, ha determinado que todas ellas lejos de ser excluyentes resultan complementarias.

    1. Determining lead sources in Mexico using the lead isotope ratio La identificación de fuentes de exposición a plomo en México a través de la determinación de la razón de isótopos de plomo

      Directory of Open Access Journals (Sweden)

      Madhu Chaudhary-Webb

      2003-01-01

      Full Text Available OBJECTIVE: Lead poisoning can, in some cases, be traced to a specific route or source of exposure on the basis of the individual's blood lead isotope ratio. To assess the major source of lead exposure among women residing in Mexico City, we compared blood, ceramic, and gasoline lead isotope ratios. MATERIAL AND METHODS: The study population, randomly selected from participants of a large trial, (1/1996-12/1996 comprised of 16 women whose lead levels exceeded 10 µg/dl and who reported using lead-glazed ceramics. Lead isotope ratios were performed on a Perkin Elmer 5000 Inductively Coupled Plasma Mass Spectrometer (ICP-MS interfaced with a Perkin Elmer HGA-600MS Electrothermal Vaporization System (ETV. RESULTS: The isotope ratios (206Pb/204Pb, 207Pb/204Pb, and 208Pb/204Pb of both the blood specimens and their corresponding ceramic specimens were highly correlated, with r=0.9979, r²=0.9958, r=0.9957, r²=0.9915 and r=0.9945, r²=0.9890 values for the three isotope ratios, respectively, suggesting that the lead exposure most likely resulted from the use of these ceramic. Measurements of lead isotope ratios from leaded gasoline in use at the time of blood sampling, differed from those in blood and ceramics. CONCLUSIONS: Determining lead isotope ratios can be an efficient tool to identify a major source of lead exposure and to support the implementation of public health prevention and control measures.OBJETIVO: Identificar la fuente principal de exposición a plomo entre mujeres residentes en la Ciudad de México, por medio de la comparación de las razones de isótopos de plomo en sangre, cerámica y gasolina. MATERIAL Y MÉTODOS: La población de estudio fue seleccionada aleatoriamente de participantes de una muestra obtenida de enero a diciembre de 1996 y consistió en 16 mujeres con niveles de plomo mayores a 10 µg/dl, que usaban cerámica vidriada con plomo. Las razones de isótopos de plomo se obtuvieron con un espectrómetro de masa de plasma inductivamente acoplado (ICP-MS Perkin Elmer 5000, en interfase con un sistema de vaporización electrotérmica (ETV Perkin Elmer HGA-600MS. RESULTADOS: Las razones de isótopos (206Pb/204Pb, 207Pb/204Pb, y 208Pb/204Pb, tanto de los especímenes de sangre, como de los de cerámica se correlacionaron fuertemente, con valores de r² de 0.9958, 0.9915, y 0.9890, para las tres razones de isótopos, respectivamente, sugiriendo que la exposición a plomo probablemente se debió al uso de la cerámica. Las mediciones de las razones de isótopos de plomo de la gasolina con plomo, que todavía se usaba al momento de la toma de muestras de sangre, fueron distintas de las encontradas en sangre y en cerámica. CONCLUSIONES: La determinación de las razones de isótopos de plomo puede ser una herramienta eficiente para la identificación de las fuentes principales de exposición a plomo y para apoyar la implantación de medidas de salud pública para prevención y control.

    2. "El cliente siempre tiene la razón": procesos de construcción de subjetividad en trabajadores jóvenes de una cadena multinacional de supermercados en la ciudad de Rosario "Client´s always right": Subjectivity construction´s process in young workers of a multinational chain of supermarkets in Rosario

      Directory of Open Access Journals (Sweden)

      Jaime Guiamet

      2012-12-01

      Full Text Available En este trabajo abordamos la problemática de la construcción de subjetividad de trabajadores jóvenes de supermercados desde la perspectiva de su relación con el cliente, ya que consideramos que en ésta se articulan una serie de dimensiones significativas del trabajo en supermercados. Las políticas empresariales en la actualidad tienden a incorporar a la subjetividad obrera en el proceso de valorización del capital y, en este sentido, la atención al cliente se constituye en un mecanismo clave para lograrlo. Además, nos preguntamos cómo se da la apropiación de estos mecanismos por parte de los trabajadores en los procesos de trabajo concretos de atención al cliente, destacando que, si bien estas políticas son eficaces, las prácticas de los trabajadores también conllevan implícitas resignificaciones, apropiaciones y límites frente a estas políticas.In this work we deal with the problem of the subjectivity construction of supermarket´s young workers from the perspective of their relationship with the client, since we consider that in this one a series of significant dimentions of the work in supermarkets are articulated. Nowadays, business politics tend to incorporate workers´ subjectivity in the capital´s appreciation process and, in this sense, attention to customer becomes a key mechanism to achieve it. Besides, we ask ourselves how workers aproppiate this mechanisms in concrete work process of attention to client, emphasizing that, beyond this politics´s effectiveness, workers´ practices also take implicit resignifications, appropiations and limits.

    3. OMREŽNA STIKALA IN KOMUTACIJA LAN/WAN

      OpenAIRE

      Prosenjak, Danijel

      2010-01-01

      Diplomska naloga obravnava koncepte komutacije. Osredotočili se bomo na lokalna omrežja. Podrobneje bomo preučili različice protokola vpetega drevesa in primere le-tega. V naslednjih poglavjih so obravnavana virtualna lokalna omrežja in VLAN povezovalni protokol. Na kratko bomo preučili komutacijo OSI plasti L3, prožnost omrežja in varnost omrežnih stikal.

    4. Effect of influenza-like illness and other wintertime respiratory illnesses on worker productivity: The child and household influenza-illness and employee function (CHIEF) study.

      Science.gov (United States)

      Palmer, Liisa A; Rousculp, Matthew D; Johnston, Stephen S; Mahadevia, Parthiv J; Nichol, Kristin L

      2010-07-12

      Acute respiratory illnesses (ARI), comprising influenza-like illness (ILI) and other wintertime respiratory illnesses (ORI), impose substantial health and economic burdens on the United States. Little is known about the impact of ILI among household members (HHM), particularly children, on employees' productivity. To quantify the impact of employee and HHM-ILI and ARI on employee productivity, a prospective, observational cohort study was conducted among employees from three large US companies. Employees who had at least one child living at home (N=2013) completed a monthly survey during the 2007-2008 influenza season, reporting the number of days missed from work and hours of presenteeism due to: (1) personal ILI, (2) HHM-ILI, and (3) personal and HHM-ARI. Employee ILI ranged from 4.8% (April) to 13.5% (February). Employees reporting ILI reported more absences than employees not reporting ILI (72% vs 30%, respectively; Pemployees surveyed had at least one child with an ILI; these employees missed more days of work due to HHM illness than employees without an ARI-ill child (0.9 days vs 0.3 days, respectively; PEmployees with ILI were less productive, on average, for 4.8h each day that they worked while sick, 2.5h of which was attributable to ILI. HHM illnesses accounted for 17.7% (1389/7868 days) of employee absenteeism, over half of which was due to HHM-ARI. ILI causes a significant amount of employee absence. Household members, particularly children, comprise a sizable proportion of general illness and injury-related employee absences. Copyright 2010 Elsevier Ltd. All rights reserved.

    5. Seasonality of absolute humidity explains seasonality of influenza-like illness in Vietnam

      Directory of Open Access Journals (Sweden)

      Pham Quang Thai

      2015-12-01

      Conclusions: Our results identify a role for AH in driving the epidemiology of ILI in a tropical setting. However, in contrast to temperate regions, high rather than low AH is associated with increased ILI activity. Fluctuation in AH may be the climate factor that underlies and unifies the seasonality of ILI in both temperate and tropical regions. Alternatively, the mechanism of action of AH on disease transmission may be different in cold-dry versus hot-humid settings.

    6. Relating calls to US poison centers for potential exposures to medications to Centers for Disease Control and Prevention reporting of influenza-like illness.

      Science.gov (United States)

      Beauchamp, Gillian A; McKeown, Nathanael J; Rodriguez, Sergio; Spyker, Daniel A

      2016-03-01

      The Centers for Disease Control (CDC) monitors influenza like illness (ILI) and the National Poison Data System (NPDS) warehouses call data uploaded by US poison centers regarding reported exposures to medication. We examined the relationship between calls to poison centers regarding reported exposures to medications commonly used to treat ILI and weekly reports of ILI. The CDC reports ILI, by age group, for each of 10 Health and Human Services (HHS) regions. We examined NPDS summary data from calls reported to poison centers regarding reported exposures to acetaminophen, cough/cold medications, and promethazine, for the same weeks, age groups, and HHS regions for influenza seasons 2000-2013. ILI and NPDS exposures were examined using graphical plots, descriptive statistics, stepwise regression analysis, and Geographic Information Systems (GIS). About 5,101,841 influenza-like illness cases were reported to the CDC, and 2,122,940 calls regarding reported exposures to medications commonly used to treat ILI, were reported by poison centers to the NPDS over the 13 flu seasons. Analysis of stepwise models of the linear untransformed data involving 24 NPDS data groups and for 60 ILI measures, over the 13 influenza seasons, demonstrated that reported exposures to medications used to treat ILI correlated with reported cases of ILI with a median R(2 )=( )0.489 (min R(2 )=( )0.248, max R(2 )=( )0.717), with mean ± SD of R(2 )=( )0.494 ± 0.121. Median number of parameters used (degrees of freedom - 1) was 7. NPDS data regarding poison center calls for selected ILI medication exposures were highly correlated with CDC ILI data. Since NPDS data are available in real time, it provides complimentary ILI monitoring. This approach may provide public health value in predicting other illnesses which are not currently as thoroughly monitored.

    7. ORF Alignment: NC_002696 [GENIUS II[Archive

      Lifescience Database Archive (English)

      Full Text Available ily [imported] - ... Caulobacter crescentus ... Length = 100 ... Query: 213 RIKRFID...DNLCDPELSVGRVAGALGVSPRYVQMVFAGMATTPLAYIXXXXXXXXXXXXXX 272 ... RIKRFIDDNLCDPELSVGRVAGALGV...SPRYVQMVFAGMATTPLAYI ... Sbjct: 1 ... RIKRFIDDNLCDPELSVGRVAGALGVSPRYVQMVFAGMATTPLAYIRRKRLERAARALRE 60 ...

    8. School principals’ and teachers’ views on reasons for the decrease of success in Turkish university entrance exams (case of Malatya [Üniversiteye giriş sınavlarındaki başarının düşme nedenlerine yönelik yönetici ve öğretmen görüşleri (Malatya ili örneği

      Directory of Open Access Journals (Sweden)

      Yeliz TEMLİ-DURMUŞ

      2015-04-01

      Full Text Available High schools’ success in Malatya province decreased during 2011-2012 in the Turkish National University Entrance Exams. The mean of high schools’ success in Turkey was higher for different score types than Malatya. The reasons for the decrease in success in the University Entrance Exams were researched based on school principals’ and teachers’ evaluations. One Science High School, one Anatolian High School, four General High Schools and two Vocational High Schools constitute the sample. In total, six school principals and 47 teachers voluntarily participated in the study. Findings were constructed into three categories as ‘Factors affecting Turkey’, ‘Factors affecting Malatya’, and ‘Solution Proposals’. The first category is composed of five themes; the ‘Problems originating from elementary education’, ‘Reduced authority and loss of respect for teachers’, ‘Rapid and frequent changes in the educational system’, ‘The exams not being perceived as a process by students’, and ‘Technological developments and failure in time-management’. The second category focused on Malatya City, and has six themes; ‘Immigration’, ‘Gangs’, ‘Partisan attitudes’, ‘Overuse of official complaint / request line (Call 147’, ‘Insensitivity of parents’, and ‘Limitation in teacher qualifications’. The third and final category is Solution Proposals and is composed of four themes; ‘Family teaching’, ‘Provincial council meetings for teachers’, ‘Collaboration among institutions’, and ‘Raising student awareness of exams’. School Principals and teachers’ evaluations were parallel with each other; therefore, the two groups have been analyzed together.

    9. Liquid Scintillation Detection of Tritium and other Radioisotopes in Insoluble or Quenching Organic Samples; Detection par compteur a scintillations a liquides du tritium et des autres radioelements contenus dans des echantillons organiques insolubles ou coupeurs; Obnaruzhenie tritiya metodom zhidkostnoj stsintillyatsii v nerastvorimykh ili sposo'nykh gasit' izluchenie organicheskikh o'raztsakh; Deteccion del tritio u otros radioisotopos por centelleo liquido en muestras organicas insolubles o que provocan extincion

      Energy Technology Data Exchange (ETDEWEB)

      Eastham, J F; Westbrook, H L; Gonzales, D [University of Tennessee, Knoxville, TN (United States)

      1962-01-15

      To facilitate a study of the H{sup 1}/H{sup 3} isotope effect in the reduction of organic compounds, it has been necessary to develop procedures to overcome the two major limitations of the most convenient general method of radioassaying organic material, liquid scintillation counting. These limitations, which are scintillation-quenching by many organic samples and limited solubility of others, are particularly common with material of biological significance: The procedures developed involve combustion of the sample wrapped in filter paper in art oxygen-filled flask, formation of a solution of the combustion products in a suitable solvent added to the flask before combustion, and scintillation-counting of the solution. Advantages of the developed, procedures, in addition to overcoming the indicated limitations, include efficacy with samples with a great range of activity (some as low as 1{mu}c/mole), good precision (as great as any other general method of radio-assaying H{sup 3}), and applicability to other soft beta emitters (C{sup 14} and S{sup 35}). With a scintillation spectrometer and the techniques developed, samples triply labelled with H{sup 3}, C{sup 14} and S{sup 35} can be differentially radio assayed. Details of the solvent systems and techniques developed are reported. Analytical results are reported for such quenching material as 2.4-dinitrophenyl-hydrazones dyes and for such insoluble materials as proteins and carbohydrates. Application of the techniques to evaluation of H{sup 1}/H{sup 3} isotope effects in certain reduction reactions are discussed. (author) [French] Pour faciliter l'etude de l'effet isotopique ''1H/''3H dans la reduction des composes organiques, il a fallu mettre au point des procedes permettant d'elargir le champ d'application de la methode generale la plus pratique de radioanalyse des matieres organiques, savoir l'analyse au moyen d'un compteur a scintillations a liquides. En effet, ce champ d'application est limite pour deux raisons: beaucoup d'echantillons organiques provoquent le coupage; d'autres echantillons sont peu solubles. Ces limitations sont particulierement frequentes dans le cas des substances importantes du point de vue biologique. Le procede mis au point par les auteurs comporte la combustion de l'echantillon enveloppe de papier filtre, dans un ballon rempli d'oxygene; la dissolution des produits de combustion dans un solvant approprie ajoute au ballon avant la combustion; enfin, le comptage de la solution. Parmi les avantages de ce procede, on relevera - outre le fait qu'il permet d'elargir le champ d'application de la methode en supprimant les limitations mentionnees plus haut - son efficacite pour des echantillons ayant des activites extremement diverses (dans certains cas, elles ne depassent pas 1 {mu}c par mole), son excellente precision (aussi grande que celle de toute autre methode generale de radioanalyse du tritium) et la possibilite de l'appliquer a d'autres emetteurs beta mous ({sup 14}C et {sup 35}S). Avec un spectrotnetre a scintillations et le procede mis au point par les auteurs, des echantillons marques par trois indicateurs (tritium, carbone-14 et soufre-35) peuvent faire l'objet d'une radioanalyse differentielle. Les auteurs donnent des details sur les solvants utilises et les techniques mises au point, et indiquent les resultats de l'analyse pour des matieres provoquant le coupage telles que les dinitro-2,4, phenylhydrazones et les colorants au thiazole, ainsi que pour des matieres insolubles telles que les proteines et les hydrates de carbone. Ils rendent compte de l'application du procede a l'evaluation des effets isotopiques {sup 1}H/{sup 3}H dans certaines reactions de reduction. (author) [Spanish] Para facilitar el estudio del efecto isotopico {sup 1}H/{sup 3}H en la reduccion de compuestos organicos, ha sido preciso idear procedimientos a fin de vencer los dos inconvenientes principales que presenta el metodo de radioanalisis general mas apropiado para las sustancias organicas, a saber, el recuento por centelleos de liquidos. Estos inconvenientes, que son la extincion del centelleo producida por. muchas muestras organicas y la escasa solubilidad de otras, son particularmente frecuentes en las sustancias de importancia biologica. El procedimiento ideado por los autores consiste en lo siguiente: combustion de la muestra, envuelta en papel de filtro, en un matraz lleno de oxigeno; disolucion de los productos de combustion en un disolvente adecuado que se introduce en el matraz antes de la combustion, y recuento por centelleo de la actividad de la solucion. Ademas de superar los inconvenientes mencionados, este procedimiento posee otras ventajas: eficacia con muestras de actividades muy diversas (algunas, tan baja como 1{mu}c/M), precision (tan elevada como la de cualquier otro metodo general de radioanalisis del {sup 3}H) y posibilidad de aplicarlo a otros emisores beta blandos ({sup 14}C y {sup 35}S). Con un espectrometro de centelleo y merced al procedimiento ideado, es posible efectuar un radioanalisis diferencial de muestras marcadas con tres indicadores ({sup 3}H, {sup 14}C y {sup 35}S). Los autores describen con detalle las tecnicas y los sistemas de disolventes utilizados. Asimismo, exponen los resultados obtenidos en el analisis de sustancias que provocan extincion, como 2,4- dinitrofenilhidrazona s y colorantes de tiazol, y de sustancias insolubles, como proteinas e hidratos de carbono. Estudian la aplicacion de estas tecnicas al analisis de los efectos isotopicos {sup 1}H/{sup 3}H en ciertas reacciones de reduccion. (author) [Russian] CHtoby oblegchit' izuchenie vliyaniya izotopa H{sup 1}/H{sup 3} na vosstanovlenie organicheskikh soedinenij neobkhodimo bylo razrabotat' protsedury dlya preodoleniya dvukh osnovnykh ogranichenij v naibolee udobnom obshchem metode izmereniya radioaktivnosti organicheskikh veshchestv posredstvom zhidkostnogo stsintillyatora . EHti ogranicheniya, kotorymi yavlyayutsya stsintillyatsionnoe gashenie mnogimi organicheskimi obraztsami i ogranichennaya rastvorimost ' drugikh, prisushchi takzhe biologicheskim veshchestvam. Razrabotannye protsedury vklyuchayut v sebya okislenie obernutogo v fil'troval'nuyu bumagu obraztsa v kolbe, napolnennoj kislorodom, obrazovanie rastvora okislennykh produktov v sootvetstvuyushchem rastvoritele, dobavlennom v kolbu pered okisleniem, i stsintillyatsionnyj schet rastvora. Preimushchestva razrabotannykh protsedur dlya preodoleniya ukazannykh ogranichenij vklyuchayut: kachestvo operatsii s obraztsami bol'shogo diapazona aktivnosti (nekotorye s takoj nizkoj aktivnost'yu kak 1{mu}c//mo1e), bol'shuyu tochnost' (takuyu zhe kak pri lyubom drugom obshchem metode izmereniya radioaktivnosti H{sup 3}), i primenimost' k drugim myagkim beta-izluchatelyam (C{sup 14} i k{sup 35}). S pomoshch'yu stsintillyatsionnogo spektrometra i razrabotannykh protsedur mozhet byt' razdel'no izmerena radioaktivnost ' obraztsov mechennykh trizhdy H{sup 3}, C{sup 14} i k{sup 35}. Detali, kasayushchiesya sistem rastvoritelya i razrabotannykh metodov, budut izlozheny v doklade, krome togo v nem budet dana rabochaya kharakteristika novogo, otnositel'no nedorogogo odnokanal'nogo stsintillyatsionnogo spektrometra. Budut izlozheny analiticheskie rezul'taty, kasayushchiesya takogo gasyashchego izluchenie materiala, kak 2,4-dinitro-fenilgidrozony i tiazolidy, a takzhe takikh nerastvorimykh materialov, kak proteiny i ugolevdy. Budet obsuzhdeno primenenie metodov k otsenke izotopnogo ehffekta H{sup 1}/H{sup 3} v opredelennykh reaktsiyakh vosstanovleniya. (author)

    10. Age-related differences in the accuracy of web query-based predictions of influenza-like illness.

      Directory of Open Access Journals (Sweden)

      Alexander Domnich

      Full Text Available Web queries are now widely used for modeling, nowcasting and forecasting influenza-like illness (ILI. However, given that ILI attack rates vary significantly across ages, in terms of both magnitude and timing, little is known about whether the association between ILI morbidity and ILI-related queries is comparable across different age-groups. The present study aimed to investigate features of the association between ILI morbidity and ILI-related query volume from the perspective of age.Since Google Flu Trends is unavailable in Italy, Google Trends was used to identify entry terms that correlated highly with official ILI surveillance data. All-age and age-class-specific modeling was performed by means of linear models with generalized least-square estimation. Hold-out validation was used to quantify prediction accuracy. For purposes of comparison, predictions generated by exponential smoothing were computed.Five search terms showed high correlation coefficients of > .6. In comparison with exponential smoothing, the all-age query-based model correctly predicted the peak time and yielded a higher correlation coefficient with observed ILI morbidity (.978 vs. .929. However, query-based prediction of ILI morbidity was associated with a greater error. Age-class-specific query-based models varied significantly in terms of prediction accuracy. In the 0-4 and 25-44-year age-groups, these did well and outperformed exponential smoothing predictions; in the 15-24 and ≥ 65-year age-classes, however, the query-based models were inaccurate and highly overestimated peak height. In all but one age-class, peak timing predicted by the query-based models coincided with observed timing.The accuracy of web query-based models in predicting ILI morbidity rates could differ among ages. Greater age-specific detail may be useful in flu query-based studies in order to account for age-specific features of the epidemiology of ILI.

    11. Automated data extraction from general practice records in an Australian setting: trends in influenza-like illness in sentinel general practices and emergency departments.

      Science.gov (United States)

      Liljeqvist, Gösta T H; Staff, Michael; Puech, Michele; Blom, Hans; Torvaldsen, Siranda

      2011-06-06

      Influenza intelligence in New South Wales (NSW), Australia is derived mainly from emergency department (ED) presentations and hospital and intensive care admissions, which represent only a portion of influenza-like illness (ILI) in the population. A substantial amount of the remaining data lies hidden in general practice (GP) records. Previous attempts in Australia to gather ILI data from GPs have given them extra work. We explored the possibility of applying automated data extraction from GP records in sentinel surveillance in an Australian setting.The two research questions asked in designing the study were: Can syndromic ILI data be extracted automatically from routine GP data? How do ILI trends in sentinel general practice compare with ILI trends in EDs? We adapted a software program already capable of automated data extraction to identify records of patients with ILI in routine electronic GP records in two of the most commonly used commercial programs. This tool was applied in sentinel sites to gather retrospective data for May-October 2007-2009 and in real-time for the same interval in 2010. The data were compared with that provided by the Public Health Real-time Emergency Department Surveillance System (PHREDSS) and with ED data for the same periods. The GP surveillance tool identified seasonal trends in ILI both retrospectively and in near real-time. The curve of seasonal ILI was more responsive and less volatile than that of PHREDSS on a local area level. The number of weekly ILI presentations ranged from 8 to 128 at GP sites and from 0 to 18 in EDs in non-pandemic years. Automated data extraction from routine GP records offers a means to gather data without introducing any additional work for the practitioner. Adding this method to current surveillance programs will enhance their ability to monitor ILI and to detect early warning signals of new ILI events.

    12. Estimation of community-level influenza-associated illness in a low resource rural setting in India.

      Science.gov (United States)

      Saha, Siddhartha; Gupta, Vivek; Dawood, Fatimah S; Broor, Shobha; Lafond, Kathryn E; Chadha, Mandeep S; Rai, Sanjay K; Krishnan, Anand

      2018-01-01

      To estimate rates of community-level influenza-like-illness (ILI) and influenza-associated ILI in rural north India. During 2011, we conducted household-based healthcare utilization surveys (HUS) for any acute medical illness (AMI) in preceding 14days among residents of 28villages of Ballabgarh, in north India. Concurrently, we conducted clinic-based surveillance (CBS) in the area for AMI episodes with illness onset ≤3days and collected nasal and throat swabs for influenza virus testing using real-time polymerase chain reaction. Retrospectively, we applied ILI case definition (measured/reported fever and cough) to HUS and CBS data. We attributed 14days of risk-time per person surveyed in HUS and estimated community ILI rate by dividing the number of ILI cases in HUS by total risk-time. We used CBS data on influenza positivity and applied it to HUS-based community ILI rates by age, month, and clinic type, to estimate the community influenza-associated ILI rates. The HUS of 69,369 residents during the year generated risk-time of 3945 person-years (p-y) and identified 150 (5%, 95%CI: 4-6) ILI episodes (38 ILI episodes/1,000 p-y; 95% CI 32-44). Among 1,372 ILI cases enrolled from clinics, 126 (9%; 95% CI 8-11) had laboratory-confirmed influenza (A (H3N2) = 72; B = 54). After adjusting for age, month, and clinic type, overall influenza-associated ILI rate was 4.8/1,000 p-y; rates were highest among children value of influenza vaccination among target groups.

    13. A placebo-controlled trial of Korean red ginseng extract for preventing Influenza-like illness in healthy adults

      Directory of Open Access Journals (Sweden)

      Ha Ki-Chan

      2012-02-01

      Full Text Available Abstracts Background Standardized Korean red ginseng extract has become the best-selling influenza-like illness (ILI remedy in Korea, yet much controversy regarding the efficacy of the Korean red ginseng (KRG in reducing ILI incidence remains. The aim of the study is to assess the efficacy of the KRG extract on the ILI incidence in healthy adults. Methods/Design We will conduct a randomized, double-blind, placebo-controlled study at the onset of the influenza seasons. A total of 100 subjects 30-70 years of age will be recruited from the general populations. The subjects will be instructed to take 9 capsules per day of either the KRG extract or a placebo for a period of 3 months. The primary outcome measure is to assess the frequency of ILI onset in participated subjects. Secondary variable measures will be included severity and duration of ILI symptoms. The ILI symptoms will be scored by subjects using a 4-point scale. Discussion This study is a randomized placebo controlled trial to evaluate the efficacy of the KRG extract compared to placebo and will be provided valuable new information about the clinical and physiological effects of the KRG extract on reduction of ILI incidence including flu and upper respiratory tract infections. The study has been pragmatically designed to ensure that the study findings can be implemented into clinical practice if KRG extract can be shown to be an effective reduction strategy in ILI incidence. Trial Registration NCT01478009.

    14. The Implementation of Web 2.0 Technology for Information Literacy Instruction in Thai University Libraries

      Science.gov (United States)

      Sawetrattanasatian, Oranuch

      2014-01-01

      Web 2.0 technology has drawn much attention recently as a fascinating tool for Information Literacy Instruction (ILI), especially in academic libraries. This research was aimed to investigate the implementation of Web 2.0 technology for ILI in Thai university libraries, in terms of information literacy skills being taught, types of Web 2.0…

    15. Kimi mantlipärija sai mõjukatele ametipostidele / Kaivo Kopli

      Index Scriptorium Estoniae

      Kopli, Kaivo

      2010-01-01

      Põhja-Korea pealinnas toimunud Tööliste Partei kongressil määrati riigi liidri Kim Jong-ili noorim poeg Kim Jong-un kesksõjakomisjoni aseesimeheks ja keskkomitee liikmeks. Poliitbüroosse määrati alternatiivliikmena Kim Jong-ili õe abikaasa Chang Song-taek

    16. O NEKIM ČAKAVSKIM IMENIMA MARIJANSKIH BLAGDANA

      OpenAIRE

      Vulić, Sanja

      1990-01-01

      Imena desetak marijanskih blagdana u desetak različitih čakavskih mjesnih govora međusobno se više ili manje razlikuju. Najčešće su motivirana samim otajstvom blagdana ili toponimom uz koji je vezan početak slavljenja stanovitoga blagdana, odnosno ojkonimom gdje se blagdan osobito svečano slavi.

    17. Influenza-Like Illness among University Students: Symptom Severity and Duration Due to Influenza Virus Infection Compared to Other Etiologies

      Science.gov (United States)

      Mullins, Jocelyn; Cook, Robert; Rinaldo, Charles; Yablonsky, Eric; Hess, Rachel; Piazza, Paolo

      2011-01-01

      Objective: University students with influenza-like illness (ILI) were assessed to determine whether symptom severity, duration, or missed days of school or work varied according to etiology. Participants: Sixty persons presenting to a university health clinic with ILI symptoms during 3 consecutive influenza seasons completed baseline survey and…

    18. Forecasting influenza-like illness dynamics for military populations using neural networks and social media.

      Directory of Open Access Journals (Sweden)

      Svitlana Volkova

      Full Text Available This work is the first to take advantage of recurrent neural networks to predict influenza-like illness (ILI dynamics from various linguistic signals extracted from social media data. Unlike other approaches that rely on timeseries analysis of historical ILI data and the state-of-the-art machine learning models, we build and evaluate the predictive power of neural network architectures based on Long Short Term Memory (LSTMs units capable of nowcasting (predicting in "real-time" and forecasting (predicting the future ILI dynamics in the 2011 - 2014 influenza seasons. To build our models we integrate information people post in social media e.g., topics, embeddings, word ngrams, stylistic patterns, and communication behavior using hashtags and mentions. We then quantitatively evaluate the predictive power of different social media signals and contrast the performance of the-state-of-the-art regression models with neural networks using a diverse set of evaluation metrics. Finally, we combine ILI and social media signals to build a joint neural network model for ILI dynamics prediction. Unlike the majority of the existing work, we specifically focus on developing models for local rather than national ILI surveillance, specifically for military rather than general populations in 26 U.S. and six international locations., and analyze how model performance depends on the amount of social media data available per location. Our approach demonstrates several advantages: (a Neural network architectures that rely on LSTM units trained on social media data yield the best performance compared to previously used regression models. (b Previously under-explored language and communication behavior features are more predictive of ILI dynamics than stylistic and topic signals expressed in social media. (c Neural network models learned exclusively from social media signals yield comparable or better performance to the models learned from ILI historical data, thus

    19. Forecasting influenza-like illness dynamics for military populations using neural networks and social media.

      Science.gov (United States)

      Volkova, Svitlana; Ayton, Ellyn; Porterfield, Katherine; Corley, Courtney D

      2017-01-01

      This work is the first to take advantage of recurrent neural networks to predict influenza-like illness (ILI) dynamics from various linguistic signals extracted from social media data. Unlike other approaches that rely on timeseries analysis of historical ILI data and the state-of-the-art machine learning models, we build and evaluate the predictive power of neural network architectures based on Long Short Term Memory (LSTMs) units capable of nowcasting (predicting in "real-time") and forecasting (predicting the future) ILI dynamics in the 2011 - 2014 influenza seasons. To build our models we integrate information people post in social media e.g., topics, embeddings, word ngrams, stylistic patterns, and communication behavior using hashtags and mentions. We then quantitatively evaluate the predictive power of different social media signals and contrast the performance of the-state-of-the-art regression models with neural networks using a diverse set of evaluation metrics. Finally, we combine ILI and social media signals to build a joint neural network model for ILI dynamics prediction. Unlike the majority of the existing work, we specifically focus on developing models for local rather than national ILI surveillance, specifically for military rather than general populations in 26 U.S. and six international locations., and analyze how model performance depends on the amount of social media data available per location. Our approach demonstrates several advantages: (a) Neural network architectures that rely on LSTM units trained on social media data yield the best performance compared to previously used regression models. (b) Previously under-explored language and communication behavior features are more predictive of ILI dynamics than stylistic and topic signals expressed in social media. (c) Neural network models learned exclusively from social media signals yield comparable or better performance to the models learned from ILI historical data, thus, signals from

    20. Blood Pyrrole-Protein Adducts--A Biomarker of Pyrrolizidine Alkaloid-Induced Liver Injury in Humans.

      Science.gov (United States)

      Ruan, Jianqing; Gao, Hong; Li, Na; Xue, Junyi; Chen, Jie; Ke, Changqiang; Ye, Yang; Fu, Peter Pi-Cheng; Zheng, Jiang; Wang, Jiyao; Lin, Ge

      2015-01-01

      Pyrrolizidine alkaloids (PAs) induce liver injury (PA-ILI) and is very likely to contribute significantly to drug-induced liver injury (DILI). In this study we used a newly developed ultra-high performance liquid chromatography-triple quadrupole-mass spectrometry (UHPLC-MS)-based method to detect and quantitate blood pyrrole-protein adducts in DILI patients. Among the 46 suspected DILI patients, 15 were identified as PA-ILI by the identification of PA-containing herbs exposed. Blood pyrrole-protein adducts were detected in all PA-ILI patients (100%). These results confirm that PA-ILI is one of the major causes of DILI and that blood pyrrole-protein adducts quantitated by the newly developed UHPLC-MS method can serve as a specific biomarker of PA-ILI.

    1. Artificial fertilization of oocytes and sperm activation in pacu: effects of the spermatozoa:oocyte ratio, water volume, and in natura semen preservation Fertilização artificial de ovócitos e ativação espermática em pacus: efeito da razão espermatozoide:ovócito, volume de água e preservação do sêmen in natura

      Directory of Open Access Journals (Sweden)

      Eduardo Antônio Sanches

      2011-01-01

      Full Text Available The objective of this work was to investigate artificial fertilization and the duration of sperm motility in pacu with different insemination doses, water volume, and in natura semen preservation. It was carried out four experimentsfor evaluation of insemination doses (7x10³, 7x10(4, 7x10(5, 7x10(6, and 7x10(7 spermatozoa oocytes-1 on the artificial fertilization of oocytes; the effect of water volume (0.5, 15.0, 30.0, 45.0, and 60.0 mL water mL-1 of oocyte with insemination doses of 105,481 and 210,963 spermatozoa oocytes-1; the effect of semen dilutions (0.005, 0.05, 0.5, and 5.0 µL semen mL-1 of water on sperm motility duration; and the effect of storage at 15ºC for 9h on sperm motility duration and sperm survival ratio. The highest results obtained were: insemination doses from 7x10³ to 7x10(7 spermatozoa oocytes-1; from 15 to 60mL water mL-1 of oocytes; semen dilution of 0.005 µL semen/mL water and 98.65% sperm survival until 2h45min 36s preservation time. Preservation at 15ºC for 9h does not influence sperm motility duration. The highest fertilization rates can be observed by using 0.27 to 270 µL semen mL-1 of oocytes with 15 at 60 mL water for activation.Objetivou-se foi avaliar a fertilização artificial e a duração da motilidade espermática em pacus com diferentes doses inseminantes, volumes de água e preservação do sêmen in natura. Foram realizados quatro experimentos para avaliação do efeito de doses inseminantes (7x10³, 7x10(4, 7x10(5, 7x10(6 e 7x10(7 espermatozoides ovócito-1 sobre a fertilização artificial dos ovócitos; do efeito do volume de água (0,5; 15,0; 30,0; 45,0 e 60,0 mL de água mL-1 de ovócitos com doses inseminantes de 105.481 e 210.963 espermatozoides ovócito-1; do efeito de diluição do sêmen (0,005; 0,05; 0,5 e 5,0 µL de sêmen mL-1 de água sobre a duração da motilidade espermática; e do efeito do armazenamento a 15 ºC por 9 h sobre a duração da motilidade espermática e o índice de sobrevivência espermática. Os maiores resultados obtidos foram: doses inseminantes entre 7x10³ e 7x10(7 espermatozoides ovócito-1; 15 a 60 mL de água mL-1 de ovócitos; diluição de 0.005 µL sêmen mL-1 de água e 98,65% de sobrevivência espermática até o tempo de preservação de 2h45min36s. A preservação a 15ºC por 9 horas não influencia a duração da motilidade espermática. As maiores taxas de fertilização podem ser observadas no emprego de 0,27 a 270 µL de sêmen mL-1 de ovócitos, com 15 a 60 mL de água para ativação.

    2. Produção de matéria seca e absorção de nutrientes pelo milho em razão da saturação por bases e da adubação potássica Dry matter yield and nutrient uptake in corn plants as a function of potassic fertilization and of basis soil saturation

      Directory of Open Access Journals (Sweden)

      MARCELO ANDREOTTI

      2000-12-01

      Full Text Available O trabalho foi conduzido em condições de casa de vegetação, com o objetivo de avaliar a resposta do milho à adubação potássica e à saturação do solo por bases, na produção de matéria seca e na absorção de nutrientes. O delineamento experimental foi inteiramente casualizado, com quatro repetições, em esquema fatorial 3x2x4, constituindo-se de três solos (Areia Quartzosa, Latossolo Vermelho-Escuro e Latossolo Roxo, dois valores de saturação por bases (40% e 70 % e quatro teores de K no solo (0,5, 1,5, 3,0 e 6,0 mmol c dm-3. Para a calagem, foi utilizada mistura de carbonato de cálcio + carbonato de magnésio (PRNT = 103,3 % na proporção de 4:1. A adubação básica constou de 200 mg kg-1 de N, 200 mg kg-1 de P e 5 mg kg-1 de Zn por vaso de 30 L, sendo o N parcelado em 2,48 g (83,7 mg kg-1 na semeadura e o restante em duas coberturas aos 25 e 40 dias após a emergência das plântulas (DAE. As doses de K utilizadas foram de 0, 3,62, 7,24 e 14,48 g de KCl por vaso. A semeadura foi realizada em 4/3/97, utilizando-se o milho cv. Zêneca 8392, mantendo-se uma planta/vaso durante 60 DAE. O K proporciona ganhos de matéria seca até teores de 1,5 mmol c dm-3 no solo. O aumento dos teores de K no solo resultam em queda na concentração de Ca e Mg na matéria seca do milho. A elevação da saturação por bases e respectivo aumento dos teores de Ca e Mg no solo reduzem a absorção de K pelo milho.The purpose of this research was to study dry matter yield and nutrients uptake by corn plants as a function of potassic fertilization and of soil basis saturation. An experiment was conducted under greenhouse conditions, using an early single hybrid corn Zêneca 8392 grown in 30 L pots, tested with three types of soil (Quartzpsamment and two alic Dark-Red Latosol - Haplorthox, with two levels of basis saturation (40 and 70 % and four levels of potassium content (0.5, 1.5, 3.0 and 6.0 mmol c dm-3. A completely random design with four replications was utilized. The basis saturation treatments were calibrated by liming the soils with a mixture of 4:1 of calcium and magnesium carbonate, according to soil type. K content in the soil was established by applying 0, 3.62, 7.24 and 14.48 g of KCl per 30 L pot. P (200 mg kg-1 and Zn (5 mg kg-1 were applied to all treatments at sowing time. N was applied at sowing time (83.7 mg kg-1 as well as at top dressing, 25 and 40 days after seedling emergence, totalizing 200 mg kg-1. Sixty days after seedling emergence the dry matter weight and N, P, K, Ca and Mg content of the leaves and stems were determined. The dry matter yield was increased by K concentrations in the soil up to 1.5 mmol c dm-3. The increase in soil K levels allowed decrease on the Ca and Mg concentrations in corn dry matter. The increase of basis saturation and soil Ca and Mg levels decrease corn plant K uptake.

    3. Does nitrogen availability have greater control over the formation of tropical heath forests than water stress?A hypothesis based on nitrogen isotope ratios Tem a disponibilidade de nitrogênio maior controle sobre a formação de florestas tropicais de campinara do que o estresse hídrico?uma hipótese fundamentada nas razões isotópicas do nitrogênio

      Directory of Open Access Journals (Sweden)

      Francis Q Brearley

      2011-01-01

      Full Text Available Global scale analyses of soil and foliage δ15N have found positive relationships between δ15N and ecosystem N loss (suggesting an open N cycle and a negative relationship between δ15N and water availability. We show here that soils and leaves from tropical heath forests are depleted in 15N relative to 'typical' forests suggesting that they have a tight N cycle and are therefore limited by N rather than by, often suggested, water availability.Análises de δ15N solo e foliar, em escala global, encontraram relações positivas entre δ15N e a perda de N do ecossistema (sugerindo um ciclo aberto de N, e uma relação negativa entre o δ15N e a disponibilidade de água. Mostramosneste trabalho que os solos e a vegetação de florestas de campinarana são empobrecidas em 15N em relação a florestas 'típicas', sugerindo que elas têm um ciclo fechado de N e são, desta forma, limitadas pelo N, ao invés da disponibilidade de água, como frequentemente sugerido.

    4. Eight years of the Great Influenza Survey to monitor influenza-like illness in Flanders.

      Directory of Open Access Journals (Sweden)

      Yannick Vandendijck

      Full Text Available In 2003, an internet-based monitoring system of influenza-like illness (ILI, the Great Influenza Survey (GIS, was initiated in Belgium. For the Flemish part of Belgium, we investigate the representativeness of the GIS population and assess the validity of the survey in terms of ILI incidence during eight influenza seasons (from 2003 through 2011. The validity is investigated by comparing estimated ILI incidences from the GIS with recorded incidences from two other monitoring systems, (i the Belgian Sentinel Network and (ii the Google Flu Trends, and by performing a risk factor analysis to investigate whether the risks on acquiring ILI in the GIS population are comparable with results in the literature. A random walk model of first order is used to estimate ILI incidence trends based on the GIS. Good to excellent correspondence is observed between the estimated ILI trends in the GIS and the recorded trends in the Sentinel Network and the Google Flu Trends. The results of the risk factor analysis are in line with the literature. In conclusion, the GIS is a useful additional surveillance network for ILI monitoring in Flanders. The advantages are the speed at which information is available and the fact that data is gathered directly in the community at an individual level.

    5. The Fine Temporal Structure of the Rat Licking Pattern: What Causes the Variabiliy in the Interlick Intervals and How is it Affected by the Drinking Solution?

      Science.gov (United States)

      2013-01-01

      Licking is a repetitive behavior controlled by a central pattern generator. Even though interlick intervals (ILIs) within bursts of licks are considered fairly regular, the conditions that affect their variability are unknown. We analyzed the licking pattern in rats that licked water, 10% sucrose solution, or 10% ethanol solution, in 90-min recording sessions after 4h of water deprivation. The histograms of ILIs indicate that licking typically occurred at a preferred ILI of about 130−140ms with evidence of bimodal or multimodal distributions due to occasional licking failures. We found that the longer the pause between bursts of licks, the shorter was the first ILI of the burst. When bursts of licks were preceded by a pause >4 s, the ILI was the shortest (~110ms) at the beginning of the burst, and then it increased rapidly in the first few licks and slowly in subsequent licks. Interestingly, the first ILI of a burst of licks was not significantly different when licking any of the 3 solutions, but subsequent licks exhibited a temporal pattern characteristic of each solution. The rapid deceleration in intraburst licking rate was due to an increase from ~27ms to ~56ms in the tongue-spout contact duration while the intercontact interval was only slightly changed (80−90ms). Therefore, the contact duration seems to be the major factor that increases the variability in the ILIs and could be another means for the rat to adjust the amount of fluid ingested in each individual lick. PMID:23902635

    6. Personality, psychological stress, and self-reported influenza symptomatology

      Directory of Open Access Journals (Sweden)

      Croon Marcel A

      2007-11-01

      Full Text Available Abstract Background Psychological stress and negative mood have been related to increased vulnerability to influenza-like illness (ILI. This prospective study re-evaluated the predictive value of perceived stress for self-reported ILI. We additionally explored the role of the negative affectivity and social inhibition traits. Methods In this study, 5,404 respondents from the general population were assessed in terms of perceived stress, personality, and control variables (vaccination, vitamin use, exercise, etc.. ILI were registered weekly using self-report measures during a follow-up period of four weeks. Results Multivariable logistic regression analysis on ILI was performed to test the predictive power of stress and personality. In this model, negative affectivity (OR = 1.05, p = 0.009, social inhibition (OR = 0.97, p = 0.011, and perceived stress (OR = 1.03, p = 0.048 predicted ILI reporting. Having a history of asthma (OR = 2.33, p = Conclusion Elderly and socially inhibited persons tend to report less ILI as compared to their younger and less socially inhibited counterparts. In contrast, asthma, trait negative affectivity, and perceived stress were associated with higher self-report of ILI. Our results demonstrate the importance of including trait markers in future studies examining the relation between stress and self-report symptom measures.

    7. Comparison of outpatient medically attended and community-level influenza-like illness-New York City, 2013-2015.

      Science.gov (United States)

      Russell, Kate E; Fowlkes, Ashley; Stockwell, Melissa S; Vargas, Celibell Y; Saiman, Lisa; Larson, Elaine L; LaRussa, Philip; Di Lonardo, Steve; Popowich, Michael; St George, Kirsten; Steffens, Andrea; Reed, Carrie

      2018-05-01

      Surveillance of influenza-like illness (ILI) in the United States is primarily conducted through medical settings despite a significant burden of non-medically attended ILI. To assess consistency between surveillance for respiratory viruses in outpatient and community settings using ILI surveillance from the Centers for Disease Control and Prevention Influenza Incidence Surveillance Project (IISP) and the Mobile Surveillance for Acute Respiratory Infections (ARI) and Influenza-Like Illness in the Community (MoSAIC) Study. The Influenza Incidence Surveillance Project conducts ILI surveillance in 3 primary care clinics in New York City, and MoSAIC conducts community-based ILI/ARI surveillance through text messaging among a cohort of New York City residents. Both systems obtain respiratory specimens from participants with ILI/ARI and test for multiple pathogens. We conducted a retrospective review of ILI cases in IISP and MoSAIC from January 2013 to May 2015 with descriptive analyses of clinical and laboratory data. Five-hundred twelve MoSAIC and 669 IISP participants met an ILI criteria (fever with cough or sore throat) and were included. Forty percent of MoSAIC participants sought care; the majority primary care. Pathogens were detected in 63% of MoSAIC and 70% of IISP cases. The relative distribution of influenza and other respiratory viruses detected was similar; however, there were statistically significant differences in the frequency that were not explained by care seeking. Outpatient and community-based surveillance in the one found similar timing and relative distribution of respiratory viruses, but community surveillance in a single neighborhood may not fully capture the variations in ILI etiology that occur more broadly. Published 2018. This article is a U.S. Government work and is in the public domain in the USA. Influenza and Other Respiratory Viruses published by John Wiley & Sons Ltd.

    8. Hospital triage system for adult patients using an influenza-like illness scoring system during the 2009 pandemic--Mexico.

      Directory of Open Access Journals (Sweden)

      Eduardo Rodriguez-Noriega

      2010-05-01

      Full Text Available Pandemic influenza A (H1N1 virus emerged during 2009. To help clinicians triage adults with acute respiratory illness, a scoring system for influenza-like illness (ILI was implemented at Hospital Civil de Guadalajara, Mexico.A medical history, laboratory and radiology results were collected on emergency room (ER patients with acute respiratory illness to calculate an ILI-score. Patients were evaluated for admission by their ILI-score and clinicians' assessment of risk for developing complications. Nasal and throat swabs were collected from intermediate and high-risk patients for influenza testing by RT-PCR. The disposition and ILI-score of those oseltamivir-treated versus untreated, clinical characteristics of 2009 pandemic influenza A (H1N1 patients versus test-negative patients were compared by Pearson's Chi(2, Fisher's Exact, and Wilcoxon rank-sum tests.Of 1840 ER patients, 230 were initially hospitalized (mean ILI-score = 15, and the rest were discharged, including 286 ambulatory patients given oseltamivir (median ILI-score = 11, and 1324 untreated (median ILI-score = 5. Fourteen (1% untreated patients returned, and 3 were hospitalized on oseltamivir (median ILI-score = 19. Of 371 patients tested by RT-PCR, 104 (28% had pandemic influenza and 42 (11% had seasonal influenza A detected. Twenty (91% of 22 imaged hospitalized pandemic influenza patients had bilateral infiltrates compared to 23 (38% of 61 imaged hospital test-negative patients (p<0.001. One patient with confirmed pandemic influenza presented 6 days after symptom onset, required mechanical ventilation, and died.The triaging system that used an ILI-score complimented clinicians' judgment of who needed oseltamivir and inpatient care and helped hospital staff manage a surge in demand for services.

    9. Seasonality of absolute humidity explains seasonality of influenza-like illness in Vietnam.

      Science.gov (United States)

      Thai, Pham Quang; Choisy, Marc; Duong, Tran Nhu; Thiem, Vu Dinh; Yen, Nguyen Thu; Hien, Nguyen Tran; Weiss, Daniel J; Boni, Maciej F; Horby, Peter

      2015-12-01

      Experimental and ecological studies have shown the role of climatic factors in driving the epidemiology of influenza. In particular, low absolute humidity (AH) has been shown to increase influenza virus transmissibility and has been identified to explain the onset of epidemics in temperate regions. Here, we aim to study the potential climatic drivers of influenza-like illness (ILI) epidemiology in Vietnam, a tropical country characterized by a high diversity of climates. We specifically focus on quantifying and explaining the seasonality of ILI. We used 18 years (1993-2010) of monthly ILI notifications aggregated by province (52) and monthly climatic variables (minimum, mean, maximum temperatures, absolute and relative humidities, rainfall and hours of sunshine) from 67 weather stations across Vietnam. Seasonalities were quantified from global wavelet spectra, using the value of the power at the period of 1 year as a measure of the intensity of seasonality. The 7 climatic time series were characterized by 534 summary statistics which were entered into a regression tree to identify factors associated with the seasonality of AH. Results were extrapolated to the global scale using simulated climatic times series from the NCEP/NCAR project. The intensity of ILI seasonality in Vietnam is best explained by the intensity of AH seasonality. We find that ILI seasonality is weak in provinces experiencing weak seasonal fluctuations in AH (annual power power >17.6). In Vietnam, AH and ILI are positively correlated. Our results identify a role for AH in driving the epidemiology of ILI in a tropical setting. However, in contrast to temperate regions, high rather than low AH is associated with increased ILI activity. Fluctuation in AH may be the climate factor that underlies and unifies the seasonality of ILI in both temperate and tropical regions. Alternatively, the mechanism of action of AH on disease transmission may be different in cold-dry versus hot-humid settings

    10. UČINKOVITOST TRIGGERPOINT TERAPIJE KOD TINITUSA

      OpenAIRE

      Jarak, Irena; Miletić, Marija; Žura, Nikolino

      2016-01-01

      UVOD: Šum u uhu (tinitus) predstavlja percepciju zvuka u uhu ili glavi koja se pojavljuje bez očitog vanjskog zvučnog podražaja, odnosno fantomski slušni podražaj. Pojavu tinitusa može uzrokovati npr. oštećenja ili promjene u otološkom sustavu, tumor, multipla skleroza, kardiovaskularna oboljenja, lijekovi, psihička oboljenja ili mišićnokoštani sustav. Tinitus nije bolest već simptom, tako da ne postoji jedinstvena terapija u njegovom liječenju. M. sternocleidomastoide...

    11. Mura - čovjek - priroda

      OpenAIRE

      Kantar, Sandra; Ivanek-Martinčić, Marjana; Augustinović, Zvjezdana

      2008-01-01

      U ovom je radu dan pregled radova studenata Visokoga gospodarskog učilišta iz Križevaca, nastalih u sklopu Interreg III A projekta suradnje pod naslovom »Mura - čovjek - priroda«. U projektu su sudjelovali Poljoprivredni fakultet Georgikon iz Keszthelyja Sveučilišta Veszprem, Poljoprivredni muzej Georgikon iz Keszthelyja, Nacionalni park Balaton, nevladina organizacija za zaštitu prirode »Bijeli gavran« i Visoko gospodarsko učilište iz Križevaca. Na hrvatskoj strani, priroda uz Muru je vrl...

    12. NITRATI I NITRITI, METABOLIZAM I TOKSIČNOST

      OpenAIRE

      Nujić, Marija; Habuda-Stanić, Mirna

      2017-01-01

      Nitrati i nitriti su kemijski spojevi koji se koriste kao gnojivo, rodenticidi ili konzervansi. Mogu se naći u zraku, tlu, vodi ili hrani (posebice povrću) a mogu se i stvarati u ljudskom tijelu. Nitrati imaju važnu ulogu u hranjenju i metabolizmu biljaka. Nastaju oksidacijom organskog otpada djelovanjem dušičnih bakterija. Ljudi mogu biti izloženi nitratima i nitritima preko konzumacije povrća i mesnih prerađevina, a manjim dijelom preko vode ili ostale hrane. Pijenje vode sa već...

    13. Determination of customer satisfaction with services of pizzerias “Cili pica”

      OpenAIRE

      Pilelienė, Lina; Grigaliūnaitė, Viktorija

      2012-01-01

      Straipsnyje analizuojamas vartotojų pasitenkinimas „Čili pica“ picerijų paslaugomis. Straipsnio tikslas – įvertinus vartotojų pasitenkinimą „Čili pica“ picerijų paslaugomis, nustatyti jį formuojančius veiksnius. Tyrimas atliekamas adaptuojant Europos Vartotojų Pasitenkinimo Indekso metodiką. Remiantis tyrimo rezultatais, „Čili pica“ picerijoms nustatyti modelio kintamieji, kuriuos reikėtų stiprinti, siekiant padidinti vartotojų pasitenkinimą šiomis picerijomis ir jų teikiamomis paslaugomis. ...

    14. Influenza-like illness in an urban community of Salvador, Brazil: incidence, seasonality and risk factors.

      Science.gov (United States)

      Oliveira, Carlos R; Costa, Gisela S R; Paploski, Igor A D; Kikuti, Mariana; Kasper, Amelia M; Silva, Monaise M O; Tavares, Aline S; Cruz, Jaqueline S; Queiroz, Tássia L; Lima, Helena C A V; Calcagno, Juan; Reis, Mitermayer G; Weinberger, Daniel M; Shapiro, Eugene D; Ko, Albert I; Ribeiro, Guilherme S

      2016-03-15

      Our understanding of the epidemiology of influenza is limited in tropical regions, which in turn has hampered identifying optimal region-specific policy to diminish disease burden. Influenza-like illness (ILI) is a clinical diagnosis that can be used as a surrogate for influenza. This study aimed to define the incidence and seasonality of ILI and to assess its association with climatic variables and school calendar in an urban community in the tropical region of Salvador, Brazil. Between 2009 and 2013, we conducted enhanced community-based surveillance for acute febrile illnesses (AFI) among patients ≥ 5 years of age in a slum community emergency unit in Salvador, Brazil. ILI was defined as a measured temperature of ≥ 37.8 °C or reported fever in a patient with cough or sore throat for ≤ 7 days, and negative test results for dengue and leptospirosis. Seasonality was analyzed with a harmonic regression model. Negative binomial regression models were used to correlate ILI incidence with rainfall, temperature, relative humidity and the number of days per month that schools were in session while controlling for seasonality. There were 2,651 (45.6% of 5,817 AFI patients) ILI cases with a mean annual incidence of 60 cases/1,000 population (95% CI 58-62). Risk of ILI was highest among 5-9 year olds with an annual incidence of 105 cases/1,000 population in 2009. ILI had a clear seasonal pattern with peaks between the 35-40th week of the year. ILI peaks were higher and earlier in 5-9 year olds compared with > 19 year olds. No association was seen between ILI and precipitation, relative humidity or temperature. There was a significant association between the incidence of ILI in children 5-9 years of age and number of scheduled school days per month. We identified a significant burden of ILI with distinct seasonality in the Brazilian tropics and highest rates among young school-age children. Seasonal peaks of ILI in children 5-9 years of age were positively associated

    15. Komunikacijski aspekt ukrašavanja tijela u zapadnoj kulturi

      OpenAIRE

      Dadić, Nikolina

      2017-01-01

      Ukrašavanje tijela kroz povijest imalo je različita značenja, bilo religijska, ritualna ili estetska, neovisno o stupnju civilizacijskog razvoja, kulturi i kontinentu. Ukrašavanje se održalo do danas, a tijekom različitih povijesnih razdoblja bilo je podložno modi i trendovima, jednako kao i odjeća, obuća ili frizura. Još uvijek postoje predrasude koje kod nekih osoba izazivaju odbojnost što se tiče ljudi koji nose tetovaže ili ukrase i u čistoj suprotnosti su sa jednim liberalnim pogledo...

    16. ŽENE U ZNANOSTI: STAKLENI STROP

      OpenAIRE

      PRIJIĆ-SAMARŽIJA, Snježana; AVELINI HOLJEVAC, Ivanka; TURK, Marko

      2009-01-01

      Temeljni cilj članka jest propitivanje postojanja "staklenoga stropa" ili podzastupljenosti žena na rukovodećim položajima u ustanovama znanosti i visokog obrazovanja kakvo je Sveučilište u Rijeci, uključivo i mehanizama koji ga uzrokuju. Prvi dio članka sadrži kratak pregled i analizu empirijskih rezultata istraživanja provedenog na Sveučilištu u Rijeci, koji nedvojbeno upućuju na prisutnost efekta "staklenoga stropa" i, shodno tome, na postojanje prikrivene primarne i s...

    17. Vrste i tehnike 3D modeliranja

      OpenAIRE

      Bernik, Andrija

      2010-01-01

      Proces stvaranja 3D stvarnih ili imaginarnih objekata naziva se 3D modeliranje. Razvoj računalne tehnologije omogućuje korisniku odabir raznih metoda i tehnika kako bi se postigla optimalna učinkovitost. Odabir je vezan za klasično 3D modeliranje ili 3D skeniranje pomoću specijaliziranih programskih i sklopovskih rješenja. 3D tehnikama modeliranja korisnik može izraditi 3D model na nekoliko načina: koristi poligone, krivulje ili hibrid dviju spomenutih tehnika pod nazivom subdivizijsko modeli...

    18. Primena metoda ekspertskog ocenjivanja pri oceni profesionalnog rizika

      OpenAIRE

      Zoran Novaković

      2007-01-01

      Osnovni cilj utvrđivanja ocene profesionalnog rizika je preventivno delovanje u funkciji bezbednosti i zaštite zdravlja zaposlenih, tj. preduzimanje opštih i posebnih mera zaštite na radu radi eliminisanja opasnosti ili štetnosti, ili smanjivanja vremena ekspozicije zaposlenog određenim faktorima rizika u sredinama gde je ustanovljena njihova prisutnost. U mnogim slučajevima raspoloživi podaci o prethodnim štetnim događajima su nepotpuni ili nisu dovoljno statistički relevantni...

    19. indicators of apoptosis in Duchenne Muscular Dystrophy Patients

      African Journals Online (AJOL)

      and at the molecular level versus 20 age and socioeconomic matching healthy boys. ... to the tumor necrosis factor superfam- ily and induces apoptosis ... tory cell induced apoptosis in blood of ..... Brain 1997; 120 (Pt 6): 929-38. Butterfield TA ...

    20. BEDEN ETKİLEŞİMLİ MEKAN TASARIMI

      OpenAIRE

      ADIGÜZEL ÖZBEK, Derya

      2018-01-01

      İnsanlar bedenli varlıklar olarak bedeni aracılığı ile dünyaya temaseder, onunla ilişki kurar ve etkileşime geçerler. İnsanların dünya ile ilişkisibeden üzerinden tanımlanmakta, bu ilişki doğrultusunda biçimlenmektedir. Mekanve bedenin etkileşim içindeki devingen ilişkisi tasarımda önemli bir yeresahiptir. Mekanın, statik beden için standart üretimi yerine deneyimleyenkullanıcı için tasarlanması gerekmektedir. Çalışmada, bu anlayışlayapılandırılan Mekan-Beden Etkileşimi dersi ve bu ders kapsa...

    1. Globalizatsija : put dlja vsego tshelovetshestva / Viktor Vaseha

      Index Scriptorium Estoniae

      Vaseha, Viktor

      2000-01-01

      Globaliseeruva maailma sisemistest vastuoludest, "globaalse" eliidi tekkimisest, globaliseerumisest kui uuskolonialismi varjunimest. Vastukaja Mihhail Balev'i artiklile "Eksperiment po globalizatsii, ili Evrosojuz kak simpatitshnõi oksjumoron" Raduga, 2000, nr.1

    2. Influenza surveillance in Europe. Comparing intensity levels calculated using the Moving Epidemic Method.

      LENUS (Irish Health Repository)

      Vega, Tomás

      2015-05-30

      Although influenza-like illnesses (ILI) and acute respiratory illnesses (ARI) surveillance are well established in Europe, the comparability of intensity among countries and seasons remains an unresolved challenge.

    3. Deep sequence characterisation of a divergent HPIV-4a from an adult with prolonged influenza-like illness

      Directory of Open Access Journals (Sweden)

      Katherine E. Arden

      2015-12-01

      Deep sequencing allowed identification and genomic characterisation of a possible pathogen from an ILI as well as being an important tool to aid future understanding of the linkages between viral genetic variation, transmission and disease prognosis.

    4. Advanced Propellants for Scalable, Multipurpose Electrospray Ion Thrusters

      Data.gov (United States)

      National Aeronautics and Space Administration — Ionic liquid ion sources (ILIS) have numerous applications in spacecraft propulsion and focused ion beam technologies. The Space Propulsion Lab at the Massachusetts...

    5. Development of dual field magnetic flux leakage (MFL) inspection technology to detect mechanical damage.

      Science.gov (United States)

      2013-03-01

      This report details the development and testing of a dual magnetization in-line inspection (ILI) : tool for detecting mechanical damage in operating pipelines, including the first field trials of a : fully operational dual-field magnetic flux leakage...

    6. A simple and reliable methodology to detect egg white in art samples

      Indian Academy of Sciences (India)

      2013-04-26

      Apr 26, 2013 ... threshold density values useful for the detection of ovalbumin in samples from ancient works of art. .... slides a mixture of a water solution of dry egg white and the .... ily, facing the problems of sample leakage, background.

    7. Grass survey of the Itremo Massif records endemic central highland ...

      African Journals Online (AJOL)

      Grasses are members of the plant family Poaceae, and are primar- ily known for their ... Madagascar Conservation & Development is the journal of. Indian Ocean .... cording to the classification by Kellogg (2015). With 64 ..... Flowering plants.

    8. Estimation of community-level influenza-associated illness in a low resource rural setting in India.

      Directory of Open Access Journals (Sweden)

      Siddhartha Saha

      Full Text Available To estimate rates of community-level influenza-like-illness (ILI and influenza-associated ILI in rural north India.During 2011, we conducted household-based healthcare utilization surveys (HUS for any acute medical illness (AMI in preceding 14days among residents of 28villages of Ballabgarh, in north India. Concurrently, we conducted clinic-based surveillance (CBS in the area for AMI episodes with illness onset ≤3days and collected nasal and throat swabs for influenza virus testing using real-time polymerase chain reaction. Retrospectively, we applied ILI case definition (measured/reported fever and cough to HUS and CBS data. We attributed 14days of risk-time per person surveyed in HUS and estimated community ILI rate by dividing the number of ILI cases in HUS by total risk-time. We used CBS data on influenza positivity and applied it to HUS-based community ILI rates by age, month, and clinic type, to estimate the community influenza-associated ILI rates.The HUS of 69,369 residents during the year generated risk-time of 3945 person-years (p-y and identified 150 (5%, 95%CI: 4-6 ILI episodes (38 ILI episodes/1,000 p-y; 95% CI 32-44. Among 1,372 ILI cases enrolled from clinics, 126 (9%; 95% CI 8-11 had laboratory-confirmed influenza (A (H3N2 = 72; B = 54. After adjusting for age, month, and clinic type, overall influenza-associated ILI rate was 4.8/1,000 p-y; rates were highest among children <5 years (13; 95% CI: 4-29 and persons≥60 years (11; 95%CI: 2-30.We present a novel way to use HUS and CBS data to generate estimates of community burden of influenza. Although the confidence intervals overlapped considerably, higher point estimates for burden among young children and older adults shows the utility for exploring the value of influenza vaccination among target groups.

    9. Estimating burden of influenza-associated influenza-like illness and severe acute respiratory infection at public healthcare facilities in Romania during the 2011/12-2015/16 influenza seasons.

      Science.gov (United States)

      Gefenaite, Giedre; Pistol, Adriana; Popescu, Rodica; Popovici, Odette; Ciurea, Daniel; Dolk, Christiaan; Jit, Mark; Gross, Diane

      2018-01-01

      Influenza is responsible for substantial morbidity and mortality, but there is limited information on reliable disease burden estimates, especially from middle-income countries in the WHO European Region. To estimate the incidence of medically attended influenza-associated influenza-like illness (ILI) and hospitalizations due to severe acute respiratory infection (SARI) presenting to public healthcare facilities in Romania. Sentinel influenza surveillance data for ILI and SARI from 2011/12-2015/16, including virological data, were used to estimate influenza-associated ILI and SARI incidence/100 000 and their 95% confidence intervals (95% CI). The overall annual incidence of ILI and influenza-associated ILI per 100 000 persons in Romania varied between 68 (95% CI: 61-76) and 318 (95% CI: 298-338) and between 23 (95% CI: 19-29) and 189 (95% CI: 149-240), respectively. The highest ILI and influenza incidence was among children aged 0-4 years. We estimated that SARI incidence per 100 000 persons was 6 (95% CI: 5-7) to 9 (95% CI: 8-10), of which 2 (95% CI: 1-2) to 3 (95% CI: 2-4) were due to influenza. Up to 0.3% of the Romanian population were annually reported with ILI, and 0.01% was hospitalized with SARI, of which as much as one-third could be explained by influenza. This evaluation was the first study estimating influenza burden in Romania. We found that during each influenza season, a substantial number of persons in Romania suffer from influenza-related ILI or are hospitalized due to influenza-associated SARI. © 2017 The World Health Organization. Influenza and Other Respiratory Viruses. Published by John Wiley & Sons Ltd.

    10. Prevalence and Incidence of Respiratory Syncytial Virus and Other Respiratory Viral Infections in Children Aged 6 Months to 10 Years With Influenza-like Illness Enrolled in a Randomized Trial

      Science.gov (United States)

      Nolan, Terry; Borja-Tabora, Charissa; Lopez, Pio; Weckx, Lily; Ulloa-Gutierrez, Rolando; Lazcano-Ponce, Eduardo; Kerdpanich, Angkool; Weber, Miguel Angel Rodriguez; Mascareñas de Los Santos, Abiel; Tinoco, Juan-Carlos; Safadi, Marco Aurelio P.; Seng, Lim Fong; Hernandez-de Mezerville, Marcela; Faingezicht, Idis; Cruz-Valdez, Aurelio; Feng, Yang; Li, Ping; Durviaux, Serge; Haars, Gerco; Roy-Ghanta, Sumita; Vaughn, David W.; Taylor, Sylvia

      2015-01-01

      Background. The high burden of respiratory syncytial virus (RSV)-associated morbidity and mortality makes vaccine development a priority. Methods. As part of an efficacy trial of pandemic influenza vaccines (NCT01051661), RSV epidemiology in healthy children aged 6 months to <10 years at first vaccination with influenza-like illness (ILI) was evaluated in Australia, Brazil, Colombia, Costa Rica, Mexico, the Philippines, Singapore, and Thailand between February 2010 and August 2011. Active surveillance for ILI was conducted for approximately 1 year, with nasal and throat swabs analyzed by polymerase chain reaction. The prevalence and incidence of RSV among ILI episodes were calculated. Results. A total of 6266 children were included, of whom 2421 experienced 3717 ILI episodes with a respiratory sample available. RSV was detected for 359 ILI episodes, a prevalence of 9.7% (95% confidence interval: 8.7–10.7). The highest prevalence was in children aged 12–23 or 24–35 months in all countries except the Philippines, where it was in children aged 6–11 months. The incidence of RSV-associated ILI was 7.0 (6.3–7.7) per 100 person-years (PY). Eighty-eight ILI episodes resulted in hospitalization, of which 8 were associated with RSV (prevalence 9.1% [4.0–17.1]; incidence 0.2 [0.1–0.3] per 100 PY). The incidence of RSV-associated ILI resulting in medical attendance was 6.0 (5.4–6.7) per 100 PY. RSV B subtypes were observed more frequently than A subtypes. Conclusions. Active surveillance demonstrated the considerable burden of RSV-associated illness that would not be identified through hospital-based surveillance, with a substantial part of the burden occurring in older infants and children. PMID:25673560

    11. Influenza like illness monitoring in adults of the State Capitals and Federal District in Brazil by telephone survey.

      Science.gov (United States)

      Reis, Priscilleyne Ouverney; Iser, Betine Pinto Moehlecke; Souza, Líbia Roberta de Oliveira; Yokota, Renata Tiene de Carvalho; de Almeida, Walquiria Aparecida Ferreira; Bernal, Regina Tomie Ivata; Malta, Deborah Carvalho; de Oliveira, Wanderson Kleber; Penna, Gerson Oliveira

      2011-09-01

      In order to estimate the prevalence of influenza like illness (ILI) in adults from all state capitals and geographic regions in Brazil, a periodical monitoring of ILI cases by the national telephone survey (VIGITEL) was carried out in 2010. A cross-sectional study with 47,876 telephone interviews in the state capitals and Federal District, a probabilistic sample of adult population (>18 years-old) with landline telephone. Questions concerning the results of ILI cases and pandemic influenza (H1N1) 2009, from January 10 to November 30, were analyzed. The proportion of cases stratified by sociodemographic characteristics and Brazilian geographic region was weighted with data from the National Survey with Household Sampling (PNAD) 2008. The prevalence of ILI cases in the last 30 days before interview was 31.2% (95%CI 30.2-32.2%) for all state capitals and the Federal District. This prevalence was higher among women, young adults (18 to 29 years-old) and individuals with 9 to 11 years of schooling. According to the geographic region analysis, Northern Brazil presented the highest prevalence of ILI cases. A tendency to increase with further decrease was observed among the geographic regions, except the Northeast. Need for health care assistance was reported by 26.8% (95%CI 25.1-28.5) from ILI cases. Among ILI cases that sought health care assistance, 2.6% (95%CI 1.8-3.4) reported pandemic influenza (H1N1) 2009 medical suspicion. The results of this survey supported influenza surveillance as it provided timeliness and useful surveillance information, which were not captured by the traditional surveillance system, as the occurrence of ILI and need of health care assistance.

    12. AcEST: DK959664 [AcEST

      Lifescience Database Archive (English)

      Full Text Available ILI6|NS1A_TASV2 Non-structural polyprotein 1A OS=Turkey ast... 30 9.3 sp|Q9ILI5|N...S1AB_TASV2 Non-structural polyprotein 1AB OS=Turkey a... 30 9.3 sp|A5DGN9|NACA_PICGU Nascent polypeptide-ass

    13. Cost of intervention delivery in a lifestyle weight loss trial in type 2 diabetes: results from the Look AHEAD clinical trial

      OpenAIRE

      Rushing, J.; Wing, R.; Wadden, T. A.; Knowler, W. C.; Lawlor, M.; Evans, M.; Killean, T.; Montez, M.; Espeland, M. A.; Zhang, P.

      2017-01-01

      Summary Objective The Action for Health in Diabetes (Look AHEAD) trial was a randomized controlled clinical trial to compare the effects of 10?years of intensive lifestyle intervention (ILI) with a control condition of diabetes support and education (DSE) on health outcomes in over 5,000 participants with type 2 diabetes. The ILI had significantly greater weight losses than DSE throughout the trial. The goal of this analysis is to describe the cost of delivering the intervention. Methods The ...

    14. Lifelong learning in public libraries principles, programs, and people

      CERN Document Server

      Gilton, Donna L

      2012-01-01

      Lifelong Learning in Public Libraries demonstrates that public librarians can promote learning by combining the elements of Information Literacy Instruction (ILI) with traditional practices of public libraries. This approach contributes to the information enfranchisement of patrons and enhances the fulfillment of the traditional goals and purposes of libraries. Donna L. Gilton provides background on ILI and current developments in public library instruction and also examines educational the

    15. An Intensive Lifestyle Intervention Is an Effective Treatment of Morbid Obesity: The TRAMOMTANA Study—A Two-Year Randomized Controlled Clinical Trial

      Science.gov (United States)

      Burguera, Bartolomé; Jesús Tur, Juan; Escudero, Antonio Jorge; Alos, María; Pagán, Alberto; Cortés, Baltasar; González, Xavier Francesc; Soriano, Joan B.

      2015-01-01

      Bariatric surgery is currently the most effective therapy to induce weight loss in morbidly obese patients. Objective. This controlled, clinical trial with a two-year intervention was aimed at comparing the efficacy of two nonsurgical approaches versus bariatric surgery, on body weight changes and metabolic parameters in morbidly obese patients. Methods. Patients were randomized to an Intensive Lifestyle Intervention (ILI) (n = 60) or Conventional Obesity Therapy (COT) (n = 46). The ILI group received behavioral therapy and nutritional counseling. The COT group received standard medical treatment. They were compared with a third group, Surgical Obesity Group (SOG) (n = 37). Results. Patients who received ILI had a greater percentage of weight loss than patients receiving COT (−11.3% versus −1.6%; p < 0.0044). Interestingly 31.4% of patients included in the ILI group were no longer morbidly obese after just six months of intervention, increasing to 44.4% after 24 months of intervention. The percentage weight loss in SOG was −29.6% after that same period of time. Conclusions. ILI was associated with significant weight loss when compared to COT, in a group of patients with obesity. An ILI approach could be an alternative therapy to patients with obesity, who are not candidates to undergo bariatric surgery. This trial is registered with EudraCT 2009-013737-24. PMID:26257780

    16. An Intensive Lifestyle Intervention Is an Effective Treatment of Morbid Obesity: The TRAMOMTANA Study—A Two-Year Randomized Controlled Clinical Trial

      Directory of Open Access Journals (Sweden)

      Bartolomé Burguera

      2015-01-01

      Full Text Available Bariatric surgery is currently the most effective therapy to induce weight loss in morbidly obese patients. Objective. This controlled, clinical trial with a two-year intervention was aimed at comparing the efficacy of two nonsurgical approaches versus bariatric surgery, on body weight changes and metabolic parameters in morbidly obese patients. Methods. Patients were randomized to an Intensive Lifestyle Intervention (ILI (n=60 or Conventional Obesity Therapy (COT (n=46. The ILI group received behavioral therapy and nutritional counseling. The COT group received standard medical treatment. They were compared with a third group, Surgical Obesity Group (SOG (n=37. Results. Patients who received ILI had a greater percentage of weight loss than patients receiving COT (−11.3% versus −1.6%; p<0.0044. Interestingly 31.4% of patients included in the ILI group were no longer morbidly obese after just six months of intervention, increasing to 44.4% after 24 months of intervention. The percentage weight loss in SOG was −29.6% after that same period of time. Conclusions. ILI was associated with significant weight loss when compared to COT, in a group of patients with obesity. An ILI approach could be an alternative therapy to patients with obesity, who are not candidates to undergo bariatric surgery. This trial is registered with EudraCT 2009-013737-24.

    17. Sentinel surveillance of influenza-like-illness in two cities of the tropical country of Ecuador: 2006-2010.

      Directory of Open Access Journals (Sweden)

      Richard W Douce

      Full Text Available Tropical countries are thought to play an important role in the global behavior of respiratory infections such as influenza. The tropical country of Ecuador has almost no documentation of the causes of acute respiratory infections. The objectives of this study were to identify the viral agents associated with influenza like illness (ILI in Ecuador, describe what strains of influenza were circulating in the region along with their epidemiologic characteristics, and perform molecular characterization of those strains.This is a prospective surveillance study of the causes of ILI based on viral culture of oropharyngeal specimens and case report forms obtained in hospitals from two cities of Ecuador over 4 years. Out of 1,702 cases of ILI, nine viral agents were detected in 597 patients. During the time of the study, seven genetic variants of influenza circulated in Ecuador, causing six periods of increased activity. There appeared to be more heterogeneity in the cause of ILI in the tropical city of Guayaquil when compared with the Andean city of Quito.This was the most extensive documentation of the viral causes of ILI in Ecuador to date. Influenza was a common cause of ILI in Ecuador, causing more than one outbreak per year. There was no well defined influenza season although there were periods of time when no influenza was detected alternating with epidemics of different variant strains.

    18. Safety and potential anticoagulant effects of nebulised heparin in burns patients with inhalational injury at Singapore General Hospital Burns Centre.

      Science.gov (United States)

      Yip, Lian Yee; Lim, Yen Fang; Chan, Hong Ngee

      2011-11-01

      Nebulised heparin, N-acetylcysteine (NAC) and salbutamol were shown to decrease reintubation rates, incidence of atelectasis and mortality in paediatric patients and reduce lung injury scores in adult burns patients with inhalational lung injury (ILI). Nebulised heparin, NAC and salbutamol treatment protocol was introduced in Singapore General Hospital (SGH) Burns Centre in 2006. However, safety data on the use of nebulised heparin and NAC for burns patients with ILI is not well established. In this study, we investigated the safety and potential anticoagulant effects of nebulised heparin in burns patients with ILI. A retrospective study with historical control was conducted. The treatment group consisted of 52 mechanically ventilated adult patients, with a diagnosis of ILI as confirmed by bronchoscopy, admitted to burn intensive care unit (BICU) from the year 2006 to 2009. The group was treated with nebulised heparin, NAC and salbutamol. The control group consists of 11 mechanically ventilated BICU ILI patients treated from year 2001 to 2005 before protocol initiation. Blood coagulation indices (prothrombin time (PT), activated partial thromboplastin time (APTT) and platelet count) were monitored and bleeding incidences were assessed. Blood coagulation indices did not suggest an increase risk of bleeding with nebulised heparin. The APTT, PT and platelet count followed a similar trend for both groups over 7 days. No clinically significant increase in bleeding risk was found to be associated with nebulised heparin. Nebulised heparin was not found to potentiate the risk of bleeding in burns patients with ILI. Copyright © 2011 Elsevier Ltd and ISBI. All rights reserved.

    19. Sentinel Surveillance of Influenza-Like-Illness in Two Cities of the Tropical Country of Ecuador: 2006–2010

      Science.gov (United States)

      Douce, Richard W.; Aleman, Washington; Chicaiza-Ayala, Wilson; Madrid, Cesar; Sovero, Merly; Delgado, Franklin; Rodas, Mireya; Ampuero, Julia; Chauca, Gloria; Perez, Juan; Garcia, Josefina; Kochel, Tadeusz; Halsey, Eric S.; Laguna-Torres, V. Alberto

      2011-01-01

      Background Tropical countries are thought to play an important role in the global behavior of respiratory infections such as influenza. The tropical country of Ecuador has almost no documentation of the causes of acute respiratory infections. The objectives of this study were to identify the viral agents associated with influenza like illness (ILI) in Ecuador, describe what strains of influenza were circulating in the region along with their epidemiologic characteristics, and perform molecular characterization of those strains. Methodology/Findings This is a prospective surveillance study of the causes of ILI based on viral culture of oropharyngeal specimens and case report forms obtained in hospitals from two cities of Ecuador over 4 years. Out of 1,702 cases of ILI, nine viral agents were detected in 597 patients. During the time of the study, seven genetic variants of influenza circulated in Ecuador, causing six periods of increased activity. There appeared to be more heterogeneity in the cause of ILI in the tropical city of Guayaquil when compared with the Andean city of Quito. Conclusions/Significance This was the most extensive documentation of the viral causes of ILI in Ecuador to date. Influenza was a common cause of ILI in Ecuador, causing more than one outbreak per year. There was no well defined influenza season although there were periods of time when no influenza was detected alternating with epidemics of different variant strains. PMID:21887216

    20. Pilot Plant for Food Irradiation in The Netherlands; Usine Pilote pour l'Irradiation de Denrees Alimentaires aux Pays-Bas; Opytnaya ustanovka po oblucheniyu pishchevykh produktov v Gollandii; Planta Piloto de Irradiacion de Alimentos en los Paises Bajos

      Energy Technology Data Exchange (ETDEWEB)

      De Zeeuw, D.; Van Kooy, J. G. [Association EURATOM-ITAL, Wageningen (Netherlands)

      1966-11-15

      investigacion en laboratorio y las aplicaciones practicas. Se suscita, en otras palabras, la cuestion de saber como pueden transmitirse a los fabricantes e industriales los conocimientos adquiridos en el laboratorio. Conviene tener en cuenta los siguientes puntos: a) Inverted-Question-Mark Se considera la planta piloto como precursora inmediata de una planta comercial? b) Como puede aumentarse 100 veces el volumen de material tratado? c) Como puede estimularse el interes comercial? d) Inverted-Question-Mark Quien es, en definitiva, responsable del programa de la planta piloto? e) Inverted-Question-Mark Que medios tecnicos se necesitan? f) Inverted-Question-Mark Como puede organizarse la planta piloto de forma que se mantenga una comunicacion constante entre las partes interesadas? Todas estas cuestiones se examinan en relacion con una planta piloto de irradiacion de alimentos que se proyecta construir en los Paises Bajos. (author) [Russian] Osnovnaja problema, voznikajushhaja v svjazi s primeneniem jeksperimental'noj ustanovki v issledovatel'skih celjah, zakljuchaetsja v razrabotke metoda, kotoryj pomog by likvidirovat' razryv mezhdu laboratornymi rabotami i prakticheskim primeneniem. Drugimi slovami, kak peredat' informaciju, poluchennuju v laboratornyh uslovijah, v rasporjazhenie organizacij i lic, zanimajushhihsja proizvodstvom ili pererabotkoj sel'skohozjajstvennoj produkcii. V svjazi s jetim voznikaet rjad voprosov: a) Rassmatrivaetsja li opytnaja ustanovka v kachestve neposredstvennogo prototipa kommercheskoj ustanovki? b) Kakim obrazom dostigaetsja uvelichenie obluchaemoj produkcii v 100 raz? v) Kak zainteresovat' kommercheskie krugi v dannoj ustanovke? g) Kto neset okonchatel'nuju otvetstvennost' za programmu opytnoj ustanovki? d) Neobhodimo tehnicheskoe oborudovanie? e) Kakim obrazom sleduet organizovat' rabotu opytnoj ustanovki s tem, chtoby obespechit' nepreryvnyj obmen informaciej mezhdu zainteresovannymi storonami? Vse vysheperechislennye aspekty obsuzhdajutsja v