An improved method for chromosome counting in maize.
Kato, A
1997-09-01
An improved method for counting chromosomes in maize (Zea mays L.) is presented. Application of cold treatment (5C, 24 hr), heat treatment (42 C, 5 min) and a second cold treatment (5C, 24 hr) to root tips before fixation increased the number of condensed and dispersed countable metaphase chromosome figures. Fixed root tips were prepared by the enzymatic maceration-air drying method and preparations were stained with acetic orcein. Under favorable conditions, one preparation with 50-100 countable chromosome figures could be obtained in diploid maize using this method. Conditions affecting the dispersion of the chromosomes are described. This technique is especially useful for determining the somatic chromosome number in triploid and tetraploid maize lines.
Analysis of B chromosome nondisjunction induced by the r-X1 deficiency in maize.
Tseng, Shih-Hsuan; Peng, Shu-Fen; Cheng, Ya-Ming
2017-11-20
The maize B chromosome typically undergoes nondisjunction during the second microspore division. For normal A chromosomes, the r-X1 deficiency in maize can induce nondisjunction during the second megaspore and first microspore divisions. However, it is not known whether the r-X1 deficiency also induces nondisjunction of the maize B chromosome during these cell divisions. To answer this question, chromosome numbers were determined in the progeny of r-X1/R-r female parents carrying two B chromosomes. Some of the r-X1-lacking progeny (21.2%) contained zero or two B chromosomes. However, a much higher percentage of the r-X1-containing progeny (43.4%) exhibited zero or two B chromosomes, but none displayed more than two B chromosomes. Thus, the results indicated that the r-X1 deficiency could also induce nondisjunction of the B chromosome during the second megaspore division; moreover, the B chromosome in itself could undergo nondisjunction during the same division. In addition, pollen grains from plants with two B chromosomes lacking or exhibiting the r-X1 deficiency were compared via pollen fluorescence in situ hybridization (FISH) using a B chromosome-specific probe. The results revealed that the r-X1 deficiency could induce the occurrence of B chromosome nondisjunction during the first microspore division and that the B chromosome in itself could undergo nondisjunction during the same division at a lower frequency. Our data shed more light on the behavior of the maize B chromosome during cell division.
International Nuclear Information System (INIS)
Wang, L.; Gu, X.; Qu, M.; Luan, J.; Zhang, J.
2012-01-01
Zea mays ssp. mexicana, a wild relative of cultivated maize (Z. mays ssp. mays), is a useful gene resource for maize breeding. In this study, two populations were generated by conventional breeding scheme (population I) or tissue culture regime (population II), respectively, to introgress genetic material of Z. mays ssp. mexicana into maize. Karyotype analysis showed that the arm ratios of 10 pairs of chromosomes in parent maize Ye515 and derivative lines from 2 different populations with 26% and 38% chromosome variation frequencies, respectively. Alien chromatin was detected in the root tip cells of progeny plants through genomic in situ hybridization (GISH). There were 3.3 chromosomes carrying alien chromatin on average in population I and 6.5 in population II. The hybridization signals were located mainly at the terminal or sub terminal regions of the chromosomes and the sizes were notably variant among lines. Based on those results, it is concluded that the introgression of genetic material from Z. mays ssp. mexicana into cultivated maize was facilitated by tissue culture, and subsequently some excellent materials for maize breeding were created. (author)
Mano, Y.; Omori, F.
2013-01-01
Background and Aims Nicaraguan teosinte (Zea nicaraguensis), a species found in frequently flooded areas, provides useful germplasm for breeding flooding-tolerant maize (Z. mays subsp. mays). The objective of this study was to select flooding-tolerant lines using a library of introgression lines (ILs), each containing a chromosome segment from Z. nicaraguensis in the maize inbred line Mi29. Methods To produce the ILs, a single F1 plant derived from a cross between maize Mi29 and Z. nicaraguensis was backcrossed to Mi29 three times, self-pollinated four times and genotyped using simple sequence repeat markers. Flooding tolerance was evaluated at the seedling stage under reducing soil conditions. Key Results By backcrossing and selfing, a series of 45 ILs were developed covering nearly the entire maize genome. Five flooding-tolerant lines were identified from among the ILs by evaluating leaf injury. Among these, line IL#18, containing a Z. nicaraguensis chromosome segment on the long arm of chromosome 4, showed the greatest tolerance to flooding, suggesting the presence of a major quantitative trait locus (QTL) in that region. The presence of the QTL was verified by examining flooding tolerance in a population segregating for the candidate region of chromosome 4. There was no significant relationship between the capacity to form constitutive aerenchyma and flooding tolerance in the ILs, indicating the presence of other factors related to flooding tolerance under reducing soil conditions. Conclusions A flooding-tolerant genotype, IL#18, was identified; this genotype should be useful for maize breeding. In addition, because the chromosome segments of Z. nicaraguensis in the ILs cover nearly the entire genome and Z. nicaraguensis possesses several unique traits related to flooding tolerance, the ILs should be valuable material for additional QTL detection and the development of flooding-tolerant maize lines. PMID:23877074
Mano, Y; Omori, F
2013-10-01
Nicaraguan teosinte (Zea nicaraguensis), a species found in frequently flooded areas, provides useful germplasm for breeding flooding-tolerant maize (Z. mays subsp. mays). The objective of this study was to select flooding-tolerant lines using a library of introgression lines (ILs), each containing a chromosome segment from Z. nicaraguensis in the maize inbred line Mi29. To produce the ILs, a single F1 plant derived from a cross between maize Mi29 and Z. nicaraguensis was backcrossed to Mi29 three times, self-pollinated four times and genotyped using simple sequence repeat markers. Flooding tolerance was evaluated at the seedling stage under reducing soil conditions. By backcrossing and selfing, a series of 45 ILs were developed covering nearly the entire maize genome. Five flooding-tolerant lines were identified from among the ILs by evaluating leaf injury. Among these, line IL#18, containing a Z. nicaraguensis chromosome segment on the long arm of chromosome 4, showed the greatest tolerance to flooding, suggesting the presence of a major quantitative trait locus (QTL) in that region. The presence of the QTL was verified by examining flooding tolerance in a population segregating for the candidate region of chromosome 4. There was no significant relationship between the capacity to form constitutive aerenchyma and flooding tolerance in the ILs, indicating the presence of other factors related to flooding tolerance under reducing soil conditions. A flooding-tolerant genotype, IL#18, was identified; this genotype should be useful for maize breeding. In addition, because the chromosome segments of Z. nicaraguensis in the ILs cover nearly the entire genome and Z. nicaraguensis possesses several unique traits related to flooding tolerance, the ILs should be valuable material for additional QTL detection and the development of flooding-tolerant maize lines.
Chromosomal changes in maize induced by hydrogen fluoride gas
Energy Technology Data Exchange (ETDEWEB)
Mohamed, A H
1970-01-01
Maize seedlings were fumigated in growth chambers with hydrogen fluoride at a concentration of about 3 ..mu..g/m/sup 3/. The experiment was run for 10 days, with the first group of treated plants removed from the chambers after 4 days and then at intervals of 2 days. Microsporocyte smears from the treated plants revealed chromosomal aberrations that included asynaptic regions, translocations, inversions, and bridges plus fragments or fragments by themselves. It is believed that these abnormalities were due to the physiological effect of HF causing the chromosomes to become sticky and/or to the occurrence of chromatid breakage followed by reunion to sticky and/or to the occurrence of chromatid breakage followed by reunion to form structural changes. These findings indicate that HF is a mutagenic agent.
Directory of Open Access Journals (Sweden)
María Florencia Realini
Full Text Available In Argentina there are two different centers of maize diversity, the Northeastern (NEA and the Northwestern (NWA regions of the country. In NEA, morphological studies identified 15 landraces cultivated by the Guaraní communities in Misiones Province. In the present study we analyzed the karyotype diversity of 20 populations of Guaraní maize landraces through classical and molecular cytogenetic analyses. Our results demonstrate significant intra and inter-populational variation in the percentage, number, size, chromosome position and frequencies of the heterochromatic blocks, which are called knobs. Knob sequence analysis (180-bp and TR-1 did not show significant differences among Guaraní populations. B chromosomes were not detected, and abnormal 10 (AB10 chromosomes were found with low frequency (0.1≥f ≤0.40 in six populations. Our results allowed karyotypic characterization of each analyzed population, defining for the first time the chromosomal constitution of maize germplasm from NEA. The multivariate analysis (PCoA and UPGMA of karyotype parameters allowed the distinction between two populations groups: the Popcorn and the Floury maize populations. These results are in agreement with previously published microsatellite and morphological/phenological studies. Finally, we compared our karyotype results with those previously reported for NWA and Central Region of South America maize. Our data suggest that there are important differences between maize from NEA and NWA at the karyotype level, supporting the hypothesis that there are two pathways of input of South America maize. Our results also confirm the existence of two centers of diversification of Argentinian native maize, NWA and NEA. This work contributes new knowledge about maize diversity, which is relevant for future plans to improve commercial maize, and for conservation of agrobiodiversity.
Lawrence, Carolyn J; Seigfried, Trent E; Bass, Hank W; Anderson, Lorinda K
2006-03-01
The Morgan2McClintock Translator permits prediction of meiotic pachytene chromosome map positions from recombination-based linkage data using recombination nodule frequency distributions. Its outputs permit estimation of DNA content between mapped loci and help to create an integrated overview of the maize nuclear genome structure.
Verification and characterization of chromosome duplication in haploid maize.
de Oliveira Couto, E G; Resende Von Pinho, E V; Von Pinho, R G; Veiga, A D; de Carvalho, M R; de Oliveira Bustamante, F; Nascimento, M S
2015-06-26
Doubled haploid technology has been used by various private companies. However, information regarding chromosome duplication methodologies, particularly those concerning techniques used to identify duplication in cells, is limited. Thus, we analyzed and characterized artificially doubled haploids using microsatellites molecular markers, pollen viability, and flow cytometry techniques. Evaluated material was obtained using two different chromosome duplication protocols in maize seeds considered haploids, resulting from the cross between the haploid inducer line KEMS and 4 hybrids (GNS 3225, GNS 3032, GNS 3264, and DKB 393). Fourteen days after duplication, plant samples were collected and assessed by flow cytometry. Further, the plants were transplanted to a field, and samples were collected for DNA analyses using microsatellite markers. The tassels were collected during anthesis for pollen viability analyses. Haploid, diploid, and mixoploid individuals were detected using flow cytometry, demonstrating that this technique was efficient for identifying doubled haploids. The microsatellites markers were also efficient for confirming the ploidies preselected by flow cytometry and for identifying homozygous individuals. Pollen viability showed a significant difference between the evaluated ploidies when the Alexander and propionic-carmin stains were used. The viability rates between the plodies analyzed show potential for fertilization.
Meiotic transmission of an in vitro-assembled autonomous maize minichromosome.
Directory of Open Access Journals (Sweden)
Shawn R Carlson
2007-10-01
Full Text Available Autonomous chromosomes are generated in yeast (yeast artificial chromosomes and human fibrosarcoma cells (human artificial chromosomes by introducing purified DNA fragments that nucleate a kinetochore, replicate, and segregate to daughter cells. These autonomous minichromosomes are convenient for manipulating and delivering DNA segments containing multiple genes. In contrast, commercial production of transgenic crops relies on methods that integrate one or a few genes into host chromosomes; extensive screening to identify insertions with the desired expression level, copy number, structure, and genomic location; and long breeding programs to produce varieties that carry multiple transgenes. As a step toward improving transgenic crop production, we report the development of autonomous maize minichromosomes (MMCs. We constructed circular MMCs by combining DsRed and nptII marker genes with 7-190 kb of genomic maize DNA fragments containing satellites, retroelements, and/or other repeats commonly found in centromeres and using particle bombardment to deliver these constructs into embryogenic maize tissue. We selected transformed cells, regenerated plants, and propagated their progeny for multiple generations in the absence of selection. Fluorescent in situ hybridization and segregation analysis demonstrated that autonomous MMCs can be mitotically and meiotically maintained. The MMC described here showed meiotic segregation ratios approaching Mendelian inheritance: 93% transmission as a disome (100% expected, 39% transmission as a monosome crossed to wild type (50% expected, and 59% transmission in self crosses (75% expected. The fluorescent DsRed reporter gene on the MMC was expressed through four generations, and Southern blot analysis indicated the encoded genes were intact. This novel approach for plant transformation can facilitate crop biotechnology by (i combining several trait genes on a single DNA fragment, (ii arranging genes in a defined
Reassignment of Drosophila willistoni Genome Scaffolds to Chromosome II Arms.
Garcia, Carolina; Delprat, Alejandra; Ruiz, Alfredo; Valente, Vera L S
2015-10-04
Drosophila willistoni is a geographically widespread Neotropical species. The genome of strain Gd-H4-1 from Guadeloupe Island (Caribbean) was sequenced in 2007 as part of the 12 Drosophila Genomes Project. The assembled scaffolds were joined based on conserved linkage and assigned to polytene chromosomes based on a handful of genetic and physical markers. This paucity of markers was particularly striking in the metacentric chromosome II, comprised two similarly sized arms, IIL and IIR, traditionally considered homologous to Muller elements C and B, respectively. In this paper we present the cytological mapping of 22 new gene markers to increase the number of markers mapped by in situ hybridization and to test the assignment of scaffolds to the polytene chromosome II arms. For this purpose, we generated, by polymerase chain reaction amplification, one or two gene probes from each scaffold assigned to the chromosome II arms and mapped these probes to the Gd-H4-1 strain's polytene chromosomes by nonfluorescent in situ hybridization. Our findings show that chromosome arms IIL and IIR correspond to Muller elements B and C, respectively, directly contrasting the current homology assignments in D. willistoni and constituting a major reassignment of the scaffolds to chromosome II arms. Copyright © 2015 Garcia et al.
Stable transformation of Hi-II maize using the particle inflow gun
CSIR Research Space (South Africa)
O'Kennedy, MM
1998-04-01
Full Text Available Focuses on the transformation of the embryogenic type II callus, initiated from cultured immature zygotic embryos of the maize line Hi-II, by microprojectile bombardment using a particle inflow gun. Use of the plasmid pAHC25; Tissue culture...
Mixing of maize and wheat genomic DNA by somatic hybridization in regenerated sterile maize plants.
Szarka, B.; Göntér, I.; Molnár-Láng, M.; Mórocz, S.; Dudits, D.
2002-07-01
Intergeneric somatic hybridization was performed between albino maize ( Zea mays L.) protoplasts and mesophyll protoplasts of wheat ( Triticum aestivum L.) by polyethylene glycol (PEG) treatments. None of the parental protoplasts were able to produce green plants without fusion. The maize cells regenerated only rudimentary albino plantlets of limited viability, and the wheat mesophyll protoplasts were unable to divide. PEG-mediated fusion treatments resulted in hybrid cells with mixed cytoplasm. Six months after fusion green embryogenic calli were selected as putative hybrids. The first-regenerates were discovered as aborted embryos. Regeneration of intact, green, maize-like plants needed 6 months of further subcultures on hormone-free medium. These plants were sterile, although had both male and female flowers. The cytological analysis of cells from callus tissues and root tips revealed 56 chromosomes, but intact wheat chromosomes were not observed. Using total DNA from hybrid plants, three RAPD primer combinations produced bands resembling the wheat profile. Genomic in situ hybridization (GISH) using total wheat DNA as a probe revealed the presence of wheat DNA islands in the maize chromosomal background. The increased viability and the restored green color were the most-significant new traits as compared to the original maize parent. Other intermediate morphological traits of plants with hybrid origin were not found.
Deep functional analysis of synII, a 770 kb synthetic yeast chromosome
Shen, Yue; Wang, Yun; Chen, Tai; Gao, Feng; Gong, Jianhui; Abramczyk, Dariusz; Walker, Roy; Zhao, Hongcui; Chen, Shihong; Liu, Wei; Luo, Yisha; Müller, Carolin A.; Paul-Dubois-Taine, Adrien; Alver, Bonnie; Stracquadanio, Giovanni
2017-01-01
Herein we report the successful design, construction and characterization of a 770 kb synthetic yeast chromosome II (synII). Our study incorporates characterization at multiple levels, including phenomics, transcriptomics, proteomics, chromosome segregation and replication analysis to provide a thorough and comprehensive analysis of a synthetic chromosome. Our “Trans-Omics” analyses reveal a modest but potentially significant pervasive up-regulation of translational machinery observed in synI...
Deep functional analysis of synII, a 770-kilobase synthetic yeast chromosome.
Shen, Yue; Wang, Yun; Chen, Tai; Gao, Feng; Gong, Jianhui; Abramczyk, Dariusz; Walker, Roy; Zhao, Hongcui; Chen, Shihong; Liu, Wei; Luo, Yisha; Müller, Carolin A; Paul-Dubois-Taine, Adrien; Alver, Bonnie; Stracquadanio, Giovanni; Mitchell, Leslie A; Luo, Zhouqing; Fan, Yanqun; Zhou, Baojin; Wen, Bo; Tan, Fengji; Wang, Yujia; Zi, Jin; Xie, Zexiong; Li, Bingzhi; Yang, Kun; Richardson, Sarah M; Jiang, Hui; French, Christopher E; Nieduszynski, Conrad A; Koszul, Romain; Marston, Adele L; Yuan, Yingjin; Wang, Jian; Bader, Joel S; Dai, Junbiao; Boeke, Jef D; Xu, Xun; Cai, Yizhi; Yang, Huanming
2017-03-10
Here, we report the successful design, construction, and characterization of a 770-kilobase synthetic yeast chromosome II (synII). Our study incorporates characterization at multiple levels-including phenomics, transcriptomics, proteomics, chromosome segregation, and replication analysis-to provide a thorough and comprehensive analysis of a synthetic chromosome. Our Trans-Omics analyses reveal a modest but potentially relevant pervasive up-regulation of translational machinery observed in synII, mainly caused by the deletion of 13 transfer RNAs. By both complementation assays and SCRaMbLE (synthetic chromosome rearrangement and modification by loxP -mediated evolution), we targeted and debugged the origin of a growth defect at 37°C in glycerol medium, which is related to misregulation of the high-osmolarity glycerol response. Despite the subtle differences, the synII strain shows highly consistent biological processes comparable to the native strain. Copyright © 2017, American Association for the Advancement of Science.
Genetic diversity of Pakistani maize genotypes using chromosome ...
African Journals Online (AJOL)
For improvement of maize crop presence of genetic diversity in the germplasm is very important. This study was conducted to determine genetic diversity among 17 Pakistani maize genotypes using 10 simple sequence repeat (SSR) primer sets. All the amplification products were in the range of <250-750 bp. To estimate the ...
Deep functional analysis of synII, a 770 kb synthetic yeast chromosome
Gao, Feng; Gong, Jianhui; Abramczyk, Dariusz; Walker, Roy; Zhao, Hongcui; Chen, Shihong; Liu, Wei; Luo, Yisha; Müller, Carolin A.; Paul-Dubois-Taine, Adrien; Alver, Bonnie; Stracquadanio, Giovanni; Mitchell, Leslie A.; Luo, Zhouqing; Fan, Yanqun; Zhou, Baojin; Wen, Bo; Tan, Fengji; Wang, Yujia; Zi, Jin; Xie, Zexiong; Li, Bingzhi; Yang, Kun; Richardson, Sarah M.; Jiang, Hui; French, Christopher E.; Nieduszynski, Conrad A.; Koszul, Romain; Marston, Adele L.; Yuan, Yingjin; Wang, Jian; Bader, Joel S.; Dai, Junbiao; Boeke, Jef D.; Xu, Xun; Cai, Yizhi; Yang, Huanming
2017-01-01
Herein we report the successful design, construction and characterization of a 770 kb synthetic yeast chromosome II (synII). Our study incorporates characterization at multiple levels, including phenomics, transcriptomics, proteomics, chromosome segregation and replication analysis to provide a thorough and comprehensive analysis of a synthetic chromosome. Our “Trans-Omics” analyses reveal a modest but potentially significant pervasive up-regulation of translational machinery observed in synII is mainly caused by the deletion of 13 tRNAs. By both complementation assays and SCRaMbLE, we targeted and debuged the origin of a growth defect at 37°C in glycerol medium, which is related to misregulation of the HOG response. Despite the subtle differences, the synII strain shows highly consistent biological processes comparable to the native strain. PMID:28280153
Howe, Elizabeth S; Clemente, Thomas E; Bass, Hank W
2012-06-01
Cytological studies of fluorescent proteins are rapidly yielding insights into chromatin structure and dynamics. Here we describe the production and cytological characterization of new transgenic maize lines expressing a fluorescent histone fusion protein, H2B-mCherry. The transgene is expressed under the control of the maize ubiquitin1 promoter, including its first exon and intron. Polymerase chain reaction-based genotyping and root-tip microscopy showed that most of the lines carrying the transgene also expressed it, producing bright uniform staining of nuclei. Further, plants showing expression in root tips at the seedling stage also showed expression during meiosis, late in the life cycle. Detailed high-resolution three-dimensional imaging of cells and nuclei from various somatic and meiotic cell types showed that H2B-mCherry produced remarkably clear images of chromatin and chromosome fiber morphology, as seen in somatic, male meiotic prophase, and early microgametophyte cells. H2B-mCherry also yielded distinct nucleolus staining and was shown to be compatible with fluorescence in situ hybridization. We found several instances where H2B-mCherry was superior to DAPI as a generalized chromatin stain. Our study establishes these histone H2B-mCherry lines as new biological reagents for visualizing chromatin structure, chromosome morphology, and nuclear dynamics in fixed and living cells in a model plant genetic system.
Updating the maize karyotype by chromosome DNA sizing
2018-01-01
The karyotype is a basic concept regarding the genome, fundamentally described by the number and morphological features of all chromosomes. Chromosome class, centromeric index, intra- and interchromosomal asymmetry index, and constriction localization are important in clinical, systematic and evolutionary approaches. In spite of the advances in karyotype characterization made over the last years, new data about the chromosomes can be generated from quantitative methods, such as image cytometry. Therefore, using Zea mays L., this study aimed to update the species’ karyotype by supplementing information on chromosome DNA sizing. After adjustment of the procedures, chromosome morphometry and class as well as knob localization enabled describing the Z. mays karyotype. In addition, applying image cytometry, DNA sizing was unprecedentedly measured for the arms and satellite of all chromosomes. This way, unambiguous identification of the chromosome pairs, and hence the assembly of 51 karyograms, were only possible after the DNA sizing of each chromosome, their arms and satellite portions. These accurate, quantitative and reproducible data also enabled determining the distribution and variation of DNA content in each chromosome. From this, a correlation between DNA amount and total chromosome length evidenced that the mean DNA content of chromosome 9 was higher than that of chromosome 8. The chromosomal DNA sizing updated the Z. mays karyotype, providing insights into its dynamic genome with regards to the organization of the ten chromosomes and their respective portions. Considering the results and the relevance of cytogenetics in the current scenario of comparative sequencing and genomics, chromosomal DNA sizing should be incorporated as an additional parameter for karyotype definition. Based on this study, it can be affirmed that cytogenetic approaches go beyond the simple morphological description of chromosomes. PMID:29293613
Directory of Open Access Journals (Sweden)
Edy Listanto
2017-05-01
Full Text Available Maize (Zea mays L. productivity in Indonesia is challenged to be increased using genetic engineering. Recent advances in Agrobacterium tumefaciens-mediated in-planta transforma-tion makes it possible to transform maize with low cost, and simple method. This study aimed to confirm pIG121Hm-Cs plasmid in A. tumefaciens, and to estimate the efficiency level of A. tumefaciens-mediated in-planta transformation of Indonesian maize by using pIG121Hm-Cs plasmid containing nptII and hpt genes. A series of studies were conducted including confirmation of gene construct of pIG121Hm-Cs plasmid in A. tumefaciens, transformation of four maize lines through A. tumefaciens-mediated in-planta technique, acclimatization of transformant plants and molecular analysis of selected plants using polymerase chain reaction (PCR. The pIG121Hm-Cs plasmid was confirmed via PCR analysis using specific primers of nptII and hpt genes and resulted 700 bp and 500 bp for fragments of nptII and hpt, respectively. After selection, acclimatization and molecular analysis steps, the efficiency levels of transformation of four maize lines were low, ranging from 3.8% to 12.8%. The level of transformation efficiency of ST-27 line was the highest accounting for 12.8% of 45 planted embryos on selection medium based on PCR analysis using specific primer for nptII gene. Overall, A. tumefaciens-mediated in planta transformation on maize floral pistil in this study proved to be successful and rapid. Therefore, this enhanced transformation method will be beneficial for Indonesian maize genetic engineering.
Regulatory cross-talk links Vibrio cholerae chromosome II replication and segregation.
Directory of Open Access Journals (Sweden)
Yoshiharu Yamaichi
2011-07-01
Full Text Available There is little knowledge of factors and mechanisms for coordinating bacterial chromosome replication and segregation. Previous studies have revealed that genes (and their products that surround the origin of replication (oriCII of Vibrio cholerae chromosome II (chrII are critical for controlling the replication and segregation of this chromosome. rctB, which flanks one side of oriCII, encodes a protein that initiates chrII replication; rctA, which flanks the other side of oriCII, inhibits rctB activity. The chrII parAB2 operon, which is essential for chrII partitioning, is located immediately downstream of rctA. Here, we explored how rctA exerts negative control over chrII replication. Our observations suggest that RctB has at least two DNA binding domains--one for binding to oriCII and initiating replication and the other for binding to rctA and thereby inhibiting RctB's ability to initiate replication. Notably, the inhibitory effect of rctA could be alleviated by binding of ParB2 to a centromere-like parS site within rctA. Furthermore, by binding to rctA, ParB2 and RctB inversely regulate expression of the parAB2 genes. Together, our findings suggest that fluctuations in binding of the partitioning protein ParB2 and the chrII initiator RctB to rctA underlie a regulatory network controlling both oriCII firing and the production of the essential chrII partitioning proteins. Thus, by binding both RctB and ParB2, rctA serves as a nexus for regulatory cross-talk coordinating chrII replication and segregation.
Directory of Open Access Journals (Sweden)
Julie Meyer
2011-11-01
Full Text Available Cytoplasmic male sterility (CMS is a maternally inherited inability to produce functional pollen. In Texas (T-cytoplasm maize ( L., CMS results from the action of the URF13 mitochondrial pore-forming protein encoded by the unique T- mitochondrial gene. Full or partial restoration of fertility to T-cytoplasm maize is mediated by the nuclear gene in combination with one of three other genes: , , or *. encodes a mitochondrial aldehyde dehydrogenase whereas , , and * are associated with the accumulation of distinctive T- mitochondrial transcripts. -associated RNA processing activity was mapped to a 4.55-Mbp region on chromosome 2L that contains 10 pentatricopeptide repeat (PPR encoding genes in the B73 5b.60 genome assembly. Genetic linkage analysis also indicated that * is positioned within this PPR cluster as well as , which restores USDA (S-cytoplasm maize. Partially male-fertile plants segregated for the presence or absence of the -associated T- 1.42- and 0.42-kbp transcripts, indicating that the RNA processing event associated with these transcripts is not necessary for anther exsertion. In addition, a statistically significant delay in flowering was observed between partially male-fertile and mostly male-fertile plants. Taken together, these new results indicate that -mediated male fertility is under the control of more than one nuclear locus.
Reassignment of Drosophila willistoni Genome Scaffolds to Chromosome II Arms
Garcia, Carolina; Delprat, Alejandra; Ruiz, Alfredo; Valente, Vera L. S.
2015-01-01
Drosophila willistoni is a geographically widespread Neotropical species. The genome of strain Gd-H4-1 from Guadeloupe Island (Caribbean) was sequenced in 2007 as part of the 12 Drosophila Genomes Project. The assembled scaffolds were joined based on conserved linkage and assigned to polytene chromosomes based on a handful of genetic and physical markers. This paucity of markers was particularly striking in the metacentric chromosome II, comprised two similarly sized arms, IIL and IIR, tradit...
Comparative QTL mapping of resistance to sugarcane mosaic virus in maize based on bioinformatics
Institute of Scientific and Technical Information of China (English)
Xiangling L(U); Xinhai LI; Chuanxiao XIE; Zhuanfang HAO; Hailian JI; Liyu SHI; Shihuang ZHANG
2008-01-01
The development of genomics and bioinfor-matics offers new tools for comparative gene mapping. In this paper, an integrated QTL map for sugarcane mosaic virus (SCMV) resistance in maize was constructed by compiling a total of 81 QTL loci available, using the Genetic Map IBM2 2005 Neighbors as reference. These 81 QTL loci were scattered on 7 chromosomes of maize, and most of them were clustered on chromosomes 3 and 6. By using the method of meta-analysis, we identified one "consensus QTL" on chromosome 3 covering a genetic distance of 6.44 cM, and two on chromosome 6 covering genetic distances of 16 cM and 27.48 cM, respectively. Four positional candidate resistant genes were identified within the "consensus QTL" on chromosome 3 via the strategy of comparative genomics. These results suggest that application of a combination of meta-analysis within a species with sequence homology comparison in a related model plant is an efficient approach to identify the major QTL and its candidate gene(s) for the target traits. The results of this study provide useful information for iden-tifying and cloning the major gene(s) conferring resistance to SCMV in maize.
Wang, Yijun; Deng, Dexiang; Shi, Yating; Miao, Nan; Bian, Yunlong; Yin, Zhitong
2012-03-01
Auxin response factors (ARFs), member of the plant-specific B3 DNA binding superfamily, target specifically to auxin response elements (AuxREs) in promoters of primary auxin-responsive genes and heterodimerize with Aux/IAA proteins in auxin signaling transduction cascade. In previous research, we have isolated and characterized maize Aux/IAA genes in whole-genome scale. Here, we report the comprehensive analysis of ARF genes in maize. A total of 36 ARF genes were identified and validated from the B73 maize genome through an iterative strategy. Thirty-six maize ARF genes are distributed in all maize chromosomes except chromosome 7. Maize ARF genes expansion is mainly due to recent segmental duplications. Maize ARF proteins share one B3 DNA binding domain which consists of seven-stranded β sheets and two short α helixes. Twelve maize ARFs with glutamine-rich middle regions could be as activators in modulating expression of auxin-responsive genes. Eleven maize ARF proteins are lack of homo- and heterodimerization domains. Putative cis-elements involved in phytohormones and light signaling responses, biotic and abiotic stress adaption locate in promoters of maize ARF genes. Expression patterns vary greatly between clades and sister pairs of maize ARF genes. The B3 DNA binding and auxin response factor domains of maize ARF proteins are primarily subjected to negative selection during selective sweep. The mixed selective forces drive the diversification and evolution of genomic regions outside of B3 and ARF domains. Additionally, the dicot-specific proliferation of ARF genes was detected. Comparative genomics analysis indicated that maize, sorghum and rice duplicate chromosomal blocks containing ARF homologs are highly syntenic. This study provides insights into the distribution, phylogeny and evolution of ARF gene family.
International Nuclear Information System (INIS)
Tease, Charles; Fisher, Graham
1996-01-01
The incidences of X-ray induced numerical and structural chromosome anomalies were screened in a range of developmental stages from metaphase II oocytes through to post-implantation embryos. Following 1 Gy of acute X-rays to immediately preovulatory stage oocytes, the rate of hyperploidy (chromosome gain) was found to be elevated over levels in unirradiated controls, at metaphase II, in 1-cell and 3.5 day pre-implantation embryos but not in 8.5 day post-implantation foetuses. In the latter, however, the frequency of mosaicism was significantly increased. A similar response of an increase in mosaicism but not in hyperploidy in 8.5 day post-implantation embryos was also found after irradiation of dictyate stage oocytes with 4 Gy of acute X-rays. Significantly elevated frequencies of structural chromosome anomalies were present in metaphase II oocytes and pre-implantation embryonic stages, but could not be detected in block-stained chromosome preparations from 8.5 day post-implantation foetuses. However, analysis of chromosome preparations after G-banding showed that almost 14% of 14.5 day foetuses carried a chromosome rearrangement after 1 Gy of X-rays to immediately preovulatory stage oocytes. Overall, our data indicate that the presence of radiation-induced chromosome gains are incompatible with embryonic survival but that a proportion of embryos with structural chromosome damage develop past mid-gestation. These latter embryos are therefore potentially capable of contributing to the genetic burden of the next generation
DEFF Research Database (Denmark)
Morrison, Ciaran; Henzing, Alexander J; Jensen, Ole Nørregaard
2002-01-01
B in the presence of radioactive ATP. Immunoblot analysis confirmed the HeLa scaffold fraction to be enriched for known chromosomal proteins including CENP-A, CENP-B, CENP-C, ScII and INCENP. Mass spectrometry of bands excised from one-dimensional polyacrylamide gels further defined the protein......The essential Aurora B kinase is a chromosomal passenger protein that is required for mitotic chromosome alignment and segregation. Aurora B function is dependent on the chromosome passenger, INCENP. INCENP, in turn, requires sister chromatid cohesion for its appropriate behaviour. Relatively few...... composition of the extracted chromosome fraction. Cloning, fluorescent tagging and expression in HeLa cells of the putative GTP-binding protein NGB/CRFG demonstrated it to be a novel mitotic chromosome protein, with a perichromosomal localisation. Identi fication of the protein bands corresponding to those...
Genomic features shaping the landscape of meiotic double-strand-break hotspots in maize.
He, Yan; Wang, Minghui; Dukowic-Schulze, Stefanie; Zhou, Adele; Tiang, Choon-Lin; Shilo, Shay; Sidhu, Gaganpreet K; Eichten, Steven; Bradbury, Peter; Springer, Nathan M; Buckler, Edward S; Levy, Avraham A; Sun, Qi; Pillardy, Jaroslaw; Kianian, Penny M A; Kianian, Shahryar F; Chen, Changbin; Pawlowski, Wojciech P
2017-11-14
Meiotic recombination is the most important source of genetic variation in higher eukaryotes. It is initiated by formation of double-strand breaks (DSBs) in chromosomal DNA in early meiotic prophase. The DSBs are subsequently repaired, resulting in crossovers (COs) and noncrossovers (NCOs). Recombination events are not distributed evenly along chromosomes but cluster at recombination hotspots. How specific sites become hotspots is poorly understood. Studies in yeast and mammals linked initiation of meiotic recombination to active chromatin features present upstream from genes, such as absence of nucleosomes and presence of trimethylation of lysine 4 in histone H3 (H3K4me3). Core recombination components are conserved among eukaryotes, but it is unclear whether this conservation results in universal characteristics of recombination landscapes shared by a wide range of species. To address this question, we mapped meiotic DSBs in maize, a higher eukaryote with a large genome that is rich in repetitive DNA. We found DSBs in maize to be frequent in all chromosome regions, including sites lacking COs, such as centromeres and pericentromeric regions. Furthermore, most DSBs are formed in repetitive DNA, predominantly Gypsy retrotransposons, and only one-quarter of DSB hotspots are near genes. Genic and nongenic hotspots differ in several characteristics, and only genic DSBs contribute to crossover formation. Maize hotspots overlap regions of low nucleosome occupancy but show only limited association with H3K4me3 sites. Overall, maize DSB hotspots exhibit distribution patterns and characteristics not reported previously in other species. Understanding recombination patterns in maize will shed light on mechanisms affecting dynamics of the plant genome.
Dynamic epigenetic states of maize centromeres
Directory of Open Access Journals (Sweden)
Yalin eLiu
2015-10-01
Full Text Available The centromere is a specialized chromosomal region identified as the major constriction, upon which the kinetochore complex is formed, ensuring accurate chromosome orientation and segregation during cell division. The rapid evolution of centromere DNA sequence and the conserved centromere function are two contradictory aspects of centromere biology. Indeed, the sole presence of genetic sequence is not sufficient for centromere formation. Various dicentric chromosomes with one inactive centromere have been recognized. It has also been found that de novo centromere formation is common on fragments in which centromeric DNA sequences are lost. Epigenetic factors play important roles in centromeric chromatin assembly and maintenance. Nondisjunction of the supernumerary B chromosome early prophase of meiosis I requires an active centromere. This review discusses recent studies in maize about genetic and epigenetic elements regulating formation and maintenance of centromere chromatin, as well as centromere behavior in meiosis.
Gómez-Herreros, Fernando; Zagnoli-Vieira, Guido; Ntai, Ioanna; Martínez-Macías, María Isabel; Anderson, Rhona M; Herrero-Ruíz, Andrés; Caldecott, Keith W
2017-08-10
DNA double-strand breaks (DSBs) induced by abortive topoisomerase II (TOP2) activity are a potential source of genome instability and chromosome translocation. TOP2-induced DNA double-strand breaks are rejoined in part by tyrosyl-DNA phosphodiesterase 2 (TDP2)-dependent non-homologous end-joining (NHEJ), but whether this process suppresses or promotes TOP2-induced translocations is unclear. Here, we show that TDP2 rejoins DSBs induced during transcription-dependent TOP2 activity in breast cancer cells and at the translocation 'hotspot', MLL. Moreover, we find that TDP2 suppresses chromosome rearrangements induced by TOP2 and reduces TOP2-induced chromosome translocations that arise during gene transcription. Interestingly, however, we implicate TDP2-dependent NHEJ in the formation of a rare subclass of translocations associated previously with therapy-related leukemia and characterized by junction sequences with 4-bp of perfect homology. Collectively, these data highlight the threat posed by TOP2-induced DSBs during transcription and demonstrate the importance of TDP2-dependent non-homologous end-joining in protecting both gene transcription and genome stability.DNA double-strand breaks (DSBs) induced by topoisomerase II (TOP2) are rejoined by TDP2-dependent non-homologous end-joining (NHEJ) but whether this promotes or suppresses translocations is not clear. Here the authors show that TDP2 suppresses chromosome translocations from DSBs introduced during gene transcription.
Frame, Bronwyn; Warnberg, Katey; Main, Marcy; Wang, Kan
2015-01-01
Agrobacterium tumefaciens-mediated transformation is an effective method for introducing genes into maize. In this chapter, we describe a detailed protocol for genetic transformation of the maize genotype Hi II. Our starting plant material is immature embryos cocultivated with an Agrobacterium strain carrying a standard binary vector. In addition to step-by-step laboratory transformation procedures, we include extensive details in growing donor plants and caring for transgenic plants in the greenhouse.
Zheng, Hongyan; Wu, Huamao; Pan, Xiaoying; Jin, Weiwei; Li, Xuexian
2017-02-01
Pollen germination is an essential step towards successful pollination during maize reproduction. How low niutrogen (N) affects pollen germination remains an interesting biological question to be addressed. We found that only low N resulted in a significantly lower germination rate of pollen grains after 4 weeks of low N, phosphorus or potassium treatment in maize production. Importantly, cytological analysis showed 7-fold more micronuclei in male meiocytes under the low N treatment than in the control, indicating that the lower germination rate of pollen grains was partially due to numerous chromosome loss events resulting from preceding meiosis. The appearance of 10 bivalents in the control and low N cells at diakinesis suggested that chromosome pairing and recombination in meiosis I was not affected by low N. Further gene expression analysis revealed dramatic down-regulation of Nuclear Division Cycle 80 (Ndc80) and Regulator of Chromosome Condensation 1 (Rcc1-1) expression and up-regulation of Cell Division Cycle 20 (Cdc20-1) expression, although no significant difference in the expression level of kinetochore foundation proteins Centromeric Histone H3 (Cenh3) and Centromere Protein C (Cenpc) and cohesion regulators Recombination 8 (Rec8) and Shugoshin (Sgo1) was observed. Aberrant modulation of three key meiotic regulators presumably resulted in a high likelihood of erroneous chromosome segregation, as testified by pronounced lagging chromosomes at anaphase I or cell cycle disruption at meiosis II. Thus, we proposed a cytogenetic mechanism whereby low N affects male meiosis and causes a higher chromosome loss frequency and eventually a lower germination rate of pollen grains in a staple crop plant. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Induced mutations in apomictic variety of maize-tripsacum hybrid
International Nuclear Information System (INIS)
Yudin, B.F.; Lukina, L.A.
1983-01-01
Three generations of six mutants obtained by γ- and x-irradiation of seeds of highly apomictic variety of 38 chromosome maize-tripsacum hybrid have been studied. Radiomutants detected in M 2 preserved the mother type and constance in M 3 and M 4 . One of the mutants, as an exception, manifested somatic splitting, which resulted in the appearance of a new apomictic clone. Irradiation and mutation in some cases were accompanied by the appearance of seedlings with high chromosome numbers in mutant posterity, including apomicts with doubled number of chromosomes, as well as the increase of total part of sexual reproduction; the latter circumstance is considered as a result of modificator balance change caused by treatments. Doubling of chromosome number in 38-chromosome apomicts, according to preliminary data, does not affect significantly the way of reproduction; 76-chromosome forms preserve a high degree of a regular apomixis
The physical and genetic framework of the maize B73 genome.
Directory of Open Access Journals (Sweden)
Fusheng Wei
2009-11-01
Full Text Available Maize is a major cereal crop and an important model system for basic biological research. Knowledge gained from maize research can also be used to genetically improve its grass relatives such as sorghum, wheat, and rice. The primary objective of the Maize Genome Sequencing Consortium (MGSC was to generate a reference genome sequence that was integrated with both the physical and genetic maps. Using a previously published integrated genetic and physical map, combined with in-coming maize genomic sequence, new sequence-based genetic markers, and an optical map, we dynamically picked a minimum tiling path (MTP of 16,910 bacterial artificial chromosome (BAC and fosmid clones that were used by the MGSC to sequence the maize genome. The final MTP resulted in a significantly improved physical map that reduced the number of contigs from 721 to 435, incorporated a total of 8,315 mapped markers, and ordered and oriented the majority of FPC contigs. The new integrated physical and genetic map covered 2,120 Mb (93% of the 2,300-Mb genome, of which 405 contigs were anchored to the genetic map, totaling 2,103.4 Mb (99.2% of the 2,120 Mb physical map. More importantly, 336 contigs, comprising 94.0% of the physical map ( approximately 1,993 Mb, were ordered and oriented. Finally we used all available physical, sequence, genetic, and optical data to generate a golden path (AGP of chromosome-based pseudomolecules, herein referred to as the B73 Reference Genome Sequence version 1 (B73 RefGen_v1.
Application and potentiality of laser micro-irradiation of chromosomes in animal and plant cells
Energy Technology Data Exchange (ETDEWEB)
Lu, H Liang; Wang, L L [Laboratory of Laser and Genetics, Institute of Genetics, Academia Sinica, Beijing (China)
1990-01-01
Full text: The classical methods of inducing genetic variation use chemical or physical mutagens applied to populations of cells. Since the development of laser techniques allows focussing a beam to a submicron spot, laser microsurgery of chromosomes was attempted. In mammalian cells, the nucleolus formation could be prevented. Also several chromosome damages were produced by focussing on specific chromosomes in prophase, metaphase and anaphase. Chromosomes of broad bean, maize, wheat, barley were dissected into small fragments. (author)
Structure and Chromosomal Organization of Yeast Genes Regulated by Topoisomerase II.
Joshi, Ricky S; Nikolaou, Christoforos; Roca, Joaquim
2018-01-03
Cellular DNA topoisomerases (topo I and topo II) are highly conserved enzymes that regulate the topology of DNA during normal genome transactions, such as DNA transcription and replication. In budding yeast, topo I is dispensable whereas topo II is essential, suggesting fundamental and exclusive roles for topo II, which might include the functions of the topo IIa and topo IIb isoforms found in mammalian cells. In this review, we discuss major findings of the structure and chromosomal organization of genes regulated by topo II in budding yeast. Experimental data was derived from short (10 min) and long term (120 min) responses to topo II inactivation in top-2 ts mutants. First, we discuss how short term responses reveal a subset of yeast genes that are regulated by topo II depending on their promoter architecture. These short term responses also uncovered topo II regulation of transcription across multi-gene clusters, plausibly by common DNA topology management. Finally, we examine the effects of deactivated topo II on the elongation of RNA transcripts. Each study provides an insight into the particular chromatin structure that interacts with the activity of topo II. These findings are of notable clinical interest as numerous anti-cancer therapies interfere with topo II activity.
Localization of Usher syndrome type II to chromosome 1q.
Kimberling, W J; Weston, M D; Möller, C; Davenport, S L; Shugart, Y Y; Priluck, I A; Martini, A; Milani, M; Smith, R J
1990-06-01
Usher syndrome is characterized by congenital hearing loss, progressive visual impairment due to retinitis pigmentosa, and variable vestibular problems. The two subtypes of Usher syndrome, types I and II, can be distinguished by the degree of hearing loss and by the presence or absence of vestibular dysfunction. Type I is characterized by a profound hearing loss and totally absent vestibular responses, while type II has a milder hearing loss and normal vestibular function. Fifty-five members of eight type II Usher syndrome families were typed for three DNA markers in the distal region of chromosome 1q: D1S65 (pEKH7.4), REN (pHRnES1.9), and D1S81 (pTHH33). Statistically significant linkage was observed for Usher syndrome type II with a maximum multipoint lod score of 6.37 at the position of the marker THH33, thus localizing the Usher type II (USH2) gene to 1q. Nine families with type I Usher syndrome failed to show linkage to the same three markers. The statistical test for heterogeneity of linkage between Usher syndrome types I and II was highly significant, thus demonstrating that they are due to mutations at different genetic loci.
Identification of QTLs for Arsenic Accumulation in Maize (Zea mays L.) Using a RIL Population
Ding, Dong; Li, Weihua; Song, Guiliang; Qi, Hongyuan; Liu, Jingbao; Tang, Jihua
2011-01-01
The Arsenic (As) concentration in different tissues of maize was analyzed using a set of RIL populations derived from an elite hybrid, Nongda108. The results showed that the trend of As concentration in the four measured tissues was leaves>stems>bracts>kernels. Eleven QTLs for As concentration were detected in the four tissues. Three QTLs for As concentration in leaves were mapped on chromosomes 1, 5, and 8, respectively. For As concentration in the bracts, two QTLs were identified, with 9.61% and 10.03% phenotypic variance. For As concentration in the stems, three QTLs were detected with 8.24%, 14.86%, and 15.23% phenotypic variance. Three QTLs were identified for kernels on chromosomes 3, 5, and 7, respectively, with 10.73%, 8.52%, and 9.10% phenotypic variance. Only one common chromosomal region between SSR marker bnlg1811 and umc1243 was detected for QTLs qLAV1 and qSAC1. The results implied that the As accumulation in different tissues in maize was controlled by different molecular mechanism. The study demonstrated that maize could be a useful plant for phytoremediation of As-contaminated paddy soil, and the QTLs will be useful for selecting inbred lines and hybrids with low As concentration in their kernels. PMID:22028786
Identification of QTLs for arsenic accumulation in maize (Zea mays L. using a RIL population.
Directory of Open Access Journals (Sweden)
Dong Ding
Full Text Available The Arsenic (As concentration in different tissues of maize was analyzed using a set of RIL populations derived from an elite hybrid, Nongda108. The results showed that the trend of As concentration in the four measured tissues was leaves>stems>bracts>kernels. Eleven QTLs for As concentration were detected in the four tissues. Three QTLs for As concentration in leaves were mapped on chromosomes 1, 5, and 8, respectively. For As concentration in the bracts, two QTLs were identified, with 9.61% and 10.03% phenotypic variance. For As concentration in the stems, three QTLs were detected with 8.24%, 14.86%, and 15.23% phenotypic variance. Three QTLs were identified for kernels on chromosomes 3, 5, and 7, respectively, with 10.73%, 8.52%, and 9.10% phenotypic variance. Only one common chromosomal region between SSR marker bnlg1811 and umc1243 was detected for QTLs qLAV1 and qSAC1. The results implied that the As accumulation in different tissues in maize was controlled by different molecular mechanism. The study demonstrated that maize could be a useful plant for phytoremediation of As-contaminated paddy soil, and the QTLs will be useful for selecting inbred lines and hybrids with low As concentration in their kernels.
Chen, Wei; Zhu, Qilin; Wang, Haiyan; Xiao, Jin; Xing, Liping; Chen, Peidu; Jin, Weiwei; Wang, Xiu-E
2015-11-20
Uniparental chromosome elimination in wheat × maize hybrid embryos is widely used in double haploid production of wheat. Several explanations have been proposed for this phenomenon, one of which is that the lack of cross-species CENH3 incorporation may act as a barrier to interspecies hybridization. However, it is unknown if this mechanism applies universally. To study the role of CENH3 in maize chromosome elimination of wheat × maize hybrid embryos, maize ZmCENH3 and wheat αTaCENH3-B driven by the constitutive CaMV35S promoter were transformed into wheat variety Yangmai 158. Five transgenic lines for ZmCENH3 and six transgenic lines for αTaCENH3-B were identified. RT-PCR analysis showed that the transgene could be transcribed at a low level in all ZmCENH3 transgenic lines, whereas transcription of endogenous wheat CENH3 was significantly up-regulated. Interestingly, the expression levels of both wheat CENH3 and ZmCENH3 in the ZmCENH3 transgenic wheat × maize hybrid embryos were higher than those in the non-transformed Yangmai 158 × maize hybrid embryos. This indicates that the alien ZmCENH3 in wheat may induce competitive expression of endogenous wheat CENH3, leading to suppression of ZmCENH3 over-expression. Eliminations of maize chromosomes in hybrid embryos of ZmCENH3 transgenic wheat × maize and Yangmai 158 × maize were compared by observations on micronuclei presence, by marker analysis using maize SSRs (simple sequence repeats), and by FISH (fluorescence in situ hybridization) using 45S rDNA as a probe. The results indicate that maize chromosome elimination events in the two crosses are not significantly different. Fusion protein ZmCENH3-YFP could not be detected in ZmCENH3 transgenic wheat by either Western blotting or immnunostaining, whereas accumulation and loading of the αTaCENH3-B-GFP fusion protein was normal in αTaCENH3-B transgenic lines. As ZmCENH3-YFP did not accumulate after AM114 treatment, we speculate that low levels of Zm
Mapping of a major QTL for salt tolerance of mature field-grown maize plants based on SNP markers.
Luo, Meijie; Zhao, Yanxin; Zhang, Ruyang; Xing, Jinfeng; Duan, Minxiao; Li, Jingna; Wang, Naishun; Wang, Wenguang; Zhang, Shasha; Chen, Zhihui; Zhang, Huasheng; Shi, Zi; Song, Wei; Zhao, Jiuran
2017-08-15
Salt stress significantly restricts plant growth and production. Maize is an important food and economic crop but is also a salt sensitive crop. Identification of the genetic architecture controlling salt tolerance facilitates breeders to select salt tolerant lines. However, the critical quantitative trait loci (QTLs) responsible for the salt tolerance of field-grown maize plants are still unknown. To map the main genetic factors contributing to salt tolerance in mature maize, a double haploid population (240 individuals) and 1317 single nucleotide polymorphism (SNP) markers were employed to produce a genetic linkage map covering 1462.05 cM. Plant height of mature maize cultivated in the saline field (SPH) and plant height-based salt tolerance index (ratio of plant height between saline and control fields, PHI) were used to evaluate salt tolerance of mature maize plants. A major QTL for SPH was detected on Chromosome 1 with the LOD score of 22.4, which explained 31.2% of the phenotypic variation. In addition, the major QTL conditioning PHI was also mapped at the same position on Chromosome 1, and two candidate genes involving in ion homeostasis were identified within the confidence interval of this QTL. The detection of the major QTL in adult maize plant establishes the basis for the map-based cloning of genes associated with salt tolerance and provides a potential target for marker assisted selection in developing maize varieties with salt tolerance.
Chai, Wenbo; Jiang, Pengfei; Huang, Guoyu; Jiang, Haiyang; Li, Xiaoyu
2017-10-01
The TCP family is a group of plant-specific transcription factors. TCP genes encode proteins harboring bHLH structure, which is implicated in DNA binding and protein-protein interactions and known as the TCP domain. TCP genes play important roles in plant development and have been evolutionarily and functionally elaborated in various plants, however, no overall phylogenetic analysis or expression profiling of TCP genes in Zea mays has been reported. In the present study, a systematic analysis of molecular evolution and functional prediction of TCP family genes in maize ( Z . mays L.) has been conducted. We performed a genome-wide survey of TCP genes in maize, revealing the gene structure, chromosomal location and phylogenetic relationship of family members. Microsynteny between grass species and tissue-specific expression profiles were also investigated. In total, 29 TCP genes were identified in the maize genome, unevenly distributed on the 10 maize chromosomes. Additionally, ZmTCP genes were categorized into nine classes based on phylogeny and purifying selection may largely be responsible for maintaining the functions of maize TCP genes. What's more, microsynteny analysis suggested that TCP genes have been conserved during evolution. Finally, expression analysis revealed that most TCP genes are expressed in the stem and ear, which suggests that ZmTCP genes influence stem and ear growth. This result is consistent with the previous finding that maize TCP genes represses the growth of axillary organs and enables the formation of female inflorescences. Altogether, this study presents a thorough overview of TCP family in maize and provides a new perspective on the evolution of this gene family. The results also indicate that TCP family genes may be involved in development stage in plant growing conditions. Additionally, our results will be useful for further functional analysis of the TCP gene family in maize.
Chromosome painting in plants.
Schubert, I.; Fransz, P.F.; Fuchs, J.; Jong, de J.H.
2001-01-01
The current 'state-of-art' as to chromosome painting in plants is reviewed. We define different situations described as painting so far: i) Genomic in situ hybridisation (GISH) with total genomic DNA to distinguish alien chromosomes on the basis of divergent dispersed repeats, ii) 'Chromosomal in
From many, one: genetic control of prolificacy during maize domestication.
Directory of Open Access Journals (Sweden)
David M Wills
2013-06-01
Full Text Available A reduction in number and an increase in size of inflorescences is a common aspect of plant domestication. When maize was domesticated from teosinte, the number and arrangement of ears changed dramatically. Teosinte has long lateral branches that bear multiple small ears at their nodes and tassels at their tips. Maize has much shorter lateral branches that are tipped by a single large ear with no additional ears at the branch nodes. To investigate the genetic basis of this difference in prolificacy (the number of ears on a plant, we performed a genome-wide QTL scan. A large effect QTL for prolificacy (prol1.1 was detected on the short arm of chromosome 1 in a location that has previously been shown to influence multiple domestication traits. We fine-mapped prol1.1 to a 2.7 kb "causative region" upstream of the grassy tillers1 (gt1 gene, which encodes a homeodomain leucine zipper transcription factor. Tissue in situ hybridizations reveal that the maize allele of prol1.1 is associated with up-regulation of gt1 expression in the nodal plexus. Given that maize does not initiate secondary ear buds, the expression of gt1 in the nodal plexus in maize may suppress their initiation. Population genetic analyses indicate positive selection on the maize allele of prol1.1, causing a partial sweep that fixed the maize allele throughout most of domesticated maize. This work shows how a subtle cis-regulatory change in tissue specific gene expression altered plant architecture in a way that improved the harvestability of maize.
Directory of Open Access Journals (Sweden)
Na Liu
2016-07-01
Full Text Available Kernel starch content is an important trait in maize (Zea mays L. as it accounts for 65% to 75% of the dry kernel weight and positively correlates with seed yield. A number of starch synthesis-related genes have been identified in maize in recent years. However, many loci underlying variation in starch content among maize inbred lines still remain to be identified. The current study is a genome-wide association study that used a set of 263 maize inbred lines. In this panel, the average kernel starch content was 66.99%, ranging from 60.60% to 71.58% over the three study years. These inbred lines were genotyped with the SNP50 BeadChip maize array, which is comprised of 56,110 evenly spaced, random SNPs. Population structure was controlled by a mixed linear model (MLM as implemented in the software package TASSEL. After the statistical analyses, four SNPs were identified as significantly associated with starch content (P ≤ 0.0001, among which one each are located on chromosomes 1 and 5 and two are on chromosome 2. Furthermore, 77 candidate genes associated with starch synthesis were found within the 100-kb intervals containing these four QTLs, and four highly associated genes were within 20-kb intervals of the associated SNPs. Among the four genes, Glucose-1-phosphate adenylyltransferase (APS1; Gene ID GRMZM2G163437 is known as an important regulator of kernel starch content. The identified SNPs, QTLs, and candidate genes may not only be readily used for germplasm improvement by marker-assisted selection in breeding, but can also elucidate the genetic basis of starch content. Further studies on these identified candidate genes may help determine the molecular mechanisms regulating kernel starch content in maize and other important cereal crops.
Is there a strategy I iron uptake mechanism in maize?
Li, Suzhen; Zhou, Xiaojin; Chen, Jingtang; Chen, Rumei
2018-04-03
Iron is a metal micronutrient that is essential for plant growth and development. Graminaceous and nongraminaceous plants have evolved different mechanisms to mediate Fe uptake. Generally, strategy I is used by nongraminaceous plants like Arabidopsis, while graminaceous plants, such as rice, barley, and maize, are considered to use strategy II Fe uptake. Upon the functional characterization of OsIRT1 and OsIRT2 in rice, it was suggested that rice, as an exceptional graminaceous plant, utilizes both strategy I and strategy II Fe uptake systems. Similarly, ZmIRT1 and ZmZIP3 were identified as functional zinc and iron transporters in the maize genome, along with the determination of several genes encoding Zn and Fe transporters, raising the possibility that strategy I Fe uptake also occurs in maize. This mini-review integrates previous reports and recent evidence to obtain a better understanding of the mechanisms of Fe uptake in maize.
Short communication: QTL mapping for ear tip-barrenness in maize
Energy Technology Data Exchange (ETDEWEB)
Ding, J.; Ma, J.; Chen, J.; Ai, T.; Li, Z.; Tian, Z.; Wu, S.; Chen, W.; Wu, J.
2016-11-01
Barren tip on corn ear is an important agronomic trait in maize, which is highly associated with grain yield. Understanding the genetic basis of tip-barrenness may help to reduce the ear tip-barrenness in breeding programs. In this study, ear tip-barrenness was evaluated in two environments in a F2:3 population, and it showed significant genotypic variation for ear tip-barrenness in both environments. Using mixed-model composite interval mapping method, three additive effects quantitative trait loci (QTL) for ear tip-barrenness were mapped on chromosomes 2, 3 and 6, respectively. They explained 16.6% of the phenotypic variation, and no significant QTL × Environment interactions and digenic interactions were detected. The results indicated that additive effect was the main genetic basis for ear tip-barrenness in maize. This is the first report of QTL mapped for ear tip-barrenness in maize. (Author)
Relationship between chromosome configurations/associations and nuclear size/shape
International Nuclear Information System (INIS)
Ostashevsky, J.Y.
2003-01-01
Full text: Chromosome configurations (linear,folded,loop,etc.,which are defined through a pattern of centromere and/or telomere anchoring to the nuclear membrane) and chromosome associations (homologous pairing, number of centromere or telomere clusters per nucleus, number of chromosome arms per cluster, etc.) are critical for the formation of radiation-induced chromosome aberrations and DSB repair. However, the rules of nuclear architecture are poorly understood. A polymer approach for chromosome configurations, associations, and attachments was developed, based on the coil-like behavior of chromosomal fibers and the tight packing of discrete chromatin domains in a nucleus. The model considers chromatin anchoring to nuclear structures and shows that confinement of chromatin diffusion in a nucleus can be related to its anchoring and higher-order chromatin structure. The model was applied to nuclei of budding and fission yeast, Drosophila, worm, newt, mammals (human, Indian and Chinese muntjac, mouse) and plants (Arabidopsis, maize, barley, wheat). Quantitative agreement between results calculated from the model and observed data was obtained in all considered (∼25) cases. This supports the model and means that permitted chromosome configurations and associations can be predicted from the geometrical constraints imposed on chromosomes by nuclear size and shape
Incorporation of conventional genetic markers and RAPD markers into an RFLP based map in maize
International Nuclear Information System (INIS)
Coe, E.H. Jr.; McMullen, M.D.; Polacco, M.; Davis, G.L.; Chao, S.
1998-01-01
Integration of classical genetic markers, in particular mutants, onto the maize Restriction Fragment Length Polymorphism (RFLP) map will provide the tools necessary to further our understanding of plant development and of complex traits. Initially integration was accomplished by visual alignment of common markers and sometimes involved the use of information from several different molecular maps to determine the relative placement of a single mutant. The maize core marker set was designed to provide a common set of markers which could be used for integration of map data. We have completed the mapping, of 56 mutants on chromosome one relative to the core marker set. Phenotypes included whole plant, seedling, and kernel effects and represented a variety of biological processes. Since these mutants were previously located to chromosome arm, mapping required the use of only seven markers per mutant to define the correct bin location. Two mistakes in marker order relative to the classical map were identified, as well as, six groups of mutants which require allelism testing. Placement of mutants and cDNAs into bins using, the core markers provides a necessary resource for identification of gene function in maize. (author)
Expression of a truncated ATHB17 protein in maize increases ear weight at silking.
Directory of Open Access Journals (Sweden)
Elena A Rice
Full Text Available ATHB17 (AT2G01430 is an Arabidopsis gene encoding a member of the α-subclass of the homeodomain leucine zipper class II (HD-Zip II family of transcription factors. The ATHB17 monomer contains four domains common to all class II HD-Zip proteins: a putative repression domain adjacent to a homeodomain, leucine zipper, and carboxy terminal domain. However, it also possesses a unique N-terminus not present in other members of the family. In this study we demonstrate that the unique 73 amino acid N-terminus is involved in regulation of cellular localization of ATHB17. The ATHB17 protein is shown to function as a transcriptional repressor and an EAR-like motif is identified within the putative repression domain of ATHB17. Transformation of maize with an ATHB17 expression construct leads to the expression of ATHB17Δ113, a truncated protein lacking the first 113 amino acids which encodes a significant portion of the repression domain. Because ATHB17Δ113 lacks the repression domain, the protein cannot directly affect the transcription of its target genes. ATHB17Δ113 can homodimerize, form heterodimers with maize endogenous HD-Zip II proteins, and bind to target DNA sequences; thus, ATHB17Δ113 may interfere with HD-Zip II mediated transcriptional activity via a dominant negative mechanism. We provide evidence that maize HD-Zip II proteins function as transcriptional repressors and that ATHB17Δ113 relieves this HD-Zip II mediated transcriptional repression activity. Expression of ATHB17Δ113 in maize leads to increased ear size at silking and, therefore, may enhance sink potential. We hypothesize that this phenotype could be a result of modulation of endogenous HD-Zip II pathways in maize.
Expression of a truncated ATHB17 protein in maize increases ear weight at silking.
Rice, Elena A; Khandelwal, Abha; Creelman, Robert A; Griffith, Cara; Ahrens, Jeffrey E; Taylor, J Philip; Murphy, Lesley R; Manjunath, Siva; Thompson, Rebecca L; Lingard, Matthew J; Back, Stephanie L; Larue, Huachun; Brayton, Bonnie R; Burek, Amanda J; Tiwari, Shiv; Adam, Luc; Morrell, James A; Caldo, Rico A; Huai, Qing; Kouadio, Jean-Louis K; Kuehn, Rosemarie; Sant, Anagha M; Wingbermuehle, William J; Sala, Rodrigo; Foster, Matt; Kinser, Josh D; Mohanty, Radha; Jiang, Dongming; Ziegler, Todd E; Huang, Mingya G; Kuriakose, Saritha V; Skottke, Kyle; Repetti, Peter P; Reuber, T Lynne; Ruff, Thomas G; Petracek, Marie E; Loida, Paul J
2014-01-01
ATHB17 (AT2G01430) is an Arabidopsis gene encoding a member of the α-subclass of the homeodomain leucine zipper class II (HD-Zip II) family of transcription factors. The ATHB17 monomer contains four domains common to all class II HD-Zip proteins: a putative repression domain adjacent to a homeodomain, leucine zipper, and carboxy terminal domain. However, it also possesses a unique N-terminus not present in other members of the family. In this study we demonstrate that the unique 73 amino acid N-terminus is involved in regulation of cellular localization of ATHB17. The ATHB17 protein is shown to function as a transcriptional repressor and an EAR-like motif is identified within the putative repression domain of ATHB17. Transformation of maize with an ATHB17 expression construct leads to the expression of ATHB17Δ113, a truncated protein lacking the first 113 amino acids which encodes a significant portion of the repression domain. Because ATHB17Δ113 lacks the repression domain, the protein cannot directly affect the transcription of its target genes. ATHB17Δ113 can homodimerize, form heterodimers with maize endogenous HD-Zip II proteins, and bind to target DNA sequences; thus, ATHB17Δ113 may interfere with HD-Zip II mediated transcriptional activity via a dominant negative mechanism. We provide evidence that maize HD-Zip II proteins function as transcriptional repressors and that ATHB17Δ113 relieves this HD-Zip II mediated transcriptional repression activity. Expression of ATHB17Δ113 in maize leads to increased ear size at silking and, therefore, may enhance sink potential. We hypothesize that this phenotype could be a result of modulation of endogenous HD-Zip II pathways in maize.
Expression of a Truncated ATHB17 Protein in Maize Increases Ear Weight at Silking
Creelman, Robert A.; Griffith, Cara; Ahrens, Jeffrey E.; Taylor, J. Philip; Murphy, Lesley R.; Manjunath, Siva; Thompson, Rebecca L.; Lingard, Matthew J.; Back, Stephanie L.; Larue, Huachun; Brayton, Bonnie R.; Burek, Amanda J.; Tiwari, Shiv; Adam, Luc; Morrell, James A.; Caldo, Rico A.; Huai, Qing; Kouadio, Jean-Louis K.; Kuehn, Rosemarie; Sant, Anagha M.; Wingbermuehle, William J.; Sala, Rodrigo; Foster, Matt; Kinser, Josh D.; Mohanty, Radha; Jiang, Dongming; Ziegler, Todd E.; Huang, Mingya G.; Kuriakose, Saritha V.; Skottke, Kyle; Repetti, Peter P.; Reuber, T. Lynne; Ruff, Thomas G.; Petracek, Marie E.; Loida, Paul J.
2014-01-01
ATHB17 (AT2G01430) is an Arabidopsis gene encoding a member of the α-subclass of the homeodomain leucine zipper class II (HD-Zip II) family of transcription factors. The ATHB17 monomer contains four domains common to all class II HD-Zip proteins: a putative repression domain adjacent to a homeodomain, leucine zipper, and carboxy terminal domain. However, it also possesses a unique N-terminus not present in other members of the family. In this study we demonstrate that the unique 73 amino acid N-terminus is involved in regulation of cellular localization of ATHB17. The ATHB17 protein is shown to function as a transcriptional repressor and an EAR-like motif is identified within the putative repression domain of ATHB17. Transformation of maize with an ATHB17 expression construct leads to the expression of ATHB17Δ113, a truncated protein lacking the first 113 amino acids which encodes a significant portion of the repression domain. Because ATHB17Δ113 lacks the repression domain, the protein cannot directly affect the transcription of its target genes. ATHB17Δ113 can homodimerize, form heterodimers with maize endogenous HD-Zip II proteins, and bind to target DNA sequences; thus, ATHB17Δ113 may interfere with HD-Zip II mediated transcriptional activity via a dominant negative mechanism. We provide evidence that maize HD-Zip II proteins function as transcriptional repressors and that ATHB17Δ113 relieves this HD-Zip II mediated transcriptional repression activity. Expression of ATHB17Δ113 in maize leads to increased ear size at silking and, therefore, may enhance sink potential. We hypothesize that this phenotype could be a result of modulation of endogenous HD-Zip II pathways in maize. PMID:24736658
Han, Shiwen; Zou, Shiying; He, Xiaoyun; Huang, Kunlun; Mei, Xiaohong
2016-08-01
The food safety of stacked trait genetically modified (GM) maize GH5112E-117C containing insect-resistance gene Cry1Ah and glyphosate-resistant gene G2-aroA was evaluated in comparison to non-GM Hi-II maize fed to Sprague-Dawley rats during a 90-day subchronic feeding study. Three different dietary concentrations (12.5, 25 and 50 %, w/w) of the GM maize were used or its corresponding non-GM maize. No biologically significant differences in the animals' clinical signs, body weights, food consumption, hematology, clinical chemistry, organ weights and histopathology were found between the stacked trait GM maize groups, and the non-GM maize groups. The results of the 90-day subchronic feeding study demonstrated that the stacked trait GM maize GH5112E-117C is as safe as the conventional non-GM maize Hi-II.
Genome-wide recombination dynamics are associated with phenotypic variation in maize.
Pan, Qingchun; Li, Lin; Yang, Xiaohong; Tong, Hao; Xu, Shutu; Li, Zhigang; Li, Weiya; Muehlbauer, Gary J; Li, Jiansheng; Yan, Jianbing
2016-05-01
Meiotic recombination is a major driver of genetic diversity, species evolution, and agricultural improvement. Thus, an understanding of the genetic recombination landscape across the maize (Zea mays) genome will provide insight and tools for further study of maize evolution and improvement. Here, we used c. 50 000 single nucleotide polymorphisms to precisely map recombination events in 12 artificial maize segregating populations. We observed substantial variation in the recombination frequency and distribution along the ten maize chromosomes among the 12 populations and identified 143 recombination hot regions. Recombination breakpoints were partitioned into intragenic and intergenic events. Interestingly, an increase in the number of genes containing recombination events was accompanied by a decrease in the number of recombination events per gene. This kept the overall number of intragenic recombination events nearly invariable in a given population, suggesting that the recombination variation observed among populations was largely attributed to intergenic recombination. However, significant associations between intragenic recombination events and variation in gene expression and agronomic traits were observed, suggesting potential roles for intragenic recombination in plant phenotypic diversity. Our results provide a comprehensive view of the maize recombination landscape, and show an association between recombination, gene expression and phenotypic variation, which may enhance crop genetic improvement. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.
Directory of Open Access Journals (Sweden)
Mario Franić
2017-01-01
Full Text Available We performed QTL mapping in testcrosses of maize population IBMSyn4 for three grain quality traits: oil and protein contents and test weight. 191 phenotyped and genotyped lines were used as a training set while 85 genotyped only lines comprised a validation set used to calculate best linear unbiased predictions (BLUP, making a total of 276 phenotypes for the QTL analysis. 92000 filtered Genotyping-By-Sequencing (GBS SNP markers were used to calculate BLUPs, while a set of 2178 genetically mapped SSRs was used in QTL analysis. By simple QTL scan, we scored several minor effect QTLs: one for oil content (chromosome 1, one for protein content (chromosome 10 and four for test weight (chromosomes 1, 3, 5 and 10. QTLs associated with test weight were found to be additive, and 18.25% of phenotypic variance was explained by their joint effect. Only one QTL for test weight was found to be significant in composite interval mapping and it was mapped on chromosome 5. This QTL accounted for 9.97% of phenotypic variance. QTLs detected in this study represent monitoring of commercially most successful elite maize germplasm for grain quality traits.
Construction of a bacterial artificial chromosome library of S-type CMS maize mitochondria
Institute of Scientific and Technical Information of China (English)
无
2000-01-01
In order to isolate mitochondrial genes easily, we have developed a new method to construct S-type CMS maize mitochondrial gene library by means of embedding mitochondria and enzymatic digesting mitochondria in situ, preparing mtDNA by electrophoresis, digesting LMP agarose with β-agarase, using BAC vector and electroporation. About 2 500 white clones of Mo17 CMS-J mitochondrial gene library were obtained with the average size of 18.24 kb, ranging from 5 to 40 kb, 63.6% inserts came from mitochondrial genome and represented 48 ′ mitochondrial genome equivalents. All the probes had detected the positive clones in the gene library. It is helpful to elucidating the maize mitochondrial genome structure and mechanism of S-type CMS, and may give some valuable reference to the construction of other plant mitochondrial genome library.
GENETIC DIVERSITY OF S3 MAIZE GENOTYPES RESISTANT TO DOWNY MILDEW BASED ON SSR MARKERS
Directory of Open Access Journals (Sweden)
Amran Muis
2016-02-01
Full Text Available The compulsory requirement for releasing new high yielding maize varieties is resistance to downy mildew. The study aimed to determine the level of homozygosity, genetic diversity, and genetic distance of 30 S3 genotypes of maize. Number of primers to be used were 30 polymorphic SSR loci which are distributed over the entire maize genomes. The S3 genotypes used were resistant to downy mildew with homozygosity level of >80%, genetic distance between the test and tester strains >0.7, and anthesis silking interval (ASI between inbred lines and tester lines was maximum 3 days. The results showed that 30 SSR primers used were spread evenly across the maize genomes which were manifested in the representation of SSR loci on each chromosome of a total of 10 chromosomes. The levels of polymorphism ranged from 0.13 to 0.78, an average of 0.51, and the number of alleles ranged from 2 to 8 alleles per SSR locus, an average of 4 alleles per SSR locus. The size of nucleotides in each locus also varied from 70 to 553 bp. Cophenetic correlation value (r at 0.67 indicated that the Unweighted Pair-Group Method Using Arithmetic Averages (UPGMA was less reliable for differentiating genotypes in five groups. Of the total of 30 genotypes analyzed, 17 genotypes had homozygosity level of >80% so it can be included in the hybrid assembly program.
Xu, Ling; Zhang, Yan; Shao, Siquan; Chen, Wei; Tan, Jing; Zhu, Mang; Zhong, Tao; Fan, Xingming; Xu, Mingliang
2014-08-31
Gray leaf spot (GLS) caused by Cercospora zeae-maydis (Czm) or Cercospora zeina (Cz) is a devastating maize disease and results in substantial yield reductions worldwide. GLS resistance is a quantitatively inherited trait. The development and cultivation of GLS-resistant maize hybrids are the most cost-effective and efficient ways to control this disease. We previously detected a major GLS resistance QTL, qRgls2, in bin 5.03-04, which spans the whole centromere of chromosome 5 encompassing a physical distance of ~110-Mb. With advanced backcross populations derived from the cross between the resistant Y32 and susceptible Q11 inbred lines, a sequential recombinant-derived progeny testing strategy was adapted to fine map qRgls2. We narrowed the region of qRgls2 from an initial ~110-Mb to an interval of ~1-Mb, flanked by the markers G346 and DD11. qRgls2 showed predominantly additive genetic effects and significantly increased the resistance percentage by 20.6 to 24.6% across multiple generations. A total of 15 genes were predicted in the mapped region according to the 5b.60 annotation of the maize B73 genome v2. Two pieces of the mapped qRgls2 region shared collinearity with two distant segments on maize chromosome 4. qRgls2, a major QTL involved in GLS resistance, was mapped to a ~1-Mb region close to the centromere of chromosome 5. There are 15 predicted genes in the mapped region. It is assumed that qRgls2 could be widely used to improve maize resistance to GLS.
Chromatid Painting for Chromosomal Inversion Detection, Phase II
National Aeronautics and Space Administration — We propose the continued development of a novel approach to the detection of chromosomal inversions. Transmissible chromosome aberrations (translocations and...
Polytene chromosome map and inversion polymorphism in Drosophila mediopunctata
Directory of Open Access Journals (Sweden)
Galina Ananina
2002-07-01
Full Text Available Drosophila mediopunctata belongs to the tripunctata group, and is one of the commonest Drosophila species collected in some places in Brazil, especially in the winter. A standard map of the polytene chromosomes is presented. The breakpoints of the naturally occurring chromosomal rearrangements are marked on the map. The distribution of breaking points through the chromosomes of D. mediopunctata is apparently non-random. Chromosomes X, II and IV show inversion polymorphisms. Chromosome II is the most polymorphic, with 17 inversions, 8 inversions in the distal region and 9 in the proximal region. Chromosome X has four different gene arrangements, while chromosome IV has only two.
Chahal, Parminder S.; Ganie, Zahoor A.; Jhala, Amit J.
2018-01-01
A Palmer amaranth (Amaranthus palmeri S. Watson) biotype has evolved resistance to photosystem (PS) II- (atrazine) and 4-hydroxyphenylpyruvate dioxygenase (HPPD)-inhibiting herbicides (mesotrione, tembotrione, and topramezone) in maize seed production field in Nebraska, USA. The objectives of this study were to determine the effect of soil residual pre-emergence (PRE) herbicides followed by (fb) tank-mixture of residual and foliar active post-emergence (POST) herbicides on PS-II- and HPPD-inhibitor-resistant Palmer amaranth control, maize yield, and net economic returns. Field experiments were conducted in a grower's field infested with PS II- and HPPD-inhibitor-resistant Palmer amaranth near Shickley in Fillmore County, Nebraska, USA in 2015 and 2016. The contrast analysis suggested that saflufenacil plus dimethenamid-P or pyroxasulfone plus saflufenacil applied PRE provided 80–82% Palmer amaranth control compared to 65 and 39% control with saflufenacil and pyroxasulfone applied alone at 3 weeks after PRE (WAPRE), respectively. Among the PRE fb POST herbicide programs, 95–98% Palmer amaranth control was achieved with pyroxasulfone plus safluefenacil, or saflufenacil plus dimethenamid-P applied PRE, fb glyphosate plus topramezone plus dimethenamid-P plus atrazine, glyphosate plus diflufenzopyr plus dicamba plus pyroxasulfone, glyphosate plus diflufenzopyr plus pendimethalin, or glyphosate plus diflufenzopyr plus dicamba plus atrazine applied POST at 3 weeks after POST (WAPOST) through maize harvest. Based on contrast analysis, PRE fb POST programs provided 77–83% Palmer amaranth control at 3 WAPOST through maize harvest compared to 12–15% control with PRE-only and 66–84% control with POST-only programs. Similarly, PRE fb POST programs provided 99% biomass reduction at 6 WAPOST compared to PRE-only (28%) and POST-only (87%) programs. PRE fb POST programs provided higher maize yield (13,617 kg ha−1) and net return (US $1,724 ha−1) compared to the PRE
Kozdroj, J; Trevors, JT; van Elsas, JD
Two species of Pseudomonas chromosomally tagged with gfp, which had shown antagonistic activity against the tomato pathogen Ralstonia solanacearum in a previous study, were assessed for their impact in the rhizosphere of maize. Plant growth characteristics, numbers of indigenous heterotrophic
T Cremer; C Cremer
2009-01-01
Part II of this historical review on the progress of nuclear architecture studies points out why the original hypothesis of chromosome territories from Carl Rabl and Theodor Boveri (described in part I) was abandoned during the 1950s and finally proven by compelling evidence forwarded by laser-uvmicrobeam studies and in situ hybridization experiments. Part II also includes a section on the development of advanced light microscopic techniques breaking the classical Abbe limit written for reade...
Meiotic Studies on Combinations of Chromosomes With Different Sized Centromeres in Maize
Directory of Open Access Journals (Sweden)
Fangpu Han
2018-06-01
Full Text Available Multiple centromere misdivision derivatives of a translocation between the supernumerary B chromosome and the short arm of chromosome 9 (TB-9Sb permit investigation of how centromeres of different sizes behave in meiosis in opposition or in competition with each other. In the first analysis, heterozygotes were produced between the normal TB-9Sb and derivatives of it that resulted from centromere misdivision that reduced the amounts of centromeric DNA. These heterozygotes could test whether these drastic differences would result in meiotic drive of the larger chromosome in female meiosis. Cytological determinations of the segregation of large and small centromeres among thousands of progeny of four combinations were made. The recovery of the larger centromere was at a few percent higher frequency in two of four combinations. However, examination of phosphorylated histone H2A-Thr133, a characteristic of active centromeres, showed a lack of correlation with the size of the centromeric DNA, suggesting an expansion of the basal protein features of the kinetochore in two of the three cases despite the reduction in the size of the underlying DNA. In the second analysis, plants containing different sizes of the B chromosome centromere were crossed to plants with TB-9Sb with a foldback duplication of 9S (TB-9Sb-Dp9. In the progeny, plants containing large and small versions of the B chromosome centromere were selected by FISH. A meiotic “tug of war” occurred in hybrid combinations by recombination between the normal 9S and the foldback duplication in those cases in which pairing occurred. Such pairing and recombination produce anaphase I bridges but in some cases the large and small centromeres progressed to the same pole. In one combination, new dicentric chromosomes were found in the progeny. Collectively, the results indicate that the size of the underlying DNA of a centromere does not dramatically affect its segregation properties or its ability
Mascher, Martin; Gerlach, Nina; Gahrtz, Manfred; Bucher, Marcel; Scholz, Uwe; Dresselhaus, Thomas
2014-01-01
Maize (Zea mays) is the most widely grown crop species in the world and a classical model organism for plant research. The completion of a high-quality reference genome sequence and the advent of high-throughput sequencing have greatly empowered re-sequencing studies in maize. In this study, plants of maize inbred line B73 descended from two different sets of seed material grown for several generations either in the field or in the greenhouse were found to show a different growth phenotype and ionome under phosphate starvation conditions and moreover a different responsiveness towards mycorrhizal fungi of the species Glomus intraradices (syn: Rhizophagus irregularis). Whole genome re-sequencing of individuals from both sets and comparison to the B73 reference sequence revealed three cryptic introgressions on chromosomes 1, 5 and 10 in the line grown in the greenhouse summing up to a total of 5,257 single-nucleotide polymorphisms (SNPs). Transcriptome sequencing of three individuals from each set lent further support to the location of the introgression intervals and confirmed them to be fixed in all sequenced individuals. Moreover, we identified >120 genes differentially expressed between the two B73 lines. We thus have found a nearly-isogenic line (NIL) of maize inbred line B73 that is characterized by an altered growth phenotype under phosphate starvation conditions and an improved responsiveness towards symbiosis with mycorrhizal fungi. Through next-generation sequencing of the genomes and transcriptomes we were able to delineate exact introgression intervals. Putative de novo mutations appeared approximately uniformly distributed along the ten maize chromosomes mainly representing G:C -> A:T transitions. The plant material described in this study will be a valuable tool both for functional studies of genes differentially expressed in both B73 lines and for research on growth behavior especially in response to symbiosis between maize and mycorrhizal fungi.
Directory of Open Access Journals (Sweden)
Martin Mascher
Full Text Available Maize (Zea mays is the most widely grown crop species in the world and a classical model organism for plant research. The completion of a high-quality reference genome sequence and the advent of high-throughput sequencing have greatly empowered re-sequencing studies in maize. In this study, plants of maize inbred line B73 descended from two different sets of seed material grown for several generations either in the field or in the greenhouse were found to show a different growth phenotype and ionome under phosphate starvation conditions and moreover a different responsiveness towards mycorrhizal fungi of the species Glomus intraradices (syn: Rhizophagus irregularis. Whole genome re-sequencing of individuals from both sets and comparison to the B73 reference sequence revealed three cryptic introgressions on chromosomes 1, 5 and 10 in the line grown in the greenhouse summing up to a total of 5,257 single-nucleotide polymorphisms (SNPs. Transcriptome sequencing of three individuals from each set lent further support to the location of the introgression intervals and confirmed them to be fixed in all sequenced individuals. Moreover, we identified >120 genes differentially expressed between the two B73 lines. We thus have found a nearly-isogenic line (NIL of maize inbred line B73 that is characterized by an altered growth phenotype under phosphate starvation conditions and an improved responsiveness towards symbiosis with mycorrhizal fungi. Through next-generation sequencing of the genomes and transcriptomes we were able to delineate exact introgression intervals. Putative de novo mutations appeared approximately uniformly distributed along the ten maize chromosomes mainly representing G:C -> A:T transitions. The plant material described in this study will be a valuable tool both for functional studies of genes differentially expressed in both B73 lines and for research on growth behavior especially in response to symbiosis between maize and
International Nuclear Information System (INIS)
Tsai-Pflugfelder, M.; Liu, L.F.; Liu, A.A.; Tewey, K.M.; Whang-Peng, J.; Knutsen, T.; Huebner, K.; Croce, C.M.; Wang, J.C.
1988-01-01
Two overlapping cDNA clones encoding human DNA topoisomerase II were identified by two independent methods. In one, a human cDNA library in phage λ was screened by hybridization with a mixed oligonucleotide probe encoding a stretch of seven amino acids found in yeast and Drosophila DNA topoisomerase II; in the other, a different human cDNA library in a λgt11 expression vector was screened for the expression of antigenic determinants that are recognized by rabbit antibodies specific to human DNA topoisomerase II. The entire coding sequences of the human DNA topoisomerase II gene were determined from these and several additional clones, identified through the use of the cloned human TOP2 gene sequences as probes. Hybridization between the cloned sequences and mRNA and genomic DNA indicates that the human enzyme is encoded by a single-copy gene. The location of the gene was mapped to chromosome 17q21-22 by in situ hybridization of a cloned fragment to metaphase chromosomes and by hybridization analysis with a panel of mouse-human hybrid cell lines, each retaining a subset of human chromosomes
Analysis of the Ceratitis capitata y chromosome using in situ hybridization to mitotic chromosomes
International Nuclear Information System (INIS)
Willhoeft, U.; Franz, G.
1998-01-01
In Ceratitis capitata the Y chromosome is responsible for sex-determination. We used fluorescence in situ hybridization (FISH) for cytogenetic analysis of mitotic chromosomes. FISH with the wild-type strain EgyptII and two repetitive DNA probes enabled us to differentiate between the short and the long arm of the Y chromosome and gives a much better resolution than C-banding of mitotic chromosomes. We identified the Y-chromosomal breakpoints in Y-autosome translocations using FISH. Even more complex rearrangements i.e. deletions and insertions in some translocation strains were detected by this method. A strategy for mapping the primary sex determination factor in Ceratitis capitata by FISH is presented. (author)
Lewis, R A; Otterud, B; Stauffer, D; Lalouel, J M; Leppert, M
1990-06-01
Usher syndrome is a heterogeneous group of autosomal recessive disorders that combines variably severe congenital neurosensory hearing impairment with progressive night-blindness and visual loss similar to that in retinitis pigmentosa. Usher syndrome type I is distinguished by profound congenital (preverbal) deafness and retinal disease with onset in the first decade of life. Usher syndrome type II is characterized by partial hearing impairment and retinal dystrophy that occurs in late adolescence or early adulthood. The chromosomal assignment and the regional localization of the genetic mutation(s) causing the Usher syndromes are unknown. We analyzed a panel of polymorphic genomic markers for linkage to the disease gene among six families with Usher syndrome type I and 22 families with Usher syndrome type II. Significant linkage was established between Usher syndrome type II and the DNA marker locus THH33 (D1S81), which maps to chromosome 1q. The most likely location of the disease gene is at a map distance of 9 cM from THH33 (lod score 6.5). The same marker failed to show linkage in families segregating an allele for Usher syndrome type I. These data confirm the provisional assignment of the locus for Usher syndrome type II to the distal end of chromosome 1q and demonstrate that the clinical heterogeneity between Usher types I and II is caused by mutational events at different genetic loci. Regional localization has the potential to improve carrier detection and to provide antenatal diagnosis in families at risk for the disease.
A chromosome conformation capture ordered sequence of the barley genome
Czech Academy of Sciences Publication Activity Database
Mascher, M.; Gundlach, H.; Himmelbach, A.; Beier, S.; Twardziok, S. O.; Wicker, T.; Šimková, Hana; Staňková, Helena; Vrána, Jan; Chan, S.; Munoz-Amatrian, M.; Houben, A.; Doležel, Jaroslav; Ayling, S.; Lonardi, S.; Mayer, K.F.X.; Zhang, G.; Braumann, I.; Spannagl, M.; Li, C.; Waugh, R.; Stein, N.
2017-01-01
Roč. 544, č. 7651 (2017), s. 427-433 ISSN 0028-0836 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : bacterial artificial chromosomes * inverted-repeat elements * complex-plant genomes * hi-c * environmental adaptation * ltr retrotransposons * structural variation * maize genome * software * database Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 40.137, year: 2016
Aflatoxins and fumonisin contamination of marketed maize, maize ...
African Journals Online (AJOL)
Aflatoxins and fumonisin contamination of marketed maize, maize bran and maize used as animal feed in northern ... PROMOTING ACCESS TO AFRICAN RESEARCH ... African Journal of Food, Agriculture, Nutrition and Development.
International Nuclear Information System (INIS)
Zhang, Zhongbao; Li, Xianglong; Zhang, Chun; Zou, Huawen; Wu, Zhongyi
2016-01-01
NUCLEAR FACTOR-Y (NF-Y) has been shown to play an important role in growth, development, and response to environmental stress. A NF-Y complex, which consists of three subunits, NF-YA, NF-YB, and, NF-YC, binds to CCAAT sequences in a promoter to control the expression of target genes. Although NF-Y proteins have been reported in Arabidopsis and rice, a comprehensive and systematic analysis of ZmNF-Y genes has not yet been performed. To examine the functions of ZmNF-Y genes in this family, we isolated and characterized 50 ZmNF-Y (14 ZmNF-YA, 18 ZmNF-YB, and 18 ZmNF-YC) genes in an analysis of the maize genome. The 50 ZmNF-Y genes were distributed on all 10 maize chromosomes, and 12 paralogs were identified. Multiple alignments showed that maize ZmNF-Y family proteins had conserved regions and relatively variable N-terminal or C-terminal domains. The comparative syntenic map illustrated 40 paralogous NF-Y gene pairs among the 10 maize chromosomes. Microarray data showed that the ZmNF-Y genes had tissue-specific expression patterns in various maize developmental stages and in response to biotic and abiotic stresses. The results suggested that ZmNF-YB2, 4, 8, 10, 13, and 16 and ZmNF-YC6, 8, and 15 were induced, while ZmNF-YA1, 3, 4, 6, 7, 10, 12, and 13, ZmNF-YB15, and ZmNF-YC3 and 9 were suppressed by drought stress. ZmNF-YA3, ZmNF-YA8 and ZmNF-YA12 were upregulated after infection by the three pathogens, while ZmNF-YA1 and ZmNF-YB2 were suppressed. These results indicate that the ZmNF-Ys may have significant roles in the response to abiotic and biotic stresses. - Highlights: • We indicated a total of 50 members of ZmNF-Y gene family in maize genome. • We analyzed gene structure, protein architecture of ZmNF-Y genes. • Evolution pattern and phylogenic relationships were analyzed among 50 ZmNF-Y genes. • Expression pattern of ZmNF-Ys were detected in various maize tissues. • Transcript levels of ZmNF-Ys were measured under various abiotic and biotic stresses.
The B73 maize genome: complexity, diversity, and dynamics.
Schnable, Patrick S; Ware, Doreen; Fulton, Robert S; Stein, Joshua C; Wei, Fusheng; Pasternak, Shiran; Liang, Chengzhi; Zhang, Jianwei; Fulton, Lucinda; Graves, Tina A; Minx, Patrick; Reily, Amy Denise; Courtney, Laura; Kruchowski, Scott S; Tomlinson, Chad; Strong, Cindy; Delehaunty, Kim; Fronick, Catrina; Courtney, Bill; Rock, Susan M; Belter, Eddie; Du, Feiyu; Kim, Kyung; Abbott, Rachel M; Cotton, Marc; Levy, Andy; Marchetto, Pamela; Ochoa, Kerri; Jackson, Stephanie M; Gillam, Barbara; Chen, Weizu; Yan, Le; Higginbotham, Jamey; Cardenas, Marco; Waligorski, Jason; Applebaum, Elizabeth; Phelps, Lindsey; Falcone, Jason; Kanchi, Krishna; Thane, Thynn; Scimone, Adam; Thane, Nay; Henke, Jessica; Wang, Tom; Ruppert, Jessica; Shah, Neha; Rotter, Kelsi; Hodges, Jennifer; Ingenthron, Elizabeth; Cordes, Matt; Kohlberg, Sara; Sgro, Jennifer; Delgado, Brandon; Mead, Kelly; Chinwalla, Asif; Leonard, Shawn; Crouse, Kevin; Collura, Kristi; Kudrna, Dave; Currie, Jennifer; He, Ruifeng; Angelova, Angelina; Rajasekar, Shanmugam; Mueller, Teri; Lomeli, Rene; Scara, Gabriel; Ko, Ara; Delaney, Krista; Wissotski, Marina; Lopez, Georgina; Campos, David; Braidotti, Michele; Ashley, Elizabeth; Golser, Wolfgang; Kim, HyeRan; Lee, Seunghee; Lin, Jinke; Dujmic, Zeljko; Kim, Woojin; Talag, Jayson; Zuccolo, Andrea; Fan, Chuanzhu; Sebastian, Aswathy; Kramer, Melissa; Spiegel, Lori; Nascimento, Lidia; Zutavern, Theresa; Miller, Beth; Ambroise, Claude; Muller, Stephanie; Spooner, Will; Narechania, Apurva; Ren, Liya; Wei, Sharon; Kumari, Sunita; Faga, Ben; Levy, Michael J; McMahan, Linda; Van Buren, Peter; Vaughn, Matthew W; Ying, Kai; Yeh, Cheng-Ting; Emrich, Scott J; Jia, Yi; Kalyanaraman, Ananth; Hsia, An-Ping; Barbazuk, W Brad; Baucom, Regina S; Brutnell, Thomas P; Carpita, Nicholas C; Chaparro, Cristian; Chia, Jer-Ming; Deragon, Jean-Marc; Estill, James C; Fu, Yan; Jeddeloh, Jeffrey A; Han, Yujun; Lee, Hyeran; Li, Pinghua; Lisch, Damon R; Liu, Sanzhen; Liu, Zhijie; Nagel, Dawn Holligan; McCann, Maureen C; SanMiguel, Phillip; Myers, Alan M; Nettleton, Dan; Nguyen, John; Penning, Bryan W; Ponnala, Lalit; Schneider, Kevin L; Schwartz, David C; Sharma, Anupma; Soderlund, Carol; Springer, Nathan M; Sun, Qi; Wang, Hao; Waterman, Michael; Westerman, Richard; Wolfgruber, Thomas K; Yang, Lixing; Yu, Yeisoo; Zhang, Lifang; Zhou, Shiguo; Zhu, Qihui; Bennetzen, Jeffrey L; Dawe, R Kelly; Jiang, Jiming; Jiang, Ning; Presting, Gernot G; Wessler, Susan R; Aluru, Srinivas; Martienssen, Robert A; Clifton, Sandra W; McCombie, W Richard; Wing, Rod A; Wilson, Richard K
2009-11-20
We report an improved draft nucleotide sequence of the 2.3-gigabase genome of maize, an important crop plant and model for biological research. Over 32,000 genes were predicted, of which 99.8% were placed on reference chromosomes. Nearly 85% of the genome is composed of hundreds of families of transposable elements, dispersed nonuniformly across the genome. These were responsible for the capture and amplification of numerous gene fragments and affect the composition, sizes, and positions of centromeres. We also report on the correlation of methylation-poor regions with Mu transposon insertions and recombination, and copy number variants with insertions and/or deletions, as well as how uneven gene losses between duplicated regions were involved in returning an ancient allotetraploid to a genetically diploid state. These analyses inform and set the stage for further investigations to improve our understanding of the domestication and agricultural improvements of maize.
Chemical and nutritional values of maize and maize products ...
African Journals Online (AJOL)
Maize and maize products in selected grain markets within Kaduna, Nigeria, were obtained and investigated for proximate and mineral composition analysis using Atomic Absorption Spectrophotometer (AAS) and flame photometer. Proximate composition of maize and maize products were in the range of 11.6- 20 .0% ...
Directory of Open Access Journals (Sweden)
Andrija Brkić
2015-06-01
Full Text Available Western corn rootworm – WCR (Diabrotica virgifera virgifera LeConte is an important maize pest in Croatia. Using native resistance of maize germplasm could reduce chemical treatments and other costs in maize production. Objectives of this study were: i to assess variability of WCR resistance traits (root injury, regrowth and size and concentrations of nine elements in roots of 128 maize genotypes, and ii to determine correlations among the traits and ion concentrations. Results revealed high variability of maize genotypes for both WCR resistance traits and ion concentrations. Significant moderate negative correlations (>-0.4 were detected between root injury and boron as well as between root regrowth and iron, manganese and zinc concentrations in root. Consequently, ion concentration in maize roots might have an impact on WCR resistance research.
In-vitro mutation breeding technology in maize
International Nuclear Information System (INIS)
Nesticky, M.
1988-08-01
Gamma-irradiation and in-vitro culture, separately or combined, as a tool for inducing mutation in maize were evaluated. This type of research has been hampered in maize because (i) maize is a cross pollinating crop and highly heterozygous and (ii) embryogenesis and plant regeneration of plants from in-vitro culture have been difficult. In the present study, carefully designed and elaborated experiments were conducted using an inbred line CH1 31 which is capable of somatic embryogenesis for the subject of mutagenesis and another line Bu 8Ro 2 for the test cross partner. Results showed: 1) Both the regeneration of plants from in-vitro culture and gamma-irradiation induced a similar spectrum of morphological variation. Although the variation with somaclones was more frequent that radiation induced mutations under the conditions used, combination of explant irradiation and in-vitro culture gave the highest frequencies of genetic variation. 2) Some of the mutations in quantitative characters can be recogned in heterozygous state. 3) Mutation can cause variation in combining ability (extent of heterosis). 4) Efficiency at embryogenesis differs with genotypes of maize. 3 refs, 11 figs, 4 tabs
International Nuclear Information System (INIS)
Lee, M.
2001-01-01
This final report summarizes the progress made towards the enhancement and distribution of genetic resources (e.g. genetic stocks, seed and DNA clones) used for basic and applied aspects of the genetic improvement of maize and sorghum. The genetic maps of maize and sorghum were improved through comparative mapping of RFLP loci detected by 124 maize cDNA clones and through the development of a new mapping population of maize. Comparative mapping between maize and sorghum and maize and rice, using the set of 124 maize cDNA clones (and other clones) in each study, substantiated previous observations of extensive conservation of locus order but it also provided strong evidence of numerous large-scale chromosomal rearrangements. The new mapping population for maize (intermated B73xMo17, 'IBM') was created by random intermating during the first segregating generation. Intermating for four generations prior to the derivation of recombinant inbred lines (RILs) increased the frequency of recombinants at many regions of the maize genome and provided better genetic resolution of locus order. Expansion of the maize genetic map was not uniform along the length of a linkage group and was less than the theoretical expectation. The 350 IBM RILs were genotyped at 512 loci detected by DNA clones, including 76 of the 124 supported by this contract. The production of the sorghum mapping population of RILs from the cross CK60xPI229828 has been delayed by weather conditions that were not conducive to plant growth and seed development. Seed of the IBM RILs have been distributed (approximately 5000 RILs in total) to 16 research organizations in the public and private sector. The DNA clones have been distributed (1,206 in total) to nine research labs. Further distribution of the seed and clones will be managed by curators at stock centers in the public domain. (author)
QTL mapping of resistance to gray leaf spot in maize.
Zhang, Yan; Xu, Ling; Fan, Xingming; Tan, Jing; Chen, Wei; Xu, Mingliang
2012-12-01
Gray leaf spot (GLS), caused by the causal fungal pathogen Cercospora zeae-maydis, is one of the most serious foliar diseases of maize worldwide. In the current study, a highly resistant inbred line Y32 and a susceptible line Q11 were used to produce segregating populations for both genetic analysis and QTL mapping. The broad-sense heritability (H (2)) for GLS resistance was estimated to be as high as 0.85, indicating that genetic factors played key roles in phenotypic variation. In initial QTL analysis, four QTL, located on chromosomes 1, 2, 5, and 8, were detected to confer GLS resistance. Each QTL could explain 2.53-23.90 % of the total phenotypic variation, predominantly due to additive genetic effects. Two major QTL, qRgls1 and qRgls2 on chromosomes 8 and 5, were consistently detected across different locations and replicates. Compared to the previous results, qRgls2 is located in a 'hotspot' for GLS resistance; while, qRgls1 does not overlap with any other known resistance QTL. Furthermore, the major QTL-qRgls1 was fine-mapped into an interval of 1.4 Mb, flanked by the markers GZ204 and IDP5. The QTL-qRgls1 could enhance the resistance percentages by 19.70-61.28 %, suggesting its usefulness to improve maize resistance to GLS.
The two chromosomes of Vibrio cholerae are initiated at different time points in the cell cycle
DEFF Research Database (Denmark)
Rasmussen, Tue; Jensen, Rasmus Bugge; Skovgaard, Ole
2007-01-01
for analysing flow cytometry data and marker frequency analysis, we show that the small chromosome II is replicated late in the C period of the cell cycle, where most of chromosome I has been replicated. Owing to the delay in initiation of chromosome II, the two chromosomes terminate replication...... at approximately the same time and the average number of replication origins per cell is higher for chromosome I than for chromosome II. Analysis of cell-cycle parameters shows that chromosome replication and segregation is exceptionally fast in V. cholerae. The divided genome and delayed replication of chromosome...... II may reduce the metabolic burden and complexity of chromosome replication by postponing DNA synthesis to the last part of the cell cycle and reducing the need for overlapping replication cycles during rapid proliferation...
Liu, Yan; Zhang, Zhiqiang; Fu, Junjie; Wang, Guoying; Wang, Jianhua; Liu, Yunjun
2017-01-01
Maize Agrobacterium-mediated transformation efficiency has been greatly improved in recent years. Antioxidants, such as, cysteine, can significantly improve maize transformation frequency through improving the Agrobacterium infection efficiency. However, the mechanism underlying the transformation improvement after cysteine exposure has not been elucidated. In this study, we showed that the addition of cysteine to the co-cultivation medium significantly increased the Agrobacterium infection efficiency of hybrid HiII and inbred line Z31 maize embryos. Reactive oxygen species contents were higher in embryos treated with cysteine than that without cysteine. We further investigated the mechanism behind cysteine-related infection efficiency increase using transcriptome analysis. The results showed that the cysteine treatment up-regulated 939 genes and down-regulated 549 genes in both Z31 and HiII. Additionally, more differentially expressed genes were found in HiII embryos than those in Z31 embryos, suggesting that HiII was more sensitive to the cysteine treatment than Z31. GO analysis showed that the up-regulated genes were mainly involved in the oxidation reduction process. The up-regulation of these genes could help maize embryos to cope with the oxidative stress stimulated by Agrobacterium infection. The down-regulated genes were mainly involved in the cell wall and membrane metabolism, such as, aquaporin and expansin genes. Decreased expression of these cell wall integrity genes could loosen the cell wall, thereby improving the entry of Agrobacterium into plant cells. This study offers insight into the role of cysteine in improving Agrobacterium-mediated transformation of maize immature embryos. PMID:29089955
Resistance of maize varieties to the maize weevil Sitophilus zeamais
African Journals Online (AJOL)
This study aimed at evaluating commonly used maize varieties, collected from Melkasa and Bako Agricultural Research Centers and Haramaya University, Ethiopia, against the maize weevil Sitophilus zeamais Motsch., one of the most important cosmopolitan stored product pests in maize. A total of 13 improved maize ...
Pathways out of poverty through cassava, maize and soybean in Thailand
Nareenat, Roonnaphai
2006-01-01
This phase II covers the case study survey and interviews with farmers growing cassava, soybean and maize in the major producing areas, namely cassava farmers in Nakhonratchasima, soybean farmers in Sukhotai and maize farmers in Nakhonsawan, with the major objectives of studying the returns of diverse farming involving three CGPRT and other crops. Opportunities and constraints for the farm families are analysed together with the related industries and marketing systems in the survey areas. Fu...
Intercropping Maize With Legumes for Sustainable Highland Maize Production
Directory of Open Access Journals (Sweden)
Adirek Punyalue
2018-02-01
Full Text Available Residue burning to prepare soil for maize growing deprives the soil of both protective cover and organic matter, and it exacerbates environmental issues such as Southeast Asia's haze problem. This paper reports on a study that evaluated the effectiveness of maize/legume intercropping as an alternative to maize cultivation with residue burning. Cowpea (Vigna unguiculata, mung bean (V. radiata, rice bean (V. umbellata, and lablab (Lablab purpureus were sown into a standing maize crop 30 days before harvest, and the results were compared with a maize crop grown using residue burning as the method for land preparation at Pang Da Agricultural Station in Chiang Mai, Thailand, in a replicated trial conducted over 3 growing seasons from 2012 to 2014. Intercropping increased maize grain yield by 31–53% and left 70–170% more residue containing 113–230% more nitrogen than the maize sown after residue burning, depending on the legume, and decreased weed dry weight by two-thirds after 2 seasons. Soil biodiversity was enriched by the intercrops, with a doubling in the spore density of arbuscular mycorrhizal fungi in the root-zone soil and increased abundance, diversity (Shannon index, and richness of the soil macrofauna. The abundance of soil animals increased with crop residue dry weight (r = 0.90, P < 0.05 and nitrogen content (r = 0.98, P < 0.01. The effect of intercropping on maize grain yield and accumulation of residue and nitrogen were then confirmed in a participatory experiment involving farmers in 2 highland villages in the Phrao and Chiang Dao districts of Chiang Mai Province with maize and rice bean in 2015. The effects of maize/legume intercropping—increased nitrogen accumulation and crop residue, enhanced soil biodiversity, suppression of weeds, and protection of the soil surface, which enabled the maize to be sown without land clearing with fire—should all contribute to sustainable highland maize production.
Genetic Diversity and Molecular Evolution of a Violaxanthin De-epoxidase Gene in Maize.
Xu, Jing; Li, Zhigang; Yang, Haorui; Yang, Xiaohong; Chen, Cuixia; Li, Hui
2016-01-01
Violaxanthin de-epoxidase (VDE) has a critical role in the carotenoid biosynthesis pathway, which is involved in protecting the photosynthesis apparatus from damage caused by excessive light. Here, a VDE gene in maize, ZmVDE1, was cloned and shown to have functional domains in common with the gramineous VDE protein. Candidate gene association analysis indicated that no polymorphic sites in ZmVDE1 were significant association with any of the examined carotenoid-related traits at P = 0.05 in an association panel containing 155 maize inbred lines. Nucleotide diversity analysis of VDE1 in maize and teosinte indicated that its exon had less genetic variation, consistent with the conserved function of VDE1 in plants. In addition, dramatically reduced nucleotide diversity, fewer haplotypes and a significantly negative parameter deviation for Tajima's D test of ZmVDE1 in maize and teosinte suggested that a potential selective force had acted across the ZmVDE1 locus. We further identified a 4.2 Mb selective sweep with low recombination surrounding the ZmVDE1 locus that resulted in severely reduced nucleotide diversity on chromosome 2. Collectively, natural selection and the conserved domains of ZmVDE1 might show an important role in the xanthophyll cycle of the carotenoid biosynthesis pathway.
Genetic Diversity and Molecular Evolution of a Violaxanthin De-Epoxidase Gene in Maize
Directory of Open Access Journals (Sweden)
Jing Xu
2016-07-01
Full Text Available Violaxanthin de-epoxidase (VDE has a critical role in the carotenoid biosynthesis pathway, which is involved in protecting the photosynthesis apparatus from damage caused by excessive light. Here, a VDE gene in maize, ZmVDE1, was cloned and shown to have functional domains in common with the gramineous VDE protein. Candidate gene association analysis indicated that no polymorphic sites in ZmVDE1 were significant association with any of the examined carotenoid-related traits at P = 0.05 in an association panel containing 155 maize inbred lines. Nucleotide diversity analysis of VDE1 in maize and teosinte indicated that its exon had less genetic variation, consistent with the conserved function of VDE1 in plants. In addition, dramatically reduced nucleotide diversity, fewer haplotypes and a significantly negative parameter deviation for Tajima’s D test of ZmVDE1 in maize and teosinte suggested that a potential selective force had acted across the ZmVDE1 locus. We further identified a 4.2 Mb selective sweep with low recombination surrounding the ZmVDE1 locus that resulted in severely reduced nucleotide diversity on chromosome 2. Collectively, natural selection and the conserved domains of ZmVDE1 might show an important role in the xanthophyll cycle of the carotenoid biosynthesis pathway.
Breeding of maize types with specific traits at the Maize Research Institute, Zemun Polje
Directory of Open Access Journals (Sweden)
Pajić Zorica
2007-01-01
Full Text Available Maize is primarily grown as an energy crop, but the use of different specific versions, such as high-oil maize, high-lysine maize, waxy maize, white-seeded maize, popping maize and sweet maize, is quite extensive. Speciality maize, due to its traits and genetic control of these traits, requires a particular attention in handling breeding material during the processes of breeding. It is especially related to prevention of uncontrolled pollination. In order to provide successful selection for a certain trait, the following specific procedures in evaluation of the trait are necessary: the estimation of a popping volume and flake quality in popping maize; the determination of sugars and harvest maturity in sweet maize; the determination of oil in selected samples of high-oil maize types, and so forth. Breeding programmes for speciality maize, except high-amylose maize, have been implemented at the Maize Research Institute, Zemun Polje, Belgrade, for the last 45 years. A great number of high-yielding sweet maize hybrids, popping maize, high-oil and high-lysine, flint and white-seeded maize hybrids were developed during this 45-year period. Auspicious selection and breeding for these traits is facilitated by the abundant genetic variability and technical and technological possibilities necessary for successful selection.
Wang, Chao; Shi, Xue; Liu, Lin; Li, Haiyan; Ammiraju, Jetty S S; Kudrna, David A; Xiong, Wentao; Wang, Hao; Dai, Zhaozhao; Zheng, Yonglian; Lai, Jinsheng; Jin, Weiwei; Messing, Joachim; Bennetzen, Jeffrey L; Wing, Rod A; Luo, Meizhong
2013-11-01
Maize is one of the most important food crops and a key model for genetics and developmental biology. A genetically anchored and high-quality draft genome sequence of maize inbred B73 has been obtained to serve as a reference sequence. To facilitate evolutionary studies in maize and its close relatives, much like the Oryza Map Alignment Project (OMAP) (www.OMAP.org) bacterial artificial chromosome (BAC) resource did for the rice community, we constructed BAC libraries for maize inbred lines Zheng58, Chang7-2, and Mo17 and maize wild relatives Zea mays ssp. parviglumis and Tripsacum dactyloides. Furthermore, to extend functional genomic studies to maize and sorghum, we also constructed binary BAC (BIBAC) libraries for the maize inbred B73 and the sorghum landrace Nengsi-1. The BAC/BIBAC vectors facilitate transfer of large intact DNA inserts from BAC clones to the BIBAC vector and functional complementation of large DNA fragments. These seven Zea Map Alignment Project (ZMAP) BAC/BIBAC libraries have average insert sizes ranging from 92 to 148 kb, organellar DNA from 0.17 to 2.3%, empty vector rates between 0.35 and 5.56%, and genome equivalents of 4.7- to 8.4-fold. The usefulness of the Parviglumis and Tripsacum BAC libraries was demonstrated by mapping clones to the reference genome. Novel genes and alleles present in these ZMAP libraries can now be used for functional complementation studies and positional or homology-based cloning of genes for translational genomics.
Searching for RFLP markers to identify genes for aluminum tolerance in maize
International Nuclear Information System (INIS)
Paiva, E.; Lopes, M.A.; Parentoni, S.N.; Martins, P.R.; Torres, G.A.
1998-01-01
The objective of this study was to identify restriction fragment length polymorphism (RFLP) markers linked to Quantitative Trait Loci (QTL) that control aluminum (Al) tolerance in maize. The strategy used was bulked segregant analysis (BSA) and the genetic materials utilized were the F 2 , F 3 and F 4 populations derived from a cross between the Al-susceptible inbred line L53 and Al-tolerant inbred line L1327. The populations were evaluated in a nutrient solution containing a toxic concentration of Al (6 ppm) and relative seminal root length (RSRL) was used as a phenotypic measure of tolerance. Seedlings of the F 2 population with the highest and lowest RSRL values were transplanted to the field and subsequently selfed to obtain F 3 and F 4 families. The efficiency of the phenotypic index for selection was found to be greater when mean values were used instead of individual RSRL values. F 3 and F 4 families were then evaluated in nutrient solution to identify those that were not segregating. One hundred and thirteen probes, with an average interval of 30 cM, covering the 10 maize chromosomes were tested for their ability to discriminate the parental lines. Fifty four of these probes were polymorphic with 46 showing codominance. These probes were hybridized with DNA from two F 3 contrasting, bulks and three probes on chromosome 8 were found to be able distinguish the F 3 contrasting bulks on the basis of band position and intensity. DNA of families from the F 3 bulks hybridized with these probes showed the presence of heterozygous individuals. These three selected probes were also hybridized with DNA from F 2 individuals. Two of them showed a significant regression coefficient with the character. However, each of these probes explained only about 10% of the phenotypic variance observed in 70 F 2 individuals. One of the probes UMC 103 was hybridized with DNA from 168 F 4 families and the regression analysis of RFLP data showed a significant regression coefficient
Bohn, Martin O; Marroquin, Juan J; Flint-Garcia, Sherry; Dashiell, Kenton; Willmot, David B; Hibbard, Bruce E
2018-02-09
Over the last 70 yr, more than 12,000 maize accessions have been screened for their level of resistance to western corn rootworm, Diabrotica virgifera virgifera (LeConte; Coleoptera: Chrysomelidae), larval feeding. Less than 1% of this germplasm was selected for initiating recurrent selection or other breeding programs. Selected genotypes were mostly characterized by large root systems and superior root regrowth after root damage caused by western corn rootworm larvae. However, no hybrids claiming native (i.e., host plant) resistance to western corn rootworm larval feeding are currently commercially available. We investigated the genetic basis of western corn rootworm resistance in maize materials with improved levels of resistance using linkage disequilibrium mapping approaches. Two populations of topcrossed doubled haploid maize lines (DHLs) derived from crosses between resistant and susceptible maize lines were evaluated for their level of resistance in three to four different environments. For each DHL topcross an average root damage score was estimated and used for quantitative trait loci (QTL) analysis. We found genomic regions contributing to western corn rootworm resistance on all maize chromosomes, except for chromosome 4. Models fitting all QTL simultaneously explained about 30 to 50% of the genotypic variance for root damage scores in both mapping populations. Our findings confirm the complex genetic structure of host plant resistance against western corn rootworm larval feeding in maize. Interestingly, three of these QTL regions also carry genes involved in ascorbate biosynthesis, a key compound we hypothesize is involved in the expression of western corn rootworm resistance. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Nahampun, Hartinio N; López-Arredondo, Damar; Xu, Xing; Herrera-Estrella, Luis; Wang, Kan
2016-05-01
Bacterial phosphite oxidoreductase gene and chemical phosphite can be used as a selection system for Agrobacterium -mediated maize transformation. Application of phosphite (Phi) on plants can interfere the plant metabolic system leading to stunted growth and lethality. On the other hand, ectopic expression of the ptxD gene in tobacco and Arabidopsis allowed plants to grow in media with Phi as the sole phosphorous source. The phosphite oxidoreductase (PTXD) enzyme catalyzes the conversion of Phi into phosphate (Pi) that can then be metabolized by plants and utilized as their essential phosphorous source. Here we assess an alternative selectable marker based on a bacterial ptxD gene for Agrobacterium-mediated maize transformation. We compared the transformation frequencies of maize using either the ptxD/Phi selection system or a standard herbicide bar/bialaphos selection system. Two maize genotypes, a transformation amenable hybrid Hi II and an inbred B104, were tested. Transgene presence, insertion copy numbers, and ptxD transcript levels were analyzed and compared. This work demonstrates that the ptxD/Phi selection system can be used for Agrobacterium-mediated maize transformation of both type I and type II callus culture and achieve a comparable frequency as that of the herbicide bar/bialaphos selection system.
Jue, Dengwei; Sang, Xuelian; Lu, Shengqiao; Dong, Chen; Zhao, Qiufang; Chen, Hongliang; Jia, Liqiang
2015-01-01
Background Ubiquitination is a post-translation modification where ubiquitin is attached to a substrate. Ubiquitin-conjugating enzymes (E2s) play a major role in the ubiquitin transfer pathway, as well as a variety of functions in plant biological processes. To date, no genome-wide characterization of this gene family has been conducted in maize (Zea mays). Methodology/Principal Findings In the present study, a total of 75 putative ZmUBC genes have been identified and located in the maize genome. Phylogenetic analysis revealed that ZmUBC proteins could be divided into 15 subfamilies, which include 13 ubiquitin-conjugating enzymes (ZmE2s) and two independent ubiquitin-conjugating enzyme variant (UEV) groups. The predicted ZmUBC genes were distributed across 10 chromosomes at different densities. In addition, analysis of exon-intron junctions and sequence motifs in each candidate gene has revealed high levels of conservation within and between phylogenetic groups. Tissue expression analysis indicated that most ZmUBC genes were expressed in at least one of the tissues, indicating that these are involved in various physiological and developmental processes in maize. Moreover, expression profile analyses of ZmUBC genes under different stress treatments (4°C, 20% PEG6000, and 200 mM NaCl) and various expression patterns indicated that these may play crucial roles in the response of plants to stress. Conclusions Genome-wide identification, chromosome organization, gene structure, evolutionary and expression analyses of ZmUBC genes have facilitated in the characterization of this gene family, as well as determined its potential involvement in growth, development, and stress responses. This study provides valuable information for better understanding the classification and putative functions of the UBC-encoding genes of maize. PMID:26606743
Zhang, Xinye; Yang, Qin; Rucker, Elizabeth; Thomason, Wade; Balint-Kurti, Peter
2017-06-01
In this study we mapped the QTL Qgls8 for gray leaf spot (GLS) resistance in maize to a ~130 kb region on chromosome 8 including five predicted genes. In previous work, using near isogenic line (NIL) populations in which segments of the teosinte (Zea mays ssp. parviglumis) genome had been introgressed into the background of the maize line B73, we had identified a QTL on chromosome 8, here called Qgls8, for gray leaf spot (GLS) resistance. We identified alternate teosinte alleles at this QTL, one conferring increased GLS resistance and one increased susceptibility relative to the B73 allele. Using segregating populations derived from NIL parents carrying these contrasting alleles, we were able to delimit the QTL region to a ~130 kb (based on the B73 genome) which encompassed five predicted genes.
Breeding of maize types with specific traits at the Maize Research Institute, Zemun Polje
Pajić Zorica
2007-01-01
Maize is primarily grown as an energy crop, but the use of different specific versions, such as high-oil maize, high-lysine maize, waxy maize, white-seeded maize, popping maize and sweet maize, is quite extensive. Speciality maize, due to its traits and genetic control of these traits, requires a particular attention in handling breeding material during the processes of breeding. It is especially related to prevention of uncontrolled pollination. In order to provide successful selection for a...
[Literature review of the dispersal of transgenes from genetically modified maize].
Ricroch, Agnès; Bergé, Jean Baptiste; Messéan, Antoine
2009-10-01
This article aims at reviewing the theoretical and experimental data published in 562 publications referring to genetically modified (GM) maize dispersal. Our choice was limited to this since in the European Union (EU), GM maize is the only GM crop currently grown commercially. The pollen dispersal of transgenic maize is due to two factors: (i) pollen-mediated gene flow; (ii) seed admixture during harvest and post-harvest processes. The pollen dispersal decreases rapidly with the distance from GM plots. Climatic and topographic factors and factors of relative density between GM and non-GM maize plots impact on the pollen dispersal. The combination of both isolation distance and flowering date between source plots and sink plots limits the adventitious presence of transgenes in non-GM plots. All publications we reviewed demonstrate that the EU 0.9% threshold is technically manageable if the measures of isolation distances as well as harvesting and post harvesting processes and fully synchronous flowering are implemented.
Sakcali, M Serdal; Kekec, Guzin; Uzonur, Irem; Alpsoy, Lokman; Tombuloglu, Huseyin
2015-08-01
This study was carried out to investigate the genotoxic effect of boron (B) on maize using randomly amplified polymorphic DNA (RAPD) method. Experimental design was conducted under 0, 5, 10, 25, 50, 100, 125, and 150 ppm B exposures, and physiological changes have revealed a sharp decrease in root growth rates from 28% to 85%, starting from 25 ppm to 150 ppm, respectively. RAPD-polymerase chain reaction (PCR) analysis shows that DNA alterations are clearly observed from beginning to 100 ppm. B-induced inhibition in root growth had a positive correlation with DNA alterations. Total soluble protein, root and stem lengths, and B content analysis in root and leaves encourage these results as a consequence. These preliminary findings reveal that B causes chromosomal aberration and genotoxic effects on maize. Meanwhile, usage of RAPD-PCR technique is a suitable biomarker to detect genotoxic effect of B on maize and other crops for the future. © The Author(s) 2013.
Wei, Kai-Fa; Chen, Juan; Chen, Yan-Feng; Wu, Ling-Juan; Xie, Dao-Xin
2012-04-01
The WRKY transcription factors function in plant growth and development, and response to the biotic and abiotic stresses. Although many studies have focused on the functional identification of the WRKY transcription factors, much less is known about molecular phylogenetic and global expression analysis of the complete WRKY family in maize. In this study, we identified 136 WRKY proteins coded by 119 genes in the B73 inbred line from the complete genome and named them in an orderly manner. Then, a comprehensive phylogenetic analysis of five species was performed to explore the origin and evolutionary patterns of these WRKY genes, and the result showed that gene duplication is the major driving force for the origin of new groups and subgroups and functional divergence during evolution. Chromosomal location analysis of maize WRKY genes indicated that 20 gene clusters are distributed unevenly in the genome. Microarray-based expression analysis has revealed that 131 WRKY transcripts encoded by 116 genes may participate in the regulation of maize growth and development. Among them, 102 transcripts are stably expressed with a coefficient of variation (CV) value of WRKY genes with the CV value of >15% are further analysed to discover new organ- or tissue-specific genes. In addition, microarray analyses of transcriptional responses to drought stress and fungal infection showed that maize WRKY proteins are involved in stress responses. All these results contribute to a deep probing into the roles of WRKY transcription factors in maize growth and development and stress tolerance.
Decomposition and fertilizing effects of maize stover and chromolaena odorata on maize yield
International Nuclear Information System (INIS)
Tetteh, F.M.; Safo, E.Y.; Quansah, C.
2008-01-01
The quality, rates of decomposition and the fertilizing effect of chromolaena odorata, and maize stover were determined in field experiments as surface application or buried in litter bags. Studies on the effect of plant materials of contrasting qualities (maize stover and C. odorata) applied sole (10 Mg ha -1 ) and mixed, on maize grain and biomass yield were also conducted on the Asuansi (Ferric Acrisol) soil series. Total nitrogen content of the residues ranged from 0.85% in maize stover to 3.50% in C. odorata. Organic carbon ranged from 34.90% in C. odorata to 48.50% in maize stover. Phosphorus ranged from 0.10% in maize stover to 0.76% in C. odorata. In the wet season, the decomposition rate constants (k) were 0.0319 day -1 for C. odorata, and 0.0081 for maize stover. In the dry season, the k values were 0.0083 for C. odorata, and 0.0072 day -1 for maize stover. Burying of the plant materials reduced the half-life (t 50 ) periods from 18 to 10 days for C. odorata, and 45 to 20 days for maize stover. Maize grain yield of 2556 kg ha -1 was obtained in sole C. odorata (10 Mg ha -1 ) compared with 2167 kg ha -1 for maize stover. Mixing of maize stover and C. odorata residues improved the nutrient content as well as nutrient release by the mixtures resulting in greater maize grain yields in the mixtures than the sole maize stover treatment. It is recommended that C. odorata be used as green manure, mulching or composting material to improve fertility. (au)
Comparative Cytotoxicity of the Herbicide Atrazine to Four Inbred Maize Lines (Zea mays L.)
International Nuclear Information System (INIS)
Shehata, Afaf I; AlGhethar, Haila A; AlHomaidan, Ali A; Arif, Ibrahim A
2008-01-01
Atrazine is one of the most widely used herbicides in the world. Recent reports have indicated that it has adverse impacts on the endocrine systems and on the early developments of wild animals and it has been banned in many European countries including Switzerland, the home of the manufacturing company. The genotoxic effects of Atrazine on four inbred lines of maize (Zea mays L.) were investigated. The herbicide showed mitoinhibition and clastogenic effects on the mitotic index of maize lines and they were proportional to the concentrations and time. The frequency of abnormality, chromosomal breakage, stickiness, lagging, C-metaphase and C-anaphase were observed at different stages of mitosis in treated cells. The harmful effect of this environmental pollutant proved that it may act as a strong mutagen. (author)
Directory of Open Access Journals (Sweden)
Yifan Wang
2018-04-01
Full Text Available In wheat-maize intercropping systems, the maize is often disadvantageous over the wheat during the co-growth period. It is unknown whether the impaired growth of maize can be recovered through the enhancement of the belowground interspecies interactions. In this study, we (i determined the mechanism of the belowground interaction in relation to root growth and distribution under different maize plant densities, and (ii quantified the “recovery effect” of maize after wheat harvest. The three-year (2014–2016 field experiment was conducted at the Oasis Agriculture Research Station of Gansu Agricultural University, Wuwei, Northwest China. Root weight density (RWD, root length density (RLD, and root surface area density (RSAD, were measured in single-cropped maize (M, single-cropped wheat (W, and three intercropping systems (i wheat-maize intercropping with no root barrier (i.e., complete belowground interaction, IC, (ii nylon mesh root barrier (partial belowground interaction, IC-PRI, and (iii plastic sheet root barrier (no belowground interaction, IC-NRI. The intercropped maize was planted at low (45,000 plants ha−1 and high (52,000 plants ha−1 densities. During the wheat/maize co-growth period, the IC treatment increased the RWD, RLD, and RSAD of the intercropped wheat in the 20–100 cm soil depth compared to the IC-PRI and IC-NRI systems; intercropped maize had 53% lower RWD, 81% lower RLD, and 70% lower RSAD than single-cropped maize. After wheat harvest, the intercropped maize recovered the growth with the increase of RWD by 40%, RLD by 44% and RSAD by 11%, compared to the single-cropped maize. Comparisons among the three intercropping systems revealed that the “recovery effect” of the intercropped maize was attributable to complete belowground interspecies interaction by 143%, the compensational effect due to root overlap by 35%, and the compensational effect due to water and nutrient exchange (CWN by 80%. The higher maize plant
Advances in Maize Transformation Technologies and Development of Transgenic Maize.
Yadava, Pranjal; Abhishek, Alok; Singh, Reeva; Singh, Ishwar; Kaul, Tanushri; Pattanayak, Arunava; Agrawal, Pawan K
2016-01-01
Maize is the principal grain crop of the world. It is also the crop where genetic engineering has been employed to a great extent to improve its various traits. The ability to transform maize is a crucial step for application of gene technology in maize improvement. There have been constant improvements in the maize transformation technologies over past several years. The choice of genotype and the explant material to initiate transformation and the different types of media to be used in various stages of tissue culture can have significant impact on the outcomes of the transformation efforts. Various methods of gene transfer, like the particle bombardment, protoplast transformation, Agrobacterium -mediated, in planta transformation, etc., have been tried and improved over years. Similarly, various selection systems for retrieval of the transformants have been attempted. The commercial success of maize transformation and transgenic development is unmatched by any other crop so far. Maize transformation with newer gene editing technologies is opening up a fresh dimension in transformation protocols and work-flows. This review captures the various past and recent facets in improvement in maize transformation technologies and attempts to present a comprehensive updated picture of the current state of the art in this area.
Utilization of maize (Zea mays) cob as an adsorbent for lead (II ...
African Journals Online (AJOL)
STORAGESEVER
2009-04-20
Apr 20, 2009 ... heavy metal of great environmental concern and poses threat to .... groups responsible for interaction with metal ions (Dakiky et al., 2002). ... negatively charged. ... was greatly enhanced by shaking except maize cob at 60.
YIELDING AND CONTENT OF SELECTED MICROELEMENTS IN MAIZE FERTILIZED WITH VARIOUS ORGANIC MATERIALS
Directory of Open Access Journals (Sweden)
Jerzy Wieczorek
2017-07-01
On the basis of conducted research it was found that various fertilizer combinations applied in the experiment had a significant influence on the test plant yielding. All compared fertilizer variants allowed maize to produce statistically significantly higher yield in comparison with the yield harvested from the unfertilized soils. Fertilization with sewage sludge I supplemented with mineral treatment and application of solely mineral salts proved the most beneficial for the maize yield. Applied fertilizer combinations affected the content of microelements. The highest concentrations of nickel in maize green mass were assessed in plant samples from the unfertilized object, whereas zinc and copper from mineral fertilization variant. Except of zinc, introducing additional metal doses did not influence their increased content in plant organs. Soil enrichment with zinc contained in sewage sludge I and II (respectively 77.4 mg and 49.9 mg ∙ pot-1 contributed to its elevated concentration in maize roots but at the same time this metal content statistically significantly decreased in maize shoots in comparison with the amounts determined in plants fertilized with mineral materials.
MaizeGDB: The Maize Genetics and Genomics Database.
Harper, Lisa; Gardiner, Jack; Andorf, Carson; Lawrence, Carolyn J
2016-01-01
MaizeGDB is the community database for biological information about the crop plant Zea mays. Genomic, genetic, sequence, gene product, functional characterization, literature reference, and person/organization contact information are among the datatypes stored at MaizeGDB. At the project's website ( http://www.maizegdb.org ) are custom interfaces enabling researchers to browse data and to seek out specific information matching explicit search criteria. In addition, pre-compiled reports are made available for particular types of data and bulletin boards are provided to facilitate communication and coordination among members of the community of maize geneticists.
Chromosome segregation in plant meiosis
Directory of Open Access Journals (Sweden)
Linda eZamariola
2014-06-01
Full Text Available Faithful chromosome segregation in meiosis is essential for ploidy stability over sexual life cycles. In plants, defective chromosome segregation caused by gene mutations or other factors leads to the formation of unbalanced or unreduced gametes creating aneuploid or polyploid progeny, respectively. Accurate segregation requires the coordinated execution of conserved processes occurring throughout the two meiotic cell divisions. Synapsis and recombination ensure the establishment of chiasmata that hold homologous chromosomes together allowing their correct segregation in the first meiotic division, which is also tightly regulated by cell-cycle dependent release of cohesin and monopolar attachment of sister kinetochores to microtubules. In meiosis II, bi-orientation of sister kinetochores and proper spindle orientation correctly segregate chromosomes in four haploid cells. Checkpoint mechanisms acting at kinetochores control the accuracy of kinetochore-microtubule attachment, thus ensuring the completion of segregation. Here we review the current knowledge on the processes taking place during chromosome segregation in plant meiosis, focusing on the characterization of the molecular factors involved.
Barriere, Y.; Alber, D.; Dolstra, O.; Lapierre, C.; Motto, M.; Ordas, A.; Waes, Van J.; Vlasminkel, L.; Welcker, C.; Monod, J.P.
2006-01-01
Although maize was early recognized as an excellent forage plant soon after its introduction in Europe, during a long time it was only bred for grain traits. However, the first recommendations of maize varieties for specific forage use are probably those given in the French VILMORIN-ANDRIEUX
Maize kernel evolution:From teosinte to maize
Maize is the most productive and highest value commodity in the US and around the world: over 1 billion tons were produced each year in 2013 and 2014. Together, maize, rice and wheat comprise over 60% of the world’s caloric intake, with wide regional variability in the importance of each crop. The i...
Maize is a remarkably diverse species, adapted to a wide range of climatic conditions and farming practices. The latitudinal range of maize is immense, ranging from 54°N in Alberta, Canada, to 45°S in the province of Chubut, Argentina. In terms of altitude, maize is cultivated from sea level to 4000...
Directory of Open Access Journals (Sweden)
Rose A. Monteiro
2008-12-01
Full Text Available The bacterium Herbaspirillum seropedicae is an endophytic diazotroph found in several plants, including economically important poaceous species. However, the mechanisms involved in the interaction between H. seropedicae and these plants are not completely characterized. We investigated the attachment of Herbaspirillum to maize roots and the invasion of the roots by this bacterium using H. seropedicae strain SMR1 transformed with the suicide plasmid pUTKandsRed, which carries a mini-Tn5 transposon containing the gene for the Discosoma red fluorescent protein (Dsred constitutively expressed together with the kanamycin resistance gene. Integration of the mini-Tn5 into the bacterial chromosome yielded the mutant H. seropedicae strain RAM4 which was capable of expressing Dsred and could be observed on and inside fresh maize root samples. Confocal microscopy of maize roots inoculated with H. seropedicae three days after germination showed that H. seropedicae cell were attached to the root surface 30 min after inoculation, were visible in the internal tissues after twenty-four hours and in the endodermis, the central cylinder and xylem after three days.
Directory of Open Access Journals (Sweden)
T Cremer
2009-06-01
Full Text Available It is now generally accepted that chromosomes in the cell nucleus are organized in distinct domains, first called chromosome territories in 1909 by the great cytologist Theodor Boveri. Yet, even today chromosomes have remained enigmatic individuals, whose structures, arrangements and functions in cycling and post-mitotic cells still need to be explored in full detail. Whereas numerous recent reviews describe present evidence for a dynamic architecture of chromosome territories and discuss the potential significance within the functional compartmentalization of the nucleus, a comprehensive historical account of this important concept of nuclear organization was lacking so far. Here, we describe the early rise of chromosome territories within the context of the discovery of chromosomes and their fundamental role in heredity, covering a period from the 1870th to the early 20th century (part I, this volume. In part II (next volume we review the abandonment of the chromosome territory concept during the 1950th to 1980th and the compelling evidence, which led to its resurrection during the 1970th to 1980th.
Vervuert, I; Brüssow, N; Bochnia, M; Cuddeford, D; Coenen, M
2013-06-01
The aims of this study were to monitor electromyographic (EMG) activity of masseter muscle in healthy horses fed (i) different types of roughage and (ii) maize after different hay allocations. Four horses were offered the following three diets ad libitum: hay, haylage or straw/alfalfa chaff (SAC). In a second trial, four horses were fed cracked maize (CM) and hay in three different orders: (i) CM after a 12-h overnight fast; (ii) CM immediately after restricted hay intake (0.6 kg hay/100 kg BW); or 3) CM after hay intake ad libitum. The activity of the masseter muscle was determined by EMG (IED(®) ), and the following were measured: amplitude (muscle action potential = MAP, maximum voltage) and duration of MAP (s). The intake of hay or haylage was associated with intense masseter muscle activity (MAP: hay, 10 ± 1.7 V; haylage, 11 ± 3.3 V; and duration of MAP: hay, 0.31 ± 0.04 s; haylage, 0.30 ± 0.04 s). Similar intense chewing was measured for SAC (MAP 13 ± 3.8 V), although duration of the chewing cycle was relatively short (0.22 ± 0.03 s, diet p haylage or SAC was associated with intensive masseter muscle activity that was likely to stimulate salivary flow rate. In contrast to roughage, concentrates like CM are consumed rapidly with less intensive masseter muscle activity. This situation is associated with a low salivary flow that may have an adverse effect on gastric function. © 2012 Blackwell Verlag GmbH.
Effects of phosphorus and sulphur on dry matter yield of maize ( Zea ...
African Journals Online (AJOL)
A screen-house experiment was conducted to investigate the effects of phosphorus (P) and sulphur (S) on maize dry-matter yield (MDY) in soils of five locations (Obantoko I, II, Alabata I, II, and III) in Abeokuta, Ogun State of Nigeria. Three levels of sulphur (0, 10 and 20 kg S ha–1) and phosphorus (0, 30 and 45 kg P ha–1) ...
In previous work, using near isogenic line (NIL) populations in which segments of the tesosinte (Zea mays ssp. parviglumis) genome had been introgressed into the background of the maize line B73, we had identified a QTL on chromosome 8, here called Qgls8, for gray leaf spot resistance. We identified...
Y-chromosome STR haplotypes in Somalis
DEFF Research Database (Denmark)
Hallenberg, Charlotte; Simonsen, Bo; Sanchez Sanchez, Juan Jose
2005-01-01
A total of 201 males from Somalia were typed for the Y-chromosome STRs DYS19, DYS385a/b, DYS389-I, DYS389-II, DYS390, DYS391, DYS392, DYS393, DYS437, DYS438 and DYS439 with the PowerPlex Y kit (Promega). A total of 96 different haplotypes were observed and the haplotype diversity was 0.9715. The ......A total of 201 males from Somalia were typed for the Y-chromosome STRs DYS19, DYS385a/b, DYS389-I, DYS389-II, DYS390, DYS391, DYS392, DYS393, DYS437, DYS438 and DYS439 with the PowerPlex Y kit (Promega). A total of 96 different haplotypes were observed and the haplotype diversity was 0...
Field performance of maize (Zea mays L. cultivars under drought stress
Directory of Open Access Journals (Sweden)
Kazem GHASSEMI-GOLEZANI
2018-04-01
Full Text Available This research was carried out in 2014 at the Research Farm of the University of Tabriz, Iran. The experiment was arranged as split plot on the basis of randomized complete block with three replicates to assess the effects of four irrigation intervals (irrigations after 60, 80, 100 and 120 mm evaporation on physiological and agronomical traits of three cultivars of maize (Zea mays L.; ‘SC704’, ‘NS640’, ‘DC303’: late, mid and early maturing, respectively. Irrigation intervals and maize cultivars were assigned to the main and sub-plots, respectively. Leaf temperature of all maize cultivars significantly increased, but chlorophyll content index, maximum efficiency of photosystem II, number of grains per plant, 1000 grain mass, plant biomass, grain yield and harvest index significantly decreased with increasing irrigation intervals. Late maturing cultivar (‘SC704’ was superior in all studied traits, followed by mid (‘NS640’ and early (‘DC303’ maturing cultivars. It was concluded that water limitation can potentially reduce performance of maize cultivars in the field, but the extent of this reduction depends on genotype and severity of stress.
Species of Cercospora associated with grey leaf spot of maize
Crous, P.W.; Groenewald, J.Z.; Groenewald, M.; Caldwell, P.; Braun, U.; Harrington, T.C.
2006-01-01
Grey leaf spot is a serious yield-reducing disease of maize (Zea mays) in many parts of the world where this crop is cultivated. The causal organism associated with the disease is Cercospora zeae-maydis. Two potential sibling species have been recognized as Groups I and II. The DNA sequences for the
Species of Cercospora associated with grey leaf spot of maize.
Crous, P.W.; Groenewald, J.Z.; Groenewald, M.; Caldwell, P.; Braun, U.; Harrington, T.C.
2006-01-01
Grey leaf spot is a serious yield-reducing disease of maize (Zea mays) in many parts of the world where this crop is cultivated. The causal organism associated with the disease is Cercospora zeae-maydis. Two potential sibling species have been recognized as Groups I and II. The DNA sequences for the
Mittal, Shikha; Banduni, Pooja; Mallikarjuna, Mallana G.; Rao, Atmakuri R.; Jain, Prashant A.; Dash, Prasanta K.; Thirunavukkarasu, Nepolean
2018-05-01
Drought is one of the major threats to maize production. In order to improve the production and to breed tolerant hybrids, understanding the genes and regulatory mechanisms during drought stress is important. Transcription factors (TFs) play a major role in gene regulation and many TFs have been identified in response to drought stress. In our experiment, a set of 15 major TF families comprising 1436 genes was structurally and functionally characterized using in-silico tools and a gene expression assay. All 1436 genes were mapped on 10 chromosome of maize. The functional annotation indicated the involvement of these genes in ABA signaling, ROS scavenging, photosynthesis, stomatal regulation, and sucrose metabolism. Duplication was identified as the primary force in divergence and expansion of TF families. Phylogenetic relationship was developed individually for each TF family as well as combined TF families. Phylogenetic analysis grouped the TF family of genes into TF-specific and mixed groups. Phylogenetic analysis of genes belonging to various TF families suggested that the origin of TFs occurred in the lineage of maize evolution. Gene structure analysis revealed that more number of genes were intron-rich as compared to intronless genes. Drought-responsive CRE’s such as ABREA, ABREB, DRE1 and DRECRTCOREAT have been identified. Expression and interaction analyses identified leaf-specific bZIP TF, GRMZM2G140355, as a potential contributor toward drought tolerance in maize. We also analyzed protein-protein interaction network of 269 drought-responsive genes belonging to different drought-related TFs. The information generated on structural and functional characteristics, expression and interaction of the drought-related TF families will be useful to decipher the drought tolerance mechanisms and to derive drought-tolerant genotypes in maize.
Huang, D; Wu, W; Lu, L
2004-05-01
Amplification of resistance gene analogs (RGAs) is both a useful method for acquiring DNA markers closely linked to disease resistance (R) genes and a potential approach for the rapid cloning of R genes in plants. However, the screening of target sequences from among the numerous amplified RGAs can be very laborious. The amplification of RGAs from specific chromosomes could greatly reduce the number of RGAs to be screened and, consequently, speed up the identification of target RGAs. We have developed two methods for amplifying RGAs from single chromosomes. Method 1 uses products of Sau3A linker adaptor-mediated PCR (LAM-PCR) from a single chromosome as the templates for RGA amplification, while Method 2 directly uses a single chromosomal DNA molecule as the template. Using a pair of degenerate primers designed on the basis of the conserved nucleotide-binding-site motifs in many R genes, RGAs were successfully amplified from single chromosomes of pomelo using both these methods. Sequencing and cluster analysis of RGA clones obtained from single chromosomes revealed the number, type and organization of R-gene clusters on the chromosomes. We suggest that Method 1 is suitable for analyzing chromosomes that are unidentifiable under a microscope, while Method 2 is more appropriate when chromosomes can be clearly identified.
Directory of Open Access Journals (Sweden)
Jambrović Antun
2014-01-01
Full Text Available Here we describe the results of the detailed array-based genotyping obtained by using the Illumina MaizeSNP50 BeadChip of eleven inbred lines belonging to different heterotic groups relevant for maize breeding in Southeast Europe - European Corn Belt. The objectives of this study were to assess the utility of the MaizeSNP50 BeadChip platform by determining its descriptive power and to assess genetic dissimilarity of the inbred lines. The distribution of the SNPs was found not completely uniform among chromosomes, but average call rate was very high (97.9% and number of polymorphic loci was 33200 out of 50074 SNPs with known mapping position indicating descriptive power of the MaizeSNP50 BeadChip. The dendrogram obtained from UPGMA cluster analysis as well as principal component analysis (PCA confirmed pedigree information, undoubtedly distinguishing lines according to their background in two population varieties of Reid Yellow Dent and Lancaster Sure Crop. Dissimilarity analysis showed that all of the inbred lines could be distinguished from each other. Whereas cluster analysis did not definitely differentiate Mo17 and Ohio inbred lines, PCA revealed clear genetic differences between them. The studied inbred lines were confirmed to be genetically diverse, representing a large proportion of the genetic variation occurring in two maize heterotic groups.
From equator to pole: splitting chromosomes in mitosis and meiosis
Duro, Eris
2015-01-01
During eukaryotic cell division, chromosomes must be precisely partitioned to daughter cells. This relies on a mechanism to move chromosomes in defined directions within the parental cell. While sister chromatids are segregated from one another in mitosis and meiosis II, specific adaptations enable the segregation of homologous chromosomes during meiosis I to reduce ploidy for gamete production. Many of the factors that drive these directed chromosome movements are known, and their molecular mechanism has started to be uncovered. Here we review the mechanisms of eukaryotic chromosome segregation, with a particular emphasis on the modifications that ensure the segregation of homologous chromosomes during meiosis I. PMID:25593304
Utilization of maize ( Zea mays ) cob as an adsorbent for lead (II ...
African Journals Online (AJOL)
Maize cob was used as an adsorbent in order to evaluate its potential for the removal of lead from aqueous solutions and effluents from battery and paint industries with Dowex (synthetic resin) as control. Experimental data were analyzed in terms of Freundlich isotherm model. Equilibrium was attained at 2 h and adsorption ...
Assessment of maize stem borer damage on hybrid maize varieties in Chitwan, Nepal
Buddhi Bahadur Achhami; Santa Bahadur BK; Ghana Shyam Bhandari
2015-01-01
Maize is the second most important cereal crop in Nepal. However, national figure of grain production still remains below than the world's average grain production per unit area. Thus, this experiment was designed to determine the suitable time of maize planting, and to assess the peak period of one of the major insects, maize stem borer, in Chitwan condition. The results showed that plant damage percentage as per the maize planting month varies significantly, and the average plant damage per...
Directory of Open Access Journals (Sweden)
Ferraro Marcos Vinícius M.
2004-01-01
Full Text Available Genotoxicity studies on toxic metals and their organic compounds are very important, especially so in the investigation of the effects of these compounds on the aquatic environments where they tend to accumulate. The use of endemic aquatic organisms as biological sentinels has proved useful to environmental monitoring. We assessed the mutagenic potential of tributyltin (TBT and inorganic lead (PbII using samples of the fish Hoplias malabaricus (commonly called traíra using the comet assay and the piscine micronucleus and chromosome aberration tests. Eighteen H. malabaricus were acclimatized in three individual aquariums, each containing six fish, six fish being exposed to 0.3 mg/g of body weight (bw of TBT, six to 21 mg/g bw of PbII and six being used as controls. Exposure to TBT and PbII was achieved by feeding the fish every five days with Astyanax (a small fish that is part of the normal diet of H. malabaricus which had been injected with solutions of TBT, PbII or with water (the control group. After two months the H. malabaricus were sacrificed and their peripheral blood collected and subjected to the comet and micronucleus assays, the chromosome aberration assay being conducted using kidney-tissue. Although the comet assay showed now mutagenic effects at the lead concentrations used but encountered results with TBT, the micronucleus and chromosome aberrations assays both indicated that TBT and PbII are potentially mutagenic (p < 0.01, the micronucleus assay showing morphological alterations of the nucleus.
Directory of Open Access Journals (Sweden)
Sisay Diriba Lemessa
2017-09-01
Full Text Available This study analyzes the technical efficiency and production risk of 862 maize farmers in major maize producing regions of Ethiopia. It employs the stochastic frontier approach (SFA to estimate the level of technical efficiencies of stallholder farmers. The stochastic frontier approach (SFA uses flexible risk properties to account for production risk. Thus, maize production variability is assessed from two perspectives, the production risk and the technical efficiency. The study also attempts to determine the socio-economic and farm characteristics that influence technical efficiency of maize production in the study area. The findings of the study showed the existence of both production risk and technical inefficiency in maize production process. Input variables (amounts per hectare such as fertilizer and labor positively influence maize output. The findings also show that farms in the study area exhibit decreasing returns to scale. Fertilizer and ox plough days reduce output risk while labor and improved seed increase output risk. The mean technical efficiency for maize farms is 48 percent. This study concludes that production risk and technical inefficiency prevents the maize farmers from realizing their frontier output. The best factors that improve the efficiency of the maize farmers in the study area include: frequency of extension contact, access to credit and use of intercropping. It was also realized that altitude and terracing in maize farms had influence on farmer efficiency.
Chiasmatic and achiasmatic inverted meiosis of plants with holocentric chromosomes
Cabral, Gabriela; Marques, André; Schubert, Veit; Pedrosa-Harand, Andrea; Schlögelhofer, Peter
2014-01-01
Meiosis is a specialized cell division in sexually reproducing organisms before gamete formation. Following DNA replication, the canonical sequence in species with monocentric chromosomes is characterized by reductional segregation of homologous chromosomes during the first and equational segregation of sister chromatids during the second meiotic division. Species with holocentric chromosomes employ specific adaptations to ensure regular disjunction during meiosis. Here we present the analysis of two closely related plant species with holocentric chromosomes that display an inversion of the canonical meiotic sequence, with the equational division preceding the reductional. In-depth analysis of the meiotic divisions of Rhynchospora pubera and R. tenuis reveals that during meiosis I sister chromatids are bi-oriented, display amphitelic attachment to the spindle and are subsequently separated. During prophase II, chromatids are connected by thin chromatin threads that appear instrumental for the regular disjunction of homologous non-sister chromatids in meiosis II. PMID:25295686
Megabase-Scale Inversion Polymorphism in the Wild Ancestor of Maize
Fang, Zhou; Pyhäjärvi, Tanja; Weber, Allison L.; Dawe, R. Kelly; Glaubitz, Jeffrey C.; González, José de Jesus Sánchez; Ross-Ibarra, Claudia; Doebley, John; Morrell, Peter L.; Ross-Ibarra, Jeffrey
2012-01-01
Chromosomal inversions are thought to play a special role in local adaptation, through dramatic suppression of recombination, which favors the maintenance of locally adapted alleles. However, relatively few inversions have been characterized in population genomic data. On the basis of single-nucleotide polymorphism (SNP) genotyping across a large panel of Zea mays, we have identified an ∼50-Mb region on the short arm of chromosome 1 where patterns of polymorphism are highly consistent with a polymorphic paracentric inversion that captures >700 genes. Comparison to other taxa in Zea and Tripsacum suggests that the derived, inverted state is present only in the wild Z. mays subspecies parviglumis and mexicana and is completely absent in domesticated maize. Patterns of polymorphism suggest that the inversion is ancient and geographically widespread in parviglumis. Cytological screens find little evidence for inversion loops, suggesting that inversion heterozygotes may suffer few crossover-induced fitness consequences. The inversion polymorphism shows evidence of adaptive evolution, including a strong altitudinal cline, a statistical association with environmental variables and phenotypic traits, and a skewed haplotype frequency spectrum for inverted alleles. PMID:22542971
Quantitative trait loci for yield and morphological traits in maize under drought stress
Directory of Open Access Journals (Sweden)
Nikolić Ana
2011-01-01
Full Text Available Drought is one of the most important factors contributing to crop yield loss. In order to develop maize varieties with drought tolerance, it is necessary to explore the genetic basis. Mapping quantitative trait loci (QTL that control the yield and associate agronomic traits is one way of understanding drought genetics. QTLs associated with grain yield (GY, leaf width (LW3, LW4 plant height (PH, ear height (EH, leaf number (NL, tassel branch number (TBN and tassel length (TL were studied with composite interval mapping. A total of 43 QTLs were detected, distributed on all chromosomes, except chromosome 9. Phenotypic variability determined for the identified QTLs for all the traits was in the range from 20.99 to 87.24%. Mapping analysis identified genomic regions associated with two traits in a manner that was consistent with phenotypic correlation among traits, supporting either pleiotropy or tight linkage among QTLs.
QTL Mapping of Kernel Number-Related Traits and Validation of One Major QTL for Ear Length in Maize.
Huo, Dongao; Ning, Qiang; Shen, Xiaomeng; Liu, Lei; Zhang, Zuxin
2016-01-01
The kernel number is a grain yield component and an important maize breeding goal. Ear length, kernel number per row and ear row number are highly correlated with the kernel number per ear, which eventually determines the ear weight and grain yield. In this study, two sets of F2:3 families developed from two bi-parental crosses sharing one inbred line were used to identify quantitative trait loci (QTL) for four kernel number-related traits: ear length, kernel number per row, ear row number and ear weight. A total of 39 QTLs for the four traits were identified in the two populations. The phenotypic variance explained by a single QTL ranged from 0.4% to 29.5%. Additionally, 14 overlapping QTLs formed 5 QTL clusters on chromosomes 1, 4, 5, 7, and 10. Intriguingly, six QTLs for ear length and kernel number per row overlapped in a region on chromosome 1. This region was designated qEL1.10 and was validated as being simultaneously responsible for ear length, kernel number per row and ear weight in a near isogenic line-derived population, suggesting that qEL1.10 was a pleiotropic QTL with large effects. Furthermore, the performance of hybrids generated by crossing 6 elite inbred lines with two near isogenic lines at qEL1.10 showed the breeding value of qEL1.10 for the improvement of the kernel number and grain yield of maize hybrids. This study provides a basis for further fine mapping, molecular marker-aided breeding and functional studies of kernel number-related traits in maize.
Ram B Paneru; Resham B Thapa
2017-01-01
The maize weevil (Sitophilus zeamais Motschulsky) is a serious pest of economic importance in stored grains. It causes major damage to stored maize grain thereby reducing its weight, quality and germination. An experiment was conducted in randomized complete block design (RCBD) with 3 replications to screen 32 maize genotypes against maize weevil in no-choice and free-choice conditions at Entomology Division, Khumaltar, Lalitpur (Room temperature: Maximum 24-32°C and Minimum 18-27°C). The fin...
Occurrence of toxigenic fungi in maize and maize-gluten meal from Pakistan
Directory of Open Access Journals (Sweden)
Muhammad Kashif SALEEMI
2012-05-01
Full Text Available The present study was designed to isolate and identify toxigenic mycoflora of maize and maize-gluten meal. A total of 82 samples of maize and 8 samples of maize-gluten meal were collected from Faisalabad district of Pakistan over a period of two years. These samples were inoculated on different culture media. Fungal contamination of maize and maize-gluten was 56% and 75% of samples, respectively. Isolation frequencies of different genera isolated from maize were Aspergillus 33%; Penicillium 28%; Fusarium 10%; and Alternaria 1%. Isolation frequency among species was maximum for P. verrucosum, followed by A. niger aggregates, A. ochraceous, A. flavus, P. chrysogenum, A. parasiticus, A. carbonarius, Fusarium spp. and Alternaria spp. Relative density of Aspergillus isolates was maximum for A. niger aggregates and A. ochraceous (30% each followed by A. flavus (26%, A. parasiticus (11% and A. carbonarius (3%. Percentage of toxigenic fungi among Aspergillus isolates was 52%. Aflatoxigenic isolates of A. flavus and A. parasiticus were 43 and 67% and ochratoxigenic isolates of A. carbonarius, A. ochraceous and A. niger aggregates were 100, 63 and 38%, respectively. Aspergillus parasiticus produced higher concentrations of AFB1 (maximum 1374.23 ng g-1 than A. flavus (maximum 635.50 ng g-1. Ochratoxin A production potential of A. ochraceous ranged from 1.81 to 9523.1 ng g-1, while in A. niger aggregates it was 1.30 to 1758.6 ng g-1. Isolation frequencies of fungal genera from maize-gluten meal were Aspergillus (63% and Penicillium (50%. A. flavus was the most frequently isolated species. Percentage of toxigenic fungi among Aspergillus isolates was 40%. Aflatoxigenic isolates of A. flavus were 33% and ochratoxigenic isolates of A. ochraceous were 100%.
Global maize production, utilization, and consumption.
Ranum, Peter; Peña-Rosas, Juan Pablo; Garcia-Casal, Maria Nieves
2014-04-01
Maize (Zea mays), also called corn, is believed to have originated in central Mexico 7000 years ago from a wild grass, and Native Americans transformed maize into a better source of food. Maize contains approximately 72% starch, 10% protein, and 4% fat, supplying an energy density of 365 Kcal/100 g and is grown throughout the world, with the United States, China, and Brazil being the top three maize-producing countries in the world, producing approximately 563 of the 717 million metric tons/year. Maize can be processed into a variety of food and industrial products, including starch, sweeteners, oil, beverages, glue, industrial alcohol, and fuel ethanol. In the last 10 years, the use of maize for fuel production significantly increased, accounting for approximately 40% of the maize production in the United States. As the ethanol industry absorbs a larger share of the maize crop, higher prices for maize will intensify demand competition and could affect maize prices for animal and human consumption. Low production costs, along with the high consumption of maize flour and cornmeal, especially where micronutrient deficiencies are common public health problems, make this food staple an ideal food vehicle for fortification. © 2014 New York Academy of Sciences. The World Health Organization retains copyright and all other rights in the manuscript of this article as submitted for publication.
Directory of Open Access Journals (Sweden)
Łukasz Tuhy
2015-07-01
Full Text Available Spent mushroom substrate (SMS is a noxious byproduct of the mushroom industry. The aim of this work was to convert SMS into organic-mineral micronutrient (Zn(II, Mn(II, and Cu(II fertilizer via biosorption and examine the effect of its application in field tests on maize compared to commercial reference micronutrient fertilizer. Crop yield and crop quality were assessed, and multielemental analysis of grains was conducted for the evaluation of the fertilization effect on maize grains and to assess bioavailability of nutrients from fertilizers. Grain yield for maize treated with micronutrients delivered with SMS was noticeably higher (11.5% than the untreated group and the NPK (nitrogen, phosphorus, potassium fertilizer treated only group (2.8%. Bioavailability (TF of micronutrients from SMS were comparable with reference micronutrient fertilizer (7% Zn, 4% Mn, and 2.3% Cu. The new product has the potential to be used as a micronutrient fertilizer. Satisfactory results of grain yield (6.4 Mg ha-1, high content of micronutrients (Zn 1.6%, Mn 1.2%, and Cu 1.8%, and macronutrients (P 1.0%, S 3.1%, Ca 8.2%, and K 0.2% were observed. The bioavailability suggests that enriched SMS could be a good alternative to fertilizers in the present market.
Breeding of speciality maize for industrial purposes
Pajić Zorica; Radosavljević Milica; Filipović Milomir; Todorović Goran; Srdić Jelena; Pavlov Milovan
2010-01-01
The breeding programme on speciality maize with specific traits was established at the Maize Research Institute, Zemun Polje, several decades ago. The initial material was collected, new methods applying to breeding of speciality maize, i.e. popping maize, sweet maize and white-seeded maize, were introduced. The aim was to enhance and improve variability of the initial material for breeding these three types of maize. Then, inbred lines of good combining abilities were developed and used as c...
Aflatoxin levels in maize and maize products during the 2004 food ...
African Journals Online (AJOL)
Aflatoxin levels in maize and maize products during the 2004 food poisoning ... district were received at the National Public Health Laboratory Services (NPHLS). On analysis, they were found to be highly contaminated with aflatoxin B1.
Fine Mapping of qroot-yield-1.06, a QTL for Root, Plant Vigor and Yield in Maize
Martinez Ascanio, Ana Karine
2015-01-01
Root-yield-1.06 is a major QTL affecting root system architecture (RSA) and other agronomic traits in maize. The effect of this QTL has been evaluated with the development of near isogenic lines (NILs) differing at the QTL position. The objective of this study was to fine map qroot-yield-1.06 by marker-assisted searching for chromosome recombinants in the QTL interval and concurrent root phenotyping in both controlled and field conditions, through successive generations. Complementary approac...
X chromosome dosage compensation via enhanced transcriptional elongation in Drosophila.
Larschan, Erica; Bishop, Eric P; Kharchenko, Peter V; Core, Leighton J; Lis, John T; Park, Peter J; Kuroda, Mitzi I
2011-03-03
The evolution of sex chromosomes has resulted in numerous species in which females inherit two X chromosomes but males have a single X, thus requiring dosage compensation. MSL (Male-specific lethal) complex increases transcription on the single X chromosome of Drosophila males to equalize expression of X-linked genes between the sexes. The biochemical mechanisms used for dosage compensation must function over a wide dynamic range of transcription levels and differential expression patterns. It has been proposed that the MSL complex regulates transcriptional elongation to control dosage compensation, a model subsequently supported by mapping of the MSL complex and MSL-dependent histone 4 lysine 16 acetylation to the bodies of X-linked genes in males, with a bias towards 3' ends. However, experimental analysis of MSL function at the mechanistic level has been challenging owing to the small magnitude of the chromosome-wide effect and the lack of an in vitro system for biochemical analysis. Here we use global run-on sequencing (GRO-seq) to examine the specific effect of the MSL complex on RNA Polymerase II (RNAP II) on a genome-wide level. Results indicate that the MSL complex enhances transcription by facilitating the progression of RNAP II across the bodies of active X-linked genes. Improving transcriptional output downstream of typical gene-specific controls may explain how dosage compensation can be imposed on the diverse set of genes along an entire chromosome.
Directory of Open Access Journals (Sweden)
Rawin Poonperm
Full Text Available Kinesin family member 4 (KIF4 and condensins I and II are essential chromosomal proteins for chromosome organization by locating primarily to the chromosome scaffold. However, the mechanism of how KIF4 and condensins localize to the chromosome scaffold is poorly understood. Here, we demonstrate a close relationship between the chromosome localization of KIF4 and condensin I, but not condensin II, and show that KIF4 and condensin I assist each other for stable scaffold formation by forming a stable complex. Moreover, phosphorylation of KIF4 and condensin I by Aurora B and polo-like kinase 1 (Plk1 is important for KIF4 and condensin I localization to the chromosome. Aurora B activity facilitates the targeting of KIF4 and condensin I to the chromosome, whereas Plk1 activity promotes the dissociation of these proteins from the chromosome. Thus, the interdependency between KIF4 and condensin I, and their phosphorylation states play important roles in chromosome scaffold organization during mitosis.
Poonperm, Rawin; Takata, Hideaki; Uchiyama, Susumu; Fukui, Kiichi
2017-01-01
Kinesin family member 4 (KIF4) and condensins I and II are essential chromosomal proteins for chromosome organization by locating primarily to the chromosome scaffold. However, the mechanism of how KIF4 and condensins localize to the chromosome scaffold is poorly understood. Here, we demonstrate a close relationship between the chromosome localization of KIF4 and condensin I, but not condensin II, and show that KIF4 and condensin I assist each other for stable scaffold formation by forming a stable complex. Moreover, phosphorylation of KIF4 and condensin I by Aurora B and polo-like kinase 1 (Plk1) is important for KIF4 and condensin I localization to the chromosome. Aurora B activity facilitates the targeting of KIF4 and condensin I to the chromosome, whereas Plk1 activity promotes the dissociation of these proteins from the chromosome. Thus, the interdependency between KIF4 and condensin I, and their phosphorylation states play important roles in chromosome scaffold organization during mitosis.
Non-disjunction of chromosome 18
DEFF Research Database (Denmark)
Bugge, M; Collins, A; Petersen, M B
1998-01-01
A sample of 100 trisomy 18 conceptuses analysed separately and together with a published sample of 61 conceptuses confirms that an error in maternal meiosis II (MII) is the most frequent cause of non-disjunction for chromosome 18. This is unlike all other human trisomies that have been studied......, which show a higher frequency in maternal meiosis I (MI). Maternal MI trisomy 18 shows a low frequency of recombination in proximal p and medial q, but not the reduction in proximal q observed in chromosome 21 MI non-disjunction. Maternal MII non-disjunction does not fit the entanglement model...... that predicts increased recombination, especially near the centromere. Whereas recent data on MII trisomy 21 show the predicted increase in recombination proximally, maternal MII trisomy 18 has non-significantly reduced recombination. Therefore, chromosome-specific factors must complicate the simple model...
Directory of Open Access Journals (Sweden)
Yong-xiang Li
Full Text Available Head smut, caused by the fungus Sphacelotheca reiliana (Kühn Clint, is a devastating threat to maize production. In this study, QTL mapping of head smut resistance was performed using a recombinant inbred line (RIL population from a cross between a resistant line "QI319" and a susceptible line "Huangzaosi" (HZS with a genetic map constructed from genotyping-by-sequencing (GBS data and composed of 1638 bin markers. Two head smut resistance QTL were identified, located on Chromosome 2 (q2.09HR and Chromosome 5 (q5.03HR, q2.09HR is co-localized with a previously reported QTL for head smut resistance, and the effect of q5.03HR has been validated in backcross populations. It was also observed that pyramiding the resistant alleles of both QTL enhanced the level of resistance to head smut. A genome-wide association study (GWAS using 277 diverse inbred lines was processed to validate the mapped QTL and to identify additional head smut resistance associations. A total of 58 associated SNPs were detected, which were distributed in 31 independent regions. SNPs with significant association to head smut resistance were detected within the q2.09HR and q5.03HR regions, confirming the linkage mapping results. It was also observed that both additive and epistastic effects determine the genetic architecture of head smut resistance in maize. As shown in this study, the combined strategy of linkage mapping and association analysis is a powerful approach in QTL dissection for disease resistance in maize.
Yang, Qin; He, Yijian; Kabahuma, Mercy; Chaya, Timothy; Kelly, Amy; Borrego, Eli; Bian, Yang; El Kasmi, Farid; Yang, Li; Teixeira, Paulo; Kolkman, Judith; Nelson, Rebecca; Kolomiets, Michael; L Dangl, Jeffery; Wisser, Randall; Caplan, Jeffrey; Li, Xu; Lauter, Nick; Balint-Kurti, Peter
2017-09-01
Alleles that confer multiple disease resistance (MDR) are valuable in crop improvement, although the molecular mechanisms underlying their functions remain largely unknown. A quantitative trait locus, qMdr 9.02 , associated with resistance to three important foliar maize diseases-southern leaf blight, gray leaf spot and northern leaf blight-has been identified on maize chromosome 9. Through fine-mapping, association analysis, expression analysis, insertional mutagenesis and transgenic validation, we demonstrate that ZmCCoAOMT2, which encodes a caffeoyl-CoA O-methyltransferase associated with the phenylpropanoid pathway and lignin production, is the gene within qMdr 9.02 conferring quantitative resistance to both southern leaf blight and gray leaf spot. We suggest that resistance might be caused by allelic variation at the level of both gene expression and amino acid sequence, thus resulting in differences in levels of lignin and other metabolites of the phenylpropanoid pathway and regulation of programmed cell death.
Li, Ye Long; Dai, Xin Ren; Yue, Xun; Gao, Xin-Qi; Zhang, Xian Sheng
2014-10-01
Maize 1,491 small secreted peptides were identified, which were classified according to the character of peptide sequences. Partial SSP gene expressions in reproductive tissues were determined by qRT-PCR. Small secreted peptides (SSPs) are important cell-cell communication messengers in plants. Most information on plant SSPs come from Arabidopsis thaliana and Oryza sativa, while little is known about the SSPs of other grass species such as maize (Zea mays). In this study, we identified 1,491 SSP genes from maize genomic sequences. These putative SSP genes were distributed throughout the ten maize chromosomes. Among them, 611 SSPs were classified into 198 superfamilies according to their conserved domains, and 725 SSPs with four or more cysteines at their C-termini shared similar cysteine arrangements with their counterparts in other plant species. Moreover, the SSPs requiring post-translational modification, as well as defensin-like (DEFL) proteins, were identified. Further, the expression levels of 110 SSP genes were analyzed in reproductive tissues, including male flower, pollen, silk, and ovary. Most of the genes encoding basal-layer antifungal peptide-like, small coat proteins-like, thioredoxin-like proteins, γ-thionins-like, and DEFL proteins showed high expression levels in the ovary and male flower compared with their levels in silk and mature pollen. The rapid alkalinization factor-like genes were highly expressed only in the mature ovary and mature pollen, and pollen Ole e 1-like genes showed low expression in silk. The results of this study provide basic information for further analysis of SSP functions in the reproductive process of maize.
Directory of Open Access Journals (Sweden)
Ram B Paneru
2017-12-01
Full Text Available The maize weevil (Sitophilus zeamais Motschulsky is a serious pest of economic importance in stored grains. It causes major damage to stored maize grain thereby reducing its weight, quality and germination. An experiment was conducted in randomized complete block design (RCBD with 3 replications to screen 32 maize genotypes against maize weevil in no-choice and free-choice conditions at Entomology Division, Khumaltar, Lalitpur (Room temperature: Maximum 24-32°C and Minimum 18-27°C. The findings showed that the maize genotypes had different response to maize weevil damage ranging from susceptible to tolerance. The genotypes Manakamana-3, Lumle White POP Corn and Ganesh-2 showed their tolerance to S. zeamais as evidenced by lower number of weevil emerged/attracted, lower amount of grain debris release and lower proportion of bored grains, while the genotype ZM-627 was the most susceptible to weevil damage in both tests. The other remaining genotypes were intermediate types. This information is useful to improve grain protection in storage and varietal improvement/release program.
Maize forage aptitude: Combining ability of inbred lines and stability of hybrids
Directory of Open Access Journals (Sweden)
Luis Máximo Bertoia
2014-12-01
Full Text Available Breeding of forage maize should combine improvement achieved for grain with the specific needs of forage hybrids. Production stability is important when maize is used for silage if the planting area is not in the ideal agronomic environment. The objectives of the present research were: (i to quantify environmental and genetic and their interaction effects on maize silage traits; (ii to identify possible heterotic groups for forage aptitude and suggest the formation of potential heterotic patterns, and (iii to identify suitable inbred line combinations for producing hybrids with forage aptitude. Forty-five hybrids derived from diallelic crosses (without reciprocals among ten inbred lines of maize were evaluated in this study. Combined ANOVA over environments showed differences between genotypes (G, environments (E, and their interactions (GEI. Heritability (H2, and genotypic and phenotypic correlations were estimated to evaluate the variation in and relationships between forage traits. Postdictive and predictive AMMI models were fitted to determine the importance of each source of variation, G, E, and GEI, and to select genotypes simultaneously on yield, quality and stability. A predominance of additive effects was found in the evaluated traits. The heterotic pattern Reid-BSSS × Argentine flint was confirmed for ear yield (EY and harvest index (HI. High and broad genetic variation was found for stover and whole plant traits. Some inbred lines had genes with differential breeding aptitude for ear and stover. Stover and ear yield should be the main breeding objectives in maize forage breeding.
Molecular mechanism in the formation of a human ring chromosome 21
International Nuclear Information System (INIS)
Wong, C.; Kazazian, H.H. Jr.; Stetten, G.; Earnshaw, W.C.; Antonarakis, S.E.; Van Keuren, M.L.
1989-01-01
The authors have characterized the structural rearrangements of a chromosome 21 that led to the de novo formation of a human ring chromosome 21 [r(21)]. Molecular cloning and chromosomal localization of the DNA regions flanking the ring junction provide evidence for a long arm to long arm fusion in formation of the r(21). In addition, the centromere and proximal long arm region of a maternal chromosome 21 are duplicated in the r(21). Therefore, the mechanism in formation of the r(21) was complex involving two sequential chromosomal rearrangements. (i) Duplication of the centromere and long arm of one maternal chromosome 21 occurred forming a rearranged intermediate. (ii) Chromosomal breaks in both the proximal and telomeric long arm regions on opposite arms of this rearranged chromosome occurred with subsequent reunion producing the r(21)
Genome-wide association mapping of leaf metabolic profiles for dissecting complex traits in maize.
Riedelsheimer, Christian; Lisec, Jan; Czedik-Eysenberg, Angelika; Sulpice, Ronan; Flis, Anna; Grieder, Christoph; Altmann, Thomas; Stitt, Mark; Willmitzer, Lothar; Melchinger, Albrecht E
2012-06-05
The diversity of metabolites found in plants is by far greater than in most other organisms. Metabolic profiling techniques, which measure many of these compounds simultaneously, enabled investigating the regulation of metabolic networks and proved to be useful for predicting important agronomic traits. However, little is known about the genetic basis of metabolites in crops such as maize. Here, a set of 289 diverse maize inbred lines was genotyped with 56,110 SNPs and assayed for 118 biochemical compounds in the leaves of young plants, as well as for agronomic traits of mature plants in field trials. Metabolite concentrations had on average a repeatability of 0.73 and showed a correlation pattern that largely reflected their functional grouping. Genome-wide association mapping with correction for population structure and cryptic relatedness identified for 26 distinct metabolites strong associations with SNPs, explaining up to 32.0% of the observed genetic variance. On nine chromosomes, we detected 15 distinct SNP-metabolite associations, each of which explained more then 15% of the genetic variance. For lignin precursors, including p-coumaric acid and caffeic acid, we found strong associations (P values to ) with a region on chromosome 9 harboring cinnamoyl-CoA reductase, a key enzyme in monolignol synthesis and a target for improving the quality of lignocellulosic biomass by genetic engineering approaches. Moreover, lignin precursors correlated significantly with lignin content, plant height, and dry matter yield, suggesting that metabolites represent promising connecting links for narrowing the genotype-phenotype gap of complex agronomic traits.
Consumer preferences for maize products in urban Kenya.
De Groote, Hugo; Kimenju, Simon Chege
2012-06-01
New maize varieties have been biofortified with provitamin A, mainly a-carotene, which renders the grain yellow or orange. Unfortunately, many African consumers prefer white maize. The maize consumption patterns in Africa are, however, not known. To determine which maize products African consumers prefer to purchase and which maize preparations they prefer to eat. A survey of 600 consumers was conducted in Nairobi, Kenya, at three types of maize outlets: posho mills (small hammer mills), kiosks, and supermarkets. Clients of posho mills had lower incomes and less education than those of kiosks and supermarkets. The preferred maize product of the posho-mill clients was artisanal maize meal; the preferred product of the others was industrial maize meal. Maize is the preferred staple for lunch and dinner, eaten as a stiff porridge (ugali), followed by boiled maize and beans (githeri), regardless of socioeconomic background. For breakfast, only half the consumers prefer maize, mostly as a soft porridge (uji). This proportion is higher in low-income groups. Consumers show a strong preference for white maize over yellow, mostly for its organoleptic characteristics, and show less interest in biofortified maize. Maize is the major food staple in Nairobi, mostly eaten in a few distinct preparations. For biofortified yellow maize to be accepted, a strong public awareness campaign to inform consumers is needed, based on a sensory evaluation and the mass media, in particular on radio in the local language.
Maize variety and method of production
Pauly, Markus; Hake, Sarah; Kraemer, Florian J
2014-05-27
The disclosure relates to a maize plant, seed, variety, and hybrid. More specifically, the disclosure relates to a maize plant containing a Cal-1 allele, whose expression results in increased cell wall-derived glucan content in the maize plant. The disclosure also relates to crossing inbreds, varieties, and hybrids containing the Cal-1 allele to produce novel types and varieties of maize plants.
Directory of Open Access Journals (Sweden)
Jianhong Chen
2010-01-01
Full Text Available Objective. To compare the difference of imprinting status of insulin-like growth factor II (IGF-II gene in villus between normal embryo development group and abnormal embryo development group and to investigate the relationship between karyotype and the imprinting status of IGF-II gene. Methods. A total of 85 pregnant women with singleton pregnancy were divided into two groups: one with abnormal embryo development (n=38 and the other with normal embryo development (n=47. Apa I polymorphism of IGF-II gene in chorionic villus was assayed with reverse transcriptase polymerase chain reaction (RT-PCR and restriction fragment length polymorphism (RFLP. The relationship between chromosomal abnormal karyotype and IGF-II gene imprinting status was analyzed by primary cell culture and G-banding chromosomal karyotype analysis. Results. IGF-II imprinting loss rate was higher in the abnormal embryo development group than the normal embryo development group (44.7% versus 31.6%, but without significant difference (P>.05. The percentage of abnormal chromosomes of chorionic villus in the abnormal embryo development group was 42.5%, in which IGF-II imprinting loss rate reached 64.7%. No abnormal karyotypes were found in the normal embryo development group. However, there was significant difference in IGF-II imprinting loss rate between two groups (P>.05. Conclusion. During weeks 6–10 of gestation, abnormal embryonic development is correlated with chromosomal abnormalities. The imprinting status of IGF-II gene played important roles in embryonic development, and imprinting loss might be related to chromosomal abnormalities.
Assessment of maize stem borer damage on hybrid maize varieties in Chitwan, Nepal
Directory of Open Access Journals (Sweden)
Buddhi Bahadur Achhami
2015-12-01
Full Text Available Maize is the second most important cereal crop in Nepal. However, national figure of grain production still remains below than the world's average grain production per unit area. Thus, this experiment was designed to determine the suitable time of maize planting, and to assess the peak period of one of the major insects, maize stem borer, in Chitwan condition. The results showed that plant damage percentage as per the maize planting month varies significantly, and the average plant damage percentage by stem borer was up to 18.11%. Length of the feeding tunnel in maize stem was significantly higher in January than July. In case of exit holes made by borer counted more than four holes per plant that were planted in the month of January. All in all, except the tunnel length measurement per plant, we observed similar pattern in other borer damage parameters such as exit whole counts and plant damage percentage within the tested varieties. Stem borer damage was not significantly affect on grain yield.
Dissection of Recombination Attributes for Multiple Maize Populations Using a Common SNP Assay
Directory of Open Access Journals (Sweden)
Haiying Guan
2017-11-01
Full Text Available Recombination is a vital characteristic for quantitative trait loci mapping and breeding to enhance the yield potential of maize. However, recombination characteristics in globally used segregating populations have never been evaluated at similar genetic marker densities. This study aimed to divulge the characteristics of recombination events, recombinant chromosomal segments, and recombination frequency for four dissimilar populations. These populations were doubled haploid (DH, recombination inbred line (RIL, intermated B73xMo17 (IBM, and multi-parent advanced generation inter-cross (MAGIC, using the Illumina MaizeSNP50 BeadChip to provide markers. Our results revealed that the average number of recombination events was 16, 41, 72, and 86 per line in DH, RIL, IBM, and MAGIC populations, respectively. Accordingly, the average length of recombinant chromosomal segments was 84.8, 47.3, 29.2, and 20.4 Mb in DH, RIL, IBM, and MAGIC populations, respectively. Furtherly, the recombination frequency varied in different genomic regions and population types [DH (0–12.7 cM/Mb, RIL (0–15.5 cM/Mb, IBM (0–24.1 cM/Mb, MAGIC (0–42.3 cM/Mb]. Utilizing different sub-sets of lines, the recombination bin number and size were analyzed in each population. Additionally, different sub-sets of markers and lines were employed to estimate the recombination bin number and size via formulas for relationship in these populations. The relationship between recombination events and recombination bin length was also examined. Our results contribute to determining the most suitable number of genetic markers, lines in each population, and population type for successful mapping and breeding.
Maize cob losses and their effects on the poverty status of maize
African Journals Online (AJOL)
This study analysed fresh maize cob losses and its effect on the poverty status of maize farmers in Edo State,. Nigeria. The specific .... is the poverty gap for ... Total cost. 162,367.48. 100.00. Returns. Total expected yield (N). 327,966.63. _.
Chromosome damage induced by DNA topoisomerase II inhibitors combined with g-radiation in vitro
Directory of Open Access Journals (Sweden)
Maria Cristina P. Araújo
1998-09-01
Full Text Available Combined radiation and antineoplastic drug treatment have important applications in cancer therapy. In the present work, an evaluation was made of two known topoisomerase II inhibitors, doxorubicin (DXR and mitoxantrone (MXN, with g-radiation. The effects of DXR or MXN on g-radiation-induced chromosome aberrations in Chinese hamster ovary (CHO cells were analyzed. Two concentrations of each drug, 0.5 and 1.0 µg/ml DXR, and 0.02 and 0.04 µg/ml MXN, were applied in combination with two doses of g-radiation (20 and 40 cGy. A significant potentiating effect on chromosomal aberrations was observed in CHO cells exposed to 1.0 µg/ml DXR plus 40 cGy. In the other tests, the combination of g-radiation with DXR or MXN gave approximately additive effects. Reduced mitotic indices reflected higher toxicity of the drugs when combined with radiation.A associação de radiação ionizante com drogas antineoplásicas tem importante aplicação na terapia do câncer. No presente trabalho, foram avaliados os efeitos de dois inibidores de topoisomerase II, doxorubicina (DXR e mitoxantrona (MXN, sobre as aberrações cromossômicas induzidas pelas radiações-g em células do ovário de hamster chinês (CHO. Foram usadas as concentrações 0,5 e 1,0 mg/ml de DXR e 0,02 e 0,04 mg/ml de MXN, combinadas com duas doses de radiações gama (20 e 40 cGy. Um significativo efeito potenciador das aberrações cromossômicas foi observado em células CHO tratadas com 1,0 mg/ml de DXR e expostas a 40 cGy de radiação. Nos outros testes, a combinação da radiação-g com a DXR ou MXN apresentou um efeito próximo ao aditivo. A redução dos índices mitóticos refletiu a alta citotoxicidade das drogas quando combinadas às radiações-g.
MaizeGDB: The Maize Model Organism Database for Basic, Translational, and Applied Research
Lawrence, Carolyn J.; Harper, Lisa C.; Schaeffer, Mary L.; Sen, Taner Z.; Seigfried, Trent E.; Campbell, Darwin A.
2008-01-01
In 2001 maize became the number one production crop in the world with the Food and Agriculture Organization of the United Nations reporting over 614 million tonnes produced. Its success is due to the high productivity per acre in tandem with a wide variety of commercial uses. Not only is maize an excellent source of food, feed, and fuel, but also its by-products are used in the production of various commercial products. Maize's unparalleled success in agriculture stems from basic research, th...
Roles of Cohesin and Condensin in Chromosome Dynamics During Mammalian Meiosis
LEE, Jibak
2013-01-01
Meiosis is a key step for sexual reproduction in which chromosome number is halved by two successive meiotic divisions after a single round of DNA replication. In the first meiotic division (meiosis I), homologous chromosomes pair, synapse, and recombine with their partners in prophase I. As a result, homologous chromosomes are physically connected until metaphase I and then segregated from each other at the onset of anaphase I. In the subsequent second meiotic division (meiosis II), sister c...
Genetic resources in maize breeding
Directory of Open Access Journals (Sweden)
Anđelković Violeta
2017-01-01
Full Text Available Maize, wheat and rice are the most important cereals grown in the world. It is predicted that by 2025 maize is likely to become the crop with the greatest production globally. Conservation of maize germplasm provides the main resources for increased food and feed production. Conservation in gene banks (ex-situ is dominant strategy for maize conservation. More than 130 000 maize accessions, e.g. about 40% of total number, are stored in ten largest gene banks worldwide and Maize Research Institute Zemun Polje (MRIZP gene bank, with about 6000 accessions, is among them. Organized collecting missions started in 1961. in the former Yugoslavian territory, and up today, more than 2000 local maize landraces were stored. Pre-breeding activities that refer to identification of desirable traits from unadapted germplasm within genebank, result in materials expected to be included in breeding programs. Successful examples are LAMP, GEM and GENRES projects. At the end of XX century, at MRIZP genebank two pre-breeding activities were undertaken: eco-core and elite-core collections were created and landraces fulfilled particular criteria were chosen. In the last decade, MRIZP genebank collection was used for identification of sources for drought tolerance and improved grain quality. According to agronomic traits and general combining ability, two mini-core collections were created and included in commercial breeding programs.
Deletion Mutagenesis and Identification of Causative Mutations in Maize.
Jia, Shangang; Li, Aixia; Zhang, Chi; Holding, David
2018-01-01
We describe a method for gamma-irradiation of mature maize seeds to generate mutants with opaque endosperm and reduced kernel fill phenotypes. We also describe methods for mapping mutants and identifying causal gene mutations. Using this method, a population of 1788M2 families and 47 Mo17 × F2s showing stable, segregating, and viable kernel phenotypes was developed. For molecular characterization of the mutants, we utilized a novel functional genomics platform that combines separate Bulked Segregant RNA and exome sequencing data sets (BSREx-seq) to map causative mutations and identify candidate genes within mapping intervals. We also describe the use of exome capture sequencing of F2 mutant and normal pools to perform mapping and candidate gene identification without the need for separate RNA-seq (BSEx-seq). To exemplify the utility of the deletion mutants for functional genomics and provide proof-of-concept for the bioinformatics platform, we summarize the identification of the causative deletion in two mutants. Mutant 937, which was characterized by BSREx-seq, harbors a 6203-bp in-frame deletion covering six exons within the Opaque-1 gene on chromosome 4. Preliminary investigation of opaque mutant 1486 with BSEx-seq shows a tight mapping interval and associated deletion on chromosome 10.
Directory of Open Access Journals (Sweden)
Erin Ryantin Gunawan
2010-04-01
Full Text Available Activated carbons were prepared from maize (Zea mays L. stems by sulfuric acids activation or chemical methods. The dry maize stems are usually used as low-value energy resources in many countries, burned in the field, or discarded, which are unfavorable to environment. This motivates the investigation of producing value-added products from the dry maize stems, such as activated carbons, as well as solving some environmental problems. The preparation process consisted of sulfuric acid impregnation at different impregnation ratio followed by carbonization at 250-400 oC for 1-4 h. The results show that the impregnation ratio was 1.25, the optimum activation temperature was 300 oC and the activation time was 1 h. The sorption capacity of the activated carbon was 25.1 mg/g.
Computational prediction and molecular confirmation of Helitron transposons in the maize genome
Directory of Open Access Journals (Sweden)
He Limei
2008-01-01
Full Text Available Abstract Background Helitrons represent a new class of transposable elements recently uncovered in plants and animals. One remarkable feature of Helitrons is their ability to capture gene sequences, which makes them of considerable potential evolutionary importance. However, because Helitrons lack the typical structural features of other DNA transposable elements, identifying them is a challenge. Currently, most researchers identify Helitrons manually by comparing sequences. With the maize whole genome sequencing project underway, an automated computational Helitron searching tool is needed. The characterization of Helitron activities in maize needs to be addressed in order to better understand the impact of Helitrons on the organization of the genome. Results We developed and implemented a heuristic searching algorithm in PERL for identifying Helitrons. Our HelitronFinder program will (i take FASTA-formatted DNA sequences as input and identify the hairpin looping patterns, and (ii exploit the consensus 5' and 3' end sequences of known Helitrons to identify putative ends. We randomly selected five predicted Helitrons from the program's high quality output for molecular verification. Four out of the five predicted Helitrons were confirmed by PCR assays and DNA sequencing in different maize inbred lines. The HelitronFinder program identified two head-to-head dissimilar Helitrons in a maize BAC sequence. Conclusion We have identified 140 new Helitron candidates in maize with our computational tool HelitronFinder by searching maize DNA sequences currently available in GenBank. Four out of five candidates were confirmed to be real by empirical methods, thus validating the predictions of HelitronFinder. Additional points to emerge from our study are that Helitrons do not always insert at an AT dinucleotide in the host sequences, that they can insert immediately adjacent to an existing Helitron, and that their movement may cause changes in the flanking
Maize lethal necrosis (MLN), an emerging threat to maize-based food security in sub-Saharan Africa
In sub-Saharan Africa, maize is a staple food and key determinant of food security for smallholder farming communities. Pest and disease outbreaks are key constraints to maize productivity. In September 2011, a serious disease outbreak, later diagnosed as maize lethal necrosis (MLN), was reported on...
Putting the Function in Maize Genomics
Directory of Open Access Journals (Sweden)
Stephen P. Moose
2009-07-01
Full Text Available The 51st Maize Genetics Conference was held March 12–15, 2009 at Pheasant Run Resort in St. Charles, Illinois. Nearly 500 attendees participated in a scientific program (available at covering a wide range of topics which integrate the rich biology of maize with recent discoveries in our understanding of the highly dynamic maize genome. Among the many research themes highlighted at the conference, the historical emphasis on studying the tremendous phenotypic diversity of maize now serves as the foundation for maize as a leading experimental system to characterize the mechanisms that generate variation in complex plant genomes and associate evolutionary change with phenotypes of interest.
Czech Academy of Sciences Publication Activity Database
Ma, W.; Gabriel, T.S.; Martis, M.M.; Gursinsky, T.; Schubert, V.; Vrána, Jan; Doležel, Jaroslav; Grundlach, H.; Altschmied, L.; Scholz, U.; Himmelbach, A.; Behrens, S.E.; Banaei-Moghaddam, A.M.; Houben, A.
2017-01-01
Roč. 213, č. 2 (2017), s. 916-928 ISSN 0028-646X R&D Projects: GA MŠk(CZ) LO1204; GA ČR GBP501/12/G090 Institutional support: RVO:61389030 Keywords : rna-polymerase-ii * ribosomal-rna * accessory chromosomes * plant argonautes * gene-expression * evolution * transcription * pseudogenes * sequences * identification * Argonaute * B chromosomes * B-located genes * gene erosion. gene expression * pseudogenization * Secale cereale Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 7.330, year: 2016
Zhang, Zixiao; Chen, Changchao; Ma, Liying; Yu, Qiuchen; Li, Shuai; Abbasi, Benazir; Yang, Jiayi; Rui, Rong; Ju, Shiqiang
2017-08-29
Polo-like kinase 1 (Plk1), as a characteristic regulator in meiosis, organizes multiple biological events of cell division. Although Plk1 has been implicated in various functions in somatic cell mitotic processes, considerably less is known regarding its function during the transition from metaphase I (MI) to metaphase II (MII) stage in oocyte meiotic progression. In this study, the possible role of Plk1 during the MI-to-MII stage transition in pig oocytes was addressed. Initially, the spatiotemporal expression and subcellular localization pattern of Plk1 were revealed in pig oocytes from MI to MII stage using indirect immunofluorescence and confocal microscopy imaging techniques combined with western blot analyses. Moreover, a highly selective Plk1 inhibitor, GSK461364, was used to determine the potential role of Plk1 during this MI-to-MII transition progression. Upon expression, Plk1 exhibited a specific dynamic intracellular localization, and co-localization of Plk1 with α-tubulin was revealed in the meiotic spindle of pig oocyte during the transition from MI to MII stage. GSK461364 treatment significantly blocked the first polar body (pbI) emission in a dose-dependent manner and resulted in a failure of meiotic maturation, with a larger percentage of the GSK461364-treated oocytes arresting in the anaphase-telophase I (ATI) stage. Further subcellular structure examination results showed that inhibition of Plk1 with GSK461364 had no visible effect on spindle assembly but caused a significantly higher proportion of the treated oocytes to have obvious defects in homologous chromosome segregation at ATI stage. Thus, these results indicate that Plk1 plays an essential role during the meiosis I/meiosis II transition in porcine oocytes, and the regulation is associated with Plk1's effects on homologous chromosome segregation in the ATI stage.
Zaki, M. K.; Komariah; Pujiasmanto, B.; Noda, K.
2018-03-01
Water deficit is a problem on rainfed maize production but can be solved by proper land management. The objective of the study to determine the soil physical properties and maize yield affected by land management to adapt to drought. The experimental design was a randomized complete block using 5 treatments with 4 repetitions, including: (i) Control (KO), (ii) Rice Straw Mulched (MC), (iii) Compost Fertilizer (CF), (iv) In-Organic Fertilizer (AF), (v) Legume Cover crop (CC). Soil physical and maize growth properties namely soil moisture, soil texture, soil bulk density, plant height, biomass, and yield were investigated. The results showed that composting land increased soil water availability and provided nutrient to crops and thus increase soil physical properties, maize growth and yield. Although inorganic fertilizer also increased plant growth and yield, but it did not improve soil physical properties.
Identification of resistance to Maize rayado fino virus in maize inbred lines
Maize rayado fino virus (MRFV) is one of the most important virus diseases of maize in America. Severe yield losses, ranging from 10 to 50% in landraces to nearly 100% in contemporary cultivars, have been reported. Resistance has been reported in populations, but few inbred lines have been identifie...
Constitutional chromosome anomalies in patients with cerebral gigantism (Sotos syndrome).
Haeusler, G; Guchev, Z; Köhler, I; Schober, E; Haas, O; Frisch, H
1993-01-01
Two boys are presented with the clinical features of cerebral gigantism and chromosomal variants which have not been described so far in this syndrome. In the first boy a de novo pericentric inversion of chromosome Y was found, the karyotypes of all other investigated family members were normal. The patient had an obstructive hypertrophic cardiomyopathy and atrial septal defect type II. The second boy had inherited pericentric inversion of the heterochromatic region of chromosome 9 from his mother. This chromosome 9 variant was also found in his sister who had a similar phenotype but without gigantism. Endocrine evaluation demonstrated normal results in both boys. The intellectual achievement in both cases was average.
Energy Technology Data Exchange (ETDEWEB)
Adu-Gyamfi, J. J.; Aigner, M.; Linic, S. [Soil and Water Management and Crop Nutrition Laboratory, Seibersdorf (Austria); Gludovacz, D. [Nuclear Material Laboratory, Safeguard Analytical Services, International Atomic Energy Agency, Seibersdorf (Austria)
2013-11-15
A glasshouse pot experiment was conducted to evaluate the differential ability of maize (Zea mays) and soybean (Glycine max) to utilize soil phosphorus (P) for plant growth from total-P, available-P and inorganic (Ca-P, Al-P and Fe-P) soil P pools using a carrier-free {sup 32}P solution. A maize variety (DK 315) and a soybean variety (TGX 1910-4F) were grown in pots containing 1 kg of a low available P soil (Hungarian) or a medium available P (Waldviertel) soil labelled with {sup 32}P for 42 days or without {sup 32}P (unlabelled) for 42 and 60 days. The shoot and root biomass of maize and soybean were significantly greater when grown on the Waldviertel than on the Hungarian soils. The shoot P concentrations were higher for soybean (1.7-2.2 g kg{sup -1}) than for maize (1.1-1.4 g kg{sup -1}). The total radioactivity (dpm x 10{sup 6}) was higher in plants grown in Waldviertel than in Hungarian soil and the values reflected plant P uptake and shoot biomass of soybean and maize. The L-values ({mu}g P g soil{sup -1}) of maize and soybean were higher in Waldviertel (72-78) than in Hungarian (9.6-20) soil. No significant differences in L-values were observed for maize and soybean grown on the Waldviertel soil, but for the Hungarian soil, the L-values were higher for maize (20.0) than for soybean (9.6) suggesting that in this low-P soil, maize was more efficient than soybean in taking up soil P. The available P (Bray II) and the Ca-P were the fractions most depleted by plants followed by the Fe-P fractions in the two soils, but differences between the crops were not significant. When soil P is limited, maize and soybean are able to access P mainly from the available P (Bray II), Fe- and Ca-P sparingly soluble fractions and not Al-P from the soil. (author)
Adaptation of Methanogenic Inocula to Anaerobic Digestion of Maize Silage
Directory of Open Access Journals (Sweden)
Martyna Wojcieszak
2017-09-01
Full Text Available A well-balanced microbial consortium is crucial for efficient biogas production. In turn, one of a major factor that influence on the structure of anaerobic digestion (AD consortium is a source of microorganisms which are used as an inoculum. This study evaluated the influence of inoculum sources (with various origin on adaptation of a biogas community and the efficiency of the biomethanization of maize silage. As initial inocula for AD of maize silage the samples from: (i an agricultural biogas plant (ABP which utilizes maize silage as a main substrate, (ii cattle slurry (CS, which contain elevated levels of lignocelluloses materials, and (iii raw sewage sludge (RSS with low content of plant origin materials were used. The adaptation of methanogenic consortia was monitored during a series of passages, and the functionality of the adapted consortia was verified through start-up operation of AD in two-stage reactors. During the first stages of the adaptation phase, methanogenic consortia occurred very slowly, and only after several passages did the microbial community adapts to allow production of biogas with high methane content. The ABP consortium revealed highest biogas production in the adaptation and in the start-up process. The biodiversity dynamics monitored during adaptation and start-up process showed that community profile changed in a similar direction in three studied consortia. Native communities were very distinct to each other, while at the end of the Phase II of the start-up process microbial diversity profile was similar in all consortia. All adopted bacterial communities were dominated by representatives of Porphyromonadaceae, Rikenellaceae, Ruminococcaceae, and Synergistaceae. A shift from low acetate-preferring acetoclastic Methanosaetaceae (ABP and RSS and/or hydrogenotrophic Archaea, e.g., Methanomicrobiaceae (CS prevailing in the inoculum samples to larger populations of high acetate-preferring acetoclastic
Johnson, Eric T; Berhow, Mark A; Dowd, Patrick F
2007-04-18
Hi II maize (Zea mays) plants were engineered to express maize p1 cDNA, a Myb transcription factor, controlled by a putative silk specific promoter, for secondary metabolite production and corn earworm resistance. Transgene expression did not enhance silk color, but about half of the transformed plant silks displayed browning when cut, which indicated the presence of p1-produced secondary metabolites. Levels of maysin, a secondary metabolite with insect toxicity, were highest in newly emerged browning silks. The insect resistance of transgenic silks was also highest at emergence, regardless of maysin levels, which suggests that other unidentified p1-induced molecules likely contributed to larval mortality. Mean survivor weights of corn earworm larvae fed mature browning transgenic silks were significantly lower than weights of those fed mature nonbrowning transgenic silks. Some transgenic pericarps browned with drying and contained similar molecules found in pericarps expressing a dominant p1 allele, suggesting that the promoter may not be silk-specific.
Bueno, Danilo; Palacios-Gimenez, Octavio Manuel; Martí, Dardo Andrea; Mariguela, Tatiane Casagrande; Cabral-de-Mello, Diogo Cavalcanti
2016-08-01
The 5S ribosomal DNA (rDNA) sequences are subject of dynamic evolution at chromosomal and molecular levels, evolving through concerted and/or birth-and-death fashion. Among grasshoppers, the chromosomal location for this sequence was established for some species, but little molecular information was obtained to infer evolutionary patterns. Here, we integrated data from chromosomal and nucleotide sequence analysis for 5S rDNA in two Abracris species aiming to identify evolutionary dynamics. For both species, two arrays were identified, a larger sequence (named type-I) that consisted of the entire 5S rDNA gene plus NTS (non-transcribed spacer) and a smaller (named type-II) with truncated 5S rDNA gene plus short NTS that was considered a pseudogene. For type-I sequences, the gene corresponding region contained the internal control region and poly-T motif and the NTS presented partial transposable elements. Between the species, nucleotide differences for type-I were noticed, while type-II was identical, suggesting pseudogenization in a common ancestor. At chromosomal point to view, the type-II was placed in one bivalent, while type-I occurred in multiple copies in distinct chromosomes. In Abracris, the evolution of 5S rDNA was apparently influenced by the chromosomal distribution of clusters (single or multiple location), resulting in a mixed mechanism integrating concerted and birth-and-death evolution depending on the unit.
Truter, J; Van Hamburg, H; Van Den Berg, J
2014-02-01
The biodiversity of an agroecosystem is not only important for its intrinsic value but also because it influences ecological functions that are vital for crop production in sustainable agricultural systems and the surrounding environment. A concern about genetically modified (GM) crops is the potential negative impact that such crops could have on diversity and abundance of nontarget organisms, and subsequently on ecosystem functions. Therefore, it is essential to assess the potential environmental risk of the release of a GM crop and to study its effect on species assemblages within that ecosystem. Assessment of the impact of Bt maize on the environment is hampered by the lack of basic checklists of species present in maize agroecosystems. The aims of the study were to compile a checklist of arthropods that occur on maize in South Africa and to compare the diversity and abundance of arthropods and functional groups on Bt maize and non-Bt maize. Collections of arthropods were carried out during two growing seasons on Bt maize and non-Bt maize plants at two localities. Three maize fields were sampled per locality during each season. Twenty plants, each of Bt maize and non-Bt maize, were randomly selected from the fields at each site. The arthropods collected during this study were classified to morphospecies level and grouped into the following functional groups: detritivores, herbivores, predators, and parasitoids. Based on feeding strategy, herbivores and predators were further divided into sucking herbivores or predators (piercing-sucking mouthparts) and chewing herbivores or predators (chewing mouthparts). A total of 8,771 arthropod individuals, comprising 288 morphospecies and presenting 20 orders, were collected. Results from this short-term study indicated that abundance and diversity of arthropods in maize and the different functional guilds were not significantly affected by Bt maize, either in terms of diversity or abundance.
DEFF Research Database (Denmark)
Zaralis, K.; Nørgaard, P.; Helander, C.
2014-01-01
Whole-crop maize silage as forage in diets of finishing cattle can promote high intakes and thus, enhances animal performance. In the present study we evaluated the effect of whole-crop maize maturity at harvest and the proportion of maize-silage in diets of finishing bulls, on feed intake...... of treatments, involving two maturity stages of maize at harvest (i.e. dough stage or dent stage) and two maize silage proportions (i.e. 100% maize silage or 50% maize and 50% grass silage). The diets were offered ad libitum as total mixed rations (TMRs) with inclusion of concentrates (i.e. rolled barley; dried...... distillers’ grain plus soluble; cold-pressed rapeseed cake) in a 40% proportion on DM basis. All animals were slaughtered at a target body weight of 630 kg. Bulls fed on diets containing maize silage as sole forage achieved higher live-weight gain (P
Directory of Open Access Journals (Sweden)
Zenzes Maria
2004-09-01
Full Text Available Abstract We investigated whether nicotine exposure in vitro of mouse oocytes affects spindle and chromosome function during meiotic maturation (M-I and M-II. Oocytes in germinal vesicle (GV stage were cultured in nicotine for 8 h or for 16 h, to assess effects in M-I and in metaphase II (M-II. The latter culture setting used the three protocols: 8 h nicotine then 8 h medium (8N + 8M; 16 h nicotine (16N; 8 h medium then 8 h nicotine (8M + 8N. Non-toxic concentrations of nicotine at 1.0, 2.5, 5.0 and 10.0 mmol/L were used. Spindle-chromosome configurations were analyzed with wide-field optical sectioning microscopy. In 8 h cultures, nicotine exposure resulted in dose-related increased proportions of M-I oocytes with defective spindle-chromosome configurations. A dose-related delayed entry into anaphase I was also detected. In 16 h cultures, nicotine exposure for the first 8 h (8N + 8M, or for 16 h (16N, resulted in dose- and time-related increased proportions of oocytes arrested in M-I (10 mmol/L; 8 h: 53.2%, controls 9.6%; 16 h: 87.6%, controls 8.5%. Defects in M-I spindles and chromosomes caused M-I arrest leading to dose-related decreased proportions of oocytes that reached metaphase-II (10 mmol/L 8 h: 46.8%, controls 90.4%;16 h: 12.4%, controls 91.5%. A delayed anaphase-I affected the normal timing of M-II, leading to abnormal oocytes with dispersed chromosomes, or with double spindles and no polar body. Nicotine exposure during the second 8 h (8M + 8N resulted in dose-related, increased proportions of M-II oocytes with defective spindles and chromosomes (10 mmol/L: 42.9%, controls 2.0%. Nicotine has no adverse effects on GV break down, but induces spindle and chromosome defects compromising oocyte meiotic maturation and development.
Effect of endosperm mutants on maize seed germination
Directory of Open Access Journals (Sweden)
Pajić Zorica
2004-01-01
Full Text Available The expression of genetic potential of yielding and quality of a certain genotype depends among other factors on seed quality. Seed is very important not only for the reproduction of the particular plant species, but also, for the contemporary plant production. Each part of maize seed (pericarp endosperm and germ has a specific function in the complex process of germination and emergence. The following three genotypes of different endosperm types were observed: ZPSC 42A (standard grain quality dent hybrid ZPSC 504 su (sweet maize hybrid with a sugary gene and ZPSyn.II sh2 (synthetic population with a shranken2 gene. Seed viability of the stated genotypes was determined by the accepted ISTA methods: standard method accelerating age and cold test. Obtained results point out to differences in the germination capacity of the observed genotypes. The greatest reduction of the germination capacity and the emergence rate was expressed by the application of the accelerating ageing method. Appeared differences are probably a result of the endosperm texture (type, grain weight, sugar content and pericarp thickens and composition.
DEFF Research Database (Denmark)
Duigou, Stephane; Knudsen, Kristine Groth; Skovgaard, Ole
2006-01-01
Although the two Vibrio cholerae chromosomes initiate replication in a coordinated fashion, we show here that each chromosome appears to have a specific replication initiator. DnaA overproduction promoted overinitiation of chromosome I and not chromosome II. In contrast, overproduction of RctB, a...
Directory of Open Access Journals (Sweden)
Walaa Kamel Mousa
2015-10-01
Full Text Available Wild maize (teosinte has been reported to be less susceptible to pests than their modern maize (corn relatives. Endophytes, defined as microbes that inhabit plants without causing disease, are known for their ability to antagonize plant pests and pathogens. We hypothesized that the wild relatives of modern maize may host endophytes that combat pathogens. Fusarium graminearum is the fungus that causes Gibberella Ear Rot (GER in modern maize and produces the mycotoxin, deoxynivalenol (DON. In this study, 215 bacterial endophytes, previously isolated from diverse maize genotypes including wild teosintes, traditional landraces and modern varieties, were tested for their ability to antagonize F. graminearum in vitro. Candidate endophytes were then tested for their ability to suppress GER in modern maize in independent greenhouse trials. The results revealed that three candidate endophytes derived from wild teosintes were most potent in suppressing F. graminearum in vitro and GER in a modern maize hybrid. These wild teosinte endophytes could suppress a broad spectrum of fungal pathogens of modern crops in vitro. The teosinte endophytes also suppressed DON mycotoxin during storage to below acceptable safety threshold levels. A fourth, less robust anti-fungal strain was isolated from a modern maize hybrid. Three of the anti-fungal endophytes were predicted to be Paenibacillus polymyxa, along with one strain of Citrobacter. Microscopy studies suggested a fungicidal mode of action by all four strains. Molecular and biochemical studies showed that the P. polymyxa strains produced the previously characterized anti-Fusarium compound, fusaricidin. Our results suggest that the wild relatives of modern crops may serve as a valuable reservoir for endophytes in the ongoing fight against serious threats to modern agriculture. We discuss the possible impact of crop evolution and domestication on endophytes in the context of plant defense.
Araripe, L O; Tao, Y; Lemos, B
2016-06-01
Y chromosomes display population variation within and between species. Co-evolution within populations is expected to produce adaptive interactions between Y chromosomes and the rest of the genome. One consequence is that Y chromosomes from disparate populations could disrupt harmonious interactions between co-evolved genetic elements and result in reduced male fertility, sterility or inviability. Here we address the contribution of 'heterospecific Y chromosomes' to fertility in hybrid males carrying a homozygous region of Drosophila mauritiana introgressed in the Drosophila simulans background. In order to detect Y chromosome-autosome interactions, which may go unnoticed in a single-species background of autosomes, we constructed hybrid genotypes involving three sister species: Drosophila simulans, D. mauritiana, and D. sechellia. These engineered strains varied due to: (i) species origin of the Y chromosome (D. simulans or D. sechellia); (ii) location of the introgressed D. mauritiana segment on the D. simulans third chromosome, and (iii) grandparental genomic background (three genotypes of D. simulans). We find complex interactions between the species origin of the Y chromosome, the identity of the D. mauritiana segment and the grandparental genetic background donating the chromosomes. Unexpectedly, the interaction of the Y chromosome and one segment of D. mauritiana drastically reduced fertility in the presence of Ysim, whereas the fertility is partially rescued by the Y chromosome of D. sechellia when it descends from a specific grandparental genotype. The restoration of fertility occurs in spite of an autosomal and X-linked genome that is mostly of D. simulans origin. These results illustrate the multifactorial basis of genetic interactions involving the Y chromosome. Our study supports the hypothesis that the Y chromosome can contribute significantly to the evolution of reproductive isolation and highlights the conditional manifestation of infertility in
Condensins: universal organizers of chromosomes with diverse functions.
Hirano, Tatsuya
2012-08-01
Condensins are multisubunit protein complexes that play a fundamental role in the structural and functional organization of chromosomes in the three domains of life. Most eukaryotic species have two different types of condensin complexes, known as condensins I and II, that fulfill nonoverlapping functions and are subjected to differential regulation during mitosis and meiosis. Recent studies revealed that the two complexes contribute to a wide variety of interphase chromosome functions, such as gene regulation, recombination, and repair. Also emerging are their cell type- and tissue-specific functions and relevance to human disease. Biochemical and structural analyses of eukaryotic and bacterial condensins steadily uncover the mechanisms of action of this class of highly sophisticated molecular machines. Future studies on condensins will not only enhance our understanding of chromosome architecture and dynamics, but also help address a previously underappreciated yet profound set of questions in chromosome biology.
"Achieving Mexico’s Maize Potential"
Antonio Turrent Fernández; Timothy A. Wise; Elise Garvey
2012-01-01
Rising agricultural prices, combined with growing import dependence, have driven Mexico’s food import bill over $20 billion per year and increased its agricultural trade deficit. Mexico imports one-third of its maize, overwhelmingly from the United States, but three million producers grow most of the country’s white maize, which is used primarily for tortillas and many other pluricultural products for human consumption. Yield gaps are large among the country’s small to medium-scale maize farm...
Y-chromosomal STR haplotypes in Inuit and Danish population samples
DEFF Research Database (Denmark)
Bosch, Elena; Rosser, Zoë H; Nørby, Søren
2003-01-01
Nineteen Y-chromosomal short tandem repeats (STRs), DYS19, DYS389-I, DYS389-II, DYS390, DYS391, DYS392, DYS393, DYS385, DYS388, DYS434, DYS435, DYS436, DYS437, DYS438, DYS439, DYS460, DYS461 and DYS462 were typed in Inuit (n=70) and Danish (n=62) population samples.......Nineteen Y-chromosomal short tandem repeats (STRs), DYS19, DYS389-I, DYS389-II, DYS390, DYS391, DYS392, DYS393, DYS385, DYS388, DYS434, DYS435, DYS436, DYS437, DYS438, DYS439, DYS460, DYS461 and DYS462 were typed in Inuit (n=70) and Danish (n=62) population samples....
Digital Repository Service at National Institute of Oceanography (India)
Goswami, U.; Goswami, S.C.
Pontellopsis herdmani and Pontella princeps (Pontellidae, Calanoida, Copepoda) showed a diploid number of 20 and a haploid number of 10 chromosomes during the spermatogonial metaphase and metaphase II stages. The chromosomes were in the size range...
Energy Technology Data Exchange (ETDEWEB)
Zorn, C; Cremer, T; Cremer, C; Zimmer, J
1977-12-29
Laser uv microirradiation of Chinese hamster interphase cells combined with caffeine post-treatment produced different patterns of chromosome damage in mitosis following irradiation of a small area of the nucleus that may be classified in three categories: (I) intact metaphase figures, (II) chromosome damage confined to a small area of the metaphase spread, (III) mitotic figures with damage on all chromosomes. Category III might be the consequence of a non-localized distortion of nuclear metabolism. By contrast, category II may reflect localized DNA damage induced by microirradiation, which could not be efficiently repaired due to the effect of caffeine. If this interpretation is right, in metaphase figures of category II chromosome damage should occur only at the irradiation site. The effect might then be used to investigate neighbourhood relationships of individual chromosomes in the interphase nucleus.
Exploring maize-legume intercropping systems in Southwest Mexico
Flores-Sanchez, D.; Pastor, A.V.; Lantinga, E.A.; Rossing, W.A.H.; Kropff, M.J.
2013-01-01
Maize yields in continuous maize production systems of smallholders in the Costa Chica, a region in Southwest Mexico, are low despite consistent inputs of fertilizers and herbicides. This study was aimed at investigating the prospects of intercropping maize (Zea mays L.) and maize-roselle (Hibiscus
Bøhn, Thomas; Aheto, Denis W; Mwangala, Felix S; Fischer, Klara; Bones, Inger Louise; Simoloka, Christopher; Mbeule, Ireen; Schmidt, Gunther; Breckling, Broder
2016-10-03
Gene flow in agricultural crops is important for risk assessment of genetically modified (GM) crops, particularly in countries with a large informal agricultural sector of subsistence cultivation. We present a pollen flow model for maize (Zea mays), a major staple crop in Africa. We use spatial properties of fields (size, position) in three small-scale maize farming communities in Zambia and estimate rates of cross-fertilisation between fields sown with different maize varieties (e.g. conventional and transgene). As an additional factor contributing to gene flow, we present data on seed saving and sharing among farmers that live in the same communities. Our results show that: i) maize fields were small and located in immediate vicinity of neighboring fields; ii) a majority of farmers saved and shared seed; iii) modeled rates of pollen-mediated gene flow showed extensive mixing of germplasm between fields and farms and iv) as a result, segregation of GM and non-GM varieties is not likely to be an option in these systems. We conclude that the overall genetic composition of maize, in this and similar agricultural contexts, will be strongly influenced both by self-organised ecological factors (pollen flow), and by socially mediated intervention (seed recycling and sharing).
DEFF Research Database (Denmark)
Odgaard, Mette Vestergaard; Bøcher, Peder Klith; Dalgaard, Tommy
2011-01-01
It is expected that the ongoing anthropogenic climate change will drive changes in agricultural production and its geographic distribution. Here, we assess the extent to which climate change is already driving spatiotemporal dynamics in maize production in Denmark. We use advanced spatial...... regression modeling with multi-model averaging to assess the extent to which the recent spatiotemporal dynamics of the maize area in Denmark are driven by climate (temperature as represented by maize heating units [MHU] and growing-season precipitation), climate change and non-climatic factors (cattle...... cultivation and cattle farming, probably reflecting a change to a more favorable climate for maize cultivation: in the beginning of the study period, northern areas were mostly too cold for maize cultivation, irrespective of cattle density, but this limitation has been diminishing as climate has warmed...
Energy Technology Data Exchange (ETDEWEB)
Persson, Tomas; Garcia y Garcia, Axel; Paz, Joel O.; Hoogenboom, Gerrit [Department of Biological and Agricultural Engineering, 1109 Experiment Street, The University of Georgia, Griffin, GA 30223 (United States); Jones, James W. [Department of Agricultural and Biological Engineering, Frazier Rogers Hall, University of Florida, Gainesville, FL 32611 (United States)
2009-08-15
A recent increase in the demand for bio-ethanol has sparked maize production in the USA and other countries across the world. The net energy value (NEV), i.e. the energy output in ethanol and co-products after accounting for energy input requirements in the production chain of ethanol, is a measure of its sustainability. Grain yield of maize, which varies substantially across different climate and soil conditions, greatly impacts the ethanol NEV. The objectives of this study were to determine i) the NEV of ethanol produced from maize grown in four production regions in the southeastern USA and, ii) the specific impact of local soil variability under the same climate conditions within the four regions on the NEV of maize-ethanol. Maize yield was simulated with the Cropping System Model (CSM)-CERES-Maize model for soil and weather conditions, and management practices representing Bulloch, Floyd, Laurens and Mitchell counties, Georgia, USA. The calculation of ethanol NEV took into account the energy inputs and outputs of the entire ethanol production chain, and was based on the crop simulations. There were statistically significant differences in ethanol NEV among the counties, and within counties due to local soil variability. Differences in ethanol NEV among counties were partially due to different transportation distances. Based on the results of this study, it was concluded that maize-ethanol NEV can be increased by accounting for the soil and climate factors in the feedstock production and by locating ethanol-processing facilities in regions with soil and climate conditions that are favorable for ethanol-maize production. (author)
New insights into human nondisjunction of chromosome 21 in oocytes.
Directory of Open Access Journals (Sweden)
Tiffany Renee Oliver
2008-03-01
Full Text Available Nondisjunction of chromosome 21 is the leading cause of Down syndrome. Two risk factors for maternal nondisjunction of chromosome 21 are increased maternal age and altered recombination. In order to provide further insight on mechanisms underlying nondisjunction, we examined the association between these two well established risk factors for chromosome 21 nondisjunction. In our approach, short tandem repeat markers along chromosome 21 were genotyped in DNA collected from individuals with free trisomy 21 and their parents. This information was used to determine the origin of the nondisjunction error and the maternal recombination profile. We analyzed 615 maternal meiosis I and 253 maternal meiosis II cases stratified by maternal age. The examination of meiosis II errors, the first of its type, suggests that the presence of a single exchange within the pericentromeric region of 21q interacts with maternal age-related risk factors. This observation could be explained in two general ways: 1 a pericentromeric exchange initiates or exacerbates the susceptibility to maternal age risk factors or 2 a pericentromeric exchange protects the bivalent against age-related risk factors allowing proper segregation of homologues at meiosis I, but not segregation of sisters at meiosis II. In contrast, analysis of maternal meiosis I errors indicates that a single telomeric exchange imposes the same risk for nondisjunction, irrespective of the age of the oocyte. Our results emphasize the fact that human nondisjunction is a multifactorial trait that must be dissected into its component parts to identify specific associated risk factors.
A global analysis of Y-chromosomal haplotype diversity for 23 STR loci
DEFF Research Database (Denmark)
Purps, Josephine; Siegert, Sabine; Willuweit, Sascha
2014-01-01
In a worldwide collaborative effort, 19,630 Y-chromosomes were sampled from 129 different populations in 51 countries. These chromosomes were typed for 23 short-tandem repeat (STR) loci (DYS19, DYS389I, DYS389II, DYS390, DYS391, DYS392, DYS393, DYS385ab, DYS437, DYS438, DYS439, DYS448, DYS456, DY...
Breeding for Quality Protein Maize (QPM Varieties: A Review
Directory of Open Access Journals (Sweden)
Liliane N. Tandzi
2017-11-01
Full Text Available The nutritional evaluation of quality protein maize (QPM in feeding trials has proved its nutritional superiority over non-QPM varieties for human and livestock consumption. The present paper reviews some of the most recent achievements in development of QPM varieties using both conventional and molecular breeding under stressed and non-stressed environments. It is evident that numerous QPM varieties have been developed and released around the world over the past few decades. While the review points out some gaps in information or research efforts, challenges associated with adoption QPM varieties are highlighted and suggestions to overcome them are presented. The adoption of released varieties and challenges facing QPM production at the farmer level are also mentioned. Several breeding methods have been conventionally used to develop QPM varieties in stressed (drought, low soil nitrogen, resistance to grey leaf spot, Turcicum leaf blight, ear rot, and Striga and non-stressed environments. At least three genetic loci have been found to be implicated in controlling the levels of a protein synthesis factor correlated with lysine. They have been mapped on chromosomes 2, 4, and 7. While the use of molecular approaches will improve the efficiency and speed of variety development, the cost implications might limit the use of these technologies in the developing world. More emphasis should be given to breeding QPM for tolerance to environmental stresses, such as low soil pH, heat, and combined heat and drought stress. The post-harvest attack of QPM grains should also be considered. The adoption of QPM genotypes by farmers has been found to be limited mainly due to the minimal collaboration between maize breeders, farmers, agricultural extension workers, and other relevant stakeholders, as well as the need for isolating QPM varieties from normal maize. Therefore, there is need to use participatory plant breeding (PPB and/or participatory variety
TCUP: A novel hAT transposon active in maize tissue culture
Directory of Open Access Journals (Sweden)
Alan eSmith
2012-01-01
Full Text Available Transposable elements are capable of inducing heritable de novo genetic variation. The sequences capable of reactivation, and environmental factors that induce mobilization, remain poorly defined even in well-studied genomes such as maize. We treated maize tissue culture with the demethylating agent 5-aza-2-deoxcytidine and examined long-term tissue culture lines to discover silenced transposable elements that have the potential to induce heritable genetic variation. Through these screens we have identified a novel low copy number hAT transposon, Tissue Culture Up-Regulated (TCUP, which is transcribed at high levels in long-term maize Black Mexican Sweet (BMS tissue culture and up-regulated in response to treatment with 5-aza-2-deoxycytidine. Analysis of the TIGR Maize Gene Index revealed that this element is the most frequently represented EST from the BMS cell culture library and is not represented in other tissue libraries, which is the basis for its name. A full-length sequence was assembled in inbred B73 that contains the putative functional motifs required for autonomous movement of a hAT transposon. Transposon display detected movement of TCUP in two long-term tissue cultured cell lines of the genotype Hi-II AxB and BMS. This research implicates TCUP as a transposon that is capable of reactivation and which may also be particularly sensitive to the stress of the tissue culture environment. Our findings are consistent with the hypothesis that epigenetic alterations potentiate genomic responses to stress during clonal propagation of plants.
Chromosomal abnormality in patients with secondary amenorrhea.
Safai, Akbar; Vasei, Mohammad; Attaranzadeh, Armin; Azad, Fariborz; Tabibi, Narjes
2012-04-01
Secondary amenorrhea is a condition in which there is cessation of menses after at least one menstruation. It is a symptom of different diseases, such as hormonal disturbances which range from pituitary to ovarian origin, as well as chromosomal abnormalities. Knowledge of the distinct cause of secondary amenorrhea is of tremendous benefit for the management and monitoring of patients. In this study, we determine the chromosomal abnormalities in patients with secondary amenorrhea in Southwest Iran. We selected 94 patients with secondary amenorrhea who referred to our Cytogenetic Ward from 2004 until 2009. For karyotyping, peripheral blood lymphocyte cultures were set up by conventional technique. In this study, 5.3% (n=5) of patients with secondary amenorrhea presented with chromosomal abnormalities, of which all contained an X element. The chromosomal abnormalities were: i) 45, X (n=1); ii) 47, XXX (n=1); iii) 45, X [13]/ 45, Xi(X)q[17] (n=1); iv) 45, X[12]/46,X,+mar[12] (n=1); and v) 46,X,del(Xq)(q23q28) (n=1). Our study revealed that some causes of secondary amenorrhea could be due to chromosomal abnormalities. Therefore, cytogenetic studies should be important tests in the evaluation of patients with secondary amenorrhea.
H19 RNA binds four molecules of insulin-like growth factor II mRNA-binding protein
DEFF Research Database (Denmark)
Runge, Steffen; Nielsen, Finn Cilius; Nielsen, Jacob
2000-01-01
H19 RNA is a major oncofetal 2.5-kilobase untranslated RNA of unknown function. The maternally expressed H19 gene is located 90 kilobase pairs downstream from the paternally expressed insulin-like growth factor II (IGF-II) gene on human chromosome 11 and mouse chromosome 7; and due to their recip......H19 RNA is a major oncofetal 2.5-kilobase untranslated RNA of unknown function. The maternally expressed H19 gene is located 90 kilobase pairs downstream from the paternally expressed insulin-like growth factor II (IGF-II) gene on human chromosome 11 and mouse chromosome 7; and due...
Baltazar, Baltazar M; Castro Espinoza, Luciano; Espinoza Banda, Armando; de la Fuente Martínez, Juan Manuel; Garzón Tiznado, José Antonio; González García, Juvencio; Gutiérrez, Marco Antonio; Guzmán Rodríguez, José Luis; Heredia Díaz, Oscar; Horak, Michael J; Madueño Martínez, Jesús Ignacio; Schapaugh, Adam W; Stojšin, Duška; Uribe Montes, Hugo Raúl; Zavala García, Francisco
2015-01-01
Mexico, the center of origin of maize (Zea mays L.), has taken actions to preserve the identity and diversity of maize landraces and wild relatives. Historically, spatial isolation has been used in seed production to maintain seed purity. Spatial isolation can also be a key component for a strategy to minimize pollen-mediated gene flow in Mexico between transgenic maize and sexually compatible plants of maize conventional hybrids, landraces, and wild relatives. The objective of this research was to generate field maize-to-maize outcrossing data to help guide coexistence discussions in Mexico. In this study, outcrossing rates were determined and modeled from eight locations in six northern states, which represent the most economically important areas for the cultivation of hybrid maize in Mexico. At each site, pollen source plots were planted with a yellow-kernel maize hybrid and surrounded by plots with a white-kernel conventional maize hybrid (pollen recipient) of the same maturity. Outcrossing rates were then quantified by assessing the number of yellow kernels harvested from white-kernel hybrid plots. The highest outcrossing values were observed near the pollen source (12.9% at 1 m distance). The outcrossing levels declined sharply to 4.6, 2.7, 1.4, 1.0, 0.9, 0.5, and 0.5% as the distance from the pollen source increased to 2, 4, 8, 12, 16, 20, and 25 m, respectively. At distances beyond 20 m outcrossing values at all locations were below 1%. These trends are consistent with studies conducted in other world regions. The results suggest that coexistence measures that have been implemented in other geographies, such as spatial isolation, would be successful in Mexico to minimize transgenic maize pollen flow to conventional maize hybrids, landraces and wild relatives.
Water requirements for wheat and maize under climate change in North Nile Delta
Energy Technology Data Exchange (ETDEWEB)
Ouda, S.; Noreldin, T; Abd El-Latif, K.
2015-07-01
Determination of water requirements for wheat and maize under climate change is important for policy makers in Egypt. The objectives of this paper were to calculate (i) ETo and (ii) water requirements for wheat and maize crops grown in five governorates (Alexandria, Demiatte, Kafr El-Sheik, El-Dakahlia and El-Behira) located in North Nile Delta of Egypt under current climate and climate change. ECHAM5 climate model was used to develop A1B climate change scenario in 2020, 2030 and 2040. Monthly values of evapotranspiration (ETo) under the different scenarios in these governorates were calculated using Hargreaves-Samani equation (H-S). Then, these values were regressed on ETo values previously calculated by Penman-Monteith equation (P-M) and linear regression (prediction equations were developed for each governorate). The predicted ETo values were compared to the values of ETo calculated by P-M equation and the deviations between them were very low (RMSE/obs=0.04-0.06 mm and R2 =0.96-0.99). Water requirements for wheat and maize were calculated using BISm model under current climate and in 2020, 2030 and 2040. The results showed that average annual ETo would increase by low percentage in 2020 and 2030. However, in 2040 the increase would reach 8%. Water requirements are expected to increase by 2-3% for wheat and by 10-15% for maize, which would result in reduction of the cultivated area. Thus, it is very important to revise and fix the production system of wheat and maize, in terms of the used cultivars, fertilizer and irrigation application to overcome the risk of climate change. (Author)
Association of recurrent pregnancy loss with chromosomal ...
African Journals Online (AJOL)
Objective: To evaluate the association of parental and fetal chromosomal abnormalities with recurrent pregnancy loss in our area and to analyze the frequency of three types of hereditary thrombophilia's; (MTHFR C677T polymorphisms, FV Leiden G1691A mutation and Prothrombin (factor II) G20210A mutation) in these ...
[Chromomeric organization of interphase chromosomes in Drosophila melanogaster].
Zhuimulev, I F; Beliaeva, E S; Zykova, T Iu; Semeshin, V F; Demakov, S A; Demakova, O V; Goncharov, F P; Khoroshko, V A; Boldyreva, L V; Kokoza, E B; Pokholkiova, G V
2013-01-01
As a result of treatment of bioinformatic data on the genome localization of structural proteins, histone modifications, DNase-hypersensitive regions, replication origins (taken from modENCODE) and their cytological localization to polytene chromosome structures, it is shown here that two types of interphase chromosomes -polytene chromosomes from salivary glands and from mitotically dividing cells cultures - demonstrate identical pictures of interband/band, i. e. the same localization and length on physical map and the same sets of proteins. In the interbands of both chromosome types we find the proteins that control initiation of transcription (RNA-polymerase II, transcription factors), replication (ORC2) as well as proteins modifying nucleosome structure (WDS, NURF) and proteins of insulators (BEAF). The nucleosome density and H1 histone concentration in the interbands are depleted; localization of DNase-hypersensitive regions corresponds strictly to the interbands. So, we conclude that both polytene and cell line interphase chromosomes are arranged according to general principle and polytene chromosomes represent precise model of interphase chromosomes. The interbands play a critical role in the initiation of transcription and replication. The interbands of interphase chromosomes are the sites of 5' parts of genes, while the 3' gene ends are located in the adjacent bands. The constancy of interbands decondensation results in the conclusion that the "interbands" genes are constantly active, i. e. they contain "house-keeping" genes. The large late replicating bands contain genes that do not have direct contact to the adjoining interbands are usually polygenic and contain tissue-specific genes.
ORF Alignment: NC_000909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta
... St Louis, MO: Elsevier; 2017:chap 69. Taber's Medical Dictionary Online. Chromosome. www.tabers.com/tabersonline/view/Tabers-Dictionary/753321/all/chromosome?q=Chromosome&ti=0 . Accessed June 11, 2017.
Zhou, Zhiqiang; Zhang, Chaoshu; Zhou, Yu; Hao, Zhuanfang; Wang, Zhenhua; Zeng, Xing; Di, Hong; Li, Mingshun; Zhang, Degui; Yong, Hongjun; Zhang, Shihuang; Weng, Jianfeng; Li, Xinhai
2016-03-03
Plant architecture attributes, such as plant height, ear height, and internode number, have played an important role in the historical increases in grain yield, lodging resistance, and biomass in maize (Zea mays L.). Analyzing the genetic basis of variation in plant architecture using high density QTL mapping will be of benefit for the breeding of maize for many traits. However, the low density of molecular markers in existing genetic maps has limited the efficiency and accuracy of QTL mapping. Genotyping by sequencing (GBS) is an improved strategy for addressing a complex genome via next-generation sequencing technology. GBS has been a powerful tool for SNP discovery and high-density genetic map construction. The creation of ultra-high density genetic maps using large populations of advanced recombinant inbred lines (RILs) is an efficient way to identify QTL for complex agronomic traits. A set of 314 RILs derived from inbreds Ye478 and Qi319 were generated and subjected to GBS. A total of 137,699,000 reads with an average of 357,376 reads per individual RIL were generated, which is equivalent to approximately 0.07-fold coverage of the maize B73 RefGen_V3 genome for each individual RIL. A high-density genetic map was constructed using 4183 bin markers (100-Kb intervals with no recombination events). The total genetic distance covered by the linkage map was 1545.65 cM and the average distance between adjacent markers was 0.37 cM with a physical distance of about 0.51 Mb. Our results demonstrated a relatively high degree of collinearity between the genetic map and the B73 reference genome. The quality and accuracy of the bin map for QTL detection was verified by the mapping of a known gene, pericarp color 1 (P1), which controls the color of the cob, with a high LOD value of 80.78 on chromosome 1. Using this high-density bin map, 35 QTL affecting plant architecture, including 14 for plant height, 14 for ear height, and seven for internode number were detected
Directory of Open Access Journals (Sweden)
Adriano Marocco
2009-09-01
Full Text Available Planting maize under no-tillage is an increasing farming practice for sustainable agriculture and sound environmental management. Although several studies on yield of no-till maize have been done, there is few information about the effect of tillage on fumonisin contamination. The present study was done to determine the effect of notillage and conventional tillage with two rates of nitrogen on fumonisin content in kernels of continuous maize. Average grain contamination with fumonisins B1 and B2 over the years 2004-06 was not significantly different, with mean values of 1682, 1984 and 2504 μg kg-1, respectively. Fumonisin B1 was the most abundant toxin found in the samples. No-tillage significantly affected the incidence of fumonisins during the first year of the trial, in which fumonisin content was significantly higher with no-till (2008 μg kg-1 compared with conventional tillage (1355 μg kg-1. However, no-tillage did not significantly affect the incidence of fumonisins in the second and third years of the study. Fumonisin content at the rate of 300 kg N ha-1 was not statistically different compared to that obtained without N fertilization. The interaction between the soil management system and the rate of applied nitrogen was only evident in the second year. Our results indicate that fumonisin contamination was affected by no-tillage only in the first year. Nitrogen fertilization had no significant effect on fumonisin content in any year. The weather conditions during susceptible stages of maize development have probably overridden the effect of nitrogen fertilization.
Species of Cercospora associated with grey leaf spot of maize.
Crous, Pedro W; Groenewald, Johannes Z; Groenewald, Marizeth; Caldwell, Pat; Braun, Uwe; Harrington, Thomas C
2006-01-01
Grey leaf spot is a serious yield-reducing disease of maize (Zea mays) in many parts of the world where this crop is cultivated. The causal organism associated with the disease is Cercospora zeae-maydis. Two potential sibling species have been recognized as Groups I and II. The DNA sequences for the internal transcribed spacers (ITS1 & ITS2), the 5.8S rRNA gene, elongation factor 1-alpha, histone H3, actin and calmodulin gene regions suggest that Groups I and II are two distinct species. Furthermore, Cercospora zeae-maydis (Group I) can be distinguished from C. zeina sp. nov. (Group II) by its faster growth rate on artificial media, the ability to produce cercosporin, longer conidiophores, and broadly fusiform conidia. A PCR-based test that distinguishes the two species was developed using species-specific primers designed from the histone H3 gene.
Maize, tropical (Zea mays L.).
Assem, Shireen K
2015-01-01
Maize (Zea mays L.) is the third most important food crop globally after wheat and rice. In sub-Saharan Africa, tropical maize has traditionally been the main staple of the diet; 95 % of the maize grown is consumed directly as human food and as an important source of income for the resource-poor rural population. The biotechnological approach to engineer biotic and abiotic traits implies the availability of an efficient plant transformation method. The production of genetically transformed plants depends both on the ability to integrate foreign genes into target cells and the efficiency with which plants are regenerated. Maize transformation and regeneration through immature embryo culture is the most efficient system to regenerate normal transgenic plants. However, this system is highly genotype dependent. Genotypes adapted to tropic areas are difficult to regenerate. Therefore, transformation methods used with model genotypes adapted to temperate areas are not necessarily efficient with tropical lines. Agrobacterium-mediated transformation is the method of choice since it has been first achieved in 1996. In this report, we describe a transformation method used successfully with several tropical maize lines. All the steps of transformation and regeneration are described in details. This protocol can be used with a wide variety of tropical lines. However, some modifications may be needed with recalcitrant lines.
Directory of Open Access Journals (Sweden)
Olanite, J. A.
2017-06-01
Full Text Available Effects of Bambara nut and cowpea planted with maize at different times on nutritive quality of maize forage were investigated. The study was laid out in a Completely Randomized Design and the treatments were combination of crop types (Bambara nut-maize (MB and Cowpea-maize (MC and planting times of legumes (2 wks before planting maize, 2WBPM and 2 wks after planting maize, 2WAPM, and sole maize (as control. An experimental field measuring 19 m � 11 m was divided into 3 replicates; each replicate was sub-divided into 5 plots of dimension 3 m2 each, with 1 m and 2 m inter-plots and inter-blocks spacing respectively. Maize forage samples were harvested on each plot at 10 wks after planting, oven-dried, milled and analyzed to evaluate the chemical composition, mineral composition, in vitro gas production and post-incubation characteristics. Results revealed significant differences (P<0.05 among treatments with the highest (95.00% and least DM (92.12% values were recorded for MB 2WBPM and MC 2WAPM, respectively. CP values ranged from 10.36% in MB 2WBPM to 15.67% in MC 2WBPM but not significantly different from 14.19 % recorded for sole maize. Ash ranged from 7.00% in MB 2WAPM to 10.00% in sole maize. MC 2WBPM and sole maize had the highest (50.63% and least (38.40% in ADF content (P<0.05. ADL value (7.25% observed in MB 2WBPM was the highest, compared to the least (5.00% in sole maize. Sole maize recorded the least (40.40% and highest (25.91% cellulose and hemicellulose contents, respectively while MC 2WAPM had the highest (50.88% and lowest (15.80% values for cellulose and hemicellulose, respectively. Ca content (4.55g/kg of MB 2WAPM was lower than the other treatments. P content ranged from 3.54 g/kg in MB 2WAPM to 12.02 g/kg in MC 2WAPM. Gas production rates only varied (P<0.05 at the 3rd, 6th, 24th and 48th hours of incubation. MB 2WBPM yielded highest values of short chain fatty acids (0.09 �mol and metabolizable energy (3.08 MJ/kg while MB
Olivoto, T; Nardino, M; Carvalho, I R; Follmann, D N; Ferrari, M; Szareski, V J; de Pelegrin, A J; de Souza, V Q
2017-03-22
Methodologies using restricted maximum likelihood/best linear unbiased prediction (REML/BLUP) in combination with sequential path analysis in maize are still limited in the literature. Therefore, the aims of this study were: i) to use REML/BLUP-based procedures in order to estimate variance components, genetic parameters, and genotypic values of simple maize hybrids, and ii) to fit stepwise regressions considering genotypic values to form a path diagram with multi-order predictors and minimum multicollinearity that explains the relationships of cause and effect among grain yield-related traits. Fifteen commercial simple maize hybrids were evaluated in multi-environment trials in a randomized complete block design with four replications. The environmental variance (78.80%) and genotype-vs-environment variance (20.83%) accounted for more than 99% of the phenotypic variance of grain yield, which difficult the direct selection of breeders for this trait. The sequential path analysis model allowed the selection of traits with high explanatory power and minimum multicollinearity, resulting in models with elevated fit (R 2 > 0.9 and ε analysis is effective in the evaluation of maize-breeding trials.
A review on threat of gray leaf spot disease of maize in Asia
Directory of Open Access Journals (Sweden)
Narayan Bahadur Dhami
2015-12-01
Full Text Available Biotic and biotic constraints are yield limiting factors in maize producing regions. Among these gray leaf spot is a yield limiting foliar disease of maize in high land regions of Asia. This review is done from related different national and international journals, thesis, books, research papers etc. The objectives of this review are to become familiar with genetics and inheritance, epidemiology, symptoms and disease management strategies etc. High relative humidity, temperature, minimum tillage and maize monoculture are important factors responsible for disease development. The sibling species of Cercospora zeae-maydis (Tehon and Daniels, 1925 Group I and Group II and Cercospora sorghai var. maydis (Chupp, 1954 are associated with this disease. Pathogens colonize in maize debris. Conidia are the source of inoculums for disease spread. Severe blighting of leaves reduces sugars, stalk lodging and causes premature death of plants resulting in yield losses of up to 100%. Disease management through cultural practices is provisional. The use of fungicides for emergencies is effective however; their prohibitive cost and detrimental effects on the environment are negative consequences. The inheritance of tolerance is quantitative with small additive effects. The introgression of resistant genes among the crosses of resistant germplasm enhances the resistance. The crosses of resistant and susceptible germplasm possess greater stability than the crosses of susceptible and resistant germplasm. The development of gray leaf spot tolerant populations through tolerance breeding principle is an economical and sustainable approach to manage the disease.
A- or C-chromosomes, does it matter for the transfer of transgenes from ¤Brassica napus¤
DEFF Research Database (Denmark)
Tomiuk, J.; Hauser, T.P.; Bagger Jørgensen, Rikke
2000-01-01
of herbicide-tolerant plants was explained by selection against the C-chromosomes of B. napus in favor of the homeologous ii-chromosomes. Obviously, such C-chromosomes could be potential candidates as safe integration sites for transgenes. We considered these safety aspects using a simple population genetic...... model. Theory and experiments, however, do not favor the chromosomes of B. napus as safe candidates with respect to the introgression of transgenes into wild populations of B. rapa....
Characterization of Indian and exotic quality protein maize (QPM ...
African Journals Online (AJOL)
Polymorphism analysis and genetic diversity of normal maize and quality protein maize (QPM) inbreds among locally well adapted germplasm is a prerequisite for hybrid maize breeding program. The diversity analyses of 48 maize accessions including Indian and exotic germplasm using 75 simple sequence repeat (SSR) ...
International Nuclear Information System (INIS)
Shahid, M.A.; Rana, Z.A.; Haq, I.; Tariq, H.
2010-01-01
Field studies were carried out in the research area of the Ayub Agricultural Research Institute, Faisalabad to determine the most effective maize seed treatment against maize shoot fly Atherigona soccata (Rond.) and insecticide against maize borer Chilo partellus (Swinh.) Trials were conducted following RCBD and replicated three times during 2005-2006. Two seed treatments Confider (imidacloprid) 70 WS and pensidor 72% WP (5 and 7 mg/kg seed) along with Confider (imidaclorid) 200 SC at the rate 40 ml/acre in the trial against maize shoot fly whereas, flubendiamide 48%, emamection 1.9 EC, spinosad 240 EC. carbofuran 3 G, indoxacarb 150 SC, alphacypermethrine 20 EC, monomehypo 5 G, bifenthrin 10 EC, cartap 4G, cyhalothrine 2.5 EC, cypermethrin 10 EC at the rate 20 ml, 150 ml, 40 ml, 8 kg, 150 ml, 200 ml, 5 kg, 150 ml, 6 kg. 250 ml and 300 ml per acre against maize borer were treated keeping one plo ast untreated check. Treatments were repeated as borer infestation reached above 5% level. All the seed treatments showed significant control of maize shoot fly in spite of dose 5 or 7 mg/kg seed along with foliar spray of confider 200 SC. The insecticides viz. flubendiamide 48% SC. emamectin 1.9 EC, spinosad 240 EC and carbofuran 3 G. indoxacarb 150 SC. alpha cypermethrin 20 EC, not only responded highest yield 5765, 5294, 5289, 5215, 5168 and 5025 kg/ha respectively but also manage the maize borer below ETL. (author)
Wondwosen, Betelehem; Hill, Sharon R; Birgersson, Göran; Seyoum, Emiru; Tekie, Habte; Ignell, Rickard
2017-01-23
Maize cultivation contributes to the prevalence of malaria mosquitoes and exacerbates malaria transmission in sub-Saharan Africa. The pollen from maize serves as an important larval food source for Anopheles mosquitoes, and females that are able to detect breeding sites where maize pollen is abundant may provide their offspring with selective advantages. Anopheles mosquitoes are hypothesized to locate, discriminate among, and select such sites using olfactory cues, and that synthetic volatile blends can mimic these olfactory-guided behaviours. Two-port olfactometer and two-choice oviposition assays were used to assess the attraction and oviposition preference of gravid Anopheles arabiensis to the headspace of the pollen from two maize cultivars (BH-660 and ZM-521). Bioactive compounds were identified using combined gas chromatography and electroantennographic detection from the headspace of the cultivar found to be most attractive (BH-660). Synthetic blends of the volatile compounds were then assessed for attraction and oviposition preference of gravid An. arabiensis, as above. Here the collected headspace volatiles from the pollen of two maize cultivars was shown to differentially attract and stimulate oviposition in gravid An. arabiensis. Furthermore, a five-component synthetic maize pollen odour blend was identified, which elicited the full oviposition behavioural repertoire of the gravid mosquitoes. The cues identified from maize pollen provide important substrates for the development of novel control measures that modulate gravid female behaviour. Such measures are irrespective of indoor or outdoor feeding and resting patterns, thus providing a much-needed addition to the arsenal of tools that currently target indoor biting mosquitoes.
Oliveira, Halley; Stolf-Moreira, Renata; Martinez, Cláudia; Sousa, Gustavo; Grillo, Renato; de Jesus, Marcelo; Fraceto, Leonardo
2015-10-01
Poly(epsilon-caprolactone) (PCL) nanocapsules have been used as a carrier system for the herbicide atrazine, which is commonly applied to maize. We demonstrated previously that these atrazine containing polymeric nanocapsules were ten-fold more effective in the control of mustard plants (a target species), as compared to a commercial atrazine formulation. Since atrazine can have adverse effects on non-target crops, here we analyzed the effect of encapsulated atrazine on growth, physiological and oxidative stress parameters of soil-grown maize plants (Zea mays L.). One day after the post-emergence treatment with PCL nanocapsules containing atrazine (1 mg mL-1), maize plants presented 15 and 21 % decreases in maximum quantum yield of photosystem II and in net CO2 assimilation rate, respectively, as compared to water-sprayed plants. The same treatment led to a 1.8-fold increase in leaf lipid peroxidation in comparison with control plants. However, all of these parameters were unaffected four and eight days after the application of encapsulated atrazine. These results suggested that the negative effects of atrazine were transient, probably due to the ability of maize plants to detoxify the herbicide. When encapsulated atrazine was applied at a ten-fold lower concentration (0.1 mg mL-1), a dosage that is still effective for weed control, no effects were detected even shortly after application. Regardless of the herbicide concentration, neither pre- nor post-emergence treatment with the PCL nanocapsules carrying atrazine resulted in the development of any macroscopic symptoms in maize leaves, and there were no impacts on shoot growth. Additionally, no effects were observed when plants were sprayed with PCL nanocapsules without atrazine. Overall, these results suggested that the use of PCL nanocapsules containing atrazine did not lead to persistent side effects in maize plants, and that the technique could offer a safe tool for weed control without affecting crop growth.
Directory of Open Access Journals (Sweden)
Denise Freitas Silva
2011-08-01
Full Text Available Irrigation use constitutes an alternative to improve maize production in Central Minas Gerais State, Brazil. However, even under adequate water supply conditions, other environmental factors may influence maize crop growth and development and may, ultimately, affect grain yield. This study aimed to establish a sowing window for irrigated maize crop, based on simulation results obtained with the decision support model CSM-CERES-Maize. Simulations were made for crop management conditions of Riacho´s Farm, located in Matozinhos, Minas Gerais State, Brazil. It was employed the model´s seasonal tool, along with a data set containing 46 years of weather data records, to simulate maize yield for weekly sowing scenarios, starting on August 1st and ending on July 24th of each year. One defined an irrigated maize sowing window, taking into account the yield break risk that a farmer would be willing to take. The model proved to be an interesting tool to assist in decision making, regarding crop and irrigation management, for an irrigated maize production system. Assuming a 10% yield break in the expected average maximum maize yield, it was defined as sowing window, the period from January 23rd to March 6th, with February 20th as the best sowing date. Other sowing windows may be established according to the risk that the farmer would be willing to take.
Status and prospects of maize research in Nepal
Directory of Open Access Journals (Sweden)
Govind KC
2015-12-01
Full Text Available Food and nutritional securities are the major threats coupled with declining factor productivity and climate change effects in Nepal. Maize being the principal food crops of the majority of the hill people and source of animal feed for ever growing livestock industries in Terai of Nepal. Despite the many efforts made to increase the maize productivity in the country, the results are not much encouraging. Many of the maize based technologies developed and recommended for the farmers to date are not fully adopted. Therefore, problem is either on technology development or on dissemination or on both. Considering the above facts, some of the innovative and modern approaches of plant breeding and crop management technologies to increase the maize yield need to be developed and disseminated. There is a need for location-specific maize production technologies, especially for lowland winter maize, marginal upland maize production system, and resource poor farmers. Research efforts can be targeted to address both yield potential and on-farm yields by reducing the impacts of abiotic and biotic constraints. Therefore, in order to streamline the future direction of maize research in Nepal, an attempt has been made in this article to highlight the present status and future prospects with few key pathways.
International Nuclear Information System (INIS)
Zuo Yuanmei; Chen Qing; Zhang Fusuo
2004-01-01
The related mechanisms of root exudates of maize in improvement iron nutrition of peanut intercropped with maize was investigated by 14 C tracer technique. Neighboring roots between maize and peanut were separated by a 30 μm nylon net, the iron nutrition of peanut was also improved just like normal intercropping of maize and peanut. The results proved that root exudates of maize played an important role in improvement iron nutrition of peanut. The photosynthesis carbohydrate of maize could exuded into the rhizosphere of peanut and transfer into shoot and root of peanut in intercropping system. Root exudates of maize could increased efficiency of iron in soil and improved iron utilization of peanut
Selection for drought tolerance in two tropical maize populations ...
African Journals Online (AJOL)
Drought is a major factor limiting maize (Zea mays L.) yield in much of the world. The need to breed maize cultivars with improved drought tolerance is apparent. This study compared two maize populations, ZM601 and ZM607 for drought tolerance during flowering, the most drought-vulnerable period for the maize plant.
Demarre, Gaëlle; Chattoraj, Dhruba K
2010-05-06
DNA adenine methylation is widely used to control many DNA transactions, including replication. In Escherichia coli, methylation serves to silence newly synthesized (hemimethylated) sister origins. SeqA, a protein that binds to hemimethylated DNA, mediates the silencing, and this is necessary to restrict replication to once per cell cycle. The methylation, however, is not essential for replication initiation per se but appeared so when the origins (oriI and oriII) of the two Vibrio cholerae chromosomes were used to drive plasmid replication in E. coli. Here we show that, as in the case of E. coli, methylation is not essential for oriI when it drives chromosomal replication and is needed for once-per-cell-cycle replication in a SeqA-dependent fashion. We found that oriII also needs SeqA for once-per-cell-cycle replication and, additionally, full methylation for efficient initiator binding. The requirement for initiator binding might suffice to make methylation an essential function in V. cholerae. The structure of oriII suggests that it originated from a plasmid, but unlike plasmids, oriII makes use of methylation for once-per-cell-cycle replication, the norm for chromosomal but not plasmid replication.
Y-chromosome STR haplotypes in Danes
DEFF Research Database (Denmark)
Hallenberg, Charlotte; Nielsen, Karsten; Simonsen, Bo Thisted
2005-01-01
A total of 185 unrelated Danish males were typed for the Y-chromosome STRs DYS19, DYS385a/b, DYS389-I, DYS389-II, DYS390, DYS391, DYS392, DYS393, DYS437, DYS438 and DYS439 using the kits PowerPlex Y (Promega), ReliaGene Y-Plex 6 and ReliaGene Y-Plex 5 (Reliagene Technologies). A total of 163...
Effects of maize planting patterns on the performance of cassava ...
African Journals Online (AJOL)
sola
The design was a split-plot arrangement, laid out in a randomized ... significant differences (P<0.05) between the treatments in the growth and yield parameters of maize. The mean effects of companion crops on maize leaf area were 0.61, 0.60, 0.60 and 0.52 m2/plant for sole maize, maize / melon, maize / cassava and.
Developing Inset Resistant Maize Varieties for Food Security in Kenya
International Nuclear Information System (INIS)
Mugo, S.
2002-01-01
The Insect Resistant Maize for Africa (IRMA) project aims at increasing maize production and food security through development and deployment of stem borer resistant maize germplasm developed using conventional and through biotechnology methods such as Bt maize. Bt maize offers farmers an effective and practical option for controlling stem borers. It was recognized that the development and routine use of Bt maize will require addressing relevant bio-safety, environmental, and community concerns and research and information gathering activities are in place to address these concerns and research and information gathering activities are in place to address these concerns. Suitable Bt gene have been acquired or synthesized and back-crossed into elite maize germplasm at CIMMYT-Mexico, and the effective Cry-proteins against the major maize stem borers in Kenya were identified to better target pests. Stem borer resistant maize germplasm is being developed through conventional breeding, using locally adapted and exotic germplasm. for safe and effective deployment of Bt maize,studies on its impacts on target and non-target arthropods as well as studies on the effects of Bt maize on key non-target arthropods as well as studies on gene flow are underway. Insect resistance management strategies are being developed through quantifying the effectiveness, ???. Socioeconomic impact studies are revealing factors in the society that may influence the adoption of Bt maize in Kenya. Also, baseline data, essential for the monitoring and evaluation of the Bt maize technology in Kenya, has been established. Technology transfer and capacity building, creating awareness and communications have received attention in the project. This paper describes the major research activities as they relate to development of the stem bore resistant maize germplasm
Santiago, Rogelio; Cao, Ana; Butrón, Ana
2015-08-20
Contamination of maize with fumonisins depends on the environmental conditions; the maize resistance to contamination and the interaction between both factors. Although the effect of environmental factors is a determinant for establishing the risk of kernel contamination in a region, there is sufficient genetic variability among maize to develop resistance to fumonisin contamination and to breed varieties with contamination at safe levels. In addition, ascertaining which environmental factors are the most important in a region will allow the implementation of risk monitoring programs and suitable cultural practices to reduce the impact of such environmental variables. The current paper reviews all works done to address the influence of environmental variables on fumonisin accumulation, the genetics of maize resistance to fumonisin accumulation, and the search for the biochemical and/or structural mechanisms of the maize plant that could be involved in resistance to fumonisin contamination. We also explore the outcomes of breeding programs and risk monitoring of undertaken projects.
Syampaku, E.M; Mafimisebi, Taiwo Ejiola
2014-01-01
The study analyzed the responsiveness of maize grain and maize meal spatial price volatilities to increased government participation in maize grain marketing in Zambia using descriptive statistics and vector auto-regression (VAR). This was achieved by comparing spatial price volatility means and spatial price means for the period under increased government participation with respective means for periods under limited government participation. Also, spatial price volatilities were regressed ag...
Biotechnology in maize breeding
Directory of Open Access Journals (Sweden)
Mladenović-Drinić Snežana
2004-01-01
Full Text Available Maize is one of the most important economic crops and the best studied and most tractable genetic system among monocots. The development of biotechnology has led to a great increase in our knowledge of maize genetics and understanding of the structure and behaviour of maize genomes. Conventional breeding practices can now be complemented by a number of new and powerful techniques. Some of these often referred to as molecular methods, enable scientists to see the layout of the entire genome of any organism and to select plants with preferred characteristics by "reading" at the molecular level, saving precious time and resources. DNA markers have provided valuable tools in various analyses ranging from phylogenetic analysis to the positional cloning of genes. Application of molecular markers for genetic studies of maize include: assessment of genetic variability and characterization of germ plasm, identification and fingerprinting of genotypes, estimation of genetic distance, detection of monogamic and quantitative trait loci, marker assisted selection, identification of sequence of useful candidate genes, etc. The development of high-density molecular maps which has been facilitated by PCR-based markers, have made the mapping and tagging of almost any trait possible and serve as bases for marker assisted selection. Sequencing of maize genomes would help to elucidate gene function, gene regulation and their expression. Modern biotechnology also includes an array of tools for introducing or deieting a particular gene or genes to produce plants with novel traits. Development of informatics and biotechnology are resulted in bioinformatic as well as in expansion of microarrey technique. Modern biotechnologies could complement and improve the efficiency of traditional selection and breeding techniques to enhance agricultural productivity.
Ruíz-Huerta, Esther Aurora; de la Garza Varela, Alonso; Gómez-Bernal, Juan Miguel; Castillo, Francisco; Avalos-Borja, Miguel; SenGupta, Bhaskar; Martínez-Villegas, Nadia
2017-10-05
Mobility of Arsenic (As) from metallurgical wastes in Matehuala, Mexico has been accounted for ultra-high concentration of As in water (4.8-158mg/L) that is used for recreational purposes as well as cultivation of maize. In this study, we (i) measured As concentrations in soils irrigated with this water, (ii) investigated the geochemical controls of available As, and (iii) measured bioaccumulation of As in maize. Water, soil, and maize plant samples were collected from 3 different plots to determine As in environmental matrices as well as water soluble As in soils. Soil mineralogy was determined by X-ray diffraction analysis. Bioaccumulation of As in maize plants was estimated from the bioconcentration and translocation factors. We recorded As built-up in agricultural soils to the extent of 172mg/kg, and noted that this As is highly soluble in water (30% on average). Maize crops presented high bioaccumulation, up to 2.5 times of bioconcentration and 45% of translocation. Furthermore, we found that water extractable As was higher in soils rich in calcite, while it was lower in soils containing high levels of gypsum, but As bioconcentration showed opposite trend. Results from this study show that irrigation with As rich water represents a significant risk to the population consuming contaminated crops. Copyright © 2017 Elsevier B.V. All rights reserved.
Genomic-based-breeding tools for tropical maize improvement.
Chakradhar, Thammineni; Hindu, Vemuri; Reddy, Palakolanu Sudhakar
2017-12-01
Maize has traditionally been the main staple diet in the Southern Asia and Sub-Saharan Africa and widely grown by millions of resource poor small scale farmers. Approximately, 35.4 million hectares are sown to tropical maize, constituting around 59% of the developing worlds. Tropical maize encounters tremendous challenges besides poor agro-climatic situations with average yields recorded <3 tones/hectare that is far less than the average of developed countries. On the contrary to poor yields, the demand for maize as food, feed, and fuel is continuously increasing in these regions. Heterosis breeding introduced in early 90 s improved maize yields significantly, but genetic gains is still a mirage, particularly for crop growing under marginal environments. Application of molecular markers has accelerated the pace of maize breeding to some extent. The availability of array of sequencing and genotyping technologies offers unrivalled service to improve precision in maize-breeding programs through modern approaches such as genomic selection, genome-wide association studies, bulk segregant analysis-based sequencing approaches, etc. Superior alleles underlying complex traits can easily be identified and introgressed efficiently using these sequence-based approaches. Integration of genomic tools and techniques with advanced genetic resources such as nested association mapping and backcross nested association mapping could certainly address the genetic issues in maize improvement programs in developing countries. Huge diversity in tropical maize and its inherent capacity for doubled haploid technology offers advantage to apply the next generation genomic tools for accelerating production in marginal environments of tropical and subtropical world. Precision in phenotyping is the key for success of any molecular-breeding approach. This article reviews genomic technologies and their application to improve agronomic traits in tropical maize breeding has been reviewed in
Chromosome microdissection and cloning in human genome and genetic disease analysis
International Nuclear Information System (INIS)
Kao, Faten; Yu, Jingwei
1991-01-01
A procedure has been described for microdissection and microcloning of human chromosomal DNA sequences in which universal amplification of the dissected fragments by Mbo I linker adaptor and polymerase chain reaction is used. A very large library comprising 700,000 recombinant plasmid microclones from 30 dissected chromosomes of human chromosome 21 was constructed. Colony hybridization showed that 42% of the clones contained repetitive sequences and 58% contained single or low-copy sequences. The insert sizes generated by complete Mbo I cleavage ranged from 50 to 1,100 base pairs with a mean of 416 base pairs. Southern blot analysis of microclones from the library confirmed their human origin and chromosome 21 specificity. Some of these clones have also been regionally mapped to specific sites of chromosome 21 by using a regional mapping panel of cell hybrids. This chromosome microtechnology can generate large numbers of microclones with unique sequences from defined chromosomal regions and can be used for processes such as (i) isolating corresponding yeast artificial chromosome clones with large inserts, (ii) screening various cDNA libraries for isolating expressed sequences, and (iii) constructing region-specific libraries of the entire human genome. The studies described here demonstrate the power of this technology for high-resolution genome analysis and explicate their use in an efficient search for disease-associated genes localized to specific chromosomal regions
Sheng, Yanmin; Wang, Yingdian; Capell, Teresa; Shi, Lianxuan; Ni, Xiuzhen; Sandmann, Gerhard; Christou, Paul; Zhu, Changfu
2015-01-01
The assignment of functions to genes in the carotenoid biosynthesis pathway is necessary to understand how the pathway is regulated and to obtain the basic information required for metabolic engineering. Few carotenoid ε-hydroxylases have been functionally characterized in plants although this would provide insight into the hydroxylation steps in the pathway. We therefore isolated mRNA from the endosperm of maize (Zea mays L., inbred line B73) and cloned a full-length cDNA encoding CYP97C19, a putative heme-containing carotenoid ε hydroxylase and member of the cytochrome P450 family. The corresponding CYP97C19 genomic locus on chromosome 1 was found to comprise a single-copy gene with nine introns. We expressed CYP97C19 cDNA under the control of the constitutive CaMV 35S promoter in the Arabidopsis thaliana lut1 knockout mutant, which lacks a functional CYP97C1 (LUT1) gene. The analysis of carotenoid levels and composition showed that lutein accumulated to high levels in the rosette leaves of the transgenic lines but not in the untransformed lut1 mutants. These results allowed the unambiguous functional annotation of maize CYP97C19 as an enzyme with strong zeinoxanthin ε-ring hydroxylation activity. PMID:26030746
IMAZAPYR-RESISTANT MAIZE TECHNOLOGY ADOPTION FOR ...
African Journals Online (AJOL)
Prof. Adipala Ekwamu
decisions by protecting maize (Zea mays L.) crop in western Kenya from Striga. Key Words: Adopters, Zea ... Africa, efficient and profitable production of maize is severely constrained by ..... gap by understanding its source. African. Journal of ...
DEFF Research Database (Denmark)
Asimwe, I.; Kimambo, A. E.; Laswai, G. H.
2015-01-01
Forty five steers (2.5–3.0 years of age and 200±5 (SEM) kg body weight) were allotted randomly into five diets to assess the effects of finishing Tanzania Shorthorn Zebu (TSZ) cattle in feedlot using diets based on either molasses or maize grain combined with maize or rice by-products. The diets...... were hay and concentrate mixtures of hominy feed with molasses (HFMO), rice polishing with molasses (RPMO), hominy feed with maize meal (HFMM), rice polishing with maize meal (RPMM) and a control of maize meal with molasses (MMMO). All concentrate mixtures contained cotton seed cake, mineral mixture.......35 for HFMO) than in maize grain based diets (6.94, 6.73 and 6.19 for RPMM, MMMO and HFMM, respectively). Energy intake was highest (P
Lin, Yumei; Wu, Wenxiang; Ge, Quansheng
2015-11-01
Climate change would cause negative impacts on future agricultural production and food security. Adaptive measures should be taken to mitigate the adverse effects. The objectives of this study were to simulate the potential effects of climate change on maize yields in Heilongjiang Province and to evaluate two selected typical household-level autonomous adaptive measures (cultivar changes and planting time adjustments) for mitigating the risks of climate change based on the CERES-Maize model. The results showed that flowering duration and maturity duration of maize would be shortened in the future climate and thus maize yield would reduce by 11-46% during 2011-2099 relative to 1981-2010. Increased CO2 concentration would not benefit maize production significantly. However, substituting local cultivars with later-maturing ones and delaying the planting date could increase yields as the climate changes. The results provide insight regarding the likely impacts of climate change on maize yields and the efficacy of selected adaptive measures by presenting evidence-based implications and mitigation strategies for the potential negative impacts of future climate change. © 2014 Society of Chemical Industry.
quixotic coupling between irrigation system and maize-cowpea
African Journals Online (AJOL)
ACSS
number row-1 and maize grain yield, respectively. The ridge ... Key Words: Furrow irrigation, water use efficiency, Zea mays. RÉSUMÉ ... important in arid and semi-arid regions, with ... as maize) canopy is not able to intercept all the solar radiation during the growth period. ... Intercropping maize and legumes considerably ...
Cheng, Jin-Mei; Li, Jian; Tang, Ji-Xin; Hao, Xiao-Xia; Wang, Zhi-Peng; Sun, Tie-Cheng; Wang, Xiu-Xia; Zhang, Yan; Chen, Su-Ren; Liu, Yi-Xun
2017-08-03
Mammalian oocyte chromosomes undergo 2 meiotic divisions to generate haploid gametes. The frequency of chromosome segregation errors during meiosis I increase with age. However, little attention has been paid to the question of how aging affects sister chromatid segregation during oocyte meiosis II. More importantly, how aneuploid metaphase II (MII) oocytes from aged mice evade the spindle assembly checkpoint (SAC) mechanism to complete later meiosis II to form aneuploid embryos remains unknown. Here, we report that MII oocytes from naturally aged mice exhibited substantial errors in chromosome arrangement and configuration compared with young MII oocytes. Interestingly, these errors in aged oocytes had no impact on anaphase II onset and completion as well as 2-cell formation after parthenogenetic activation. Further study found that merotelic kinetochore attachment occurred more frequently and could stabilize the kinetochore-microtubule interaction to ensure SAC inactivation and anaphase II onset in aged MII oocytes. This orientation could persist largely during anaphase II in aged oocytes, leading to severe chromosome lagging and trailing as well as delay of anaphase II completion. Therefore, merotelic kinetochore attachment in oocyte meiosis II exacerbates age-related genetic instability and is a key source of age-dependent embryo aneuploidy and dysplasia.
Propanol in maize silage at Danish dairy farms
DEFF Research Database (Denmark)
Raun, Birgitte Marie Løvendahl; Kristensen, Niels Bastian
2010-01-01
The objective of the present study was to investigate the prevalence maize silage containing propanol, the seasonal variation in propanol content of maize silage, and correlations between propanol and other fermentation products in maize silage collected from 20 randomly selected Danish dairy farms...... farms, the maize silage had ≥5 g propanol/kg DM. The present study indicates that dairy cows in Denmark are commonly exposed to propanol and that approximately 20% of the dairy cows will have an intake in the range of 75-100 g propanol/d under common feeding conditions....
Water transfer in an alfalfa/maize association
International Nuclear Information System (INIS)
Corak, S.J.; Blevins, D.G.; Pallardy, S.G.
1987-01-01
The authors investigated the possibility of interspecific water transfer in an alfalfa (Medicago sativa L.) and maize (Zea mays L.) association. An alfalfa plant was grown through two vertically stacked plastic tubes. A 5 centimeter air gap between tubes was bridged by alfalfa roots. Five-week old maize plants with roots confined to the top tube were not watered, while associated alfalfa roots had free access to water in the bottom tube (the -/+ treatment). Additional treatments included: top and bottom tubes watered (+/+), top and bottom tubes droughted (-/-), and top tube droughted after removal of alfalfa root bridges and routine removal of alfalfa tillers (-*). Predawn leaf water potential of maize in the -/+ treatment fell to -1.5 megapascals 13 days after the start of drought; thereafter, predawn and midday potentials were maintained near -1.9 megapascals. Leaf water potentials of maize in the -/- and -* treatments declined steadily; all plants in these treatments were completely desiccated before day 50. High levels of tritium activity were detected in water extracted from both alfalfa and maize leaves after 3 H 2 O was injected into the bottom -/+ tube at day 70 or later. Maize in the -/+ treatment was able to survive an otherwise lethal period of drought by utilizing water lost by alfalfa roots
Sub-Saharan African maize-based foods
Ekpa, Onu; Palacios-Rojas, Natalia; Kruseman, Gideon; Fogliano, Vincenzo; Linnemann, Anita R.
2018-01-01
The demand for maize in Sub-Saharan Africa will triple by 2050 due to rapid population growth, while challenges from climate change will threaten agricultural productivity. Most maize breeding programmes have focused on improving agronomic properties and have paid relatively little attention to
Directory of Open Access Journals (Sweden)
Chandni Mathur
Full Text Available Genetically modified, (GM crops with potential allergens must be evaluated for safety and endogenous IgE binding pattern compared to native variety, prior to market release.To compare endogenous IgE binding proteins of three GM maize seeds containing Cry 1Ab,1Ac,1C transgenic proteins with non GM maize.An integrated approach of in silico & in vitro methods was employed. Cry proteins were tested for presence of allergen sequence by FASTA in allergen databases. Biochemical assays for maize extracts were performed. Specific IgE (sIgE and Immunoblot using food sensitized patients sera (n = 39 to non GM and GM maize antigens was performed.In silico approaches, confirmed for non sequence similarity of stated transgenic proteins in allergen databases. An insignificant (p> 0.05 variation in protein content between GM and non GM maize was observed. Simulated Gastric Fluid (SGF revealed reduced number of stable protein fractions in GM then non GM maize which might be due to shift of constituent protein expression. Specific IgE values from patients showed insignificant difference in non GM and GM maize extracts. Five maize sensitized cases, recognized same 7 protein fractions of 88-28 kD as IgE bindng in both GM and non-GM maize, signifying absence of variation. Four of the reported IgE binding proteins were also found to be stable by SGF.Cry proteins did not indicate any significant similarity of >35% in allergen databases. Immunoassays also did not identify appreciable differences in endogenous IgE binding in GM and non GM maize.
Maize-Pathogen Interactions: An Ongoing Combat from a Proteomics Perspective
Directory of Open Access Journals (Sweden)
Olga Pechanova
2015-11-01
Full Text Available Maize (Zea mays L. is a host to numerous pathogenic species that impose serious diseases to its ear and foliage, negatively affecting the yield and the quality of the maize crop. A considerable amount of research has been carried out to elucidate mechanisms of maize-pathogen interactions with a major goal to identify defense-associated proteins. In this review, we summarize interactions of maize with its agriculturally important pathogens that were assessed at the proteome level. Employing differential analyses, such as the comparison of pathogen-resistant and susceptible maize varieties, as well as changes in maize proteomes after pathogen challenge, numerous proteins were identified as possible candidates in maize resistance. We describe findings of various research groups that used mainly mass spectrometry-based, high through-put proteomic tools to investigate maize interactions with fungal pathogens Aspergillus flavus, Fusarium spp., and Curvularia lunata, and viral agents Rice Black-streaked Dwarf Virus and Sugarcane Mosaic Virus.
Maize-Pathogen Interactions: An Ongoing Combat from a Proteomics Perspective.
Pechanova, Olga; Pechan, Tibor
2015-11-30
Maize (Zea mays L.) is a host to numerous pathogenic species that impose serious diseases to its ear and foliage, negatively affecting the yield and the quality of the maize crop. A considerable amount of research has been carried out to elucidate mechanisms of maize-pathogen interactions with a major goal to identify defense-associated proteins. In this review, we summarize interactions of maize with its agriculturally important pathogens that were assessed at the proteome level. Employing differential analyses, such as the comparison of pathogen-resistant and susceptible maize varieties, as well as changes in maize proteomes after pathogen challenge, numerous proteins were identified as possible candidates in maize resistance. We describe findings of various research groups that used mainly mass spectrometry-based, high through-put proteomic tools to investigate maize interactions with fungal pathogens Aspergillus flavus, Fusarium spp., and Curvularia lunata, and viral agents Rice Black-streaked Dwarf Virus and Sugarcane Mosaic Virus.
Directory of Open Access Journals (Sweden)
Ghanashyam Bhandari
2016-12-01
Full Text Available Maize stem borer (MSB, Chilo partellus Swinhoe, Lepidoptera: Pyralidae is one of the most important insect pest of maize in Nepal. Host plant resistance is the cost-effective, ecologically sound and stable approach to reduce damage by stem borers. Forty four maize genotypes were screened for resistance to maize stem borer at the research field of National Maize Research Program, Rampur during spring seasons (March to June of two consecutive years 2013 and 2014. The maize genotypes were evaluated in randomized complete block design with three replications and data were collected on foliar damage rating, tunnel length and number of exit holes made by the borer. The foliar damage and tunnel length damage were significant for genotypes for both the years. The exit holes were not significant in 2013 but significant in 2014 ranging from 2-6 scale. The foliar rating ranged from 2 to 5.5 in 2013 and 1.1 to 4.5 in 2014 on a 1-9 rating scale. The highly resistant genotypes (10 cm scale. The least susceptible genotypes (<5 cm were RampurSO3F8, RampurSO3FQ02 and RampurS10F18. The genotypes having least exit holes (2.0 in 2014 were RampurSO3F8, RampurSO3FQ02, RampurS10F18. Thus less damage parameters were observed in R-POP-2, RML-5/RML-8, RampurSO3F8, RampurSO3FQ02 and RampurS10F18 and therefore they can be used as parents or as sources of resistance in breeding program.
An Agrobacterium-delivered CRISPR/Cas9 system for high-frequency targeted mutagenesis in maize.
Char, Si Nian; Neelakandan, Anjanasree K; Nahampun, Hartinio; Frame, Bronwyn; Main, Marcy; Spalding, Martin H; Becraft, Philip W; Meyers, Blake C; Walbot, Virginia; Wang, Kan; Yang, Bing
2017-02-01
CRISPR/Cas9 is a powerful genome editing tool in many organisms, including a number of monocots and dicots. Although the design and application of CRISPR/Cas9 is simpler compared to other nuclease-based genome editing tools, optimization requires the consideration of the DNA delivery and tissue regeneration methods for a particular species to achieve accuracy and efficiency. Here, we describe a public sector system, ISU Maize CRISPR, utilizing Agrobacterium-delivered CRISPR/Cas9 for high-frequency targeted mutagenesis in maize. This system consists of an Escherichia coli cloning vector and an Agrobacterium binary vector. It can be used to clone up to four guide RNAs for single or multiplex gene targeting. We evaluated this system for its mutagenesis frequency and heritability using four maize genes in two duplicated pairs: Argonaute 18 (ZmAgo18a and ZmAgo18b) and dihydroflavonol 4-reductase or anthocyaninless genes (a1 and a4). T 0 transgenic events carrying mono- or diallelic mutations of one locus and various combinations of allelic mutations of two loci occurred at rates over 70% mutants per transgenic events in both Hi-II and B104 genotypes. Through genetic segregation, null segregants carrying only the desired mutant alleles without the CRISPR transgene could be generated in T 1 progeny. Inheritance of an active CRISPR/Cas9 transgene leads to additional target-specific mutations in subsequent generations. Duplex infection of immature embryos by mixing two individual Agrobacterium strains harbouring different Cas9/gRNA modules can be performed for improved cost efficiency. Together, the findings demonstrate that the ISU Maize CRISPR platform is an effective and robust tool to targeted mutagenesis in maize. © 2016 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.
Fungal Diversity of Maize (Zea Mays L. Grains
Directory of Open Access Journals (Sweden)
Gulbis Kaspars
2016-06-01
Full Text Available Maize is becoming more and more important crop for dairy farming as forage and as substrate for biogas production. The mycotoxin producing fungi can spoil feed, reduce cattle productivity and cause health problems. The aim of this research was to study the mycoflora of maize grains in order to clarify the fungal composition and verify the presence of potential mycotoxin producing fungi. The grain samples were collected from different maize hybrid performance trial in Research and Study farm “Vecauce” of Latvia University of Agriculture in 2014. The fungi from 14 genera were isolated from surface sterilized grains. The most abundant were Alternaria, Fusarium and Penicillium spp. Mycotoxin producing fungi are present in maize grain mycoflora, and there is a risk that maize production can contain mycotoxins.
Maize Bioactive Peptides against Cancer
Díaz-Gómez, Jorge L.; Castorena-Torres, Fabiola; Preciado-Ortiz, Ricardo E.; García-Lara, Silverio
2017-06-01
Cancer is one of the main chronic degenerative diseases worldwide. In recent years, consumption of whole-grain cereals and their derived food products has been associated with reduction risks of various types of cancer. Cereals main biomolecules includes proteins, peptides, and amino acids present in different quantities within the grain. The nutraceutical properties associated with peptides exerts biological functions that promote health and prevent this disease. In this review, we report the current status and advances on maize peptides regarding bioactive properties that have been reported such as antioxidant, antihypertensive, hepatoprotective, and anti-tumour activities. We also highlighted its biological potential through which maize bioactive peptides exert anti-cancer activity. Finally, we analyse and emphasize the possible areas of application for maize peptides.
Genetic effects of organic mercury compounds. II. Chromosome segregation in Drosophila melanogaster
Energy Technology Data Exchange (ETDEWEB)
Ramel, C; Magnusson, J
1969-01-01
The genetic effect of organic mercury compounds on the fruit fly, Drosophila melanogaster was investigated. Treatments of larvae with methyl and phenyl mercury gave rise to development disturbances. Chromosomal abnormalities were noted.
Directory of Open Access Journals (Sweden)
Gaëlle Demarre
2010-05-01
Full Text Available DNA adenine methylation is widely used to control many DNA transactions, including replication. In Escherichia coli, methylation serves to silence newly synthesized (hemimethylated sister origins. SeqA, a protein that binds to hemimethylated DNA, mediates the silencing, and this is necessary to restrict replication to once per cell cycle. The methylation, however, is not essential for replication initiation per se but appeared so when the origins (oriI and oriII of the two Vibrio cholerae chromosomes were used to drive plasmid replication in E. coli. Here we show that, as in the case of E. coli, methylation is not essential for oriI when it drives chromosomal replication and is needed for once-per-cell-cycle replication in a SeqA-dependent fashion. We found that oriII also needs SeqA for once-per-cell-cycle replication and, additionally, full methylation for efficient initiator binding. The requirement for initiator binding might suffice to make methylation an essential function in V. cholerae. The structure of oriII suggests that it originated from a plasmid, but unlike plasmids, oriII makes use of methylation for once-per-cell-cycle replication, the norm for chromosomal but not plasmid replication.
Genomic variation in recently collected maize landraces from Mexico
Directory of Open Access Journals (Sweden)
María Clara Arteaga
2016-03-01
Full Text Available The present dataset comprises 36,931 SNPs genotyped in 46 maize landraces native to Mexico as well as the teosinte subspecies Zea maiz ssp. parviglumis and ssp. mexicana. These landraces were collected directly from farmers mostly between 2006 and 2010. We accompany these data with a short description of the variation within each landrace, as well as maps, principal component analyses and neighbor joining trees showing the distribution of the genetic diversity relative to landrace, geographical features and maize biogeography. High levels of genetic variation were detected for the maize landraces (HE = 0.234 to 0.318 (mean 0.311, while slightly lower levels were detected in Zea m. mexicana and Zea m. parviglumis (HE = 0.262 and 0.234, respectively. The distribution of genetic variation was better explained by environmental variables given by the interaction of altitude and latitude than by landrace identity. This dataset is a follow up product of the Global Native Maize Project, an initiative to update the data on Mexican maize landraces and their wild relatives, and to generate information that is necessary for implementing the Mexican Biosafety Law. Keywords: Maize, Teosinte, Maize SNP50K BeadChip, Mexican landraces, Proyecto Global de Maíces Nativos
Bachy, Aurélie; Aubinet, Marc; Schoon, Niels; Amelynck, Crist; Bodson, Bernard; Moureaux, Christine; Heinesch, Bernard
2016-04-01
Maize is the most important C4 crop worldwide. It is also the second most important crop worldwide (C3 and C4 mixed), and is a dominant crop in some world regions. Therefore, it can potentially influence local climate and air quality through its exchanges of gases with the atmosphere. Among others, biogenic volatile organic compounds (BVOC) are known to influence the atmospheric composition and thereby modify greenhouse gases lifetime and pollutant formation in the atmosphere. However, so far, only two studies have dealt with BVOC exchanges from maize. Moreover, these studies were conducted on a limited range of meteorological and phenological conditions, so that the knowledge of BVOC exchanges by this crop remains poor. Here, we present the first BVOC measurement campaign performed at ecosystem-scale on a maize field during a whole growing season. It was carried out in the Lonzée Terrestrial Observatory (LTO), an ICOS site. BVOC fluxes were measured by the disjunct by mass-scanning eddy covariance technique with a proton transfer reaction mass spectrometer for BVOC mixing ratios measurements. Outstanding results are (i) BVOC exchanges from soil were as important as BVOC exchanges from maize itself; (ii) BVOC exchanges observed on our site were much lower than exchanges observed by other maize studies, even under normalized temperature and light conditions, (iii) they were also lower than those observed on other crops grown in Europe. Lastly (iv), BVOC exchanges observed on our site under standard environmental conditions, i.e., standard emission factors SEF, were much lower than those currently considered by BVOC exchange up-scaling models. From those observations, we deduced that (i) soil BVOC exchanges should be better understood and should be incorporated in terrestrial BVOC exchanges models, and that (ii) SEF for the C4 crop plant functional type cannot be evaluated at global scale but should be determined for each important agronomic and pedo-climatic region
Miller, Matthew P; Ünal, Elçin; Brar, Gloria A; Amon, Angelika
2012-01-01
During meiosis, a single round of DNA replication is followed by two consecutive rounds of nuclear divisions called meiosis I and meiosis II. In meiosis I, homologous chromosomes segregate, while sister chromatids remain together. Determining how this unusual chromosome segregation behavior is established is central to understanding germ cell development. Here we show that preventing microtubule–kinetochore interactions during premeiotic S phase and prophase I is essential for establishing the meiosis I chromosome segregation pattern. Premature interactions of kinetochores with microtubules transform meiosis I into a mitosis-like division by disrupting two key meiosis I events: coorientation of sister kinetochores and protection of centromeric cohesin removal from chromosomes. Furthermore we find that restricting outer kinetochore assembly contributes to preventing premature engagement of microtubules with kinetochores. We propose that inhibition of microtubule–kinetochore interactions during premeiotic S phase and prophase I is central to establishing the unique meiosis I chromosome segregation pattern. DOI: http://dx.doi.org/10.7554/eLife.00117.001 PMID:23275833
Strategic Marketing Problems in the Uganda Maize Seed Industry
Larson, Donald W.; Mbowa, Swaibu
2004-01-01
Strategic marketing issues and challenges face maize seed marketing firms as farmers increasingly adopt hybrid varieties in a modernizing third world country such as Uganda. The maize seed industry of Uganda has changed dramatically from a government owned, controlled, and operated industry to a competitive market oriented industry with substantial private firm investment and participation. The new maize seed industry is young, dynamic, growing and very competitive. The small maize seed marke...
Gametocidal chromosomes enhancing chromosome aberration in common wheat induced by 5-azacytidine.
Su, W-Y; Cong, W-W; Shu, Y-J; Wang, D; Xu, G-H; Guo, C-H
2013-07-08
The gametocidal (Gc) chromosome from Aegilops spp induces chromosome mutation, which is introduced into common wheat as a tool of chromosome manipulation for genetic improvement. The Gc chromosome functions similar to a restriction-modification system in bacteria, in which DNA methylation is an important regulator. We treated root tips of wheat carrying Gc chromosomes with the hypomethylation agent 5-azacytidine; chromosome breakage and micronuclei were observed in these root tips. The frequency of aberrations differed in wheat containing different Gc chromosomes, suggesting different functions inducing chromosome breakage. Gc chromosome 3C caused the greatest degree of chromosome aberration, while Gc chromosome 3C(SAT) and 2C caused only slight chromosome aberration. Gc chromosome 3C induced different degrees of chromosome aberration in wheat varieties Triticum aestivum var. Chinese Spring and Norin 26, demonstrating an inhibition function in common wheat.
Maize production in mid hills of Nepal: from food to feed security
Krishna Prasad Timsina; Yuga Nath Ghimire; Jeevan Lamichhane
2016-01-01
This study was undertaken in 2016 to analyze the production and utilization of maize in Nepal. Sixty maize growers from Kavre and Lamjung districts were selected using purposive, cluster and simple random sampling techniques. Similarly, six feed industries and five maize experts from Chitwan district were also interviewed. Study shows 56% of the total areas were used for maize production and 50% of the maize areas were covered by hybrid maize. There was no practice of contract maize productio...
Chromosomal Mosaicism in Human Feto-Placental Development: Implications for Prenatal Diagnosis
Directory of Open Access Journals (Sweden)
Francesca Romana Grati
2014-07-01
Full Text Available Chromosomal mosaicism is one of the primary interpretative issues in prenatal diagnosis. In this review, the mechanisms underlying feto-placental chromosomal mosaicism are presented. Based on the substantial retrospective diagnostic experience with chorionic villi samples (CVS of a prenatal diagnosis laboratory the following items are discussed: (i The frequency of the different types of mosaicism (confined placental, CPM, and true fetal mosaicisms, TFM; (ii The risk of fetal confirmation after the detection of a mosaic in CVS stratified by chromosome abnormality and placental tissue involvement; (iii The frequency of uniparental disomy for imprinted chromosomes associated with CPM; (iv The incidence of false-positive and false-negative results in CVS samples analyzed by only (semi-direct preparation or long term culture; and (v The implications of the presence of a feto-placental mosaicism for microarray analysis of CVS and non-invasive prenatal screening (NIPS.
Fetal chromosome analysis: screening for chromosome disease?
DEFF Research Database (Denmark)
Philip, J; Tabor, Ann; Bang, J
1983-01-01
The aim of the study was to investigate the rationale of the current indications for fetal chromosome analysis. 5372 women had 5423 amniocentesis performed, this group constituting a consecutive sample at the chromosome laboratory, Rigshospitalet, Copenhagen from March 1973 to September 1980 (Group...... A + B). Pregnant women 35 years of age, women who previously had a chromosomally abnormal child, families with translocation carriers or other heritable chromosomal disease, families where the father was 50 years or more and women in families with a history of Down's syndrome (group A), were compared...... to women having amniocentesis, although considered not to have any increased risk of fetal chromosome abnormality (1390 pregnancies, group B). They were also compared with 750 consecutive pregnancies in women 25-34 years of age, in whom all heritable diseases were excluded (group C). The risk of unbalanced...
Vulnerability of Maize Yields to Droughts in Uganda
Directory of Open Access Journals (Sweden)
Terence Epule Epule
2017-03-01
Full Text Available Climate projections in Sub-Saharan Africa (SSA forecast an increase in the intensity and frequency of droughts with implications for maize production. While studies have examined how maize might be affected at the continental level, there have been few national or sub-national studies of vulnerability. We develop a vulnerability index that combines sensitivity, exposure and adaptive capacity and that integrates agroecological, climatic and socio-economic variables to evaluate the national and spatial pattern of maize yield vulnerability to droughts in Uganda. The results show that maize yields in the north of Uganda are more vulnerable to droughts than in the south and nationally. Adaptive capacity is higher in the south of the country than in the north. Maize yields also record higher levels of sensitivity and exposure in the north of Uganda than in the south. Latitudinally, it is observed that maize yields in Uganda tend to record higher levels of vulnerability, exposure and sensitivity towards higher latitudes, while in contrast, the adaptive capacity of maize yields is higher towards the lower latitudes. In addition to lower precipitation levels in the north of the country, these observations can also be explained by poor soil quality in most of the north and socio-economic proxies, such as, higher poverty and lower literacy rates in the north of Uganda.
Contributions of Zea mays subspecies mexicana haplotypes to modern maize.
Yang, Ning; Xu, Xi-Wen; Wang, Rui-Ru; Peng, Wen-Lei; Cai, Lichun; Song, Jia-Ming; Li, Wenqiang; Luo, Xin; Niu, Luyao; Wang, Yuebin; Jin, Min; Chen, Lu; Luo, Jingyun; Deng, Min; Wang, Long; Pan, Qingchun; Liu, Feng; Jackson, David; Yang, Xiaohong; Chen, Ling-Ling; Yan, Jianbing
2017-11-30
Maize was domesticated from lowland teosinte (Zea mays ssp. parviglumis), but the contribution of highland teosinte (Zea mays ssp. mexicana, hereafter mexicana) to modern maize is not clear. Here, two genomes for Mo17 (a modern maize inbred) and mexicana are assembled using a meta-assembly strategy after sequencing of 10 lines derived from a maize-teosinte cross. Comparative analyses reveal a high level of diversity between Mo17, B73, and mexicana, including three Mb-size structural rearrangements. The maize spontaneous mutation rate is estimated to be 2.17 × 10 -8 ~3.87 × 10 -8 per site per generation with a nonrandom distribution across the genome. A higher deleterious mutation rate is observed in the pericentromeric regions, and might be caused by differences in recombination frequency. Over 10% of the maize genome shows evidence of introgression from the mexicana genome, suggesting that mexicana contributed to maize adaptation and improvement. Our data offer a rich resource for constructing the pan-genome of Zea mays and genetic improvement of modern maize varieties.
Oven-drying reduces ruminal starch degradation in maize kernels
Ali, M.; Cone, J.W.; Hendriks, W.H.; Struik, P.C.
2014-01-01
The degradation of starch largely determines the feeding value of maize (Zea mays L.) for dairy cows. Normally, maize kernels are dried and ground before chemical analysis and determining degradation characteristics, whereas cows eat and digest fresh material. Drying the moist maize kernels
Directory of Open Access Journals (Sweden)
Halley Caixeta Oliveira
2015-10-01
Full Text Available Poly(epsilon-caprolactone (PCL nanocapsules have been used as a carrier system for the herbicide atrazine, which is commonly applied to maize. We demonstrated previously that these atrazine containing polymeric nanocapsules were ten-fold more effective in the control of mustard plants (a target species, as compared to a commercial atrazine formulation. Since atrazine can have adverse effects on non-target crops, here we analyzed the effect of encapsulated atrazine on growth, physiological and oxidative stress parameters of soil-grown maize plants (Zea mays L.. One day after the post-emergence treatment with PCL nanocapsules containing atrazine (1 mg mL-1, maize plants presented 15 and 21 % decreases in maximum quantum yield of photosystem II and in net CO2 assimilation rate, respectively, as compared to water-sprayed plants. The same treatment led to a 1.8-fold increase in leaf lipid peroxidation in comparison with control plants. However, all of these parameters were unaffected four and eight days after the application of encapsulated atrazine. These results suggested that the negative effects of atrazine were transient, probably due to the ability of maize plants to detoxify the herbicide. When encapsulated atrazine was applied at a ten-fold lower concentration (0.1 mg mL-1, a dosage that is still effective for weed control, no effects were detected even shortly after application. Regardless of the herbicide concentration, neither pre- nor post-emergence treatment with the PCL nanocapsules carrying atrazine resulted in the development of any macroscopic symptoms in maize leaves, and there were no impacts on shoot growth. Additionally, no effects were observed when plants were sprayed with PCL nanocapsules without atrazine. Overall, these results suggested that the use of PCL nanocapsules containing atrazine did not lead to persistent side effects in maize plants, and that the technique could offer a safe tool for weed control without affecting
Horikoshi, Renato J.; Bernardi, Daniel; Bernardi, Oderlei; Malaquias, José B.; Okuma, Daniela M.; Miraldo, Leonardo L.; Amaral, Fernando S. De A. E.; Omoto, Celso
2016-10-01
The resistance of fall armyworm (FAW), Spodoptera frugiperda, has been characterized to some Cry and Vip3A proteins of Bacillus thuringiensis (Bt) expressed in transgenic maize in Brazil. Here we evaluated the effective dominance of resistance based on the survival of neonates from selected Bt-resistant, heterozygous, and susceptible (Sus) strains of FAW on different Bt maize and cotton varieties. High survival of strains resistant to the Cry1F (HX-R), Cry1A.105/Cry2Ab (VT-R) and Cry1A.105/Cry2Ab/Cry1F (PW-R) proteins was detected on Herculex, YieldGard VT PRO and PowerCore maize. Our Vip3A-resistant strain (Vip-R) exhibited high survival on Herculex, Agrisure Viptera and Agrisure Viptera 3 maize. However, the heterozygous from HX-R × Sus, VT-R × Sus, PW-R × Sus and Vip-R × Sus had complete mortality on YieldGard VT PRO, PowerCore, Agrisure Viptera, and Agrisure Viptera 3, whereas the HX-R × Sus and Vip-R × Sus strains survived on Herculex maize. On Bt cotton, the HX-R, VT-R and PW-R strains exhibited high survival on Bollgard II. All resistant strains survived on WideStrike, but only PW-R and Vip-R × Sus survived on TwinLink. Our study provides useful data to aid in the understanding of the effectiveness of the refuge strategy for Insect Resistance Management of Bt plants.
Effect of organic fertilizers on maize production in Eastern Georgia
Jolokhava, Tamar; Kenchiashvili, Naira; Tarkhnishvili, Maia; Ghambashidze, Giorgi
2016-04-01
Maize remains to be the most important cereal crop in Georgia. Total area of arable land under cereal crops production equals to 184 thousands hectares (FAO statistical yearbook, 2014), from which maize takes the biggest share. Leading position of maize among other cereal crops is caused by its dual purpose as food and feed product. In Spite of a relatively high production of maize to other cereals there is still a high demand on it, especially as feed for animal husbandry. The same tendency is seen in organic production, where producers of livestock and poultry products require organically grown maize, the average yield of which is much less than those produced conventionally. Therefore, it is important to increase productivity of maize in organic farms. Current study aimed to improve maize yield using locally produced organic fertilizers and to compare them to the effect of mineral fertilizers. The study was carried out in Eastern Georgia under dry subtropical climate conditions on local hybrid of maize. This is the first attempt to use hybrid maize (developed with organic plant breeding method) in organic field trials in Georgia. The results shown, that grain yield from two different types of organic fertilizers reached 70% of the yields achieved with industrial mineral fertilizers. As on farm level differences between organic and conventional maize production are much severe, the results from the field trials seems to be promising for future improvement of organic cereal crop production.
Intercropping maize with cassava or cowpea in Ghana | Ennin ...
African Journals Online (AJOL)
Maize/cassava and maize/cowpea intercrops were evaluated in southern Ghana, over a 5-year period to determine the optimum combination of component crop varieties and component plant population densities to optimize productivity of maize-based intercropping systems. Results indicated that some cowpea varieties ...
ORF Alignment: NC_003280 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... chromosome II ... Length = 113 ... Query: 3 ... SRKRKSELEHYIDKLTDPPEKQRKMAEFYNSLRMFYKRRWNATLKLPHVQGVEV...NLYRLY 62 ... SRKRKSELEHYIDKLTDPPEKQRKMAEFYNSLRMFYKRRWNATLKLPHVQGVEVNLYRLY Sbjct: 1 ... SRKRKSELEHYIDKLTDPPEKQRKMAEFYNSLRMFYKRRWNATLKLPHVQGVEVNLYRLY 60 ...
Tian, Hong-Li; Wang, Feng-Ge; Zhao, Jiu-Ran; Yi, Hong-Mei; Wang, Lu; Wang, Rui; Yang, Yang; Song, Wei
2015-01-01
Single nucleotide polymorphisms (SNPs) are abundant and evenly distributed throughout the maize ( Zea mays L.) genome. SNPs have several advantages over simple sequence repeats, such as ease of data comparison and integration, high-throughput processing of loci, and identification of associated phenotypes. SNPs are thus ideal for DNA fingerprinting, genetic diversity analysis, and marker-assisted breeding. Here, we developed a high-throughput and compatible SNP array, maizeSNP3072, containing 3072 SNPs developed from the maizeSNP50 array. To improve genotyping efficiency, a high-quality cluster file, maizeSNP3072_GT.egt, was constructed. All 3072 SNP loci were localized within different genes, where they were distributed in exons (43 %), promoters (21 %), 3' untranslated regions (UTRs; 22 %), 5' UTRs (9 %), and introns (5 %). The average genotyping failure rate using these SNPs was only 6 %, or 3 % using the cluster file to call genotypes. The genotype consistency of repeat sample analysis on Illumina GoldenGate versus Infinium platforms exceeded 96.4 %. The minor allele frequency (MAF) of the SNPs averaged 0.37 based on data from 309 inbred lines. The 3072 SNPs were highly effective for distinguishing among 276 examined hybrids. Comparative analysis using Chinese varieties revealed that the 3072SNP array showed a better marker success rate and higher average MAF values, evaluation scores, and variety-distinguishing efficiency than the maizeSNP50K array. The maizeSNP3072 array thus can be successfully used in DNA fingerprinting identification of Chinese maize varieties and shows potential as a useful tool for germplasm resource evaluation and molecular marker-assisted breeding.
DEFF Research Database (Denmark)
Sauer, Johannes; Balint, Borbala
This research aims at shedding empirical light on the relative efficiency of small-scale maize producers in Romania. Farmers in transition countries still face heavily distorted price systems resulting from imperfect market conditions and socioeconomic and institutional constraints. To capture...
Directory of Open Access Journals (Sweden)
Zhang Zhenhai
2010-10-01
Full Text Available Abstract Background Maize (Zea mays ssp. mays L. is an important model for plant basic and applied research. In 2009, the B73 maize genome sequencing made a great step forward, using clone by clone strategy; however, functional annotation and gene classification of the maize genome are still limited. Thus, a well-annotated datasets and informative database will be important for further research discoveries. Signal transduction is a fundamental biological process in living cells, and many protein families participate in this process in sensing, amplifying and responding to various extracellular or internal stimuli. Therefore, it is a good starting point to integrate information on the maize functional genes involved in signal transduction. Results Here we introduce a comprehensive database 'ProFITS' (Protein Families Involved in the Transduction of Signalling, which endeavours to identify and classify protein kinases/phosphatases, transcription factors and ubiquitin-proteasome-system related genes in the B73 maize genome. Users can explore gene models, corresponding transcripts and FLcDNAs using the three abovementioned protein hierarchical categories, and visualize them using an AJAX-based genome browser (JBrowse or Generic Genome Browser (GBrowse. Functional annotations such as GO annotation, protein signatures, protein best-hits in the Arabidopsis and rice genome are provided. In addition, pre-calculated transcription factor binding sites of each gene are generated and mutant information is incorporated into ProFITS. In short, ProFITS provides a user-friendly web interface for studies in signal transduction process in maize. Conclusion ProFITS, which utilizes both the B73 maize genome and full length cDNA (FLcDNA datasets, provides users a comprehensive platform of maize annotation with specific focus on the categorization of families involved in the signal transduction process. ProFITS is designed as a user-friendly web interface and it is
Zhang, Xiao; Zhang, Hua; Li, Lujiang; Lan, Hai; Ren, Zhiyong; Liu, Dan; Wu, Ling; Liu, Hailan; Jaqueth, Jennifer; Li, Bailin; Pan, Guangtang; Gao, Shibin
2016-08-31
Maize breeding germplasm used in Southwest China has high complexity because of the diverse ecological features of this area. In this study, the population structure, genetic diversity, and linkage disequilibrium decay distance of 362 important inbred lines collected from the breeding program of Southwest China were characterized using the MaizeSNP50 BeadChip with 56,110 single nucleotide polymorphisms (SNPs). With respect to population structure, two (Tropical and Temperate), three (Tropical, Stiff Stalk and non-Stiff Stalk), four [Tropical, group A germplasm derived from modern U.S. hybrids (PA), group B germplasm derived from modern U.S. hybrids (PB) and Reid] and six (Tropical, PB, Reid, Iowa Stiff Stalk Synthetic, PA and North) subgroups were identified. With increasing K value, the Temperate group showed pronounced hierarchical structure with division into further subgroups. The Genetic Diversity of each group was also estimated, and the Tropical group was more diverse than the Temperate group. Seven low-genetic-diversity and one high-genetic-diversity regions were collectively identified in the Temperate, Tropical groups, and the entire panel. SNPs with significant variation in allele frequency between the Tropical and Temperate groups were also evaluated. Among them, a region located at 130 Mb on Chromosome 2 showed the highest genetic diversity, including both number of SNPs with significant variation and the ratio of significant SNPs to total SNPs. Linkage disequilibrium decay distance in the Temperate group was greater (2.5-3 Mb) than that in the entire panel (0.5-0.75 Mb) and the Tropical group (0.25-0.5 Mb). A large region at 30-120 Mb of Chromosome 7 was concluded to be a region conserved during the breeding process by comparison between S37, which was considered a representative tropical line in Southwest China, and its 30 most similar derived lines. For the panel covered most of widely used inbred lines in Southwest China, this work
Changes in the transcriptomic profiles of maize roots in response to iron-deficiency stress.
Li, Yan; Wang, Nian; Zhao, Fengtao; Song, Xuejiao; Yin, Zhaohua; Huang, Rong; Zhang, Chunqing
2014-07-01
Plants are often subjected to iron (Fe)-deficiency stress because of its low solubility. Plants have evolved two distinct strategies to solubilize and transport Fe to acclimate to this abiotic stress condition. Transcriptomic profiling analysis was performed using Illumina digital gene expression to understand the mechanism underlying resistance responses of roots to Fe starvation in maize, an important Strategy II plant. A total of 3,427, 4,069, 4,881, and 2,610 genes had significantly changed expression levels after Fe-deficiency treatments of 1, 2, 4 or 7 days, respectively. Genes involved in 2'-deoxymugineic acid (DMA) synthesis, secretion, and Fe(III)-DMA uptake were significantly induced. Many genes related to plant hormones, protein kinases, and protein phosphatases responded to Fe-deficiency stress, suggesting their regulatory roles in response to the Fe-deficiency stress. Functional annotation clustering analysis, using the Database for Annotation, Visualization and Integrated Discovery, revealed maize root responses to Fe starvation. This resulted in 38 functional annotation clusters: 25 for up-regulated genes, and 13 for down-regulated ones. These included genes encoding enzymes involved in the metabolism of carboxylic acids, isoprenoids and aromatic compounds, transporters, and stress response proteins. Our work provides integrated information for understanding maize response to Fe-deficiency stress.
Maize production in mid hills of Nepal: from food to feed security
Directory of Open Access Journals (Sweden)
Krishna Prasad Timsina
2016-12-01
Full Text Available This study was undertaken in 2016 to analyze the production and utilization of maize in Nepal. Sixty maize growers from Kavre and Lamjung districts were selected using purposive, cluster and simple random sampling techniques. Similarly, six feed industries and five maize experts from Chitwan district were also interviewed. Study shows 56% of the total areas were used for maize production and 50% of the maize areas were covered by hybrid maize. There was no practice of contract maize production. The results revealed that 60%, 25% and 3% of the grain were used for animal feed, food and seed respectively in hill districts. Whereas the remaining amount of the maize (12% was sold to the different buyers. The proportion of maize feed supply to different animals in the study area was varying. Result shows that at least 1.5 million tons of maize is required only to the feed industries affiliated with national feed industry association in Nepal. Similarly, out of total maize used in feed production, 87% of the maize was imported from India each year by feed industries. Analysis shows negative correlation between scale of feed production and use of domestic maize due to unavailability of required quantity of maize in time. The major pre-condition of feed industries for maize buying was moisture content which must be equal or less than 14%. Very little or no inert materials and physical injury, free from fungal attack and bigger size were also the criteria for maize buying. However, some of the feed industries were also thinking about protein and amino acid contents. Result shows 13% and 8.5% increasing demand of poultry feed and animal feed, respectively over the last five year in Nepal. Most likely, maize is known as a means of food security in Nepal, however, in the context of changing utilization patterns at the farm level and also tremendous increasing demand of maize at the industry level suggest to give more focus on development and dissemination of
Lu, Y. T.; Hidaka, H.; Feldman, L. J.
1996-01-01
Roots of many species respond to gravity (gravitropism) and grow downward only if illuminated. This light-regulated root gravitropism is phytochrome-dependent, mediated by calcium, and inhibited by KN-93, a specific inhibitor of calcium/calmodulin-dependent protein kinase II (CaMK II). A cDNA encoding MCK1, a maize homolog of mammalian CaMK, has been isolated from roots of maize (Zea mays L.). The MCK1 gene is expressed in root tips, the site of perception for both light and gravity. Using the [35S]CaM gel-overlay assay we showed that calmodulin-binding activity of the MCK1 is abolished by 50 microM KN-93, but binding is not affected by 5 microM KN-93, paralleling physiological findings that light-regulated root gravitropism is inhibited by 50 microM KN-93, but not by 5 microM KN-93. KN-93 inhibits light-regulated gravitropism by interrupting transduction of the light signal, not light perception, suggesting that MCK1 may play a role in transducing light. This is the first report suggesting a physiological function for a CaMK homolog in light signal transduction.
Maize flour fortification in Africa: markets, feasibility, coverage, and costs.
Fiedler, John L; Afidra, Ronald; Mugambi, Gladys; Tehinse, John; Kabaghe, Gladys; Zulu, Rodah; Lividini, Keith; Smitz, Marc-Francois; Jallier, Vincent; Guyondet, Christophe; Bermudez, Odilia
2014-04-01
The economic feasibility of maize flour and maize meal fortification in Kenya, Uganda, and Zambia is assessed using information about the maize milling industry, households' purchases and consumption levels of maize flour, and the incremental cost and estimated price impacts of fortification. Premix costs comprise the overwhelming share of incremental fortification costs and vary by 50% in Kenya and by more than 100% across the three countries. The estimated incremental cost of maize flour fortification per metric ton varies from $3.19 in Zambia to $4.41 in Uganda. Assuming all incremental costs are passed onto the consumer, fortification in Zambia would result in at most a 0.9% increase in the price of maize flour, and would increase annual outlays of the average maize flour-consuming household by 0.2%. The increases for Kenyans and Ugandans would be even less. Although the coverage of maize flour fortification is not likely to be as high as some advocates have predicted, fortification is economically feasible, and would reduce deficiencies of multiple micronutrients, which are significant public health problems in each of these countries. © 2013 New York Academy of Sciences.
Mathur, Chandni; Kathuria, Pooran C.; Dahiya, Pushpa; Singh, Anand B.
2015-01-01
Background Genetically modified, (GM) crops with potential allergens must be evaluated for safety and endogenous IgE binding pattern compared to native variety, prior to market release. Objective To compare endogenous IgE binding proteins of three GM maize seeds containing Cry 1Ab,1Ac,1C transgenic proteins with non GM maize. Methods An integrated approach of in silico & in vitro methods was employed. Cry proteins were tested for presence of allergen sequence by FASTA in allergen databases. Biochemical assays for maize extracts were performed. Specific IgE (sIgE) and Immunoblot using food sensitized patients sera (n = 39) to non GM and GM maize antigens was performed. Results In silico approaches, confirmed for non sequence similarity of stated transgenic proteins in allergen databases. An insignificant (p> 0.05) variation in protein content between GM and non GM maize was observed. Simulated Gastric Fluid (SGF) revealed reduced number of stable protein fractions in GM then non GM maize which might be due to shift of constituent protein expression. Specific IgE values from patients showed insignificant difference in non GM and GM maize extracts. Five maize sensitized cases, recognized same 7 protein fractions of 88-28 kD as IgE bindng in both GM and non-GM maize, signifying absence of variation. Four of the reported IgE binding proteins were also found to be stable by SGF. Conclusion Cry proteins did not indicate any significant similarity of >35% in allergen databases. Immunoassays also did not identify appreciable differences in endogenous IgE binding in GM and non GM maize. PMID:25706412
Directory of Open Access Journals (Sweden)
Ephraim Sekyi-Annan
2018-05-01
Full Text Available Improving irrigation management in semi-arid regions of Sub-Saharan Africa is crucial to respond to increasing variability in rainfall and overcome deficits in current irrigation schemes. In small-scale and medium-scale reservoir-based irrigation schemes in the Upper East region of Ghana, we explored options for improving the traditional, dry season irrigation practices and assessed the potential for supplemental irrigation in the rainy season. The AquaCrop model was used to (i assess current water management in the typical tomato-maize rotational system; (ii develop an improved irrigation schedule for dry season cultivation of tomato; and (iii determine the requirement for supplemental irrigation of maize in the rainy season under different climate scenarios. The improved irrigation schedule for dry season tomato cultivation would result in a water saving of 130–1325 mm compared to traditional irrigation practices, accompanied by approximately a 4–14% increase in tomato yield. The supplemental irrigation of maize would require 107–126 mm of water in periods of low rainfall and frequent dry spells, and 88–105 mm in periods of high rainfall and rare dry spells. Therefore, year-round irrigated crop production may be feasible, using water saved during dry season tomato cultivation for supplemental irrigation of maize in the rainy season.
Structural Chromosomal Alterations Induced by Dietary Bioflavonoids in Fanconi Anemia Lymphocytes
Directory of Open Access Journals (Sweden)
Gonzalo Guevara
2007-06-01
Full Text Available IntroductionFanconi anemia is an autosomal recessive diseasecharacterized by a variety of congenital abnormalities,progressive bone marrow failure,increased chromosomal instability and higherrisk to acute myeloid leukemia, solid tumors. Thisentity can be considered an appropriate biologicalmodel to analyze natural substances with possiblegenotoxic effect. The aims of this study wereto describe and quantify structural chromosomalaberrations induced by 5 flavones, 2 isoflavonesand a topoisomerase II chemotherapeutic inhibitorin Fanconi anemia lymphocytes in order todetermine chromosomal numbers changes and/or type of chromosomal damage.Materials and methodsChromosomes stimulated by phytohaemagglutininM, from Fanconi anemia lymphocytes,were analysed by conventional cytogenetic culture.For each chemical substance and controls,one hundred metaphases were evaluated. Chromosomalalterations were documented by photographyand imaging analyzer. To statisticalanalysis was used chi square test to identify significantdifferences between frequencies of chromosomaldamage of basal and exposed cellcultured a P value less than 0.05.ResultsThere were 431 chromosomal alterations in1000 metaphases analysed; genistein was themore genotoxic bioflavonoid, followed in descendentorder by genistin, fisetin, kaempferol,quercetin, baicalein and miricetin. Chromosomalaberrations observed were: chromatidbreaks, chromosomal breaks, cromatid andchromosomal gaps, quadriratials exchanges,dicentrics chromosome and complex rearrangements.ConclusionBioflavonoids as genistein, genistin and fisetin,which are commonly present in the human diet,showed statistical significance in the number ofchromosomal aberrations in Fanconi anemialymphocytes, regarding the basal damage.
Li, Shang-Zhong; Fan, Ting-Lu; Wang, Yong; Zhao, Gang; Wang, Lei; Tang, Xiao-Ming; Dang, Yi; Zhao, Hui
2014-02-01
The differences on chlorophyll fluorescence parameters, yield and water use efficiency of dryland maize were compared among full plastic film mulching on double ridges and planting in catchment furrows (FFDRF), half plastic film mulching on double ridges and planting in catchment furrows (HFDRF), plastic film mulching on ridge and planting in film-side (FS), and flat planting with no plastic film mulching (NM) under field conditions in dry highland of Loess Plateau in 2007-2012. The results showed that fluorescence yield (Fo), the maximum fluorescence yield (Fm), light-adapted fluorescence yield when PS II reaction centers were totally open (F), light-adapted fluorescence yield when PS II reaction centers closed (Fm'), the maximal photochemical efficiency of PS II (Fv/Fm), the actual photochemical efficiency of PS II in the light (Phi PS II), the relative electron transport rate (ETR), photochemical quenching (qP) and non-photochemical quenching (qN) in maize leaves of FFDRF were higher than that of control (NM), and the value of 1-qP was lower than that of control, at 13:00, chlorophyll fluorescence parameters values of FFDRF was significantly higher than control, which were increased by 5.3%, 56.8%, 10.7%, 36.3%, 23.6%, 56.7%, 64.4%, 45.5%, 23.6% and -55.6%, respectively, compared with the control. Yield and water use efficiency of FFDRF were the highest in every year no matter dry year, normal year, humid year and hail disaster year. Average yield and water use efficiency of FFDRF were 12,650 kg x hm(-2) and 40.4 kg x mm(-1) x hm(-2) during 2007-2012, increased by 57.8% and 61.6% compared with the control, respectively, and also significantly higher compared with HFDRF and PS. Therefore, it was concluded that FFDRF had significantly increased the efficiency of light energy conversion and improved the production capacity of dryland maize.
The response of maize production in Kenya to economic incentives
Directory of Open Access Journals (Sweden)
Onono, P.A.,
2013-06-01
Full Text Available Agricultural development policy in Kenya has emphasised the use of incentives towards increased production and therefore self-sufficiency in maize which is a basic staple for most households. The channels used to provide incentives to maize farmers over the years include setting higher producer prices; subsidisation of inputs; provision of agricultural credit, research and extension services; construction and maintenance of roads, development of irrigation and water systems; legislative, institutional and macroeconomic reforms. Despite these efforts outputof maize has remained below domestic requirements in most years and the country continues to rely on imports to meet the deficits. Studies have assessed the responsiveness of maize to output price and reported inelastic responses and have recommended policies targeting non-price incentives to complement prices for the required increased production of maize. The studies, however, did not analyse the influence of the non-price incentives on the production of the crop. The findings of those studies are therefore deficient in explaining the relative importance of different non-price incentives and how they complement prices in influencing maize production in Kenya. This study investigated the response of maize production to both price and non-price incentives. The aim of this study was to ascertain the relative importance of non-price factors in influencing production of the crops as well as complementarity between price and non-price incentives. The findings show that maize production responds positively to its output price, development expenditures in agriculture, maize sales to marketing boards, growth in per capita GDP, liberalisation and governance reforms. However, maize production responds negatively to fertiliser price and unfavourable weather conditions. The response of maize output to its price is lower with rising inflation and grain market liberalisation.
MaizeGDB: enabling access to basic, translational, and applied research information
MaizeGDB is the Maize Genetics and Genomics Database (available online at http://www.maizegdb.org). The MaizeGDB project is not simply an online database and website but rather an information service to maize researchers that supports customized data access and analysis needs to individual research...
Inter-chromosomal heterogeneity in the formation of radiation induced chromosomal aberrations
International Nuclear Information System (INIS)
Natarajan, A.T.; Vermeulen, S.; Boei, J.J.W.A.
1997-01-01
It is generally assumed that radiation induced chromosomal lesions are distributed randomly and repaired randomly among the genome. Recent studies using fluorescent in situ hybridization (FISH) and chromosome specific DNA libraries indicate that some chromosomes are more sensitive for radiation induced aberration formation than others. Chromosome No. 4 in human and chromosome No. 8 in Chinese hamster have been found to involve more in exchange aberrations than others, when calculated on the basis of their DNA content. Painting with arm specific chromosome libraries indicate that the frequencies of radiation induced intra-chromosome exchanges (i.e., between the arms of a chromosome, such as centric rings and inversions) are far in excess than one would expect on the basis of the frequencies of observed inter-chromosomal exchanges. The possible factors leading to the observed heterogeneity will be discussed
"Omics" of maize stress response for sustainable food production: opportunities and challenges.
Gong, Fangping; Yang, Le; Tai, Fuju; Hu, Xiuli; Wang, Wei
2014-12-01
Maize originated in the highlands of Mexico approximately 8700 years ago and is one of the most commonly grown cereal crops worldwide, followed by wheat and rice. Abiotic stresses (primarily drought, salinity, and high and low temperatures), together with biotic stresses (primarily fungi, viruses, and pests), negatively affect maize growth, development, and eventually production. To understand the response of maize to abiotic and biotic stresses and its mechanism of stress tolerance, high-throughput omics approaches have been used in maize stress studies. Integrated omics approaches are crucial for dissecting the temporal and spatial system-level changes that occur in maize under various stresses. In this comprehensive analysis, we review the primary types of stresses that threaten sustainable maize production; underscore the recent advances in maize stress omics, especially proteomics; and discuss the opportunities, challenges, and future directions of maize stress omics, with a view to sustainable food production. The knowledge gained from studying maize stress omics is instrumental for improving maize to cope with various stresses and to meet the food demands of the exponentially growing global population. Omics systems science offers actionable potential solutions for sustainable food production, and we present maize as a notable case study.
Cytochrome oxidase subunit II gene in mitochondria of Oenothera has no intron
Hiesel, Rudolf; Brennicke, Axel
1983-01-01
The cytochrome oxidase subunit II gene has been localized in the mitochondrial genome of Oenothera berteriana and the nucleotide sequence has been determined. The coding sequence contains 777 bp and, unlike the corresponding gene in Zea mays, is not interrupted by an intron. No TGA codon is found within the open reading frame. The codon CGG, as in the maize gene, is used in place of tryptophan codons of corresponding genes in other organisms. At position 742 in the Oenothera sequence the TGG of maize is changed into a CGG codon, where Trp is conserved as the amino acid in other organisms. Homologous sequences occur more than once in the mitochondrial genome as several mitochondrial DNA species hybridize with DNA probes of the cytochrome oxidase subunit II gene. ImagesFig. 5. PMID:16453484
Mixed cropping of groundnuts and maize in East Java
Hoof, van W.C.H.
1987-01-01
Mixed cropping of groundnuts and maize in East Java was studied by means of a survey of farming practice and by field experiments. The influence of different sowing times and plant density of maize on the development and yield of groundnuts and maize were the main topics in this thesis. Plant
Maize and the Malnutrition Conundrum in South Africa | BOOYENS ...
African Journals Online (AJOL)
In this paper, the author gives an overview of the factors leading to maize becoming a staple food among black people in South Africa. The purported relationship between maize consumption and malnutrition, proposals as well as experimental and practical efforts to correct the dietary deficiencies of maize are briefly ...
Transmission of chromosomal and instability via a chromosome irradiated with ionizing radiation
International Nuclear Information System (INIS)
Kodama, Seiji; Tanabe, Masateru; Shiraishi, Kazunori; Oshimura, Mitsuo
2010-01-01
We examined the stability of the transferred chromosome in 5 and 12 microcell hybrids including unirradiated human chromosomes 6 and 8, respectively, and 6 and 19 microcell hybrids including 4 Gy-irradiated human chromosomes 6 and 8, respectively. The transferred chromosome was structurally stable in most microcell hybrids transferred with the unirradiated chromosomes 6 and 8. In contrast, the 4 Gy-irradiated human chromosomes were unstable in 3 out of 6 hybrids (50%) with chromosome 6 and 3 out of 19 hybrids (16%) with chromosome 8, showing multiple aberrations in high frequencies (35∼98%). To know the cause of delayed chromosomal instability, intrachromosomal rearrangements of the human chromosome is investigated by subtelomere FISH in 17 microcell hybrids transferred with chromosomes 6 and 8. We found frequent intrachromosomal in 7 microcell hybrids (41%). However, no clear correlation was observed between the intrachromosomal rearrangements and the induction of delayed chromosomal instability by ionizing radiation
Chromosomal aberrations in subjects exposed to ionizing radiation
International Nuclear Information System (INIS)
Jovicic, D.; Milacic, S.; Kovacevic, R.; Tanaskovic, I.
2006-01-01
Occupational exposure is particularly delicate because of chronic exposure to low doses of ionizing radiation and its cumulative effect, where it is important to consider the biological response of body to given conditions of exposure. The objective of this study was the observation of the recovery of the DNA damages in subjects working in the radiation area in two different intervals.Group I, consisting of 30 subjects, was exposed to ionizing radiation and unstable chromosomal aberrations were identified. Group II included the same, re-examined subjects (30) 9 months later. It was verified that 5 (16.67%) subjects still had unstable chromosomal aberrations, although they had been excluded from radiation area Controls groups (C) consisted of 64 subjects that were not exposed to mutagenic agents.The comparison of the control group with the two studied groups revealed the reduction of the unstable aberrations (p<0.05). The total effective doses, which increased with the years spent in radiation area, reflected the yield of chromosomal aberrations. The presence of chromosomal aberrations in some subjects, after the exclusion from the ionising radiation exposure, suggests that the time needed for the recovery of the DNA damages is different, which indicates the individual differences in radiosensitivity as well as different of the reparatory cellular response. (author)
International Nuclear Information System (INIS)
Heermann, Dieter W.
2012-01-01
Mounting evidence is compiling linking the physical organizational structure of chromosomes and the nuclear structure to biological function. At the base of the physical organizational structure of both is the concept of loop formation. This implies that physical proximity within chromosomes is provided for otherwise distal genomic regions and thus hierarchically organizing the chromosomes. Together with entropy many experimental observations can be explained with these two concepts. Among the observations that can be explained are the measured physical extent of the chromosomes, their shape, mechanical behavior, the segregation into territories (chromosomal and territories within chromosomes), the results from chromosome conformation capture experiments, as well as linking gene expression to structural organization.
Energy Technology Data Exchange (ETDEWEB)
Heermann, Dieter W., E-mail: heermann@tphys.uni-heidelberg.de
2012-07-15
Mounting evidence is compiling linking the physical organizational structure of chromosomes and the nuclear structure to biological function. At the base of the physical organizational structure of both is the concept of loop formation. This implies that physical proximity within chromosomes is provided for otherwise distal genomic regions and thus hierarchically organizing the chromosomes. Together with entropy many experimental observations can be explained with these two concepts. Among the observations that can be explained are the measured physical extent of the chromosomes, their shape, mechanical behavior, the segregation into territories (chromosomal and territories within chromosomes), the results from chromosome conformation capture experiments, as well as linking gene expression to structural organization.
Review: Maize research and production in Nigeria | Iken | African ...
African Journals Online (AJOL)
Maize (Zea mays) is a major important cereal being cultivated in the rainforest and the derived Savannah zones of Nigeria. Land races, improved high yielding and pest and diseases resistant varieties of maize have been developed. Key words: Maize, Zea mays, Nigeria. African Journal of Biotechnology Vol.3(6) 2004: 302- ...
Making better maize plants for sustainable grain production in a changing climate.
Gong, Fangping; Wu, Xiaolin; Zhang, Huiyong; Chen, Yanhui; Wang, Wei
2015-01-01
Achieving grain supply security with limited arable land is a major challenge in the twenty-first century, owing to the changing climate and increasing global population. Maize plays an increasingly vital role in global grain production. As a C4 plant, maize has a high yield potential. Maize is predicted to become the number one cereal in the world by 2020. However, maize production has plateaued in many countries, and hybrid and production technologies have been fully exploited. Thus, there is an urgent need to shape maize traits and architectures for increased stress tolerance and higher yield in a changing climate. Recent achievements in genomics, proteomics, and metabolomics have provided an unprecedented opportunity to make better maize. In this paper, we discuss the current challenges and potential of maize production, particularly in China. We also highlight the need for enhancing maize tolerance to drought and heat waves, summarize the elite shoot and root traits and phenotypes, and propose an ideotype for sustainable maize production in a changing climate. This will facilitate targeted maize improvement through a conventional breeding program combined with molecular techniques.
The Combining Ability of Maize Inbred Lines for Grain Yield and ...
African Journals Online (AJOL)
The Combining Ability of Maize Inbred Lines for Grain Yield and Reaction to Grey ... East African Journal of Sciences ... (GLS) to maize production, the national maize research program of Ethiopia ... The information from this study will be useful for the development of high-yielding and GLS disease-resistant maize varieties.
Extraction and characterization of natural cellulose fibers from maize tassel
CSIR Research Space (South Africa)
Maepa, CE
2015-04-01
Full Text Available This article reports on the extraction and characterization of novel natural cellulose fibers obtained from the maize (tassel) plant. Cellulose was extracted from the agricultural residue (waste biomaterial) of maize tassel. The maize tassel fibers...
Usage of γ-ray treatment for productivity increasing of maize
International Nuclear Information System (INIS)
Ilieva, V.; Dimov, K.
2003-01-01
The aim of this study is to determine the influence of γ irradiation on phosphorus nutrition and maize productivity increasing. The vegetation experiment with irradiated and non-irradiated maize seeds in controlled conditions (moisture and temperature) for determination of phosphorus and phosphorus-gypsum absorption was carried out. The influence of γ irradiation on maize growth, export of mineral elements in maize, phosphorus fertilizing and dry biomass of maize plants are presented. The effect of the moisture of γ irradiated maize seeds (sort 'Knezha' - 3L - 621) on dry substance and yield of green mass is also discussed. Based on the presented experimental data the following conclusion have been made: the maize seeds (sort 'Knezha, hybrid H-708) simulation is useful; in all variants of phosphorus-gypsum absorption the increasing of plant mass yield (absolutely dry) is observed; the absorbed phosphates reserve is enhanced twice; the efficiency of 32 P use in stimulated seeds is higher than in non-stimulated seeds; the phosphorus content in maize (sort 'Knezha' - 2L - 611) is increasing mainly in leaves after X-ray irradiation (750 - 1500 R); γ irradiation (7.5 Gy) stimulate the root system (18%) and side roots development and drying up overcome
Biofuel, land and water: maize, switchgrass or Miscanthus?
International Nuclear Information System (INIS)
Zhuang Qianlai; Qin Zhangcai; Chen Min
2013-01-01
The productive cellulosic crops switchgrass and Miscanthus are considered as viable biofuel sources. To meet the 2022 national biofuel target mandate, actions must be taken, e.g., maize cultivation must be intensified and expanded, and other biofuel crops (switchgrass and Miscanthus) must be cultivated. This raises questions on the use efficiencies of land and water; to date, the demand on these resources to meet the national biofuel target has rarely been analyzed. Here, we present a data-model assimilation analysis, assuming that maize, switchgrass and Miscanthus will be grown on currently available croplands in the US. Model simulations suggest that maize can produce 3.0–5.4 kiloliters (kl) of ethanol for every hectare of land, depending on the feedstock to ethanol conversion efficiency; Miscanthus has more than twice the biofuel production capacity relative to maize, and switchgrass is the least productive of the three potential sources of ethanol. To meet the biofuel target, about 26.5 million hectares of land and over 90 km 3 of water (of evapotranspiration) are needed if maize grain alone is used. If Miscanthus was substituted for maize, the process would save half of the land and one third of the water. With more advanced biofuel conversion technology for Miscanthus, only nine million hectares of land and 45 km 3 of water would probably meet the national target. Miscanthus could be a good alternative biofuel crop to maize due to its significantly lower demand for land and water on a per unit of ethanol basis. (letter)
Production of high-amylose maize lines using RNA interference in ...
African Journals Online (AJOL)
amylose maize lines with a low T-DNA copy number, demonstrating that RNAi is an efficient method for the production of high-amylose maize lines. Key words: Maize, high-amylose, RNA interference, starch branching enzyme gene sbe2a.
Cai, Fu; Zhang, Shu-jie; Ji, Rui-peng; Mi, Na; Wu, Jin-wen; Zhang, Yu-shu
2015-01-01
Maize water suitability (MWS) model was developed at growth stage scale. Frequency and severity of drought were evaluated by combining MWS estimates and agricultural meteorological drought indexes. The MWS at each growth stage was calculated by using maize observational data and conventional meteorological data at 52 sites in Liaoning during the period from 1981 to 2010. Based on the climatic trend and abrupt change analysis, spatiotemporal dynamics of MWS were investigated. Meanwhile, occurrence of agricultural drought and its severity were also estimated. The results showed that the variation of MWS largely differed at different growth stages. Climatic abrupt change happened in 1994, 1996 and 1999 at the stages of emergence to seven leaves (II), jointing to tasseling (IV) and physiological maturity to maturity (VI). During the past 30 years, MWS showed an obvious increasing trend at the stages of sowing to emergence(I) , seven leaves to jointing(III), IV and tasseling to physiological maturity(V), while it showed a decreasing trend at the stages of II and VI, and that at VI stage was statistically significant. In addition, the climatic trend of MWS showed apparently spatial variability. The frequencies of drought at different severities varied with maize growth stages. Areas of high variability of MWS were located in the Northwest and South of Liaoning at the stages of I , II , III and VI, where were also the regions of high frequency of mid- and severe-drought. At the stages of IV and V, the frequency of drought was low and only light- and mid-drought occurred in few areas. In conclusion, the regional mean MWS could be capable to reasonably assess the agricultural drought in Liaoning at the regional scale.
Iron and manganese oxides modified maize straw to remove tylosin from aqueous solutions.
Yin, Yongyuan; Guo, Xuetao; Peng, Dan
2018-08-01
Maize straw modified by iron and manganese oxides was synthesized via a simple and environmentally friendly method. Three maize straw materials, the original maize straw, maize straw modified by manganese oxides and maize straw modified by iron and manganese oxides, were detected by SEM, BET, XPS, XRD and FTIR. The results showed that maize straw was successfully modified and maize straw modified by iron and manganese oxides has a larger surface area than MS. According to the experimental data, the sorption trend could conform to the pseudo-second-order kinetic model well, and the sorption ability of tylosin on sorbents followed the order of original maize straw oxides iron and manganese oxides. The study indicated that manganese oxides and iron-manganese oxides could significantly enhance the sorption capacity of original maize straw. The sorption isotherm data of tylosin on original maize straw fit a linear model well, while Freundlich models were more suitable for maize straw modified by manganese oxides and maize straw modified by iron and manganese oxides. The pH, ionic strength and temperature can affect the sorption process. The sorption mechanisms of tylosin on iron and manganese oxides modified maize straw were attribute to the surface complexes, electrostatic interactions, H bonding and hydrophobic interactions. Copyright © 2018 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Ishii, Yutaka
1988-01-01
Chromosomal aberrations are classified into two types, chromosome-type and chromatid-type. Chromosom-type aberrations include terminal deletion, dicentric, ring and interstitial deletion, and chromatid-type aberrations include achromatic lesion, chromatid deletion, isochromatid deletion and chromatid exchange. Clastogens which induce chromosomal aberration are divided into ''S-dependent'' agents and ''S-independent''. It might mean whether they can induce double strand breaks independent of the S phase or not. Double strand breaks may be the ultimate lesions to induce chromosomal aberrations. Caffeine added even in the G 2 phase appeared to modify the frequency of chromatid aberrations induced by X-rays and mitomycin C. Those might suggest that the G 2 phase involves in the chromatid aberration formation. The double strand breaks might be repaired by ''G 2 repair system'', the error of which might yield breakage types of chromatid aberrations and the by-pass of which might yield chromatid exchanges. Chromosome-type aberrations might be formed in the G 1 phase. (author)
The DNA topoisomerase II catalytic inhibitor merbarone is genotoxic and induces endoreduplication
International Nuclear Information System (INIS)
Pastor, Nuria; Domínguez, Inmaculada; Orta, Manuel Luís; Campanella, Claudia; Mateos, Santiago; Cortés, Felipe
2012-01-01
In the last years a number of reports have shown that the so-called topoisomerase II (topo II) catalytic inhibitors are able to induce DNA and chromosome damage, an unexpected result taking into account that they do not stabilize topo II-DNA cleavable complexes, a feature of topo II poisons such as etoposide and amsacrine. Merbarone inhibits the catalytic activity of topo II by blocking DNA cleavage by the enzyme. While it was first reported that merbarone does not induce genotoxic effects in mammalian cells, this has been challenged by reports showing that the topo II inhibitor induces efficiently chromosome and DNA damage, and the question as to a possible behavior as a topo II poison has been put forward. Given these contradictory results, and the as yet incomplete knowledge of the molecular mechanism of action of merbarone, in the present study we have tried to further characterize the mechanism of action of merbarone on cell proliferation, cell cycle, as well as chromosome and DNA damage in cultured CHO cells. Merbarone was cytotoxic as well as genotoxic, inhibited topo II catalytic activity, and induced endoreduplication. We have also shown that merbarone-induced DNA damage depends upon ongoing DNA synthesis. Supporting this, inhibition of DNA synthesis causes reduction of DNA damage and increased cell survival.
(SSR) markers for drought tolerance in maize
African Journals Online (AJOL)
Maize is moderately sensitive to drought. Drought affects virtually all aspects of maize growth in varying degrees at all stages, from germination to maturity. Tolerance to drought is genetically and physiologically complicated and inherited quantitatively. Application of molecular-marker aided selection technique for ...
Directory of Open Access Journals (Sweden)
Harbhajan Kaur
2009-08-01
Full Text Available The Lygaeidae (Heteroptera are a large and diverse family in which the male diploid chromosomal complement ranges from 10 to 30. Diploid numbers of 14 and 16 are taken as two modal numbers of the family. The Rhyparochrominae, one of the largest subfamilies of the Lygaeidae, are known to be heterogeneous both cytologically and morphologically. Available data on the tribe Rhyparochromini reveal that all species are characterized by the presence of a pair of microchromosomes (m-chromosomes and have an XY/XX (♂/♀ sex chromosome determining system. Dieuches coloratus (Distant, 1909 and D. insignis (Distant, 1918 belonging to Rhyparochromini, have 2n=14=10A+2m+XY and 2n=12=8A+2m+XY respectively. Both the species are similar inone pair of distinctly large autosomes in their chromosome complements. The metaphase plate arrangement of autosomes, sex chromosomes and m-chromosomes in D. coloratus is similar to the common condition observed in the tribe Rhyparochromini. In D. insignis, however, the arrangement is different. Here, metaphase I is usual in showing peripheral position of autosomes and central position of sex chromosomes and m-chromosomes. At metaphase II, however, autosomes, sex chromosomes and m-chromosomes are peripherally placed, an arrangement, which is not reported earlier in the tribe Rhyparochromini.
Y-chromosome evolution: emerging insights into processes of Y-chromosome degeneration.
Bachtrog, Doris
2013-02-01
The human Y chromosome is intriguing not only because it harbours the master-switch gene that determines gender but also because of its unusual evolutionary history. The Y chromosome evolved from an autosome, and its evolution has been characterized by massive gene decay. Recent whole-genome and transcriptome analyses of Y chromosomes in humans and other primates, in Drosophila species and in plants have shed light on the current gene content of the Y chromosome, its origins and its long-term fate. Furthermore, comparative analysis of young and old Y chromosomes has given further insights into the evolutionary and molecular forces triggering Y-chromosome degeneration and into the evolutionary destiny of the Y chromosome.
A comparative study on infestation of three varieties of maize ( Zea ...
African Journals Online (AJOL)
A study was carried out to study the infestation of three maize varieties (Maize suwan I–Y, Maize T2 USR – White single cross and Maize suwan 123) by Sitophilus zeamais Motsch. Infestation was assessed by counting the numbers of alive and dead adults and the number of infested and uninfested seeds. It was found out ...
Inda, María del Mar; Fan, Xing; Muñoz, Jorge; Perot, Christine; Fauvet, Didier; Danglot, Giselle; Palacio, Ana; Madero, Pilar; Zazpe, Idoya; Portillo, Eduardo; Tuñón, Teresa; Martínez-Peñuela, José María; Alfaro, Jorge; Eiras, José; Bernheim, Alain; Castresana, Javier S
2003-01-01
Various genomic alterations have been detected in glioblastoma. Chromosome 7p, with the epidermal growth factor receptor locus, together with chromosome 10q, with the phosphatase and tensin homologue deleted in chromosome 10 and deleted in malignant brain tumors-1 loci, and chromosome 9p, with the cyclin-dependent kinase inhibitor 2A locus, are among the most frequently damaged chromosomal regions in glioblastoma. In this study, we evaluated the genetic status of 32 glioblastomas by comparative genomic hybridization; the sensitivity of comparative genomic hybridization versus differential polymerase chain reaction to detect deletions at the phosphatase and tensin homologue deleted in chromosome 10, deleted in malignant brain tumors-1, and cyclin-dependent kinase inhibitor 2A loci and amplifications at the cyclin-dependent kinase 4 locus; the frequency of genetic lesions (gain or loss) at 16 different selected loci (including oncogenes, tumor-suppressor genes, and proliferation markers) mapping on 13 different chromosomes; and the possible existence of a statistical association between any pair of molecular markers studied, to subdivide the glioblastoma entity molecularly. Comparative genomic hybridization showed that the most frequent region of gain was chromosome 7p, whereas the most frequent losses occurred on chromosomes 10q and 13q. The only statistically significant association was found for 7p gain and 10q loss. Copyright 2002 Wiley-Liss, Inc.
Yu, Tao; Li, Geng; Dong, Shuting; Liu, Peng; Zhang, Jiwang; Zhao, Bin
2016-11-04
Grain development in maize is an essential process in the plant's life cycle and is vital for use of the plant as a crop for animals and humans. However, little is known regarding the protein regulatory networks that control grain development. Here, isobaric tag for relative and absolute quantification (iTRAQ) technology was used to analyze temporal changes in protein expression during maize grain development. Maize grain proteins and changes in protein expression at eight developmental stages from 3 to 50 d after pollination (DAP) were performed using iTRAQ-based proteomics. Overall, 4751 proteins were identified; 2639 of these were quantified and 1235 showed at least 1.5-fold changes in expression levels at different developmental stages and were identified as differentially expressed proteins (DEPs). The DEPs were involved in different cellular and metabolic processes with a preferential distribution to protein synthesis/destination and metabolism categories. A K-means clustering analysis revealed coordinated protein expression associated with different functional categories/subcategories at different development stages. Our results revealed developing maize grain display different proteomic characteristics at distinct stages, such as numerous DEPs for cell growth/division were highly expressed during early stages, whereas those for starch biosynthesis and defense/stress accumulated in middle and late stages, respectively. We also observed coordinated expression of multiple proteins of the antioxidant system, which are essential for the maintenance of reactive oxygen species (ROS) homeostasis during grain development. Particularly, some DEPs, such as zinc metallothionein class II, pyruvate orthophosphate dikinase (PPDK) and 14-3-3 proteins, undergo major changes in expression at specific developmental stages, suggesting their roles in maize grain development. These results provide a valuable resource for analyzing protein function on a global scale and also
Effects of temperature changes on maize production in Mozambique
Harrison, L.; Michaelsen, J.; Funk, Chris; Husak, G.
2011-01-01
We examined intraseasonal changes in maize phenology and heat stress exposure over the 1979-2008 period, using Mozambique meteorological station data and maize growth requirements in a growing degree-day model. Identifying historical effects of warming on maize growth is particularly important in Mozambique because national food security is highly dependent on domestic food production, most of which is grown in already warm to hot environments. Warming temperatures speed plant development, shortening the length of growth periods necessary for optimum plant and grain size. This faster phenological development also alters the timing of maximum plant water demand. In hot growing environments, temperature increases during maize pollination threaten to make midseason crop failure the norm. In addition to creating a harsher thermal environment, we find that early season temperature increases have caused the maize reproductive period to start earlier, increasing the risk of heat and water stress. Declines in time to maize maturation suggest that, independent of effects to water availability, yield potential is becoming increasingly limited by warming itself. Regional variations in effects are a function of the timing and magnitude of temperature increases and growing season characteristics. Continuation of current climatic trends could induce substantial yield losses in some locations. Farmers could avoid some losses through simple changes to planting dates and maize varietal types.
Cluster Analysis of Maize Inbred Lines
Directory of Open Access Journals (Sweden)
Jiban Shrestha
2016-12-01
Full Text Available The determination of diversity among inbred lines is important for heterosis breeding. Sixty maize inbred lines were evaluated for their eight agro morphological traits during winter season of 2011 to analyze their genetic diversity. Clustering was done by average linkage method. The inbred lines were grouped into six clusters. Inbred lines grouped into Clusters II had taller plants with maximum number of leaves. The cluster III was characterized with shorter plants with minimum number of leaves. The inbred lines categorized into cluster V had early flowering whereas the group into cluster VI had late flowering time. The inbred lines grouped into the cluster III were characterized by higher value of anthesis silking interval (ASI and those of cluster VI had lower value of ASI. These results showed that the inbred lines having widely divergent clusters can be utilized in hybrid breeding programme.
The effects of a seed treatment on early season growth, seedling disease development, incidence Fusarium spp. infection, and photosynthetic performance of maize were evaluated at two locations in Iowa in 2007. Maize seed was either treated with Cruiser 2Extreme 250 ® (fludioxonil + azoxystrobin + me...
PERFORMANCE OF MAIZE (ZEA MAYS) CULTIVARS AS ...
African Journals Online (AJOL)
IBUKUN
reported to have low remobilisation efficiency and reduced plasticity of seed weight to assimilate availability ... have indicated that the use of organo-mineral fertiliser in maize and melon gave high relative .... The soil physical and chemical characteristics of ..... yield in maize by examining genetic improvement and heterosis.
Deregulation of Lesotho's maize market
van Schalkwyk, Herman D.; van Zyl, Johan; Botha, P.W.; Bayley, B.
1997-01-01
During the past year, there have been major policy reforms in Lesotho and South Africa with respect to maize pricing and marketing. In Lesotho the impact of deregulation on producers, consumers and government revenues was substantially lower than it should have been, and as a result Lesotho was not able to reap the full benefits of these changes. This is partly because information on the changes to the maize marketing system did not reach the potential beneficiaries of the new system. Free an...
Hausmann, M.; Dudin, G.; Aten, J. A.; Heilig, R.; Diaz, E.; Cremer, C.
1991-01-01
The recently developed methods of non radioactive in situ hybridization of chromosomes offer new aspects for chromosome analysis. Fluorescent labelling of hybridized chromosomes or chromosomal subregions allows to facilitate considerably the detection of specific chromosomal abnormalities. For many
Growing sensitivity of maize to water scarcity under climate change.
Meng, Qingfeng; Chen, Xinping; Lobell, David B; Cui, Zhenling; Zhang, Yi; Yang, Haishun; Zhang, Fusuo
2016-01-25
Climate change can reduce crop yields and thereby threaten food security. The current measures used to adapt to climate change involve avoiding crops yield decrease, however, the limitations of such measures due to water and other resources scarcity have not been well understood. Here, we quantify how the sensitivity of maize to water availability has increased because of the shift toward longer-maturing varieties during last three decades in the Chinese Maize Belt (CMB). We report that modern, longer-maturing varieties have extended the growing period by an average of 8 days and have significantly offset the negative impacts of climate change on yield. However, the sensitivity of maize production to water has increased: maize yield across the CMB was 5% lower with rainfed than with irrigated maize in the 1980s and was 10% lower (and even >20% lower in some areas) in the 2000s because of both warming and the increased requirement for water by the longer-maturing varieties. Of the maize area in China, 40% now fails to receive the precipitation required to attain the full yield potential. Opportunities for water saving in maize systems exist, but water scarcity in China remains a serious problem.
Effect and fate of lindane in maize plant
International Nuclear Information System (INIS)
Bennaceur, M.; Ghezal, F.; Klaa, K.
1992-10-01
The fate and effect of lindane in maize plant, soil and predators were studied following insecticide application under field conditions. Respectively 84,2% and 93,3% of lindane residues were lost after 2 and 4 months in soil after treatment. About 90% of the insecticide was lost after one month in maize plant. Lindane residues were present in maize grains (0,205ppm). Lindane decreases the density of many predators in soils such as species of collembola, coccinellidae, formicidae, coleoptera
Combining Maize Base Germplasm for Cold Tolerance Breeding
Rodríguez Graña, Víctor Manuel; Butrón Gómez, Ana María; Sandoya Miranda, Germán; Ordás Pérez, Amando; Revilla Temiño, Pedro
2007-01-01
Early planting can contribute to increased grain yield of maize (Zea mays L.), but it requires cold tolerance. A limited number of cold-tolerant maize genotypes have been reported. The objectives of this study were to test a new strategy to improve cold tolerance in maize searching for broad x narrow genetic combinations that may be useful as base populations for breeding programs, to compare genotype performance under cold-controlled and field conditions, and to establish the major genetic e...
Status and prospects of maize research in Nepal
Govind KC; Tika B. Karki; Jiban Shrestha; Buddhi B. Achhami
2015-01-01
Food and nutritional securities are the major threats coupled with declining factor productivity and climate change effects in Nepal. Maize being the principal food crops of the majority of the hill people and source of animal feed for ever growing livestock industries in Terai of Nepal. Despite the many efforts made to increase the maize productivity in the country, the results are not much encouraging. Many of the maize based technologies developed and recommended for the farmers to date ar...
Chromosomic studies on some Pteridophyta from Portugal. II
Directory of Open Access Journals (Sweden)
Queirós, Magarida
1991-12-01
Full Text Available Chromosome numbers of ten taxa of Pteridophyta from Portugal are reported. Earlier counts on six of these taxa have been carried out on material from other portuguese places. Selaginella denticulata (L. Spring, Polypodium cambricum L. subsp. Cambricum, Asplenium adiantum-nigrum L. var. adiantum-nigrum and Cystopteris fragilis (L. Bernh. subsp. fragilisare now first studied under the caryological point of view.
Se ha estudiado el número cromosómico de algunos taxones de Pteridaphyta portugueses de los cuales se dan a conocer per primera vez los siguientes: Selaginella denticulata (L. Spring, Polypodium cambricum L. subsp. Cambricum, Asplenium adiantum-nigrum L. var. adiantum-nigrum y Cystopteris fragilis (L. Bernh. subsp. fragilis. Los restantes coinciden con los datos dados anteriormente.
Genomic variation in recently collected maize landraces from Mexico
Arteaga, María Clara; Moreno-Letelier, Alejandra; Mastretta-Yanes, Alicia; Vázquez-Lobo, Alejandra; Breña-Ochoa, Alejandra; Moreno-Estrada, Andrés; Eguiarte, Luis E.; Piñero, Daniel
2015-01-01
The present dataset comprises 36,931 SNPs genotyped in 46 maize landraces native to Mexico as well as the teosinte subspecies Zea maiz ssp. parviglumis and ssp. mexicana. These landraces were collected directly from farmers mostly between 2006 and 2010. We accompany these data with a short description of the variation within each landrace, as well as maps, principal component analyses and neighbor joining trees showing the distribution of the genetic diversity relative to landrace, geographical features and maize biogeography. High levels of genetic variation were detected for the maize landraces (HE = 0.234 to 0.318 (mean 0.311), while slightly lower levels were detected in Zea m. mexicana and Zea m. parviglumis (HE = 0.262 and 0.234, respectively). The distribution of genetic variation was better explained by environmental variables given by the interaction of altitude and latitude than by landrace identity. This dataset is a follow up product of the Global Native Maize Project, an initiative to update the data on Mexican maize landraces and their wild relatives, and to generate information that is necessary for implementing the Mexican Biosafety Law. PMID:26981357
Directory of Open Access Journals (Sweden)
Luchian T.
2012-04-01
Full Text Available The response of maize to radiation exposure was investigated by two cytogenetic methods considering the importance of the geno-toxic effect for environmental and agricultural purposes. Uniform genophond seeds, freshly germinated, were exposed to relatively low radiation doses using a radiotherapy X-ray applicator from a hospital irradiation device and to a 50 Hz electromagnetic field with about 10 mT magnetic induction (generated within laboratory assembled electromagnetic coils. Radicular meristeme tissue aliquots were prevailed for cytogenetic investigation based on microscopic observations and cell counting. Microscope slides were prepared following a specific procedure (squash technique and Feulgen method based on modified Carr reactive coloration. Mitotic index as well as chromosomal aberration percentage were calculated for more than 30,000 cells taken into account. From a qualitative viewpoint, chromosomal aberrations such as interchromatidian bridges, lagging and expelled chromosomes and multipolar divisions were evidenced - no distinct situation for either ionizing radiation or electromagnetic field being identified. The main quantitative difference consisted in the increased mitotic index for electromagnetic exposure increased times compared with the diminished mitotic index in the case of low X-ray doses.
Is Investment in Maize Research Balanced and Justified? An Empirical Study
Directory of Open Access Journals (Sweden)
Hari Krishna Shrestha
2016-12-01
Full Text Available The objective of this study was to investigate whether the investment in maize research was adequate and balanced in Nepalese context. Resource use in maize research was empirically studied with standard congruency analysis by using Full Time Equivalent (FTE of researchers as a proxy measure of investment. The number of researchers involved in maize was 61 but it was only 21.25 on FTE basis, indicating that full time researchers were very few as compared to the cultivated area of maize in the country. Statistical analysis revealed that the investment in maize research was higher in Tarai and lower in the Hills. Congruency index on actual production basis was found low across the eco-zones and even lower across the geographical regions indicating that the investment in maize research was a mismatch and not justified. While adjusted with the equity factor and the research progress factor in the analysis substantial difference was not found in congruency index. This study recommends that substantial increase in investment in maize research is needed with balanced and justified manner across the eco-zones and the geographical regions. Hills need special attention to increase the investment as maize output value is higher in this eco-zone. Eastern and western regions also need increased investment in maize according to their contribution in the output value.
Chromosomal Replication Complexity: A Novel DNA Metrics and Genome Instability Factor.
Directory of Open Access Journals (Sweden)
Andrei Kuzminov
2016-10-01
Full Text Available As the ratio of the copy number of the most replicated to the unreplicated regions in the same chromosome, the definition of chromosomal replication complexity (CRC appears to leave little room for variation, being either two during S-phase or one otherwise. However, bacteria dividing faster than they replicate their chromosome spike CRC to four and even eight. A recent experimental inquiry about the limits of CRC in Escherichia coli revealed two major reasons to avoid elevating it further: (i increased chromosomal fragmentation and (ii complications with subsequent double-strand break repair. Remarkably, examples of stable elevated CRC in eukaryotic chromosomes are well known under various terms like "differential replication," "underreplication," "DNA puffs," "onion-skin replication," or "re-replication" and highlight the phenomenon of static replication fork (sRF. To accurately describe the resulting "amplification by overinitiation," I propose a new term: "replification" (subchromosomal overreplication. In both prokaryotes and eukaryotes, replification, via sRF processing, causes double-strand DNA breaks and, with their repair elevating chromosomal rearrangements, represents a novel genome instability factor. I suggest how static replication bubbles could be stabilized and speculate that some tandem duplications represent such persistent static bubbles. Moreover, I propose how static replication bubbles could be transformed into tandem duplications, double minutes, or inverted triplications. Possible experimental tests of these models are discussed.
Developing a database for maize variety in Nigeria | Daniel | Moor ...
African Journals Online (AJOL)
Performance data of maize varieties at different locations needs to be accurate and accessible to stimulate the improvement of the Nigerian maize seed system. This paper describes a database model to implement a simple computerized information system for maize varieties and their performance at various locations in ...
Global maize trade and food security: implications from a social network model.
Wu, Felicia; Guclu, Hasan
2013-12-01
In this study, we developed a social network model of the global trade of maize: one of the most important food, feed, and industrial crops worldwide, and critical to food security. We used this model to analyze patterns of maize trade among nations, and to determine where vulnerabilities in food security might arise if maize availability was decreased due to factors such as diversion to nonfood uses, climatic factors, or plant diseases. Using data on imports and exports from the U.N. Commodity Trade Statistics Database for each year from 2000 to 2009 inclusive, we summarized statistics on volumes of maize trade between pairs of nations for 217 nations. There is evidence of market segregation among clusters of nations; with three prominent clusters representing Europe, Brazil and Argentina, and the United States. The United States is by far the largest exporter of maize worldwide, whereas Japan and the Republic of Korea are the largest maize importers. In particular, the star-shaped cluster of the network that represents U.S. maize trade to other nations indicates the potential for food security risks because of the lack of trade these other nations conduct with other maize exporters. If a scenario arose in which U.S. maize could not be exported in as large quantities, maize supplies in many nations could be jeopardized. We discuss this in the context of recent maize ethanol production and its attendant impacts on food prices elsewhere worldwide. © 2013 Society for Risk Analysis.
Studies on the traditional methods of production of maize tuwo (a ...
African Journals Online (AJOL)
African Journal of Food, Agriculture, Nutrition and Development ... on the quality characteristics of maize tuwo (a Nigerian nonfermented maize dumpling) ... The sequential mixing of flour and water during maize tuwo preparation should also ...
Xu, Tian-Jun; Dong, Zhi-Qiang; Gao, Jiao; Chen, Chuan-Xiao; Jiao, Liu; Xie, Zhen-Xing
2013-02-01
Taking the two maize varieties Zhengdan 958 and Fengdan 3 grown on the three accumulated temperature zones (I, II and III) in Heilongjiang Provice as test materials, a field investigation was made in 2010 and 2011 to study the effects of PASP-KT-NAA (PKN), a compound of exogenous plant growth regulators, on the grain filling and yield of the varieties under different environmental temperatures. From zone I to III, the air temperature at the grain filling stage had a decreasing trend, with the average minimum temperature being 12.16, 11.40, and 9.56, respectively. The effective accumulated temperature at the mid-ate amt sae stage of grain filling was too low to be sufficient for grain filling, which severely affected the grain filling process. Applying N, P and K promoted the dry matter accumulation of maize grain and the grain filling rate in the three zones, delayed the peak time (Tmax) of the grain filling rate of Fengdan 3 but advanced that of Zhengdan 958, promoted the growth capacity at peak time of grain filling rate and the maximum grain filling rate of the two varieties, and shortened their active grain filling period. Applying N, P, and K increased the grain yield of the two varieties in the three zones obviously, and, as compared with those in zones I and II , the grain yields of Zhengdan 958 and Fengdan 3 in zone III were increased by 8.2% and 5.1% , and 3.4% and 0.8% , respectively. Therefore, applying N, P and K could help maize utilizing the limited accumulation temperature, improve the grain filling rate, decrease the grain water content, and ultimately, increase the maize yield.
Energy Technology Data Exchange (ETDEWEB)
Bauchinger, M.; Schmid, E.; Hug, O. [Gesellschaft fuer Strahlenforschung, Institut fuer Biologie, Neuherberg, Federal Republic of Germany (Germany); Strahlenbiologisches Institut der Universitaet Muenchen, Federal Republic of Germany (Germany)
1971-06-15
The usefulness of chromosome analysis for biological dosimetry has been tested in two groups of persons occupationally exposed to radiation: (I) in nurses employed in gynaecological radiology, exposed especially when handling radium inserts; and (II) in nuclear industry workers, all of which were exposed to external gamma irradiation and some of them also to internal radiation after incorporation of various radionuclides. The total dose registered with personal dosimeters ranged in Group 1 from 0.1 to 91.1 rem accumulated over working periods of 0.1 to 13 years, and in Group II from 1.0 to 18.2 rem accumulated over 1 to 9 years. Compared with unexposed controls, both groups exhibit a significant increase of cells with chromosome aberrations as well as larger numbers of breaks per cell. Dicentrics and rings could be observed in some cells, providing good evidence for previous radiation exposure, since these types of aberrations are extremely rare events in unexposed individuals. No correlation between the aberration yields and the film badge values could be demonstrated in Group II. Also, in Group I the fluctuations from individual to individual are rather high. Nevertheless, a positive correlation to the ''dose'' was obtained. Even a sub-group of the nurses that had only been exposed to 20 rem showed significantly more aberrations than control persons. From the results obtained, type and frequency of chromosome aberrations may be considered an indicator of radiation exposure even at the low doses. The reasons for lack of correspondence of chromosome aberration yields and the results of personal monitoring procedures are discussed in detail. (author)
[Contamination with genetically modified maize MON863 of processed foods on the market].
Ohgiya, Yoko; Sakai, Masaaki; Miyashita, Taeko; Yano, Koichi
2009-06-01
Genetically modified maize MON863 (MON863), which has passed a safety examination in Japan, is commercially cultivated in the United States as a food and a resource for fuel. Maize is an anemophilous flower, which easily hybridizes. However, an official method for quantifying the content of MON863 has not been provided yet in Japan. We here examined MON863 contamination in maize-processed foods that had no labeling indicating of the use of genetically modified maize.From March 2006 to July 2008, we purchased 20 frozen maize products, 8 maize powder products, 7 canned maize products and 4 other maize processed foods. Three primer pairs named MON 863 primer, MON863-1, and M3/M4 for MON863-specific integrated cassette were used for qualitative polymerase chain reaction (PCR). A primer pair "SSIIb-3" for starch synthase gene was used to confirm the quality of extracted DNA. The starch synthase gene was detected in all samples. In qualitative tests, the MON863-specific fragments were detected in 7 (18%) maize powder products out of the 39 processed foods with all the three primer pairs.We concluded that various maize processed foods on the market were contaminated with MON863. It is important to accumulate further information on MON863 contamination in maize-processed foods that have no label indication of the use of genetically modified maize.
Nitrogen effects on maize yield following groundnut in rotation on ...
African Journals Online (AJOL)
Rotating maize (Zea mays L.) with groundnut (Arachis hypogaea L.) has been proposed as a way to maintain soil fertility and prevent maize productivity declines in the smallholder cropping systems of sub-humid Zimbabwe. Field experiments with fertilizer-N on maize in rotation with groundnut were conducted at three ...
Quantitative trait loci for resistance to Maize rayado fino virus
Maize rayado fino virus (MRFV) causes one of the most important virus diseases of maize in regions of Mexico, Central and South America, where it causes moderate to severe yield losses. The virus is found from the southern United States. to northern Argentina where its vector, the maize leafhopper D...
Sporophytic control of pollen tube growth and guidance in maize
Lausser, Andreas; Kliwer, Irina; Srilunchang, Kanok-orn; Dresselhaus, Thomas
2010-01-01
Pollen tube germination, growth, and guidance (progamic phase) culminating in sperm discharge is a multi-stage process including complex interactions between the male gametophyte as well as sporophytic tissues and the female gametophyte (embryo sac), respectively. Inter- and intra-specific crossing barriers in maize and Tripsacum have been studied and a precise description of progamic pollen tube development in maize is reported here. It was found that pollen germination and initial tube growth are rather unspecific, but an early, first crossing barrier was detected before arrival at the transmitting tract. Pollination of maize silks with Tripsacum pollen and incompatible pollination of Ga1s/Ga1s-maize silks with ga1-maize pollen revealed another two incompatibility barriers, namely transmitting tract mistargeting and insufficient growth support. Attraction and growth support by the transmitting tract seem to play key roles for progamic pollen tube growth. After leaving transmitting tracts, pollen tubes have to navigate across the ovule in the ovular cavity. Pollination of an embryo sac-less maize RNAi-line allowed the role of the female gametophyte for pollen tube guidance to be determined in maize. It was found that female gametophyte controlled guidance is restricted to a small region around the micropyle, approximately 50–100 μm in diameter. This area is comparable to the area of influence of previously described ZmEA1-based short-range female gametophyte signalling. In conclusion, the progamic phase is almost completely under sporophytic control in maize. PMID:19926683
Exploring cost-effective maize integrated weed management ...
African Journals Online (AJOL)
Several production constraints have led to low yields (< 2.5 t ha-1) in maize (Zea mays L.) inUganda, among which are weeds. This study investigated the most cost-effective integrated weedmanagement (IWM) approach in maize in eastern Uganda. An experiment was conducted atIkulwe station, Mayuge in 2011 and 2012 ...
Assessment of Climate Suitability of Maize in South Korea
Hyun, S.; Choi, D.; Seo, B.
2017-12-01
Assessing suitable areas for crops would be useful to design alternate cropping systems as an adaptation option to climate change adaptation. Although suitable areas could be identified by using a crop growth model, it would require a number of input parameters including cultivar and soil. Instead, a simple climate suitability model, e.g., EcoCrop model, could be used for an assessment of climate suitability for a major grain crop. The objective of this study was to assess of climate suitability for maize using the EcoCrop model under climate change conditions in Korea. A long term climate data from 2000 - 2100 were compiled from weather data source. The EcoCrop model implemented in R was used to determine climate suitability index at each grid cell. Overall, the EcoCrop model tended to identify suitable areas for maize production near the coastal areas whereas the actual major production areas located in inland areas. It is likely that the discrepancy between assessed and actual crop production areas would result from the socioeconomic aspects of maize production. Because the price of maize is considerably low, maize has been grown in an area where moisture and temperature conditions would be less than optimum. In part, a simple algorithm to predict climate suitability for maize would caused a relatively large error in climate suitability assessment under the present climate conditions. In 2050s, the climate suitability for maize increased in a large areas in southern and western part of Korea. In particular, the plain areas near the coastal region had considerably greater suitability index in the future compared with mountainous areas. The expansion of suitable areas for maize would help crop production policy making such as the allocation of rice production area for other crops due to considerably less demand for the rice in Korea.
A Comprehensive Analysis of Alternative Splicing in Paleopolyploid Maize
Directory of Open Access Journals (Sweden)
Wenbin Mei
2017-05-01
Full Text Available Identifying and characterizing alternative splicing (AS enables our understanding of the biological role of transcript isoform diversity. This study describes the use of publicly available RNA-Seq data to identify and characterize the global diversity of AS isoforms in maize using the inbred lines B73 and Mo17, and a related species, sorghum. Identification and characterization of AS within maize tissues revealed that genes expressed in seed exhibit the largest differential AS relative to other tissues examined. Additionally, differences in AS between the two genotypes B73 and Mo17 are greatest within genes expressed in seed. We demonstrate that changes in the level of alternatively spliced transcripts (intron retention and exon skipping do not solely reflect differences in total transcript abundance, and we present evidence that intron retention may act to fine-tune gene expression across seed development stages. Furthermore, we have identified temperature sensitive AS in maize and demonstrate that drought-induced changes in AS involve distinct sets of genes in reproductive and vegetative tissues. Examining our identified AS isoforms within B73 × Mo17 recombinant inbred lines (RILs identified splicing QTL (sQTL. The 43.3% of cis-sQTL regulated junctions are actually identified as alternatively spliced junctions in our analysis, while 10 Mb windows on each side of 48.2% of trans-sQTLs overlap with splicing related genes. Using sorghum as an out-group enabled direct examination of loss or conservation of AS between homeologous genes representing the two subgenomes of maize. We identify several instances where AS isoforms that are conserved between one maize homeolog and its sorghum ortholog are absent from the second maize homeolog, suggesting that these AS isoforms may have been lost after the maize whole genome duplication event. This comprehensive analysis provides new insights into the complexity of AS in maize.
Studies on maize inbred lines susceptibility to herbicides
Directory of Open Access Journals (Sweden)
Stefanović Lidija
2010-01-01
Full Text Available This paper presents the analysis of results obtained during long- term studies on the response of maize inbred lines to herbicides. Under the agroecological conditions of Zemun Polje the response (reaction of maize inbred lines to herbicides of different classes was investigated. Biological tests were performed and some agronomic, morphological, physiological and biochemical parameters were determined when the response of maize inbred lines to herbicides was estimated. The use of active ingredients of herbicides from triazine, acetanilide, thiocarbamate to new chemical groups (sulfonylurea etc., have been resulted in changes in weed suppression and susceptibility of inbred lines. Obtained results show that effects of herbicides on susceptible maize genotypes can be different: they can slowdown the growth and development and affect the plant height; they can also affect the stages of the tassel and ear development and at the end they can reduced grain yield of the tested inbreds. Numerous studies confirmed the existence of differences in susceptibility level of maize genotypes in relation to herbicides. According to gained results the recommendations for growers are made on the possibility of the application of new herbicides in the hybrid seed production.
Characterization and fine mapping of qkc7.03: a major locus for kernel cracking in maize.
Yang, Mingtao; Chen, Lin; Wu, Xun; Gao, Xing; Li, Chunhui; Song, Yanchun; Zhang, Dengfeng; Shi, Yunsu; Li, Yu; Li, Yong-Xiang; Wang, Tianyu
2018-02-01
A major locus conferring kernel cracking in maize was characterized and fine mapped to an interval of 416.27 kb. Meanwhile, combining the results of transcriptomic analysis, the candidate gene was inferred. Seed development requires a proper structural and physiological balance between the maternal tissues and the internal structures of the seeds. In maize, kernel cracking is a disorder in this balance that seriously limits quality and yield and is characterized by a cracked pericarp at the kernel top and endosperm everting. This study elucidated the genetic basis and characterization of kernel cracking. Primarily, a near isogenic line (NIL) with a B73 background exhibited steady kernel cracking across environments. Therefore, deprived mapping populations were developed from this NIL and its recurrent parent B73. A major locus on chromosome 7, qkc7.03, was identified to be associated with the cracking performance. According to a progeny test of recombination events, qkc7.03 was fine mapped to a physical interval of 416.27 kb. In addition, obvious differences were observed in embryo development and starch granule arrangement within the endosperm between the NIL and its recurrent parent upon the occurrence of kernel cracking. Moreover, compared to its recurrent parent, the transcriptome of the NIL showed a significantly down-regulated expression of genes related to zeins, carbohydrate synthesis and MADS-domain transcription factors. The transcriptomic analysis revealed ten annotated genes within the target region of qkc7.03, and only GRMZM5G899476 was differently expressed between the NIL and its recurrent parent, indicating that this gene might be a candidate gene for kernel cracking. The results of this study facilitate the understanding of the potential mechanism underlying kernel cracking in maize.
Louis, Joe; Basu, Saumik; Varsani, Suresh; Castano-Duque, Lina; Jiang, Victoria; Williams, W. Paul; Felton, Gary W.; Luthe, Dawn S.
2015-01-01
Signaling networks among multiple phytohormones fine-tune plant defense responses to insect herbivore attack. Previously, it was reported that the synergistic combination of ethylene (ET) and jasmonic acid (JA) was required for accumulation of the maize insect resistance1 (mir1) gene product, a cysteine (Cys) proteinase that is a key defensive protein against chewing insect pests in maize (Zea mays). However, this study suggests that mir1-mediated resistance to corn leaf aphid (CLA; Rhopalosiphum maidis), a phloem sap-sucking insect pest, is independent of JA but regulated by the ET-signaling pathway. Feeding by CLA triggers the rapid accumulation of mir1 transcripts in the resistant maize genotype, Mp708. Furthermore, Mp708 provided elevated levels of antibiosis (limits aphid population)- and antixenosis (deters aphid settling)-mediated resistance to CLA compared with B73 and Tx601 maize susceptible inbred lines. Synthetic diet aphid feeding trial bioassays with recombinant Mir1-Cys Protease demonstrates that Mir1-Cys Protease provides direct toxicity to CLA. Furthermore, foliar feeding by CLA rapidly sends defensive signal(s) to the roots that trigger belowground accumulation of the mir1, signifying a potential role of long-distance signaling in maize defense against the phloem-feeding insects. Collectively, our data indicate that ET-regulated mir1 transcript accumulation, uncoupled from JA, contributed to heightened resistance to CLA in maize. In addition, our results underscore the significance of ET acting as a central node in regulating mir1 expression to different feeding guilds of insect herbivores. PMID:26253737
Suga, Koushirou; Mark Welch, David B; Tanaka, Yukari; Sakakura, Yoshitaka; Hagiwara, Atsushi
2008-06-01
The monogonont rotifer Brachionus plicatilis is an emerging model system for a diverse array of questions in limnological ecosystem dynamics, the evolution of sexual recombination, cryptic speciation, and the phylogeny of basal metazoans. We sequenced the complete mitochondrial genome of B. plicatilis sensu strictu NH1L and found that it is composed of 2 circular chromosomes, designated mtDNA-I (11,153 bp) and mtDNA-II (12,672 bp). Hybridization to DNA isolated from mitochondria demonstrated that mtDNA-I is present at 4 times the copy number of mtDNA-II. The only nucleotide similarity between the 2 chromosomes is a 4.9-kbp region of 99.5% identity including a transfer RNA (tRNA) gene and an extensive noncoding region that contains putative D-loop and control sequence. The mtDNA-I chromosome encodes 4 proteins (ATP6, COB, NAD1, and NAD2), 13 tRNAs, and the large and small subunit ribosomal RNAs; mtDNA-II encodes 8 proteins (COX1-3, NAD3-6, and NAD4L) and 9 tRNAs. Gene order is not conserved between B. plicatilis and its closest relative with a sequenced mitochondrial genome, the acanthocephalan Leptorhynchoides thecatus, or other sequenced mitochondrial genomes. Polymerase chain reaction assays and Southern hybridization to DNA from 18 strains of Brachionus suggest that the 2-chromosome structure has been stable for millions of years. The novel organization of the B. plicatilis mitochondrial genome into 2 nearly equal chromosomes of 4-fold different copy number may provide insight into the evolution of metazoan mitochondria and the phylogenetics of rotifers and other basal animal phyla.
The economic implication of substituting cocoa pod husk for maize ...
African Journals Online (AJOL)
This saving was found to bridge the deficit between demand and supply as given by supplementation done by importing maize. The study concluded that by utilizing CPH in compounding various livestock feed rations, the high price of maize arising from excessive demand can be reduced. The limiting role of maize in ...
Jacobs, C M; Utterback, P L; Parsons, C M; Rice, D; Smith, B; Hinds, M; Liebergesell, M; Sauber, T
2008-03-01
An experiment using 216 Hy-Line W-36 pullets was conducted to evaluate transgenic maize grain containing the cry34Ab1 and cry35Ab1 genes from a Bacillus thuringiensis (Bt) strain and the phosphinothricin ace-tyltransferase (pat) gene from Streptomyces viridochromogenes. Expression of the cry34Ab1 and cry35Ab1 genes confers resistance to corn rootworms, and the pat gene confers tolerance to herbicides containing glufosinate-ammonium. Pullets (20 wk of age) were placed in cage lots (3 hens/cage, 2 cages/lot) and were randomly assigned to 1 of 3 corn-soybean meal dietary treatments (12 lots/treatment) formulated with the following maize grains: near-isogenic control (control), conventional maize, and transgenic test corn line 59122 containing event DAS-59122-7. Differences between 59122 and control group means were evaluated with statistical significance at P < 0.05. Body weight and gain, egg production, egg mass, and feed efficiency for hens fed the 59122 corn were not significantly different from the respective values for hens fed diets formulated with control maize grain. Egg component weights, Haugh unit measures, and egg weight class distribution were similar regardless of the corn source. This research indicates that performance of hens fed diets containing 59122 maize grain, as measured by egg production and egg quality, was similar to that of hens fed diets formulated with near-isogenic corn grain.
A review on important maize diseases and their management in Nepal
Directory of Open Access Journals (Sweden)
Subash Subedi
2015-12-01
Full Text Available In Nepal, maize ranks second after rice both in area and production. In recent years, maize area and production has shown a steady increase, but productivity has been low (2.46 t/ha. The major maize producing regions in Nepal are mid hill (72.85%, terai (17.36% and high hill (9.79% respectively. A literature review was carried out to explore major maize diseases and their management in Nepal. The omnipresent incidence of diseases at the pre harvest stage has been an important bottleneck in increasing production. Till now, a total of 78 (75 fungal and 3 bacterial species are pathogenic to maize crop in Nepal. The major and economically important maize diseases reported are Gray leaf spot, Northern leaf blight, Southern leaf Blight, Banded leaf and sheath blight, Ear rot, Stalk rot, Head smut, Common rust, Downy mildew and Brown spot. Information on bacterial and virus diseases, nematodes and yield loss assessment is also given. Description of the major maize diseases, their causal organisms, distribution, time and intensity of disease incidence, symptoms, survival, spreads, environmental factors for disease development, yield losses and various disease management strategies corresponded to important maize diseases of Nepal are gathered and compiled thoroughly from the available publications. Concerted efforts of NARC commodity programs, divisions, ARS and RARS involving research on maize pathology and their important outcomes are mentioned. The use of disease management methods focused on host resistance has also been highlighted.
Field-Evolved Resistance to Bt Maize by Western Corn Rootworm
Gassmann, Aaron J.; Petzold-Maxwell, Jennifer L.; Keweshan, Ryan S.; Dunbar, Mike W.
2011-01-01
Background Crops engineered to produce insecticidal toxins derived from the bacterium Bacillus thuringiensis (Bt) are planted on millions of hectares annually, reducing the use of conventional insecticides and suppressing pests. However, the evolution of resistance could cut short these benefits. A primary pest targeted by Bt maize in the United States is the western corn rootworm Diabrotica virgifera virgifera (Coleoptera: Chrysomelidae). Methodology/Principal Findings We report that fields identified by farmers as having severe rootworm feeding injury to Bt maize contained populations of western corn rootworm that displayed significantly higher survival on Cry3Bb1 maize in laboratory bioassays than did western corn rootworm from fields not associated with such feeding injury. In all cases, fields experiencing severe rootworm feeding contained Cry3Bb1 maize. Interviews with farmers indicated that Cry3Bb1 maize had been grown in those fields for at least three consecutive years. There was a significant positive correlation between the number of years Cry3Bb1 maize had been grown in a field and the survival of rootworm populations on Cry3Bb1 maize in bioassays. However, there was no significant correlation among populations for survival on Cry34/35Ab1 maize and Cry3Bb1 maize, suggesting a lack of cross resistance between these Bt toxins. Conclusions/Significance This is the first report of field-evolved resistance to a Bt toxin by the western corn rootworm and by any species of Coleoptera. Insufficient planting of refuges and non-recessive inheritance of resistance may have contributed to resistance. These results suggest that improvements in resistance management and a more integrated approach to the use of Bt crops may be necessary. PMID:21829470
Diversity in global maize germplasm: Characterization and utilization
Indian Academy of Sciences (India)
2012-10-15
Oct 15, 2012 ... maize farmers as well as to the scientific community are depicted in figure 1, and ..... best practices for maintaining the original genetic diversity of the gene bank ..... maize; in Studies in the neolithic and urban revolution: V.
Climate Change and Maize Production: Empirical Evidence from ...
African Journals Online (AJOL)
Michael Madukwe
Time series data on aggregate maize production, fertilizer use, .... The maize response model (eqn 3) was estimated using the time series data for ... The R. 2 value obtained from the equation is 0.534. This further indicates that aggregate total.
Sister chromatid segregation in meiosis II
Wassmann, Katja
2013-01-01
Meiotic divisions (meiosis I and II) are specialized cell divisions to generate haploid gametes. The first meiotic division with the separation of chromosomes is named reductional division. The second division, which takes place immediately after meiosis I without intervening S-phase, is equational, with the separation of sister chromatids, similar to mitosis. This meiotic segregation pattern requires the two-step removal of the cohesin complex holding sister chromatids together: cohesin is removed from chromosome arms that have been subjected to homologous recombination in meiosis I and from the centromere region in meiosis II. Cohesin in the centromere region is protected from removal in meiosis I, but this protection has to be removed—deprotected”—for sister chromatid segregation in meiosis II. Whereas the mechanisms of cohesin protection are quite well understood, the mechanisms of deprotection have been largely unknown until recently. In this review I summarize our current knowledge on cohesin deprotection. PMID:23574717
19 CFR 10.57 - Certified seed potatoes, and seed corn or maize.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certified seed potatoes, and seed corn or maize... Provisions Potatoes, Corn, Or Maize § 10.57 Certified seed potatoes, and seed corn or maize. Claim for classification as seed potatoes under subheading 0701.10.00, as seed corn (maize) under subheading 1005.10...
Multiple Pesticides Detoxification Function of Maize (Zea mays) GST34.
Li, Dongzhi; Xu, Li; Pang, Sen; Liu, Zhiqian; Zhao, Weisong; Wang, Chengju
2017-03-08
ZmGST34 is a maize Tau class GST gene and was found to be differently expressed between two maize cultivars differing in tolerance to herbicide metolachlor. To explore the possible role of ZmGST34 in maize development, the expression pattern and substrate specificity of ZmGST34 were characterized by quantitative RT-PCR and heterologous expression system, respectively. The results indicated that the expression level of ZmGST34 was increased ∼2-5-fold per day during the second-leaf stage of maize seedling. Chloroacetanilide herbicides or phytohormone treatments had no influence on the expression level of ZmGST34, suggesting that ZmGST34 is a constitutively expressed gene in maize seedling. Heterologous expression in Escherichia coli and in Arabidopsis thaliana proved that ZmGST34 can metabolize most chloroacetanilide herbicides and increase tolerance to these herbicides in transgenic Arabidopsis thaliana. The constitutive expression pattern and broad substrate activity of ZmGST34 suggested that this gene may play an important role in maize development in addition to the detoxification of pesticides.
The Importance of Maize Management on Dung Beetle Communities in Atlantic Forest Fragments.
Directory of Open Access Journals (Sweden)
Renata Calixto Campos
Full Text Available Dung beetle community structures changes due to the effects of destruction, fragmentation, isolation and decrease in tropical forest area, and therefore are considered ecological indicators. In order to assess the influence of type of maize cultivated and associated maize management on dung beetle communities in Atlantic Forest fragments surrounded by conventional and transgenic maize were evaluated 40 Atlantic Forest fragments of different sizes, 20 surrounded by GM maize and 20 surrounded by conventional maize, in February 2013 and 2014 in Southern Brazil. After applying a sampling protocol in each fragment (10 pitfall traps baited with human feces or carrion exposed for 48 h, a total of 3454 individuals from 44 species were captured: 1142 individuals from 38 species in GM maize surrounded fragments, and 2312 from 42 species in conventional maize surrounded fragments. Differences in dung beetle communities were found between GM and conventional maize communities. As expected for fragmented areas, the covariance analysis showed a greater species richness in larger fragments under both conditions; however species richness was greater in fragments surrounded by conventional maize. Dung beetle structure in the forest fragments was explained by environmental variables, fragment area, spatial distance and also type of maize (transgenic or conventional associated with maize management techniques. In Southern Brazil's scenario, the use of GM maize combined with associated agricultural management may be accelerating the loss of diversity in Atlantic Forest areas, and consequently, important ecosystem services provided by dung beetles may be lost.
The Importance of Maize Management on Dung Beetle Communities in Atlantic Forest Fragments.
Campos, Renata Calixto; Hernández, Malva Isabel Medina
2015-01-01
Dung beetle community structures changes due to the effects of destruction, fragmentation, isolation and decrease in tropical forest area, and therefore are considered ecological indicators. In order to assess the influence of type of maize cultivated and associated maize management on dung beetle communities in Atlantic Forest fragments surrounded by conventional and transgenic maize were evaluated 40 Atlantic Forest fragments of different sizes, 20 surrounded by GM maize and 20 surrounded by conventional maize, in February 2013 and 2014 in Southern Brazil. After applying a sampling protocol in each fragment (10 pitfall traps baited with human feces or carrion exposed for 48 h), a total of 3454 individuals from 44 species were captured: 1142 individuals from 38 species in GM maize surrounded fragments, and 2312 from 42 species in conventional maize surrounded fragments. Differences in dung beetle communities were found between GM and conventional maize communities. As expected for fragmented areas, the covariance analysis showed a greater species richness in larger fragments under both conditions; however species richness was greater in fragments surrounded by conventional maize. Dung beetle structure in the forest fragments was explained by environmental variables, fragment area, spatial distance and also type of maize (transgenic or conventional) associated with maize management techniques. In Southern Brazil's scenario, the use of GM maize combined with associated agricultural management may be accelerating the loss of diversity in Atlantic Forest areas, and consequently, important ecosystem services provided by dung beetles may be lost.
Nitrate Leaching From Grain Maize After Different Tillage Methods and Long/Short Term Cover Cropping
DEFF Research Database (Denmark)
Hansen, Elly Møller
trial initiated in 1968 on a coarse sandy soil. The previous trial included spring sown crops undersown (with or without) perennial ryegrass (Lolium perenne L.) as cover crop, two N-rates (90 and 120 kg N ha-1) and different tillage methods (shallow tillage and ploughing autumn or spring). With maize......) previous history of long-term cover cropping, ii) soil tillage methods, iii) N rates and iv) present short-term use of cover cropping in maize. Preliminary results from 2009 – 2011 suggest that leaching after a history of cover cropping tended to be higher than after no history of cover cropping......, but the effect was insignificant. The effect of tillage and previous N rates were also insignificant but the present use of cover crops had a small but significant decreasing effect on leaching compared to no cover cropping. The cover crop was well established in both years but grew less vigorously during autumn...
Chromosome painting in the manatee supports Afrotheria and Paenungulata
Directory of Open Access Journals (Sweden)
Zori Roberto T
2007-01-01
Full Text Available Abstract Background Sirenia (manatees, dugongs and Stellar's sea cow have no evolutionary relationship with other marine mammals, despite similarities in adaptations and body shape. Recent phylogenomic results place Sirenia in Afrotheria and with elephants and rock hyraxes in Paenungulata. Sirenia and Hyracoidea are the two afrotherian orders as yet unstudied by comparative molecular cytogenetics. Here we report on the chromosome painting of the Florida manatee. Results The human autosomal and X chromosome paints delimited a total of 44 homologous segments in the manatee genome. The synteny of nine of the 22 human autosomal chromosomes (4, 5, 6, 9, 11, 14, 17, 18 and 20 and the X chromosome were found intact in the manatee. The syntenies of other human chromosomes were disrupted in the manatee genome into two to five segments. The hybridization pattern revealed that 20 (15 unique associations of human chromosome segments are found in the manatee genome: 1/15, 1/19, 2/3 (twice, 3/7 (twice, 3/13, 3/21, 5/21, 7/16, 8/22, 10/12 (twice, 11/20, 12/22 (three times, 14/15, 16/19 and 18/19. Conclusion There are five derived chromosome traits that strongly link elephants with manatees in Tethytheria and give implicit support to Paenungulata: the associations 2/3, 3/13, 8/22, 18/19 and the loss of the ancestral eutherian 4/8 association. It would be useful to test these conclusions with chromosome painting in hyraxes. The manatee chromosome painting data confirm that the associations 1/19 and 5/21 phylogenetically link afrotherian species and show that Afrotheria is a natural clade. The association 10/12/22 is also ubiquitous in Afrotheria (clade I, present in Laurasiatheria (clade IV, only partially present in Xenarthra (10/12, clade II and absent in Euarchontoglires (clade III. If Afrotheria is basal to eutherians, this association could be part of the ancestral eutherian karyotype. If afrotherians are not at the root of the eutherian tree, then the 10
Vibrio chromosome-specific families
DEFF Research Database (Denmark)
Lukjancenko, Oksana; Ussery, David
2014-01-01
We have compared chromosome-specific genes in a set of 18 finished Vibrio genomes, and, in addition, also calculated the pan- and core-genomes from a data set of more than 250 draft Vibrio genome sequences. These genomes come from 9 known species and 2 unknown species. Within the finished...... chromosomes, we find a core set of 1269 encoded protein families for chromosome 1, and a core of 252 encoded protein families for chromosome 2. Many of these core proteins are also found in the draft genomes (although which chromosome they are located on is unknown.) Of the chromosome specific core protein...... families, 1169 and 153 are uniquely found in chromosomes 1 and 2, respectively. Gene ontology (GO) terms for each of the protein families were determined, and the different sets for each chromosome were compared. A total of 363 different "Molecular Function" GO categories were found for chromosome 1...
Prevalence of genetically modified rice, maize, and soy in Saudi food products.
Elsanhoty, Rafaat M; Al-Turki, A I; Ramadan, Mohamed Fawzy
2013-10-01
Qualitative and quantitative DNA-based methods were applied to detect genetically modified foods in samples from markets in the Kingdom of Saudi Arabia. Two hundred samples were collected from Al-Qassim, Riyadh, and Mahdina in 2009 and 2010. GMOScreen 35S and NOS test kits for the detection of genetically modified organism varieties in samples were used. The positive results obtained from GMOScreen 35S and NOS were identified using specific primer pairs. The results indicated that all rice samples gave negative results for the presence of 35S and NOS terminator. About 26 % of samples containing soybean were positive for 35S and NOS terminator and 44 % of samples containing maize were positive for the presence of 35S and/or NOS terminator. The results showed that 20.4 % of samples was positive for maize line Bt176, 8.8 % was positive for maize line Bt11, 8.8 % was positive for maize line T25, 5.9 % was positive for maize line MON 810, and 5.9 % was positive for StarLink maize. Twelve samples were shown to contain genetically modified (GM) soy and 6 samples >10 % of GM soy. Four samples containing GM maize were shown to contain >5 % of GM maize MON 810. Four samples containing GM maize were shown to contain >1 % of StarLink maize. Establishing strong regulations and certified laboratories to monitor GM foods or crops in Saudi market is recommended.
Directory of Open Access Journals (Sweden)
Lal Prasad Amgain
2015-12-01
Full Text Available The average maize yield of 2.5 t/ha in sub-tropical terai and inner terai of Nepal has been very less than its potential yield of about 5.0 t/ha, for which changing climatic scenarios have been reported the critical factors. Cropping system Model (CSM-Crop Estimation through Resource and Environment Synthesis (CERES-Maize, embedded under Decision Support System for Agro-technology Transfer (DSSAT ver. 4.2 was evaluated from a datasets of field experimentation by growing four diverse maize genotypes viz. full season OPV (Rampur Composite, Quality Protein Maize (Posilo Makai-1, Hybrid (Gaurav and Pop corn (Pool-12 under three different planting dates (September 1, October 1 and November 1 in 2009-10 at Rampur Campus, Chitwan. The experiment was laid out in two factor factorial randomized complete block design (RCBD with three replications in slightly acidic (pH 6.7 sandy loam soil having low soil available N( 0.49% and K (148 kg/ha and medium P (16.3 kg/ha status. The ancillary and yield data obtaining from field experiment was analyzed from the M-Stat C software and recorded that Gaurav hybrid produced significantly higher yield under September 1 planting (5.86 t/ha followed by Posilo Makai 1 (5.55 t/ha, Rampur Composite (5.1t/ha and the least with Pool-12 (3.45 t/ha. Further, the heat use efficiency of diverse maize genotypes were also calculated by using the mean temperature based accumulative heat unit system and found the stable yields only with Rampur Composite for all planting dates and the rest genotypes were suitable only to the early winter plantings. Model calibration was done by using September 1 planting date for all 4 maize genotypes while validation was accomplished by using the remaining treatments for predicting growth and yield of different maize genotypes. The year 2006- 07 was found 13, 18, 23 and 7% higher in producing the maize yield than the standard year 2009-10 for Rampur Composite, Posilo Makai-1, Gaurav and Pool-12
Evaluation of maize-soybean flour blends for sour maize bread ...
African Journals Online (AJOL)
Properties examined included amylose content, bulk density, dispersibility, swelling power, water absorption capacity and viscoelastic properties. The effect of the different flour/meal samples on the properties of sour maize bread were evaluated by baking bread samples with the different flours/meals using a mixed starter ...
Kermicle, Jerry L
2006-01-01
Some populations of maize's closest relatives, the annual teosintes of Mexico, are unreceptive to maize pollen. When present in the pistil (silk and ovary) a number of maize genes discriminate against or exclude pollen not carrying the same allele. An analogous gene Tcb1-s was found in some teosinte populations but not in sympatric or parapatric maize. It was polymorphic among populations of teosinte growing wild, but regularly present in populations growing in intimate association with maize as a weed. Introduction of Tcb1-s into maize substantially to fully restored compatibility with Tcb1-s carrying teosintes. Although Tcb1-s pollen can fertilize tcb1 tcb1 maize, it is at a competitive disadvantage relative to tcb1 pollen. Hence, the influence of Tcb1-s on crossability is bidirectional. In the absence of maize, Tcb1-s can increase in teosinte populations without improving their fitness. In the presence of maize, Tcb1-s appears to have been co-opted to provide reproductive isolation for adaptation to a cultivated habitat.
Genetic diversity among yellow maize with pro-vitamin A content
Directory of Open Access Journals (Sweden)
Mercy Oluremi Olowolafe
2016-06-01
Full Text Available An improvement in the concentration of vitamin A in adapted yellow maize varieties grown in Africa can have a positive impact on the dietary intakes in regions where maize is a staple food. The present study was designed to identify heterotic groups and divergent parents for developing new pro-vitamin A enriched maize lines. Ten Simple Sequence Repeats (SSR markers were used to generate DNA profiles among thirteen commonly grown yellow maize lines across south western Nigeria and three high pro-vitamin A lines from International Institute of Tropical Agriculture (IITA, Ibadan. The result obtained estimated 100% polymorphism among the ten SSR markers with polymorphic information content that ranged from 0.28 to 0.71 on an average of 0.50. Genetic similarity coefficients among the 16 maize lines varied from 0.28 to 0.92 GS with an average of 0.63 GS. Four well defined groups were identified at 0.65 GS with an IITA line, PVA8, solely, formed a group. The study identified PVA8 and its most three distant relatives as potential divergent parents that could serve as important genetic resources for broadening the genetic base of the presently assessed IAR&T maize collections and also to develop new maize lines with higher level of pro-vitamin A content.
Giemsa C-banding of Barley Chromosomes. IV. Chromosomal Constitution of Autotetraploid Barley
DEFF Research Database (Denmark)
Linde-Laursen, Ib
1984-01-01
The progeny of an autotetraploid barley plant (C1) consisted of 45 tetraploids and 33 aneuploids. Giemsa C-banding was used to identify each of the chromosomes in 20 euploid and 31 aneuploid C2--seedlings, and in 11 C3--offspring of aneuploid C2--plants. The euploid C2--seedlings all had four...... homologues of each of the chromosomes. The aneuploid C2--seedlings were fairly equally distributed on hypo-and hyperploids, and on the seven chromosome groups. This suggests that a particular chromosome is lost or gained at random in gametes and embryos. The 11 C3--seedlings comprised seven true euploids......, one seedling with 2n=28 having an extra chromosome 6 and missing one chromosome 3, and three seedlings with 2n=29. The chromosomal composition of aneuploid C3--seedlings did not reflect that of their aneuploid C2--parents with respect to missing or extra chromosomes. Two hypohexaploid C2--seedlings...
Rodrigues, Débora Silva; Rivera, Miryan; Lourenço, Luciana Bolsoni
2012-03-20
For anurans, knowledge of 5S rDNA is scarce. For Engystomops species, chromosomal homeologies are difficult to recognize due to the high level of inter- and intraspecific cytogenetic variation. In an attempt to better compare the karyotypes of the Amazonian species Engystomops freibergi and Engystomops petersi, and to extend the knowledge of 5S rDNA organization in anurans, the 5S rDNA sequences of Amazonian Engystomops species were isolated, characterized, and mapped. Two types of 5S rDNA, which were readily differentiated by their NTS (non-transcribed spacer) sizes and compositions, were isolated from specimens of E. freibergi from Brazil and E. petersi from two Ecuadorian localities (Puyo and Yasuní). In the E. freibergi karyotypes, the entire type I 5S rDNA repeating unit hybridized to the pericentromeric region of 3p, whereas the entire type II 5S rDNA repeating unit mapped to the distal region of 6q, suggesting a differential localization of these sequences. The type I NTS probe clearly detected the 3p pericentromeric region in the karyotypes of E. freibergi and E. petersi from Puyo and the 5p pericentromeric region in the karyotype of E. petersi from Yasuní, but no distal or interstitial signals were observed. Interestingly, this probe also detected many centromeric regions in the three karyotypes, suggesting the presence of a satellite DNA family derived from 5S rDNA. The type II NTS probe detected only distal 6q regions in the three karyotypes, corroborating the differential distribution of the two types of 5S rDNA. Because the 5S rDNA types found in Engystomops are related to those of Physalaemus with respect to their nucleotide sequences and chromosomal locations, their origin likely preceded the evolutionary divergence of these genera. In addition, our data indicated homeology between Chromosome 5 in E. petersi from Yasuní and Chromosomes 3 in E. freibergi and E. petersi from Puyo. In addition, the chromosomal location of the type II 5S r
Fusarium graminearum and Fusarium verticillioides infection on maize seeds
Directory of Open Access Journals (Sweden)
Dayana Portes Ramos
2014-03-01
Full Text Available The previous knowledge of the infection process and pathogens behavior, for evaluating the physiological potential of maize seeds, is essential for decision making on the final destination of lots that can endanger sowing. This research was carried out in order to study the minimum period required for maize seeds contamination by Fusarium graminearum Schwabe and Fusarium verticillioides (Sacc. Nirenberg, as well as these pathogens influence on seed germination and vigor, by using the cold test. Three maize seeds hybrids, kept in contact with the pathogens for different periods, were evaluated with and without surface disinfection. After determining the most suitable period, new samples were contaminated by F. graminearum and F. verticillioides, under different infection levels, and subjected to germination tests in sand. The cold test was conducted with healthy and contaminated seeds, at different periods, in a cold chamber. The contact of maize seeds with F. graminearum and F. verticillioides for 16 hours was enough to cause infection. F. graminearum and F. verticillioides did not affect the maize seeds germination, however, F. graminearum reduced the vigor of seeds lots.
Mapping the Diversity of Maize Races in Mexico
Perales, Hugo; Golicher, Duncan
2014-01-01
Traditional landraces of maize are cultivated throughout more than one-half of Mexico's cropland. Efforts to organize in situ conservation of this important genetic resource have been limited by the lack of knowledge of regional diversity patterns. We used recent and historic collections of maize classified for race type to determine biogeographic regions and centers of landrace diversity. We also analyzed how diversity has changed over the last sixty years. Based on racial composition of maize we found that Mexico can be divided into 11 biogeographic regions. Six of these biogeographic regions are in the center and west of the country and contain more than 90% of the reported samples for 38 of the 47 races studied; these six regions are also the most diverse. We found no evidence of rapid overall decline in landrace diversity for this period. However, several races are now less frequently reported and two regions seem to support lower diversity than in previous collection periods. Our results are consistent with a previous hypothesis for diversification centers and for migration routes of original maize populations merging in western central Mexico. We provide maps of regional diversity patterns and landrace based biogeographic regions that may guide efforts to conserve maize genetic resources. PMID:25486121
Mapping of novel powdery mildew resistance gene(s) from Agropyron cristatum chromosome 2P.
Li, Huanhuan; Jiang, Bo; Wang, Jingchang; Lu, Yuqing; Zhang, Jinpeng; Pan, Cuili; Yang, Xinming; Li, Xiuquan; Liu, Weihua; Li, Lihui
2017-01-01
A physical map of Agropyron cristatum 2P chromosome was constructed for the first time and the novel powdery mildew resistance gene(s) from chromosome 2P was(were) also mapped. Agropyron cristatum (L.) Gaertn. (2n = 28, PPPP), a wild relative of common wheat, is highly resistant to powdery mildew. Previous studies showed that wheat-A. cristatum 2P disomic addition line II-9-3 displayed high resistance to powdery mildew, and the resistance was attributable to A. cristatum chromosome 2P. To utilize and physically map the powdery mildew resistance gene(s), 15 wheat-A. cristatum 2P translocation lines and three A. cristatum 2P deletion lines with different chromosomal segment sizes, obtained from II-9-3 using 60 Co-γ ray irradiation, were characterized using cytogenetic and molecular marker analysis. A. cristatum 2P chromosomal segments in the translocations were translocated to different wheat chromosomes, including 1A, 4A, 5A, 6A, 7A, 1B, 2B, 3B, 7B, 3D, 4D, and 6D. A physical map of the 2P chromosome was constructed with 82 STS markers, consisting of nine bins with 34 markers on 2PS and eight bins with 48 markers on 2PL. The BC 1 F 2 populations of seven wheat-A. cristatum 2P translocation lines (2PT-3, 2PT-4, 2PT-5, 2PT-6, 2PT-8, 2PT-9, and 2PT-10) were developed by self-pollination, tested with powdery mildew and genotyped with 2P-specific STS markers. From these results, the gene(s) conferring powdery mildew resistance was(were) located on 2PL bin FL 0.66-0.86 and 19 2P-specific markers were identified in this bin. Moreover, two new powdery mildew-resistant translocation lines (2PT-4 and 2PT-5) with small 2PL chromosome segments were obtained. The newly developed wheat lines with powdery mildew resistance and the closely linked molecular markers will be valuable for wheat disease breeding in the future.
Zhang, Yunxia; Cheng, Chunyan; Li, Ji; Yang, Shuqiong; Wang, Yunzhu; Li, Ziang; Chen, Jinfeng; Lou, Qunfeng
2015-09-25
Differentiation and copy number of repetitive sequences affect directly chromosome structure which contributes to reproductive isolation and speciation. Comparative cytogenetic mapping has been verified an efficient tool to elucidate the differentiation and distribution of repetitive sequences in genome. In present study, the distinct chromosomal structures of five Cucumis species were revealed through genomic in situ hybridization (GISH) technique and comparative cytogenetic mapping of major satellite repeats. Chromosome structures of five Cucumis species were investigated using GISH and comparative mapping of specific satellites. Southern hybridization was employed to study the proliferation of satellites, whose structural characteristics were helpful for analyzing chromosome evolution. Preferential distribution of repetitive DNAs at the subtelomeric regions was found in C. sativus, C hystrix and C. metuliferus, while majority was positioned at the pericentromeric heterochromatin regions in C. melo and C. anguria. Further, comparative GISH (cGISH) through using genomic DNA of other species as probes revealed high homology of repeats between C. sativus and C. hystrix. Specific satellites including 45S rDNA, Type I/II, Type III, Type IV, CentM and telomeric repeat were then comparatively mapped in these species. Type I/II and Type IV produced bright signals at the subtelomeric regions of C. sativus and C. hystrix simultaneously, which might explain the significance of their amplification in the divergence of Cucumis subgenus from the ancient ancestor. Unique positioning of Type III and CentM only at the centromeric domains of C. sativus and C. melo, respectively, combining with unique southern bands, revealed rapid evolutionary patterns of centromeric DNA in Cucumis. Obvious interstitial telomeric repeats were observed in chromosomes 1 and 2 of C. sativus, which might provide evidence of the fusion hypothesis of chromosome evolution from x = 12 to x = 7 in
Enhanced plastochromanol-8 accumulation during reiterated drought in maize (Zea mays L.).
Fleta-Soriano, Eva; Munné-Bosch, Sergi
2017-03-01
Plastochromanol-8 (PC-8) belongs to the group of tocochromanols, and together with tocopherols and carotenoids, might help protect photosystem II from photoinhibition during environmental stresses. Here, we aimed to unravel the time course evolution of PC-8 together with that of vitamin E compounds, in maize (Zea mays L.) plants exposed to reiterated drought. Measurements were performed in plants grown in a greenhouse subjected to two consecutive cycles of drought-recovery. PC-8 contents, which accounted for more than 25% of tocochromanols in maize leaves, increased progressively in response to reiterated drought stress. PC-8 contents paralleled with those of vitamin E, particularly α-tocopherol. Profiling of the stress-related phytohormones (ABA, jasmonic acid and salicylic acid) was consistent with a role of ABA in the regulation of PC-8 and vitamin E biosynthesis during drought stress. Results also suggest that PC-8 may help tocopherols prevent damage to the photosynthetic apparatus. A better knowledge of the ABA-dependent regulation of PC-8 may help us manipulate the contents of this important antioxidant in crops. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
Directory of Open Access Journals (Sweden)
Magnolia Montoya-Mejía
Full Text Available ABSTRACT The objective of our study was to assess the apparent digestibility of plant ingredients in diets for juvenile (50 g and adult (220 g Nile tilapia (Oreochromis niloticus. Dietary dry matter and protein apparent digestibility coefficients of four plant-derived feedstuffs (chickpea, maize, high-quality maize protein, and beans were tested. The beans diet had the lowest apparent digestibility coefficient of dry matter (ADCDM (69.41%, while no significant differences were detected in ADCDM among the other diets; ADCDM was significantly higher in adults compared with juveniles (77.02 vs. 73.76%. Apparent dry matter digestibility coefficient of ingredients (ADCI was significantly higher in the chickpea (70.48% and high-quality protein maize (71.09% ingredients, and lower in the beans (52.79% ingredient. Apparent dry matter digestibility coefficient of ingredients was significantly higher in juveniles compared with adults (72.56 vs. 56.80%. The protein digestibility of diet (ADCCP was significantly higher in the reference diet (93.68%, while the lowest corresponded to the maize (87.86% and beans (87.29% diets. Significantly lower apparent digestibility coefficient of protein (ADCICP was obtained with the high-quality maize protein (59.11% and maize (49.48% ingredients, while higher ADCICP was obtained with the chickpea and beans ingredients (71.31 and 63.89%, respectively. The apparent digestibility coefficient of ingredient crude protein ADCICP was significantly higher in juveniles compared with adults (67.35 vs. 53.46. Digestibility is generally higher in juveniles, and we recommend using chickpea as an ingredient in diets for Nile tilapia.
African maize porridge: a food with slow in vitro starch digestibility
CSIR Research Space (South Africa)
Van der Merwe, B
2001-02-15
Full Text Available maize porridge to bread. An in vitro method was used to determine the starch digestibility of African maize porridge compared to other cereal foods. Maize porridge had a much lower in vitro starch digestibility than white bread (P<0.001). There was a...
Energy Technology Data Exchange (ETDEWEB)
Zhou Shunli [Key Laboratory of Crop Cultivation and Farming System, Ministry of Agriculture, College of Agronomy and Biotechnology, China Agricultural University, 2 West Yuanmingyuan Road, Beijing 100094 (China)], E-mail: zhoushl@cau.edu.cn; Wu Yongcheng [Key Laboratory of Crop Cultivation and Farming System, Ministry of Agriculture, College of Agronomy and Biotechnology, China Agricultural University, 2 West Yuanmingyuan Road, Beijing 100094 (China); College of Agronomy, Si Chuan Agricultural University, Yaan 625014 (China); Wang Zhimin [Key Laboratory of Crop Cultivation and Farming System, Ministry of Agriculture, College of Agronomy and Biotechnology, China Agricultural University, 2 West Yuanmingyuan Road, Beijing 100094 (China); Lu Laiqing; Wang Runzheng [Wuqiao Experimental Station, China Agricultural University, Hebei 061802 (China)
2008-04-15
In winter wheat (Triticum aestivum L.)-summer maize (Zea mays L.) rotation system in the North China Plain, maize roots do not extend beyond 1.2 m in the vertical soil profile, but wheat roots can reach up to 2.0 m. Increases in soil nitrate content at maize harvest and significant reductions after winter wheat harvest were observed in the 1.4-2.0 m depth under field conditions. The recovery of {sup 15}N isotope (calcium nitrate) from various (1.0, 1.2, 1.4, 1.6, 1.8 and 2.0 m) soil depths showed that deep-rooting winter wheat could use soil nitrate up to the 2.0 m depth. This accounted partially, for the reduced nitrate in the 1.4-2.0 m depth of the soil after harvest of wheat in the rotation system. - Deep-rooted wheat can recycle nitrate leached from maize root zone in winter wheat-summer maize rotation system.
International Nuclear Information System (INIS)
Zhou Shunli; Wu Yongcheng; Wang Zhimin; Lu Laiqing; Wang Runzheng
2008-01-01
In winter wheat (Triticum aestivum L.)-summer maize (Zea mays L.) rotation system in the North China Plain, maize roots do not extend beyond 1.2 m in the vertical soil profile, but wheat roots can reach up to 2.0 m. Increases in soil nitrate content at maize harvest and significant reductions after winter wheat harvest were observed in the 1.4-2.0 m depth under field conditions. The recovery of 15 N isotope (calcium nitrate) from various (1.0, 1.2, 1.4, 1.6, 1.8 and 2.0 m) soil depths showed that deep-rooting winter wheat could use soil nitrate up to the 2.0 m depth. This accounted partially, for the reduced nitrate in the 1.4-2.0 m depth of the soil after harvest of wheat in the rotation system. - Deep-rooted wheat can recycle nitrate leached from maize root zone in winter wheat-summer maize rotation system
Liu, Jiangang; Wang, Guangyao; Chu, Qingquan; Chen, Fu
2017-07-01
Nitrogen (N) application significantly increases maize yield; however, the unreasonable use of N fertilizer is common in China. The analysis of crop yield gaps can reveal the limiting factors for yield improvement, but there is a lack of practical strategies for narrowing yield gaps of household farms. The objectives of this study were to assess the yield gap of summer maize using an integrative method and to develop strategies for narrowing the maize yield gap through precise N fertilization. The results indicated that there was a significant difference in maize yield among fields, with a low level of variation. Additionally, significant differences in N application rate were observed among fields, with high variability. Based on long-term simulation results, the optimal N application rate was 193 kg ha -1 , with a corresponding maximum attainable yield (AY max ) of 10 318 kg ha -1 . A considerable difference between farmers' yields and AY max was observed. Low agronomic efficiency of applied N fertilizer (AE N ) in farmers' fields was exhibited. The integrative method lays a foundation for exploring the specific factors constraining crop yield gaps at the field scale and for developing strategies for rapid site-specific N management. Optimization strategies to narrow the maize yield gap include increasing N application rates and adjusting the N application schedule. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
Analysis of Maize Seed Germs by Photoacoustic Microscopy and Photopyroelectric Technique
Pacheco, A. Domínguez; Aguilar, C. Hernández; Cruz-Orea, A.
2013-05-01
A knowledge about thermal parameters of structural components of maize seed is of great relevance in the seed technology practice. The objective of the present study was to determine the thermal effusivity of germs of maize ( Zea mays L.) of different genotypes by means of the photopyroelectric technique (PPE) in the inverse configuration and obtaining the thermal imaging of these samples by photoacoustic microscopy (PAM). Germs from crystalline maize (white pigment), semi-crystalline maize (yellow pigment), and floury maize (blue pigment) were used in this investigation. The results show differences between germs of maize seeds mainly in the values of their thermal effusivities. The thermal images showed minimum inhomogeneity of these seed germs. Characterizations of thermal parameters in seeds are important in agriculture and food production and could be particularly useful to define their quality and determine their utility. PPE and PAM can be considered as potential diagnostic tools for the characterization of agriculture seeds.
Locally processed roasted-maize-based weaning foods fortified with ...
African Journals Online (AJOL)
Locally processed roasted-maize-based weaning foods fortified with legumes: factors ... African Journal of Food, Agriculture, Nutrition and Development ... Tom Brown (roasted-maize porridge) is one of the traditional weaning foods in Ghana.
Life-History Traits of Spodoptera frugiperda Populations Exposed to Low-Dose Bt Maize.
Sousa, Fernanda F; Mendes, Simone M; Santos-Amaya, Oscar F; Araújo, Octávio G; Oliveira, Eugenio E; Pereira, Eliseu J G
2016-01-01
Exposure to Bacillus thuringiensis (Bt) toxins in low- and moderate-dose transgenic crops may induce sublethal effects and increase the rate of Bt resistance evolution, potentially compromising control efficacy against target pests. We tested this hypothesis using the fall armyworm Spodoptera frugiperda, a major polyphagous lepidopteran pest relatively tolerant to Bt notorious for evolving field-relevant resistance to single-gene Bt maize. Late-instar larvae were collected from Bt Cry1Ab and non-Bt maize fields in five locations in Brazil, and their offspring was compared for survival, development, and population growth in rearing environment without and with Cry1Ab throughout larval development. Larval survival on Cry1Ab maize leaves varied from 20 to 80% among the populations. Larvae reared on Cry1Ab maize had seven-day delay in development time in relation to control larvae, and such delay was shorter in offspring of armyworms from Cry1Ab maize. Population growth rates were 50-70% lower for insects continuously exposed to Cry1Ab maize relative to controls, showing the population-level effect of Cry1Ab, which varied among the populations and prior exposure to Cry1Ab maize in the field. In three out of five populations, armyworms derived from Bt maize reared on Cry1Ab maize showed higher larval weight, faster larval development and better reproductive performance than the armyworms derived from non-Bt maize, and one of these populations showed better performance on both Cry1Ab and control diets, indicating no fitness cost of the resistance trait. Altogether, these results indicate that offspring of armyworms that developed on field-grown, single-gene Bt Cry1Ab maize had reduced performance on Cry1Ab maize foliage in two populations studied, but in other three populations, these offspring had better overall performance on the Bt maize foliage than that of the armyworms from non-Bt maize fields, possibly because of Cry1Ab resistance alleles in these populations
Desjardins, Anne E; Busman, Mark; Manandhar, Gyanu; Jarosz, Andrew M; Manandhar, Hira K; Proctor, Robert H
2008-07-09
The fungus Fusarium graminearum (sexual stage Gibberella zeae) causes ear rot of maize (Zea mays) and contamination with the 8-ketotrichothecenes nivalenol (1) or 4-deoxynivalenol (2), depending on diversity of the fungal population for the 4-oxygenase gene (TRI13). To determine the importance of 1 and 2 in maize ear rot, a survey of naturally contaminated maize in Nepal was combined with experiments in the field and in a plant growth room. In the survey, 1 contamination was 4-fold more frequent than 2 contamination and 1-producers (TRI13) were isolated more than twice as frequently as 2-producers (Psi TRI13). In maize ear rot experiments, genetically diverse 1-producers and 2-producers caused ear rot and trichothecene contamination. Among strains with the same genetic background, however, 1-producers caused less ear rot and trichothecene contamination than did 2-producers. The high frequency of 1 contamination and the high virulence of many 1-producers are of concern because maize is a staple food of rural populations in Nepal and because 1 has proven to be more toxic than 2 to animals.
In vitro cytotoxicity of fungi spoiling maize silage
DEFF Research Database (Denmark)
Rasmussen, Rie Romme; Rasmussen, Peter Have; Larsen, Thomas Ostenfeld
2011-01-01
Penicillium roqueforti, Penicillium paneum, Monascus ruber, Alternaria tenuissima, Fusarium graminearum, Fusarium avenaceum, Byssochlamys nivea and Aspergillus fumigatus have previously been identified as major fungal contaminants of Danish maize silage. In the present study their metabolite....... roqueforti metabolites roquefortine C (48μg/mL), andrastin A (>50μg/mL), mycophenolic acid (>100μg/mL) and 1-hydroxyeremophil-7(11),9(10)-dien-8-one (>280μg/mL) were high. Fractionating of agar extracts identified PR-toxin as an important cytotoxic P. roqueforti metabolite, also detectable in maize silage....... The strongly cytotoxic B. nivea and P. paneum agar extracts contained patulin above the IC50 of 0.6μg/mL, however inoculated onto maize silage B. nivea and P. paneum did not produce patulin (>371μg/kg). Still B. nivea infected maize silage containing mycophenolic acid (∼50mg/kg), byssochlamic acid and other...
DistAMo: A web-based tool to characterize DNA-motif distribution on bacterial chromosomes
Directory of Open Access Journals (Sweden)
Patrick eSobetzko
2016-03-01
Full Text Available Short DNA motifs are involved in a multitude of functions such as for example chromosome segregation, DNA replication or mismatch repair. Distribution of such motifs is often not random and the specific chromosomal pattern relates to the respective motif function. Computational approaches which quantitatively assess such chromosomal motif patterns are necessary. Here we present a new computer tool DistAMo (Distribution Analysis of DNA Motifs. The algorithm uses codon redundancy to calculate the relative abundance of short DNA motifs from single genes to entire chromosomes. Comparative genomics analyses of the GATC-motif distribution in γ-proteobacterial genomes using DistAMo revealed that (i genes beside the replication origin are enriched in GATCs, (ii genome-wide GATC distribution follows a distinct pattern and (iii genes involved in DNA replication and repair are enriched in GATCs. These features are specific for bacterial chromosomes encoding a Dam methyltransferase. The new software is available as a stand-alone or as an easy-to-use web-based server version at http://www.computational.bio.uni-giessen.de/distamo.
Factors Affecting the Efficiency of Maize Marketing in Vandeikya ...
African Journals Online (AJOL)
Factors Affecting the Efficiency of Maize Marketing in Vandeikya Local Government Area of Benue State, Nigeria. ... Two hundred maize marketers were selected from Vandeikya Local Area (LGA) of ... EMAIL FULL TEXT EMAIL FULL TEXT
participatory evaluation of drought tolerant maize varieties in the ...
African Journals Online (AJOL)
User
). Maize production provides livelihoods for millions of subsistence farmers in WCA, thus, increasing the productivity of maize-based cropping sys- tems could increase and stabilize rural incomes, alleviate poverty and reduce food insecurity in.
A review on important maize diseases and their management in Nepal
Subash Subedi
2015-01-01
In Nepal, maize ranks second after rice both in area and production. In recent years, maize area and production has shown a steady increase, but productivity has been low (2.46 t/ha). The major maize producing regions in Nepal are mid hill (72.85%), terai (17.36%) and high hill (9.79%) respectively. A literature review was carried out to explore major maize diseases and their management in Nepal. The omnipresent incidence of diseases at the pre harvest stage has been an important bottleneck ...
Verbruggen, Erik; Kuramae, Eiko E; Hillekens, Remy; de Hollander, Mattias; Kiers, E Toby; Röling, Wilfred F M; Kowalchuk, George A; van der Heijden, Marcel G A
2012-10-01
The cultivation of genetically modified (GM) crops has increased significantly over the last decades. However, concerns have been raised that some GM traits may negatively affect beneficial soil biota, such as arbuscular mycorrhizal fungi (AMF), potentially leading to alterations in soil functioning. Here, we test two maize varieties expressing the Bacillus thuringiensis Cry1Ab endotoxin (Bt maize) for their effects on soil AM fungal communities. We target both fungal DNA and RNA, which is new for AM fungi, and we use two strategies as an inclusive and robust way of detecting community differences: (i) 454 pyrosequencing using general fungal rRNA gene-directed primers and (ii) terminal restriction fragment length polymorphism (T-RFLP) profiling using AM fungus-specific markers. Potential GM-induced effects were compared to the normal natural variation of AM fungal communities across 15 different agricultural fields. AM fungi were found to be abundant in the experiment, accounting for 8% and 21% of total recovered DNA- and RNA-derived fungal sequences, respectively, after 104 days of plant growth. RNA- and DNA-based sequence analyses yielded most of the same AM fungal lineages. Our research yielded three major conclusions. First, no consistent differences were detected between AM fungal communities associated with GM plants and non-GM plants. Second, temporal variation in AMF community composition (between two measured time points) was bigger than GM trait-induced variation. Third, natural variation of AMF communities across 15 agricultural fields in The Netherlands, as well as within-field temporal variation, was much higher than GM-induced variation. In conclusion, we found no indication that Bt maize cultivation poses a risk for AMF.
International Nuclear Information System (INIS)
Awa, A.A.; Nakano, Mimako; Ohtaki, Kazuo; Kodama, Yoshiaki; Lucas, J.; Gray, J.
1992-01-01
An overview is given of the dose-response relationship for stable chromosome aberrations (i.e., translocations and inversions) in the peripheral blood lymphocytes of A-bomb survivors in Hiroshima. Special emphasis is placed on (i) the overdispersion of survivor cases with either unexpectedly high or low aberration frequencies relative to the estimated DS86 kerma values assigned to individual survivors, termed 'cytogenetic outliers', and (ii) the correlation of chromosome aberration frequencies with other biological endpoints, such as acute radiation symptoms (severe epilation). A new molecular biological technique, known as fluorescence in situ hybridization (FISH) with composite, whole-chromosome probes to paint differentially the target chromosomes, has facilitated rapid, efficient, and extensive scoring of translocation-type chromosome aberrations in which the target chromosomes are involved. Using this methodology, the observed findings on translocation frequencies in A-bomb survivors have shown that the frequency of stable chromosome aberrations, which have persisted for years without change in frequency in irradiated persons, is indeed useful as an indicator for biological dosimetry. (author)
Occurrence of aflatoxin contamination in maize kernels and ...
African Journals Online (AJOL)
Aflatoxins are toxic metabolites produced mainly by Aspergillus flavus and Aspergillus parasiticus. Aflatoxin B1 (AFB1) is a potent carcinogen, teratogen and mutagen. 660 pre- and post- harvest maize samples were collected from major maize growing areas in Tamil Nadu, India. Aflatoxin contamination was observed in ...
Determinants of technical inefficiency among maize-based farming ...
African Journals Online (AJOL)
Examining the level of farm-specific technical inefficiency of maize-based farming households in Niger state of Nigeria, this study fitted cross-sectional data into a Cobb- Douglass production frontier. Data used for this study were obtained using structured questionnaire administered to 108 randomly selected maize-based ...
Discrimination of chromosome by autoradiography
International Nuclear Information System (INIS)
Masubuchi, Masanori
1975-01-01
This paper describes discrimination of chromosome by autoradiography. In this method, the difference in DNA synthetic phase between each chromosome was used as a standard, and the used chromosome was in metaphase, as morphological characteristics were markedly in this phase. Cell cycle and autoradiography with 3 H-thymidine were also examined. In order to discriminate chromosome by autoradiography, it was effective to utilize the labelled pattern in late DNA synthetic phase, where asynchronous replication of chromosome appeared most obviously. DNA synthesis in chromosome was examined in each DNA synthetic phase by culturing the chromosome after the treatment with 3 H-thymidine and altering the time to prepare chromosome specimen. Discrimination of chromosome in plants and animals by autoradiography was also mentioned. It was noticed as a structural and functional discrimination of chromosome to observe amino acid uptake into chromosome protein and to utilize the difference in labelled pattern between the sites of chromosome. (K. Serizawa)
Zhang, Peng; Wei, Ting; Cai, Tie; Ali, Shahzad; Han, Qingfang; Ren, Xiaolong; Jia, Zhikuan
2017-01-01
Film mulch has gradually been popularized to increase water availability to crops for improving and stabilizing agricultural production in the semiarid areas of Northwest China. To find more sustainable and economic film mulch methods for alleviating drought stress in semiarid region, it is necessary to test optimum planting methods in same cultivation conditions. A field experiment was conducted during 2013 and 2014 to evaluate the effects of different plastic film mulch methods on soil water, soil temperature, water use efficiency (WUE), yield and revenue. The treatments included: (i) the control, conventional flat planting without plastic film mulch (CK); (ii) flat planting with maize rows (60 cm spacing) on plastic film mulch (70 cm wide); (iii) furrow planting of maize (60 cm spacing), separated by consecutive plastic film-mulched ridges (each 50 cm wide and 15 cm tall); (iv) furrow planting of maize (60 cm spacing), separated by alternating large and small plastic film-mulched ridges (large ridges: 70 cm wide and 15 cm tall, small ridges 50 cm wide and 10 cm tall); and (v) furrow-flat planting of maize (60 cm spacing) with a large plastic film-mulched ridge (60 cm wide and 15 cm tall) alternating with a flat without plastic film-mulched space (60 cm wide). Topsoil temperature (5-25 cm) was significantly ( p plastic film mulch than the control (CK), and resulted in greater soil water storage (0-200 cm) up to 40 days after planting. Maize grain yield and WUE were significantly ( p < 0.05) higher with the furrow planting methods (consecutive film-mulched ridges and alternating film-mulched ridges) than the check in both years. Maize yield was, on average, 29% ( p < 0.05) greater and 28% ( p < 0.05) greater with these furrow planting methods, while the average WUE increased by 22.8% ( p < 0.05) with consecutive film-mulched ridges and 21.1% ( p < 0.05) with alternating film-mulched ridges. The 2-year average net income increased by 1559, 528, and 350 Chinese Yuan
The Y chromosome of the Atelidae family (Platyrrhini): study by chromosome microdissection.
Gifalli-Iughetti, C; Koiffmann, C P
2009-01-01
In order to study the intergeneric variability of the Y chromosome, we describe the hybridization of the Y chromosome of Brachytelesarachnoides, obtained by microdissection, to metaphases of Atelesbelzebuthmarginatus, Lagothrixlagothricha, and Alouatta male specimens. Brachytelesarachnoides (Atelinae) has 62 chromosomes and a very small Y chromosome. Our results showed that the Brachytelesarachnoides Y chromosome probe hybridized to Lagothrixlagothricha metaphases yielding one hybridization signal on only the tiny Y chromosome, and when hybridized with Atelesbelzebuthmarginatus metaphases it yielded one hybridization signal on two thirds of the small acrocentric Y chromosome. However, no hybridization signal was observed in Alouatta metaphases (subfamily Alouattinae), a closely related genus in the Atelidae family. Furthermore, our data support a close phylogenetic relationship among Brachyteles, Ateles, and Lagothrix and their placement in the Atelinae subfamily, but exclude Alouatta from this group indicating its placement as basal to this group. Copyright 2009 S. Karger AG, Basel.
the influence of farmers' adoption behaviour on maize production ...
African Journals Online (AJOL)
p2333147
The main cash crops grown in the country include coffee, sisal, cashew, cotton, tobacco ... Among these food crops, maize is the most important cereal food crop, and ... promoting recommended maize production practices in a package form.
Directory of Open Access Journals (Sweden)
Kelvin Mark Mtei
2011-06-01
Full Text Available Maize production in smallholder farming systems in Kenya is largely limited by low soil fertility. As mineral fertilizer is expensive, green manuring using leguminous cover crops could be an alternative strategy for farmers to enhance farm productivity. However due to variability in soil type and crop management, the effects of green manure are likely to differ with farms. The objectives of this study were to evaluate Mucuna pruriens and Arachis pintoi on (i biomass and nitrogen fixation (15N natural abundance, (ii soil carbon and nitrogen stocks and (iii their effects on maize yields over two cropping seasons in Kakamega, Western Kenya. Mucuna at 6 weeks accumulated 1–1.3 Mg ha^{-1} of dry matter and 33–56 kg ha^{-1} nitrogen of which 70% was nitrogen derived from the atmosphere (Ndfa. Arachis after 12 months accumulated 2–2.7 Mg ha^{-1} of dry matter and 51–74 kg N ha^{-1} of which 52-63 % was from Ndfa. Soil carbon and nitrogen stocks at 0–15 cm depth were enhanced by 2-4 Mg C ha^{-1} and 0.3–1.0 Mg N ha^{-1} under Mucuna and Arachis fallow, irrespective of soil type. Maize yield increased by 0.5-2 Mg ha^{-1} in Mucuna and 0.5–3 Mg ha^{-1} in Arachis and the response was stronger on Nitisol than on Acrisol or Ferralsol. We concluded that leguminous cover crops seem promising in enhancing soil fertility and maize yields in Kenya, provided soil conditions and rainfall are suitable.
Mycoflora Of Maize Zea Maize At Different Locations In Hail Area-Saudi Arabia
Directory of Open Access Journals (Sweden)
Elham S. Dawood
2015-06-01
Full Text Available Abstract Zea maize is one of the main cereals produced in Hail area Saudi Arabia. The risk of mycotoxin contamination is related to mycoflora associated with corn kernel. This paper reports on isolation and identification of external and internal mycoflora of maize harvested in Hail area in 2006 2008. A mycological survey was carried out on 200 samples from two agricultural companies . Comparison between frequency and relative density of the prevalent genera and species was carried out. Genus Fusarium was the most prevalent component of the internal seed - borne mycoflora in the two companies Aspergillus spp. was the most prevalent genus as external seed borne mycoflora. The predominant species of the different genera were Fusarium moniliforrme Aspergillus flavus A. niger and Alternaria alternate.
Radiation preservation of maize
International Nuclear Information System (INIS)
Wasito.
1980-01-01
Radiation preservation of maize was carried out. Radiation doses and sources, shielding materials, packaging materials, chemical radiation effects, biological radiation effects, were discussed. Experimental methods, samples and accessories were also presented. (SMN)
Directory of Open Access Journals (Sweden)
Marianne Iversen
Full Text Available Small-scale subsistence farmers in South Africa have been introduced to genetically modified (GM crops for more than a decade. Little is known about i the extent of transgene introgression into locally recycled seed, ii what short and long-term ecological and socioeconomic impacts such mixing of seeds might have, iii how the farmers perceive GM crops, and iv to what degree approval conditions are followed and controlled. This study conducted in the Eastern Cape, South Africa, aims primarily at addressing the first of these issues. We analysed for transgenes in 796 individual maize plants (leaves and 20 seed batches collected in a village where GM insect resistant maize was previously promoted and grown as part of an governmental agricultural development program over a seven year period (2001-2008. Additionally, we surveyed the varieties of maize grown and the farmers' practices of recycling and sharing of seed in the same community (26 farmers were interviewed. Recycling and sharing of seeds were common in the community and may contribute to spread and persistence of transgenes in maize on a local or regional level. By analysing DNA we found that the commonly used transgene promoter p35s occurred in one of the 796 leaf samples (0.0013% and in five of the 20 seed samples (25%. Three of the 20 seed samples (15% included herbicide tolerant maize (NK603 intentionally grown by the farmers from seed bought from local seed retailers or acquired through a currently running agricultural development program. The two remaining positive seed samples (10% included genes for insect resistance (from MON810. In both cases the farmers were unaware of the transgenes present. In conclusion, we demonstrate that transgenes are mixed into seed storages of small-scale farming communities where recycling and sharing of seeds are common, i.e. spread beyond the control of the formal seed system.
International Nuclear Information System (INIS)
Allen, R.N.; Ritter, L.; Moore, S.R.; Grosovsky, A.J.
2003-01-01
Full text: Studies in our lab have led to the hypothesis that chromosomal rearrangements can generate novel breakage-prone sites, resulting in chromosomal instability acting predominantly in cis. For example, specific breakage of large blocks of centromeric region heterochromatin on chromosome 16q by treatment with 2,6-diaminopurine (DAP) is associated with repeated rearrangement of chromosome 16q during outgrowth of DAP-treated clones, thereby establishing a link between the initial site of damage and the occurrence of persistent chromosomal instability. Similarly, karyotypic analysis of gamma ray induced instability demonstrated that chromosomal rearrangements in sub-clones were significantly clustered near the site of previously identified chromosomal rearrangement junctions in unstable parental clones. This study investigates the hypothesis that integration of transfected sequences into host chromosomes could create breakage-prone junction regions and persistent genomic instability without exposure to DNA-damage agents. These junctions may mimic the unstable chromosomal rearrangements induced by DAP or radiation, and thus provide a test of the broader hypothesis that instability can to some extent be attributed to the formation of novel chromosomal breakage hot spots. These experiments were performed using human-hamster hybrid AL cells containing a single human chromosome 11, which was used to monitor instability in a chromosomal painting assay. AL cells were transfected with a 2.5 Kb fragment containing multiple copies of the 180 bp human alpha heterochromatic repeat, which resulted in chromosomal instability in 41% of the transfected clones. Parallel exposure to gamma-radiation resulted in a similar level of chromosomal instability, although control transfections with plasmid alone did not lead to karyotypic instability. Chromosomal instability induced by integration of alpha heterochromatic repeats was also frequently associated with delayed reproductive
Estimating plant distance in maize using Unmanned Aerial Vehicle (UAV).
Zhang, Jinshui; Basso, Bruno; Price, Richard F; Putman, Gregory; Shuai, Guanyuan
2018-01-01
Distance between rows and plants are essential parameters that affect the final grain yield in row crops. This paper presents the results of research intended to develop a novel method to quantify the distance between maize plants at field scale using an Unmanned Aerial Vehicle (UAV). Using this method, we can recognize maize plants as objects and calculate the distance between plants. We initially developed our method by training an algorithm in an indoor facility with plastic corn plants. Then, the method was scaled up and tested in a farmer's field with maize plant spacing that exhibited natural variation. The results of this study demonstrate that it is possible to precisely quantify the distance between maize plants. We found that accuracy of the measurement of the distance between maize plants depended on the height above ground level at which UAV imagery was taken. This study provides an innovative approach to quantify plant-to-plant variability and, thereby final crop yield estimates.
Determination of the Heterotic groups of Maize inbred lines and the ...
African Journals Online (AJOL)
Maize weevil (Sitophilus zeamais Motschulsky) is a major maize (Zea mays L) storage insect pest in the tropics. Fifty-two inbred lines developed for weevil resistance were crossed to two testers, A and B, to determine their heterotic groups and inheritance of resistance to maize weevil. For 10 testcrosses selected for ...
Yields of ZP sweet maize hybrids in dependence on sowing densities
Directory of Open Access Journals (Sweden)
Srdić Jelena
2008-01-01
Full Text Available Sweet maize differs from maize of standard grain quality by many important traits that affect the ear appearance, and especially by traits controlling taste. The ear appearance trait encompasses the kernel row number, configuration, row pattern (direction and arrangement, seed set, kernel width and depth, ear shape and size. The quality of immature kernels is controlled by genes by which sweet maize differs from common maize. In order to obtain high-ranking and high-quality yields, it is necessary to provide the most suitable cropping practices for sweet maize hybrids developed at the Maize Research Institute, Zemun Polje. The adequate sowing density is one of more important elements of correct cropping practices. The objective of the present study was to determine the effect of four sowing densities in four ZP sweet maize hybrids of different FAO maturity groups on ear qualitative traits and yields obtained on chernozem type of soil in Zemun Polje. The observed traits of sweet maize (ear length, kernel row number, number of kernels per row, yield and shelling percentage significantly varied over years. The higher sowing density was the higher yield of sweet maize was, hence the highest ear yield of 9.67 t ha-1 , on the average for all four hybrids, was recorded at the highest sowing density of 70,000 plants ha-1. The highest yield was detected in the hybrid ZP 424su. The highest shelling percentage (67.81% was found in the hybrid ZP 521su at the sowing density of 60,000 plants ha-1. Generally, it can be stated that sweet maize hybrids of a shorter growing season (FAO 400 could be cultivated up to 70,000 plants ha-1, while those of a longer growing season (FAO 500 could be grown up to 60,000 plants ha-1. In such a way, the most favorable parameters of yields and the highest yields can be obtained.
Maize Endophytic Bacterial Diversity as Affected by Soil Cultivation History.
Correa-Galeote, David; Bedmar, Eulogio J; Arone, Gregorio J
2018-01-01
The bacterial endophytic communities residing within roots of maize ( Zea mays L.) plants cultivated by a sustainable management in soils from the Quechua maize belt (Peruvian Andes) were examined using tags pyrosequencing spanning the V4 and V5 hypervariable regions of the 16S rRNA. Across four replicate libraries, two corresponding to sequences of endophytic bacteria from long time maize-cultivated soils and the other two obtained from fallow soils, 793 bacterial sequences were found that grouped into 188 bacterial operational taxonomic units (OTUs, 97% genetic similarity). The numbers of OTUs in the libraries from the maize-cultivated soils were significantly higher than those found in the libraries from fallow soils. A mean of 30 genera were found in the fallow soil libraries and 47 were in those from the maize-cultivated soils. Both alpha and beta diversity indexes showed clear differences between bacterial endophytic populations from plants with different soil cultivation history and that the soils cultivated for long time requires a higher diversity of endophytes. The number of sequences corresponding to main genera Sphingomonas, Herbaspirillum, Bradyrhizobium and Methylophilus in the maize-cultivated libraries were statistically more abundant than those from the fallow soils. Sequences of genera Dyella and Sreptococcus were significantly more abundant in the libraries from the fallow soils. Relative abundance of genera Burkholderia, candidatus Glomeribacter, Staphylococcus, Variovorax, Bacillus and Chitinophaga were similar among libraries. A canonical correspondence analysis of the relative abundance of the main genera showed that the four libraries distributed in two clearly separated groups. Our results suggest that cultivation history is an important driver of endophytic colonization of maize and that after a long time of cultivation of the soil the maize plants need to increase the richness of the bacterial endophytes communities.
Micromechanics of human mitotic chromosomes
International Nuclear Information System (INIS)
Sun, Mingxuan; Kawamura, Ryo; Marko, John F
2011-01-01
Eukaryote cells dramatically reorganize their long chromosomal DNAs to facilitate their physical segregation during mitosis. The internal organization of folded mitotic chromosomes remains a basic mystery of cell biology; its understanding would likely shed light on how chromosomes are separated from one another as well as into chromosome structure between cell divisions. We report biophysical experiments on single mitotic chromosomes from human cells, where we combine micromanipulation, nano-Newton-scale force measurement and biochemical treatments to study chromosome connectivity and topology. Results are in accord with previous experiments on amphibian chromosomes and support the 'chromatin network' model of mitotic chromosome structure. Prospects for studies of chromosome-organizing proteins using siRNA expression knockdowns, as well as for differential studies of chromosomes with and without mutations associated with genetic diseases, are also discussed
THE IMPORTANCE OF WESTERN CORN ROOTWORM IN CONTINUOUS MAIZE
Directory of Open Access Journals (Sweden)
Marija Ivezić
2006-06-01
Full Text Available Western Corn Rootworm (Diabrotica virgifera virgifera LeConte is considered to be one of the most important and potentially most severe pest of maize worldwide. The pest was detected in Croatia for the first time in 1995. Since then it has been spread over all areas with maize production in Croatia. The economically most efficient and preventive control measure is crop rotation and growing maize hybrids that show tolerance to WCR. The trials were settled in the area near Dubosevica where in 2002 and 2003 the economic damages caused by WCR were up to 80%. The aim of this investigation is to determine damages on maize root caused by WCR and loss in grain yield on commercial maize hybrids in continuous farming. Pheromone traps, type Csal♀m♂N®, were used in order to monitor WCR population dynamics. In the period of two months, 366 WCR adult beetles in total were captured. Root damage was evaluated according to Iowa Node Injury Scale and grain yield was measured and corrected to 14% moisture. Furthermore, the plant lodging, as a consequence of larval feeding, was assessed. The results have shown that root damage for hybrid Bc 5982 was 1.15, and 0.73 damage was on Pr 35p 12 roots. The grain yield obtained from hybrid Bc 5982 was 11.7 t/ha, and Pr 35p 12 had 12.3 t/ha. Statistical analyses showed that there were no significant differences in root damage and losses in grain yield between the two investigated hybrids. Results of this investigation indicate that growing maize for 2 to 3 years in continuous farming, in the same field, would not cause economically significant loss in maize gain yield.
Fatty acid composition of maize germ oil from high-oil hybrids wet-milling processing
Directory of Open Access Journals (Sweden)
Jovanović Petar Lj.
2005-01-01
Full Text Available Maize germ was obtained by wet-milling laboratory processing of domestic high-oil maize hybrids. After separation, the germ was subjected to extraction of maize oil. Fatty acid composition of maize germ oil was determined by gas chromatography. The results showed very high levels of unsaturated fatty acids and a constant sum of oleic and linoleic acids in oils of different maize hybrids.
The Optical Absorption Coefficient of Maize Grains Investigated by Photoacoustic Spectroscopy
Rodríguez-Páez, C. L.; Carballo-Carballo, A.; Rico-Molina, R.; Hernández-Aguilar, C.; Domínguez-Pacheco, A.; Cruz-Orea, A.; Moreno-Martínez, E.
2017-01-01
In the maize and tortilla industry, it is important to characterize the color of maize ( Zea mays L.) grain, as it is one of the attributes that directly affect the quality of the tortillas consumed by the population. For this reason, the availability of alternative techniques for assessing and improving the quality of grain is valued. Photoacoustic spectroscopy has proven to be a useful tool for characterizing maize grain. So, the objective of the present study was to determine the optical absorption coefficient β of the maize grain used to make tortillas from two regions of Mexico: (a) Valles Altos, 2012-2013 production cycle and (b) Guasave, Sinaloa, 2013-2014 production cycle. Traditional reflectance measurements, physical characteristics of the grain and nutrient content were also calculated. The experimental results show different characteristics for maize grains.
Maize-common bean/lupine intercrop productivity and profitability in ...
African Journals Online (AJOL)
Phaseolus vulgaris L.), narrow-leaf lupine (Lupinus angustifolius L.), and white lupine (Lupinus albus L.) with maize (Zea mays L.) were conducted under two intercrop planting arrangements (IPA), single row of legume in between maize rows and ...
Proteomics of Maize Root Development.
Hochholdinger, Frank; Marcon, Caroline; Baldauf, Jutta A; Yu, Peng; Frey, Felix P
2018-01-01
Maize forms a complex root system with structurally and functionally diverse root types that are formed at different developmental stages to extract water and mineral nutrients from soil. In recent years proteomics has been intensively applied to identify proteins involved in shaping the three-dimensional architecture and regulating the function of the maize root system. With the help of developmental mutants, proteomic changes during the initiation and emergence of shoot-borne, lateral and seminal roots have been examined. Furthermore, root hairs were surveyed to understand the proteomic changes during the elongation of these single cell type structures. In addition, primary roots have been used to study developmental changes of the proteome but also to investigate the proteomes of distinct tissues such as the meristematic zone, the elongation zone as well as stele and cortex of the differentiation zone. Moreover, subcellular fractions of the primary root including cell walls, plasma membranes and secreted mucilage have been analyzed. Finally, the superior vigor of hybrid seedling roots compared to their parental inbred lines was studied on the proteome level. In summary, these studies provide novel insights into the complex proteomic interactions of the elaborate maize root system during development.
Proteomics of Maize Root Development
Directory of Open Access Journals (Sweden)
Frank Hochholdinger
2018-03-01
Full Text Available Maize forms a complex root system with structurally and functionally diverse root types that are formed at different developmental stages to extract water and mineral nutrients from soil. In recent years proteomics has been intensively applied to identify proteins involved in shaping the three-dimensional architecture and regulating the function of the maize root system. With the help of developmental mutants, proteomic changes during the initiation and emergence of shoot-borne, lateral and seminal roots have been examined. Furthermore, root hairs were surveyed to understand the proteomic changes during the elongation of these single cell type structures. In addition, primary roots have been used to study developmental changes of the proteome but also to investigate the proteomes of distinct tissues such as the meristematic zone, the elongation zone as well as stele and cortex of the differentiation zone. Moreover, subcellular fractions of the primary root including cell walls, plasma membranes and secreted mucilage have been analyzed. Finally, the superior vigor of hybrid seedling roots compared to their parental inbred lines was studied on the proteome level. In summary, these studies provide novel insights into the complex proteomic interactions of the elaborate maize root system during development.
Partial Placement of Maize with Cocoa Husks Meals in Layers Mash ...
African Journals Online (AJOL)
The partial replacement value of cocoa husk meals for maize in laying hen diets were assessed under an on-farm condition, Urea-treated and untreated cocoa husk meals were each incorporated into the farmer's layer mash (FLM) to replace 25% of the maize portion. FLM contained 40% maize. Six groups of 15 laying hens ...
Determination of carotenoids in yellow maize, the effects of saponification and food preparations.
Muzhingi, Tawanda; Yeum, Kyung-Jin; Russell, Robert M; Johnson, Elizabeth J; Qin, Jian; Tang, Guangwen
2008-05-01
Maize is an important staple food consumed by millions of people in many countries. Yellow maize naturally contains carotenoids which not only provide provitamin A carotenoids but also xanthophylls, which are known to be important for eye health. This study was aimed at 1) evaluating the effect of saponification during extraction of yellow maize carotenoids, 2) determining the major carotenoids in 36 genotypes of yellow maize by high-performance liquid chromatography with a C30 column, and 3) determining the effect of cooking on the carotenoid content of yellow maize. The major carotenoids in yellow maize were identified as all-trans lutein, cis-isomers of lutein, all-trans zeaxanthin, alpha- and beta-cryptoxanthin, all-trans beta-carotene, 9-cis beta-carotene, and 13-cis beta-carotene. Our results indicated that carotenoid extraction without saponification showed a significantly higher yield than that obtained using saponification. Results of the current study indicate that yellow maize is a good source of provitamin A carotenoids and xanthophylls. Cooking by boiling yellow maize at 100 degrees C for 30 minutes increased the carotenoid concentration, while baking at 450 degrees F for 25 minutes decreased the carotenoid concentrations by almost 70% as compared to the uncooked yellow maize flour.
Productivity and profitability of maize-pumpkin mix cropping in Chitwan, Nepal
Directory of Open Access Journals (Sweden)
Shiva Chandra Dhakal
2015-12-01
Full Text Available The study was conducted to determine the productivity, profitability and resource use efficiency of maize-pumpkin mix crop production in Chitwan. The study used 53 maize-pumpkin mix crop adopting farmers from among 300 farmers adopting different pollinator friendly practices. Descriptive and statistical tools including Cobb-Douglas production function were used to analyze data, collected from structured interview schedule. The benefit cost ratio (1.58 indicates that maize-pumpkin mix cropping was profitable with productivity of 2.83 ton per ha on maize main product equivalent basis. The magnitude of regression coefficients of maize-pumpkin mix cropping implied that expenditure on seed and fertilizer and irrigation had significant positive effect on gross return with estimated decreasing return to scale (0.85. According to estimated allocative efficiency indices, it is suggested to increase expenditure on seed and fertilizer cum irrigation by about 90% and 55% respectively. Extension of modern technologies with adjustment on resource use is to be encouraged for increase in productivity and profitability of maize-pumpkin mix crop production which indirectly promotes and ensure forage for pollinators
Diversity in global maize germplasm: Characterization and utilization
Indian Academy of Sciences (India)
Maize (Zea mays L.) is not only of worldwide importance as a food, feed and as a source of diverse industrially important products, but is also a model genetic organism with immense genetic diversity. Although it was first domesticated in Mexico, maize landraces are widely found across the continents. Several studies in ...
Uptake, translocation, and debromination of polybrominated diphenyl ethers in maize
Institute of Scientific and Technical Information of China (English)
Moming Zhao; Shuzhen Zhang; Sen Wang; Honglin Huang
2012-01-01
Uptake,translocation and debromination of three polybrominated diphenyl ethers(PBDEs),BDE-28,-47 and-99,in maize were studied in a hydroponic experiment.Roots took up most of the PBDEs in the culture solutions and more highly brominated PBDEs had a stronger uptake capability.PBDEs were detected in the stems and leaves of maize after exposure but rarely detected in the blank control plants.Furthermore,PBDE concentrations decreased from roots to stems and then to leaves,and a very clear decreasing gradient was found in segments upwards along the stem.These altogether provide substantiating evidence for the acropetal translocation of PBDEs in maize.More highly brominated PBDEs were translocated with more difficulty.Radial translocation of PBDEs from nodes to sheath inside maize was also observed.Both acropetal and radial translocations were enhanced at higher transpiration rates,suggesting that PBDE transport was probably driven by the transpiration stream.Debromination of PBDEs occurred in all parts of the maize,and debromination patterns of different parent PBDEs and in different parts of a plant were similar but with some differences.This study for the first time provides direct evidence for the acropetal translocation of PBDEs within plants,elucidates the process of PBDE transport and clarifies the debromination products of PBDEs in maize.
Chromosomal Behavior during Meiosis in the Progeny of Triticum timopheevii × Hexaploid Wild Oat.
Directory of Open Access Journals (Sweden)
Hongzhou An
Full Text Available The meiotic behavior of pollen mother cells (PMCs of the F2 and F3 progeny from Triticum timopheevii × hexaploid wild oat was investigated by cytological analysis and sequential C-banding-genomic in situ hybridization (GISH in the present study. A cytological analysis showed that the chromosome numbers of the F2 and F3 progeny ranged from 28 to 41. A large number of univalents, lagging chromosomes, chromosome bridges and micronuclei were found at the metaphase I, anaphase I, anaphase II and tetrad stages in the F2 and F3 progeny. The averages of univalents were 3.50 and 2.73 per cell, and those of lagging chromosomes were 3.37 and 1.87 in the F2 and F3 progeny, respectively. The PMC meiotic indices of the F2 and F3 progeny were 12.22 and 20.34, respectively, indicating considerable genetic instability. A sequential C-banding-GISH analysis revealed that some chromosomes and fragments from the hexaploid wild oat were detected at metaphase I and anaphase I in the progeny, showing that the progeny were of true intergeneric hybrid origin. The alien chromosomes 6A, 7A, 3C and 2D were lost during transmission from F2 to F3. In addition, partial T. timopheevii chromosomes appeared in the form of univalents or lagging chromosomes, which might result from large genome differences between the parents, and the wild oat chromosome introgression interfered with the wheat homologues' normally pairing.
Leaf transpiration efficiency of some drought-resistant maize lines
Field measurements of leaf gas exchange in maize often indicate stomatal conductances higher than required to provide substomatal carbon dioxide concentrations saturating to photosynthesis. Thus maize leaves often operate at lower transpiration efficiency (TE) than potentially achievable for specie...
Salvi, Silvio; Giuliani, Silvia; Ricciolini, Claudia; Carraro, Nicola; Maccaferri, Marco; Presterl, Thomas; Ouzunova, Milena; Tuberosa, Roberto
2016-02-01
The genetic dissection of root architecture and functions allows for a more effective and informed design of novel root ideotypes and paves the way to evaluate their effects on crop resilience to a number of abiotic stresses. In maize, limited attention has been devoted to the genetic analysis of root architecture diversity at the early stage. The difference in embryonic (including seminal and primary) root architecture between the maize reference line B73 (which mostly develops three seminal roots) and the landrace Gaspé Flint (with virtually no seminal roots) was genetically dissected using a collection of introgression lines grown in paper rolls and pots. Quantitative trait locus (QTL) analysis identified three QTLs controlling seminal root number (SRN) on chromosome bins 1.02, 3.07, and 8.04-8.05, which collectively explained 66% of the phenotypic variation. In all three cases, Gaspé Flint contributed the allele for lower SRN. Primary root dry weight was negatively correlated with SRN (r= -0.52), and QTLs for primary root size co-mapped with SRN QTLs, suggesting a pleiotropic effect of SRN QTLs on the primary root, most probably caused by competition for seed resources. Interestingly, two out of three SRN QTLs co-mapped with the only two known maize genes (rtcs and rum1) affecting the number of seminal roots. The strong additive effect of the three QTLs and the development of near isogenic lines for each QTL in the elite B73 background provide unique opportunities to characterize functionally the genes involved in root development and to evaluate how root architecture affects seedling establishment, early development, and eventually yield in maize. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.
The proteome and phosphoproteome of maize pollen uncovers fertility candidate proteins.
Chao, Qing; Gao, Zhi-Fang; Wang, Yue-Feng; Li, Zhe; Huang, Xia-He; Wang, Ying-Chun; Mei, Ying-Chang; Zhao, Biligen-Gaowa; Li, Liang; Jiang, Yu-Bo; Wang, Bai-Chen
2016-06-01
Maize is unique since it is both monoecious and diclinous (separate male and female flowers on the same plant). We investigated the proteome and phosphoproteome of maize pollen containing modified proteins and here we provide a comprehensive pollen proteome and phosphoproteome which contain 100,990 peptides from 6750 proteins and 5292 phosphorylated sites corresponding to 2257 maize phosphoproteins, respectively. Interestingly, among the total 27 overrepresented phosphosite motifs we identified here, 11 were novel motifs, which suggested different modification mechanisms in plants compared to those of animals. Enrichment analysis of pollen phosphoproteins showed that pathways including DNA synthesis/chromatin structure, regulation of RNA transcription, protein modification, cell organization, signal transduction, cell cycle, vesicle transport, transport of ions and metabolisms, which were involved in pollen development, the following germination and pollen tube growth, were regulated by phosphorylation. In this study, we also found 430 kinases and 105 phosphatases in the maize pollen phosphoproteome, among which calcium dependent protein kinases (CDPKs), leucine rich repeat kinase, SNF1 related protein kinases and MAPK family proteins were heavily enriched and further analyzed. From our research, we also uncovered hundreds of male sterility-associated proteins and phosphoproteins that might influence maize productivity and serve as targets for hybrid maize seed production. At last, a putative complex signaling pathway involving CDPKs, MAPKs, ubiquitin ligases and multiple fertility proteins was constructed. Overall, our data provides new insight for further investigation of protein phosphorylation status in mature maize pollen and construction of maize male sterile mutants in the future.
Influence of growing measures on weed interference and water status in maize
Directory of Open Access Journals (Sweden)
Simić Milena
2017-01-01
Full Text Available Growing modern hybrids in narrow plant spacing together with nitrogen and herbicide application gives an advantage to maize crops over weeds. The aim of the present investigation was to evaluate the effect of nitrogen form, maize row spacing and herbicide treatment on weed and maize biomass and water usage, as well as maize yield. The investigation was conducted at the Maize Research Institute Zemun Polje, Belgrade during 2014-2016. A field experiment was set up as a split-split-plot block design with four replications. The maize hybrid ZP388 was planted, and a standard and a slow-release form of urea were applied. For each N source, maize was grown at two row spacings: narrow of 50 cm, and standard of 70 cm, while weed control treatments included: C - without herbicide application, T - application of a pre-emergence mix of herbicides. Sowing was done in the second decade of April, 2014, 2015 and 2016. Six weeks after herbicide application, the fresh biomass of weeds uprooted from 1 m2 and aboveground biomass of ten crop plants per plot were measured together with dry matter after drying in a laboratory oven. Water content (% in weed and maize plants was calculated as a relation between fresh and dry biomass. Maize yield was measured at the end of each growing season and calculated with 14% of moisture. All data were processed by ANOVA. The fresh and dry biomass of weeds were significantly (P>0.05 higher in untreated control than in the treated variant, while differences in water content were not significant between the two treatments. Row spacing and urea form did not cause significant differences in weed parameters. Related to this, maize fresh and dry biomass, as well as water content, were higher in herbicide-treated variants than in control but differences were insignificant. Maize biomass was somewhat higher in 50 cm rows and after application of the slow-release urea fertilizer. Yield was higher from 70 cm rows and after application of
DEFF Research Database (Denmark)
Carracedo, A; Beckmann, A; Bengs, A
2001-01-01
A collaborative exercise was carried out by the European DNA Profiling Group (EDNAP) in the frame work of the STADNAP program, i.e. standardization of DNA profiling in Europe, in order to evaluate the performance of a Y-chromosome STR pentaplex, which includes the loci DYS19, DYS389 I and II, DYS...
Effect of Spatial Arrangement on Growth and Yield of Cowpea in a Cowpea-maize Intercrop
Directory of Open Access Journals (Sweden)
Ocaya, CP.
2001-01-01
Full Text Available Cowpea growth and yield performance when intercropped with maize was studied for 3 consecutive seasons under three spatial arrangements, i. e., maize planted at 90 x 30, 100 x 27, and 120 x 22.5 cm, with 2 rows of cowpea between the maize rows. Growth and yield of cowpea was improved significantly by widening maize intra-row distances as compared to the 90 x 30 cm spacing. Hence, intercropped cowpea needs to be sown where maize rows are wide apart, but the maize rows should not be too wide as this would lower the grain yield of maize.
Babu, Ramesh; Van Dyke, Daniel L; Dev, Vaithilingam G; Koduru, Prasad; Rao, Nagesh; Mitter, Navnit S; Liu, Mingya; Fuentes, Ernesto; Fuentes, Sarah; Papa, Stephen
2018-02-01
- Chromosome analysis on bone marrow or peripheral blood samples fails in a small proportion of attempts. A method that is more reliable, with similar or better resolution, would be a welcome addition to the armamentarium of the cytogenetics laboratory. - To develop a method similar to banded metaphase chromosome analysis that relies only on interphase nuclei. - To label multiple targets in an equidistant fashion along the entire length of each chromosome, including landmark subtelomere and centromere regions. Each label so generated by using cloned bacterial artificial chromosome probes is molecularly distinct with unique spectral characteristics, so the number and position of the labels can be tracked to identify chromosome abnormalities. - Interphase chromosome profiling (ICP) demonstrated results similar to conventional chromosome analysis and fluorescence in situ hybridization in 55 previously studied cases and obtained useful ICP chromosome analysis results on another 29 cases in which conventional methods failed. - ICP is a new and powerful method to karyotype peripheral blood and bone marrow aspirate preparations without reliance on metaphase chromosome preparations. It will be of particular value for cases with a failed conventional analysis or when a fast turnaround time is required.
Dynamics in the microbiology of maize silage during whole-season storage
DEFF Research Database (Denmark)
Storm, Ida Marie Lindhardt Drejer; Kristensen, N.B.; Raun, B.M.L.
2010-01-01
Aims: To monitor seasonal variations in the microbiology of maize silage and to determine whether the risk of fungal spoilage varies during whole-year storage. Methods and Results: A continuous survey of 20 maize silage stacks was conducted over a period from three to 11 months after ensiling...... variations in the microbiology of maize silage over a whole storage season. The risk of fungal spoilage was highest 5-7 months after ensiling and lowest after 11 months. Significance and Impact of the Study: This information is valuable in the assessment of health risks connected with spoiled maize silage...
Sequencing, assembly, and annotation of Maize B104 : A maize transformation resource
Maize transformation is complicated. Most lines are not readily cultured and transformed, making the germplasm available for genome engineering extremely limited. Developing a better understanding of the genomic regions responsible for differences in culturability and transformability would be a goo...
Complete sequence and diversity of a maize-associated Polerovirus in East Africa.
Massawe, Deogracious P; Stewart, Lucy R; Kamatenesi, Jovia; Asiimwe, Theodore; Redinbaugh, Margaret G
2018-06-01
Since 2011-2012, Maize lethal necrosis (MLN) has emerged in East Africa, causing massive yield loss and propelling research to identify viruses and virus populations present in maize. As expected, next generation sequencing (NGS) has revealed diverse and abundant viruses from the family Potyviridae, primarily sugarcane mosaic virus (SCMV), and maize chlorotic mottle virus (MCMV) (Tombusviridae), which are known to cause MLN by synergistic co-infection. In addition to these expected viruses, we identified a virus in the genus Polerovirus (family Luteoviridae) in 104/172 samples selected for MLN or other potential virus symptoms from Kenya, Uganda, Rwanda, and Tanzania. This polerovirus (MF974579) nucleotide sequence is 97% identical to maize-associated viruses recently reported in China, termed 'maize yellow mosaic virus' (MaYMV) and maize yellow dwarf virus (MaYMV; KU291101, KU291107, MYDV-RMV2; KT992824); and 99% identical to MaYMV (KY684356) infecting sugarcane and itch grass in Nigeria; 83% identical to a barley-associated polerovirus recently identified in Korea (BVG; KT962089); and 79% identical to the U.S. maize-infecting polerovirus maize yellow dwarf virus (MYDV-RMV; KT992824). Nucleotide sequences from ORF0 of 20 individual East African isolates collected from Kenya, Uganda, Rwanda, and Tanzania shared 98% or higher identity, and were detected in 104/172 (60.5%) of samples collected for virus-like symptoms, indicating extensive prevalence but limited diversity of this virus in East Africa. We refer to this virus as "MYDV-like polerovirus" until symptoms of the virus in maize are known.
Spatial pattern characteristics of water footprint for maize production in Northeast China.
Duan, Peili; Qin, Lijie; Wang, Yeqiao; He, Hongshi
2016-01-30
Water footprint (WF) methodology is essential for quantifying total water consumption of crop production and making efficient water management policies. This study calculated the green, blue, grey and total WFs of maize production in Northeast China from 1998 to 2012 and compared the values of the provinces. This study also analyzed the spatial variation and structure characteristics of the WFs at the prefecture level. The annual average WF of maize production was 1029 m(3) per ton, which was 51% green, 21% blue and 28% grey. The WF of maize production was highest in Liaoning Province, moderate in Heilongjiang Province and lowest in Jilin Province. The spatial differences of the WFs calculated for the 36 major maize production prefectures were significant in Northeast China. There was a moderate positive spatial autocorrelation among prefectures that had similar WFs. Local indicator of spatial autocorrelation index (LISA) analysis identified prefectures with higher WFs in the southeast region of Liaoning Province and the southwest region of Heilongjiang Province and prefectures with lower WFs in the middle of Jilin Province. Spatial differences in the WF of maize production were caused mainly by variations in climate conditions, soil quality, irrigation facilities and maize yield. The spatial distribution of WFs can help provide a scientific basis for optimizing maize production distribution and then formulate strategies to reduce the WF of maize production. © 2015 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Sebastian Pita
2013-05-01
Full Text Available In this study, we used fluorescence in situ hybridisation to determine the chromosomal location of 45S rDNA clusters in 10 species of the tribe Rhodniini (Hemiptera: Reduviidae: Triatominae. The results showed striking inter and intraspecific variability, with the location of the rDNA clusters restricted to sex chromosomes with two patterns: either on one (X chromosome or both sex chromosomes (X and Y chromosomes. This variation occurs within a genus that has an unchanging diploid chromosome number (2n = 22, including 20 autosomes and 2 sex chromosomes and a similar chromosome size and genomic DNA content, reflecting a genome dynamic not revealed by these chromosome traits. The rDNA variation in closely related species and the intraspecific polymorphism in Rhodnius ecuadoriensis suggested that the chromosomal position of rDNA clusters might be a useful marker to identify recently diverged species or populations. We discuss the ancestral position of ribosomal genes in the tribe Rhodniini and the possible mechanisms involved in the variation of the rDNA clusters, including the loss of rDNA loci on the Y chromosome, transposition and ectopic pairing. The last two processes involve chromosomal exchanges between both sex chromosomes, in contrast to the widely accepted idea that the achiasmatic sex chromosomes of Heteroptera do not interchange sequences.
Huitlacoche yield in some maize varieties in the Mediterranean region of Turkey
Directory of Open Access Journals (Sweden)
Mehmet Aydoğdu
2015-06-01
Full Text Available Huitlacoche is the Aztecs name given to the smut galls on ears of maize caused by the pathogenic plant fungus Ustilago maydis [(DC Corda.]. It is known as maize mushroom, and it has been considered a delicacy and in Mesoamerica. The aim of the present study was to determine the responses of some maize varieties to the growth of the fungus in order to evaluate the prospect production of these smutty ears as a maize mushroom. A 2-year study was conducted in the Mediterranean region of Turkey in 2010 and 2011. Inoculations were performed by injecting inoculum into the ear through the silk channel of plants in plots. Each treatment had control plots. Average ear-gall (huitlacoche severity and incidence of all the varieties were at the rates of 4.0 and 41.6%, respectively. However, the highest severity of ear-gall (6.5 and incidence (60.6% were found in Karadeniz Yıldızı flint maize variety; colossal smutty ears were formed in the maize cultivars. This study showed that certain maize cultivars (flint corn and dent corn can be used efficiently in the production of huitlacoche.
Use of Maize (Zea mays L.) for phytomanagement of Cd-contaminated soils: a critical review.
Rizwan, Muhammad; Ali, Shafaqat; Qayyum, Muhammad Farooq; Ok, Yong Sik; Zia-Ur-Rehman, Muhammad; Abbas, Zaheer; Hannan, Fakhir
2017-04-01
Maize (Zea mays L.) has been widely adopted for phytomanagement of cadmium (Cd)-contaminated soils due to its high biomass production and Cd accumulation capacity. This paper reviewed the toxic effects of Cd and its management by maize plants. Maize could tolerate a certain level of Cd in soil while higher Cd stress can decrease seed germination, mineral nutrition, photosynthesis and growth/yields. Toxicity response of maize to Cd varies with cultivar/varieties, growth medium and stress duration/extent. Exogenous application of organic and inorganic amendments has been used for enhancing Cd tolerance of maize. The selection of Cd-tolerant maize cultivar, crop rotation, soil type, and exogenous application of microbes is a representative agronomic practice to enhance Cd tolerance in maize. Proper selection of cultivar and agronomic practices combined with amendments might be successful for the remediation of Cd-contaminated soils with maize. However, there might be the risk of food chain contamination by maize grains obtained from the Cd-contaminated soils. Thus, maize cultivation could be an option for the management of low- and medium-grade Cd-contaminated soils if grain yield is required. On the other hand, maize can be grown on Cd-polluted soils only if biomass is required for energy production purposes. Long-term field trials are required, including risks and benefit analysis for various management strategies aiming Cd phytomanagement with maize.
Sources of Technical Efficiency Among Smallholders Maize Farmers ...
African Journals Online (AJOL)
The results show that the mean technical efficiency score for famers in the study area is 62.3%. This implies that there is a significant room for increasing maize yield in the study area if farmers use the resources at their disposal efficiently. Moreover, the results show that the efficiency of maize farmers in the study area is ...
Telomere dysfunction and chromosome instability
Energy Technology Data Exchange (ETDEWEB)
Murnane, John P., E-mail: jmurnane@radonc.ucsf.edu [Department of Radiation Oncology, University of California San Francisco, 2340 Sutter Street, San Francisco, CA 94143-1331 (United States)
2012-02-01
The ends of chromosomes are composed of a short repeat sequence and associated proteins that together form a cap, called a telomere, that keeps the ends from appearing as double-strand breaks (DSBs) and prevents chromosome fusion. The loss of telomeric repeat sequences or deficiencies in telomeric proteins can result in chromosome fusion and lead to chromosome instability. The similarity between chromosome rearrangements resulting from telomere loss and those found in cancer cells implicates telomere loss as an important mechanism for the chromosome instability contributing to human cancer. Telomere loss in cancer cells can occur through gradual shortening due to insufficient telomerase, the protein that maintains telomeres. However, cancer cells often have a high rate of spontaneous telomere loss despite the expression of telomerase, which has been proposed to result from a combination of oncogene-mediated replication stress and a deficiency in DSB repair in telomeric regions. Chromosome fusion in mammalian cells primarily involves nonhomologous end joining (NHEJ), which is the major form of DSB repair. Chromosome fusion initiates chromosome instability involving breakage-fusion-bridge (B/F/B) cycles, in which dicentric chromosomes form bridges and break as the cell attempts to divide, repeating the process in subsequent cell cycles. Fusion between sister chromatids results in large inverted repeats on the end of the chromosome, which amplify further following additional B/F/B cycles. B/F/B cycles continue until the chromosome acquires a new telomere, most often by translocation of the end of another chromosome. The instability is not confined to a chromosome that loses its telomere, because the instability is transferred to the chromosome donating a translocation. Moreover, the amplified regions are unstable and form extrachromosomal DNA that can reintegrate at new locations. Knowledge concerning the factors promoting telomere loss and its consequences is
DEFF Research Database (Denmark)
Philip, J; Tabor, A; Bang, J
1983-01-01
The aim of the study was to investigate the rationale of the current indications for fetal chromosome analysis. 5372 women had 5423 amniocentesis performed, this group constituting a consecutive sample at the chromosome laboratory, Rigshospitalet, Copenhagen from March 1973 to September 1980 (Group...... A + B). Pregnant women 35 years of age, women who previously had a chromosomally abnormal child, families with translocation carriers or other heritable chromosomal disease, families where the father was 50 years or more and women in families with a history of Down's syndrome (group A), were compared...... to women having amniocentesis, although considered not to have any increased risk of fetal chromosome abnormality (1390 pregnancies, group B). They were also compared with 750 consecutive pregnancies in women 25-34 years of age, in whom all heritable diseases were excluded (group C). The risk of unbalanced...
The chromosome painting is an efficient tool for chromosome research. However, plant chromosome painting is relatively underdeveloped. In this study, chromosome painting was developed and used to identify alien chromosomes in TAi-27, a wheat-Thinopyrum intermedium addition line, and chromosomes of...
Deng, Chuanliang; Bai, Lili; Fu, Shulan; Yin, Weibo; Zhang, Yingxin; Chen, Yuhong; Wang, Richard R-C; Zhang, Xiangqi; Han, Fangpu; Hu, Zanmin
2013-01-01
In this study, chromosome painting was developed and used to identify alien chromosomes in TAi-27, a wheat--Thinopyrum intermedium addition line, and the chromosomes of the three different genomes of Th. Intermedium. The smallest alien chromosome of TAi-27 was microdissected and its DNA amplified by DOP-PCR was used as a probe to hybridize with metaphase chromosomes of TAi-27 and Th. intermedium. Results showed that hybridization signals were observed in all regions of a pair of the smallest alien chromosomes and the pericentromeric area of another pair of alien chromosomes in TAi-27, indicating that the probe from microdissected chromosome is species specific. In Th. intermedium, 14 chromosomes had wide and strong hybridization signals distributed mainly on the pericentromere area and 9 chromosomes with narrow and weak signals on the pericentromere area. The remaining chromosomes displayed a very weak or no signal. Sequential FISH/GISH on Th. intermedium chromosomes using the DNAs of microdissected chromosome, Pseudoroegneria spicata (St genome) and pDbH12 (a J(s) genome specific probe) as the probes indicated that the microdissected chromosome belonged to the St genome, three genomes (J(s) , J and St) in Th. intermedium could be distinguished, in which there is no hybridization signal on J genome that is similar to the genome of Th. bessarabicum. Our results showed that the smallest alien chromosomes may represent a truncated chromosome and the repetitive sequence distribution might be similar in different chromosomes within the St genome. However, the repetitive sequence distributions are different within the J(s) genome, within a single chromosome, and among different genomes in Th. intermedium. Our results suggested that chromosome painting could be feasible in some plants and useful in detecting chromosome variation and repetitive sequence distribution in different genomes of polyploidy plants, which is helpful for understanding the evolution of different
Yin, Weibo; Zhang, Yingxin; Chen, Yuhong; Wang, Richard R.-C.; Zhang, Xiangqi; Han, Fangpu; Hu, Zanmin
2013-01-01
In this study, chromosome painting was developed and used to identify alien chromosomes in TAi-27, a wheat - Thinopyrum intermedium addition line, and the chromosomes of the three different genomes of Th. Intermedium. The smallest alien chromosome of TAi-27 was microdissected and its DNA amplified by DOP-PCR was used as a probe to hybridize with metaphase chromosomes of TAi-27 and Th . intermedium . Results showed that hybridization signals were observed in all regions of a pair of the smallest alien chromosomes and the pericentromeric area of another pair of alien chromosomes in TAi-27, indicating that the probe from microdissected chromosome is species specific. In Th . intermedium , 14 chromosomes had wide and strong hybridization signals distributed mainly on the pericentromere area and 9 chromosomes with narrow and weak signals on the pericentromere area. The remaining chromosomes displayed a very weak or no signal. Sequential FISH/GISH on Th . intermedium chromosomes using the DNAs of microdissected chromosome, Pseudoroegneria spicata (St genome) and pDbH12 (a Js genome specific probe) as the probes indicated that the microdissected chromosome belonged to the St genome, three genomes (Js, J and St) in Th . intermedium could be distinguished, in which there is no hybridization signal on J genome that is similar to the genome of Th . bessarabicum . Our results showed that the smallest alien chromosomes may represent a truncated chromosome and the repetitive sequence distribution might be similar in different chromosomes within the St genome. However, the repetitive sequence distributions are different within the Js genome, within a single chromosome, and among different genomes in Th . intermedium . Our results suggested that chromosome painting could be feasible in some plants and useful in detecting chromosome variation and repetitive sequence distribution in different genomes of polyploidy plants, which is helpful for understanding the evolution of different
Maize transformation technology development for commercial event generation
Que, Qiudeng; Elumalai, Sivamani; Li, Xianggan; Zhong, Heng; Nalapalli, Samson; Schweiner, Michael; Fei, Xiaoyin; Nuccio, Michael; Kelliher, Timothy; Gu, Weining; Chen, Zhongying; Chilton, Mary-Dell M.
2014-01-01
Maize is an important food and feed crop in many countries. It is also one of the most important target crops for the application of biotechnology. Currently, there are more biotech traits available on the market in maize than in any other crop. Generation of transgenic events is a crucial step in the development of biotech traits. For commercial applications, a high throughput transformation system producing a large number of high quality events in an elite genetic background is highly desirable. There has been tremendous progress in Agrobacterium-mediated maize transformation since the publication of the Ishida et al. (1996) paper and the technology has been widely adopted for transgenic event production by many labs around the world. We will review general efforts in establishing efficient maize transformation technologies useful for transgenic event production in trait research and development. The review will also discuss transformation systems used for generating commercial maize trait events currently on the market. As the number of traits is increasing steadily and two or more modes of action are used to control key pests, new tools are needed to efficiently transform vectors containing multiple trait genes. We will review general guidelines for assembling binary vectors for commercial transformation. Approaches to increase transformation efficiency and gene expression of large gene stack vectors will be discussed. Finally, recent studies of targeted genome modification and transgene insertion using different site-directed nuclease technologies will be reviewed. PMID:25140170
Maize transformation technology development for commercial event generation.
Que, Qiudeng; Elumalai, Sivamani; Li, Xianggan; Zhong, Heng; Nalapalli, Samson; Schweiner, Michael; Fei, Xiaoyin; Nuccio, Michael; Kelliher, Timothy; Gu, Weining; Chen, Zhongying; Chilton, Mary-Dell M
2014-01-01
Maize is an important food and feed crop in many countries. It is also one of the most important target crops for the application of biotechnology. Currently, there are more biotech traits available on the market in maize than in any other crop. Generation of transgenic events is a crucial step in the development of biotech traits. For commercial applications, a high throughput transformation system producing a large number of high quality events in an elite genetic background is highly desirable. There has been tremendous progress in Agrobacterium-mediated maize transformation since the publication of the Ishida et al. (1996) paper and the technology has been widely adopted for transgenic event production by many labs around the world. We will review general efforts in establishing efficient maize transformation technologies useful for transgenic event production in trait research and development. The review will also discuss transformation systems used for generating commercial maize trait events currently on the market. As the number of traits is increasing steadily and two or more modes of action are used to control key pests, new tools are needed to efficiently transform vectors containing multiple trait genes. We will review general guidelines for assembling binary vectors for commercial transformation. Approaches to increase transformation efficiency and gene expression of large gene stack vectors will be discussed. Finally, recent studies of targeted genome modification and transgene insertion using different site-directed nuclease technologies will be reviewed.
Interaction of maize chromatin-associated HMG proteins with mononucleosomes
DEFF Research Database (Denmark)
Lichota, J.; Grasser, Klaus D.
2003-01-01
maize HMGA and five different HMGB proteins with mononucleosomes (containing approx. 165 bp of DNA) purified from micrococcal nuclease-digested maize chromatin. The HMGB proteins interacted with the nucleosomes independent of the presence of the linker histone H1, while the binding of HMGA...
Noutoshi, Y; Arai, R; Fujie, M; Yamada, T
1997-01-01
As a model for plant-type chromosomes, we have been characterizing molecular organization of the Chlorella vulgaris C-169 chromosome I. To identify chromosome structural elements including the centromeric region and replication origins, we constructed a chromosome I specific cosmid library and aligned each cosmid clones to generate contigs. So far, more than 80% of the entire chromosome I has been covered. A complete clonal physical reconstitution of chromosome I provides information on the structure and genomic organization of plant genome. We propose our strategy to construct an artificial chromosome by assembling the functional chromosome structural elements identified on Chrorella chromosome I.
DEFF Research Database (Denmark)
Ramos Madrigal, Jazmin; Smith, Bruce D.; Moreno Mayar, José Victor
2016-01-01
The complex evolutionary history of maize (Zea mays L. ssp. mays) has been clarified with genomic-level data from modern landraces and wild teosinte grasses [1, 2], augmenting archaeological findings that suggest domestication occurred between 10,000 and 6,250 years ago in southern Mexico [3, 4......]. Maize rapidly evolved under human selection, leading to conspicuous phenotypic transformations, as well as adaptations to varied environments [5]. Still, many questions about the domestication process remain unanswered because modern specimens do not represent the full range of past diversity due...... to abandonment of unproductive lineages, genetic drift, on-going natural selection, and recent breeding activity. To more fully understand the history and spread of maize, we characterized the draft genome of a 5,310-year-old archaeological cob excavated in the Tehuacan Valley of Mexico. We compare this ancient...
Adapting maize production to drought in the Northeast Farming Region of China
DEFF Research Database (Denmark)
Yin, Xiaogang; Olesen, Jørgen Eivind; Wang, M.
2016-01-01
Maize (Zea mays L.) is the most prominent crop in the Northeast Farming Region of China (NFR), and drought has been the largest limitation for maize production in this area during recent decades. The question of how to adapt maize production to drought has received great attention from policy...
International Nuclear Information System (INIS)
Swedak, J.A.M.; Forer, A.
1987-01-01
Sex chromosomes in crane-fly spermatocytes move polewards at anaphase after the autosomes have reached the poles. We irradiated one kinetochore of one sex chromosome using an ultraviolet microbeam. When both sex chromosomes were normally oriented, irradiation of a single kinetochore permanently blocked movement of both sex chromosomes. Irradiation of non-kinetochore chromosomal regions or of spindle fibres did not block movement, or blocked movement only temporarily. We argue that ultraviolet irradiation of one kinetochore blocks movement of both sex chromosomes because of effects on a 'signal' system. Irradiation of one kinetochore of a maloriented sex chromosome did not block motion of either sex chromosome. However, irradiation of one kinetochore of a normally oriented sex chromosome permanently blocked motion of both that sex chromosome and the maloriented sex chromosome. Thus for the signal system to allow the sex chromosomes to move to the pole each sex chromosome must have one spindle fibre to each pole. (author)
Coordination of the maize transcriptome by a conserved circadian clock
Directory of Open Access Journals (Sweden)
Harmon Frank G
2010-06-01
Full Text Available Abstract Background The plant circadian clock orchestrates 24-hour rhythms in internal physiological processes to coordinate these activities with daily and seasonal changes in the environment. The circadian clock has a profound impact on many aspects of plant growth and development, including biomass accumulation and flowering time. Despite recent advances in understanding the circadian system of the model plant Arabidopsis thaliana, the contribution of the circadian oscillator to important agronomic traits in Zea mays and other cereals remains poorly defined. To address this deficit, this study investigated the transcriptional landscape of the maize circadian system. Results Since transcriptional regulation is a fundamental aspect of circadian systems, genes exhibiting circadian expression were identified in the sequenced maize inbred B73. Of the over 13,000 transcripts examined, approximately 10 percent displayed circadian expression patterns. The majority of cycling genes had peak expression at subjective dawn and dusk, similar to other plant circadian systems. The maize circadian clock organized co-regulation of genes participating in fundamental physiological processes, including photosynthesis, carbohydrate metabolism, cell wall biogenesis, and phytohormone biosynthesis pathways. Conclusions Circadian regulation of the maize genome was widespread and key genes in several major metabolic pathways had circadian expression waveforms. The maize circadian clock coordinated transcription to be coincident with oncoming day or night, which was consistent with the circadian oscillator acting to prepare the plant for these major recurring environmental changes. These findings highlighted the multiple processes in maize plants under circadian regulation and, as a result, provided insight into the important contribution this regulatory system makes to agronomic traits in maize and potentially other C4 plant species.
Predicting weed problems in maize cropping by species distribution modelling
Directory of Open Access Journals (Sweden)
Bürger, Jana
2014-02-01
Full Text Available Increasing maize cultivation and changed cropping practices promote the selection of typical maize weeds that may also profit strongly from climate change. Predicting potential weed problems is of high interest for plant production. Within the project KLIFF, experiments were combined with species distribution modelling for this task in the region of Lower Saxony, Germany. For our study, we modelled ecological and damage niches of nine weed species that are significant and wide spread in maize cropping in a number of European countries. Species distribution models describe the ecological niche of a species, these are the environmental conditions under which a species can maintain a vital population. It is also possible to estimate a damage niche, i.e. the conditions under which a species causes damage in agricultural crops. For this, we combined occurrence data of European national data bases with high resolution climate, soil and land use data. Models were also projected to simulated climate conditions for the time horizon 2070 - 2100 in order to estimate climate change effects. Modelling results indicate favourable conditions for typical maize weed occurrence virtually all over the study region, but only a few species are important in maize cropping. This is in good accordance with the findings of an earlier maize weed monitoring. Reaction to changing climate conditions is species-specific, for some species neutral (E. crus-galli, other species may gain (Polygonum persicaria or loose (Viola arvensis large areas of suitable habitats. All species with damage potential under present conditions will remain important in maize cropping, some more species will gain regional importance (Calystegia sepium, Setara viridis.
Robertson, Carol
2016-01-01
Learning about chromosomes is standard fare in biology classrooms today. However, students may find it difficult to understand the relationships among the "genome", "chromosomes", "genes", a "gene locus", and "alleles". In the simple activity described in this article, which follows the 5E approach…
... and more. Stony Point, NY 10980 Close X Home > Complications & Loss > Birth defects & other health conditions > Chromosomal conditions Chromosomal conditions ... Disorders See also: Genetic counseling , Your family health history Last reviewed: February, 2013 ... labor & premature birth The newborn intensive care unit (NICU) Birth defects & ...
Electochemical detection of chromosome translocation
DEFF Research Database (Denmark)
Kwasny, Dorota; Dimaki, Maria; Silahtaroglu, Asli
2014-01-01
Cytogenetics is a study of the cell structure with a main focus on chromosomes content and their structure. Chromosome abnormalities, such as translocations may cause various genetic disorders and heametological malignancies. Chromosome translocations are structural rearrangements of two...... chromosomes that results in formation of derivative chromosomes with a mixed DNA sequence. The method currently used for their detection is Fluorescent In Situ Hybridization, which requires a use of expensive, fluorescently labeled probes that target the derivative chromosomes. We present here a double...... hybridization approach developed for label-free detection of the chromosome translocations. For specific translocation detection it is necessary to determine that the two DNA sequences forming a derivative chromosome are connected, which is achieved by two subsequent hybridization steps. The electrochemical...
Effects of intercropping on maize stemborers and their natural enemies
DEFF Research Database (Denmark)
Skovgård, Henrik; Päts, Peeter
1996-01-01
The effects of maize-cowpea intercropping on three lepidopteran stemborers (Chilo partellus (Swinhoe) C. orichalcociliellus (Strand) and Sesamia calamistis Hampson) and their natural enemies were studied in Kenya. Oviposition was not affected by intercropping, but significantly fewer larvae...... and wandering spiders, were not augmented by intercropping, but an inverse relationship in abundance was found between these two predator groups. It is concluded that maize intercropped with cowpea has only limited potential as a method of controlling the key pests in maize....
Host Status of Five Weed Species and Their Effects on Pratylenchus zeae Infestation of Maize.
Jordaan, E M; De Waele, D
1988-10-01
The host suitability of five of the most common weed species occurring in maize (Zea mays L.) fields in South Africa to Pratylenchus zeae was tested. Based on the number of nematodes per root unit, mealie crotalaria (Crotalaria sphaerocarpa) was a good host; goose grass (Eleusine indica), common pigweed (Amaranthus hybridus), and thorn apple (Datura stramonium) were moderate hosts; and khaki weed (Tagetes minuta) was a poor host. Only the root residues of khaki weed suppressed the P. zeae infestation of subsequently grown maize. When goose grass, khaki weed, and mealie crotalaria were grown in association with maize in soil infested with P. zeae, goose grass and khaki weed severely suppressed maize root development; this resulted in a low number of nematodes per maize root system and a high number of nematodes per maize root unit. Mealie crotalaria did not restrict maize root growth and did not affect nematode densities per maize root system or maize root unit. Special attention should be given to the control of mealie crotalaria, which is a good host for P. zeae, and goose grass, which, in addition to its ability to compete with maize, is also a suitable host for P. zeae.
The influence of farmers\\' adoption behaviour on maize production ...
African Journals Online (AJOL)
This study was therefore designed to determine the contribution of farmers\\' adoption of recommended maize production practices, namely maize varieties, seed spacing, fertilization and weeding on production efficiency in order to assess the soundness of the advice given to farmers. The research was conducted in the ...
Intraplant communication in maize contributes to defense against insects
The vasculature of plants act as a channel for transport of signal(s) that facilitate long-distance intraplant communication. In maize, Maize insect resistance1-Cysteine Protease (Mir1-CP), which has homology to papain-like proteases, provides defense to different feeding guilds of insect pests. Fur...
Performance and Energy Metabolism by Broiler Chickens Fed Maize ...
African Journals Online (AJOL)
Studies were conducted to evaluate the effect of replacing maize grain with different dietary levels of maize and millet offals on performance and energy metabolism in broiler chickens. Proximate composition and metabolizable energy (ME) values were determined. Feeding trial was also conducted to comparemaize and ...
Water requirements for wheat and maize under climate change in North Nile Delta
Directory of Open Access Journals (Sweden)
Samiha Ouda
2015-03-01
Full Text Available Determination of water requirements for wheat and maize under climate change is important for policy makers in Egypt. The objectives of this paper were to calculate (i ETo and (ii water requirements for wheat and maize crops grown in five governorates (Alexandria, Demiatte, Kafr El-Sheik, El-Dakahlia and El-Behira located in North Nile Delta of Egypt under current climate and climate change. ECHAM5 climate model was used to develop A1B climate change scenario in 2020, 2030 and 2040. Monthly values of evapotranspiration (ETo under the different scenarios in these governorates were calculated using Hargreaves-Samani equation (H-S. Then, these values were regressed on ETo values previously calculated by Penman-Monteith equation (P-M and linear regression (prediction equations were developed for each governorate. The predicted ETo values were compared to the values of ETo calculated by P-M equation and the deviations between them were very low (RMSE/obs=0.04-0.06 mm and R2 =0.96-0.99. Water requirements for wheat and maize were calculated using BISm model under current climate and in 2020, 2030 and 2040. The results showed that average annual ETo would increase by low percentage in 2020 and 2030. However, in 2040 the increase would reach 8%. Water requirements are expected to increase by 2-3% for wheat and by 10-15% for maize, which would result in reduction of the cultivated area. Thus, it is very important to revise and fix the production system of wheat and maize, in terms of the used cultivars, fertilizer and irrigation application to overcome the risk of climate change. Additional key words: Triticum spp; Zea mays; Penman-Monteith equation; Hargreaves-Samani equation; BISm model; ECHAM5 climate model; A1B climate change scenario. Abbreviations used: BISm (basic irrigation scheduling model; CCAFS (Climate Change, Agriculture and Food Security; ETo (evapotranspiration; H-S (Hargreaves & Samani; Kc (crop coefficient; PI (percentage of increase; P
Energy Technology Data Exchange (ETDEWEB)
Szemere, G. (Orvostudomanyi Egyetem, Szeged (Hungary). Orvosbiologiai Intezet)
1982-01-01
Metaphase II cells with unequal dyad-arms and obvious X/autosomal rearrangements were found after an exposure to X-rays (2 Gy) of male mice at different stages of meiosis (pachytene, diplotene and diakinesis) with a frequency of 0.2, 1.26 and 0.6%, respectively, giving a direct cytological evidence of structural chromosomal rearrangements in metaphase II cells, partly with autosomal and partly with X/autosomal partners.
International Nuclear Information System (INIS)
Szemere, G.
1982-01-01
Metaphase II cells with unequal dyad-arms and obvious X/autosomal rearrangements were found after an exposure to X-rays (2 Gy) of male mice at different stages of meiosis (pachytene, diplotene and diakinesis) with a frequency of 0.2, 1.26 and 0.6%, respectively, giving a direct cytological evidence of structural chromosomal rearrangements in metaphase II cells, partly with autosomal and partly with X/autosomal partners. (author)
Edwards, Michael C; Weiland, John J; Todd, Jane; Stewart, Lucy R; Lu, Shunwen
2016-04-01
Maize rayado fino virus (MRFV) possesses an open reading frame (ORF43) predicted to encode a 43 kDa protein (p43) that has been postulated to be a viral movement protein. Using a clone of MRFV (pMRFV-US) from which infectious RNA can be produced, point mutations were introduced to either prevent initiation from three potential AUG initiation codons near the 5'-end of ORF43 or prematurely terminate translation of ORF43. Inoculation of maize seed via vascular puncture inoculation (VPI) resulted in plants exhibiting symptoms typical of MRFV infection for all mutants tested. Furthermore, corn leafhoppers (Dalbulus maidis) transmitted the virus mutants to healthy plants at a frequency similar to that for wild-type MRFV-US. Viral RNA recovered from plants infected with mutants both prior to and after leafhopper transmission retained mutations blocking ORF43 expression. The results indicate that ORF43 of MRFV is dispensable for both systemic infection of maize and transmission by leafhoppers.
A study on mutations in plants caused by ion implantation
International Nuclear Information System (INIS)
Lu Ting; Xie Liqing
1991-01-01
Seeds of maize, rice, barley, rye, wheat, soybean, pansy and petunia are irradiated by ion beam. Variations in germination percentage, growth speed and plant type are found. The degree and type of variation are different between species and varieties. In the observation of chromosomes, behaviours of chromosomes are normal in mitoses, but abnormal in some mitoses. Univalent, trivalent and tetravalent in PMCs of maize, backward chromosomes in PMNs of soybean and micro nucleoli in PMNCs of rice are found. The currents, Characters and prospects of radiation mutation induced by ion beam are discussed
Effect of Spatial Arrangement on Growth and Yield of Cowpea in a Cowpea-maize Intercrop
Ocaya, CP.; Adipala, E.; Osiru, DSO.
2001-01-01
Cowpea growth and yield performance when intercropped with maize was studied for 3 consecutive seasons under three spatial arrangements, i. e., maize planted at 90 x 30, 100 x 27, and 120 x 22.5 cm, with 2 rows of cowpea between the maize rows. Growth and yield of cowpea was improved significantly by widening maize intra-row distances as compared to the 90 x 30 cm spacing. Hence, intercropped cowpea needs to be sown where maize rows are wide apart, but the maize rows should not be too wide as...
Energy Technology Data Exchange (ETDEWEB)
Martienssen, Robert
2001-12-01
The classical maize mutant iojap (Iodent japonica) has variegated green and white leaves. Green sectors have cells with normal chloroplasts whereas white sectors have cells where plastids fail to differentiate. These mutant plastids, when transmitted through the female gametophyte, do not recover in the presence of wild type Iojap. We cloned the Ij locus, and we have investigated the mechanism of epigenetic inheritance and phenotypic expression. More recently, a modifier of this type of variegation, ''Inhibitor of striate'', has also been cloned. Both the iojap and inhibitor of striate proteins have homologs in bacteria and are members of ancient conserved families found in multiple species. These tools can be used to address fundamental questions of inheritance and variegation associated with this classical conundrum of maize genetics. Since the work of Rhoades there has been considerable speculation concerning the nature of the Iojap gene product, the origin of leaf variegation and the mechanism behind the material inheritance of defective plastids. This has made Iojap a textbook paradigm for cytoplasmic inheritance and nuclear-organellar interaction for almost 50 years. Cloning of the Iojap gene in maize, and homologs in other plants and bacteria, provides a new means to address the origin of heteroplastidity, variegation and cytoplasmic inheritance in higher plants.
Directory of Open Access Journals (Sweden)
Chuanliang Deng
Full Text Available In this study, chromosome painting was developed and used to identify alien chromosomes in TAi-27, a wheat--Thinopyrum intermedium addition line, and the chromosomes of the three different genomes of Th. Intermedium. The smallest alien chromosome of TAi-27 was microdissected and its DNA amplified by DOP-PCR was used as a probe to hybridize with metaphase chromosomes of TAi-27 and Th. intermedium. Results showed that hybridization signals were observed in all regions of a pair of the smallest alien chromosomes and the pericentromeric area of another pair of alien chromosomes in TAi-27, indicating that the probe from microdissected chromosome is species specific. In Th. intermedium, 14 chromosomes had wide and strong hybridization signals distributed mainly on the pericentromere area and 9 chromosomes with narrow and weak signals on the pericentromere area. The remaining chromosomes displayed a very weak or no signal. Sequential FISH/GISH on Th. intermedium chromosomes using the DNAs of microdissected chromosome, Pseudoroegneria spicata (St genome and pDbH12 (a J(s genome specific probe as the probes indicated that the microdissected chromosome belonged to the St genome, three genomes (J(s , J and St in Th. intermedium could be distinguished, in which there is no hybridization signal on J genome that is similar to the genome of Th. bessarabicum. Our results showed that the smallest alien chromosomes may represent a truncated chromosome and the repetitive sequence distribution might be similar in different chromosomes within the St genome. However, the repetitive sequence distributions are different within the J(s genome, within a single chromosome, and among different genomes in Th. intermedium. Our results suggested that chromosome painting could be feasible in some plants and useful in detecting chromosome variation and repetitive sequence distribution in different genomes of polyploidy plants, which is helpful for understanding the evolution of
Mortality and reproduction of Sitophilus zeamais Mots. on irradiated macaroni and maize
International Nuclear Information System (INIS)
Wiendl, F.M.
1975-11-01
Maize weevils, Sitophilus zeamais Mots. were reared on irradiated macaroni and maize. Diets were treated with dosages of O (control), 20, 100, 500 and 1500 Krad of gamma radiation from a Cobalt 60 gamma source, with a supplementary doses of 5000 Krad on maize. The parent generation was checked for mortality and fecundity. The analysis of results indicated decrease of longevity on diets used. Also it could be observed that on maize, the doses of 100 Krad caused an increase of progeny, with no effects on other dosages
Physiological and molecular analysis of selected Kenyan maize lines for aluminum tolerance
Aluminum (Al) toxicity is an important limitation to maize production in many tropical and sub-tropical acid soil areas. The aim of this study was to survey the variation in Al tolerance in a panel of maize lines adapted for Kenya and look for novel sources of Al tolerance. 112 Kenyan maize accessio...
Burgerhout, W G; Smit, S L; Jongsma, A P
1977-01-01
The position of genes coding for PGD, PPH1, UGPP, GuK1, PGM1, Pep-C, and FH on human chromosome 1 was investigated by analysis of karyotype and enzyme phenotypes in man-Chinese hamster somatic cell hybrids carrying aberrations involving chromosome 1. Suitable hybrid cell lines were obtained by X-irradiation of hybrid cells carrying an intact chromosome 1 and by fusion of human cells from a clonal population carrying a translocation involving chromosome 1 with Chinese hamster cells. The latter human cell population had been isolated following X-irradiation of primary Lesch-Nyhan fibroblasts. In addition, products of de novo chromosome breakage in the investigated hybrid lines were utilized. By integrating the results of these analyses with earlier findings in our laboratory, the following positions of genes are deduced: PGD and PPH1 in 1p36 leads to 1p34; PGM1 in 1p32; UGPP in 1q21 leads to 1q23; GuK1 in 1q31 leads to 1q42; Pep-C in 1q42; and FH in 1qter leads to 1q42.
Pure chromosome-specific PCR libraries from single sorted chromosomes
VanDevanter, D. R.; Choongkittaworn, N. M.; Dyer, K. A.; Aten, J. A.; Otto, P.; Behler, C.; Bryant, E. M.; Rabinovitch, P. S.
1994-01-01
Chromosome-specific DNA libraries can be very useful in molecular and cytogenetic genome mapping studies. We have developed a rapid and simple method for the generation of chromosome-specific DNA sequences that relies on polymerase chain reaction (PCR) amplification of a single flow-sorted
Induced cytomictic diversity in maize (Zea mays L.) inbred.
Rai, Prashant Kumar; Kumar, Girjesh; Tripathi, Avinash
2010-01-01
Mutation breeding has been used for improving oligogenic and polygenic characters, disease resistance and quantitative characters including yielding ability. The cytological stability of maize inbred lines is an important consideration in view of their extensive use in genetics and plant breeding research. Investigation in Zea mays L. confirms that the migration of chromosomes is a real event that cannot be misunderstood as an artifact produced by fixation or mechanical injuries. During present investigation, we found that out of six inbred lines of Zea mays L. viz. CM-135, CM-136, CM-137, CM-138, CM-142 and CM-213 at various treatment doses of gamma irradiations viz. 200, 400 and 600 Gy, some of the plants of inbred line CM- 138 at 200 Gy dose displayed characteristic cytoplasmic connections during all the stages of meiosis. Four plants from this treatment set were found to be engaged in a rare phenomenon reported as "Cytomixis". It elucidates that in inbred of Zea mays L., induced cytomixis through gamma rays treatment may be considered to be a possible source of production of aneuploid and polyploid gametes. This phenomenon may have several applications in Zea mays L. improvement in the sense of diversity and ever yield potential.
Inadvertent presence of genetically modified elements in maize food ...
African Journals Online (AJOL)
Kenya has a biosafety law and has tested genetically modified (GM) maize under confinement and containment, but has neither released nor commercialized any GM crop. This study assessed various maize food products from the Kenyan farms and markets for the inadvertent presence of GMOs. It assessed the possibility ...
Yield advantage and water saving in maize/pea intercrop
Mao, L.; Zhang, L.; Li, W.; Werf, van der W.; Sun, J.; Spiertz, J.H.J.; Li, L.
2012-01-01
Intercropping is a well-established strategy for maximization of yield from limited land, but mixed results have been obtained as to its performance in terms of water use efficiency. Here, two maize/pea intercrop layouts were studied in comparison to sole maize and sole pea with and without plastic
Importance of husk covering on field infestation of maize by ...
African Journals Online (AJOL)
STORAGESEVER
2008-10-20
Oct 20, 2008 ... An experiment was conducted to determine the importance of husk covering on field infestation of maize by the maize ... high yielding plants with no consideration for resistance ..... provided financial support for the study.
Cremer, T; Cremer, C
2006-01-01
Part II of this historical review on the progress of nuclear architecture studies points out why the original hypothesis of chromosome territories from Carl Rabl and Theodor Boveri (described in part I) was abandoned during the 1950s and finally proven by compelling evidence forwarded by laser-uv-microbeam studies and in situ hybridization experiments. Part II also includes a section on the development of advanced light microscopic techniques breaking the classical Abbe limit written for readers with little knowledge about the present state of the theory of light microscopic resolution. These developments have made it possible to perform 3D distance measurements between genes or other specifically stained, nuclear structures with high precision at the nanometer scale. Moreover, it has become possible to record full images from fluorescent structures and perform quantitative measurements of their shapes and volumes at a level of resolution that until recently could only be achieved by electron microscopy. In part III we review the development of experiments and models of nuclear architecture since the 1990s. Emphasis is laid on the still strongly conflicting views about the basic principles of higher order chromatin organization. A concluding section explains what needs to be done to resolve these conflicts and to come closer to the final goal of all studies of the nuclear architecture, namely to understand the implications of nuclear architecture for nuclear functions.
Quality characteristics of bread produced from wheat, rice and maize flours.
Rai, Sweta; Kaur, Amarjeet; Singh, Baljit; Minhas, K S
2012-12-01
Rice (Oryza sativa) flour and maize (Zea mays) meal substitution in wheat (Triticum aestivum) flour, from 0 to 100% each, for the production of bread was investigated. The proximate analysis, pasting properties, bread making qualities of raw materials and sensory evaluation of the bread samples were determined. The pasting temperature increased with increased percentage of rice flour and maize meal. But the other pasting characters decreased with the higher proportion of rice flour. The baking absorption was observed to increase with higher level of maize meal but it decreased when level of rice flour was increased. Loaf weight (g) decreased with progressive increase in the proportion of maize meal but increased when rice flour incorporation was increased. Loaf volume, loaf height and specific volume decreased for progressively higher level of maize meal and rice flour. The sensory evaluation revealed that 25% replacement of wheat flour was found to be more acceptable than control sample.
Expression and characterization of a recombinant maize CK-2 alpha subunit
DEFF Research Database (Denmark)
Boldyreff, B; Meggio, F; Dobrowolska, G
1993-01-01
to support the immunological data also by biochemical and biophysical experiments the availability of a recombinant CK-2 alpha from maize was a prerequisite. A maize cDNA clone of maize CK-2 alpha was expressed in the bacterial strain BL21 (DE3). The recombinant protein was purified to homogeneity; its......CKIIB, one of the CK-2 like enzymes which have been isolated from maize, has been shown to be a monomeric enzyme that cross-reacts with anti CK-2 alpha specific antibodies suggesting a possible relationship between the two proteins (Dobrowolska et al. (1992) Eur. J. Biochem. 204, 299-303). In order...... molecular mass on one-dimensional SDS PAGE was estimated to be 36.5 kDa. The calculated molecular mass according to the amino acid composition is 39,228 Da (332 amino acids). The recombinant maize CK-2 alpha (rmCK-2 alpha) exhibited mostly the same properties as the recombinant human CK-2 alpha (rhCK-2...
Sotero-Caio, C G; Pieczarka, J C; Nagamachi, C Y; Gomes, A J B; Lira, T C; O'Brien, P C M; Ferguson-Smith, M A; Souza, M J; Santos, N
2011-01-01
Substantial effort has been made to elucidate karyotypic evolution of phyllostomid bats, mostly through comparisons of G-banding patterns. However, due to the limited number of G-bands in respective karyotypes and to the similarity of non-homologous bands, an accurate evolutionary history of chromosome segments remains questionable. This is the case for vampire bats (Desmodontinae). Despite several proposed homologies, banding data have not yet provided a detailed understanding of the chromosomal changes within vampire genera. We examined karyotype differentiation of the 3 species within this subfamily using whole chromosomal probes from Phyllostomus hastatus (Phyllostominae) and Carollia brevicauda (Carolliinae). Painting probes of P. hastatus respectively detected 22, 21 and 23 conserved segments in Diphylla ecaudata, Diaemus youngi, and Desmodus rotundus karyotypes, whereas 27, 27 and 28 were respectively detectedwith C. brevicauda paints. Based on the evolutionary relationships proposed by morphological and molecular data, we present probable chromosomal synapomorphies for vampire bats and propose chromosomes that were present in the common ancestor of the 5 genera analyzed. Karyotype comparisons allowed us to relate a number of conserved chromosomal segments among the 5 species, providing a broader database for understanding karyotype evolution in the family. 2010 S. Karger AG, Basel.
Productivity and profitability of maize-pumpkin mix cropping in Chitwan, Nepal
Shiva Chandra Dhakal; Punya Prasad Regmi; Resham Bahadur Thapa; Shrawan Kumar Sah; Dilli Bahadur Khatri-Chhetri
2015-01-01
The study was conducted to determine the productivity, profitability and resource use efficiency of maize-pumpkin mix crop production in Chitwan. The study used 53 maize-pumpkin mix crop adopting farmers from among 300 farmers adopting different pollinator friendly practices. Descriptive and statistical tools including Cobb-Douglas production function were used to analyze data, collected from structured interview schedule. The benefit cost ratio (1.58) indicates that maize-pumpkin mix croppin...
Differential expression of α-L-arabinofuranosidases during maize (Zea mays L.) root elongation.
Kozlova, Liudmila V; Gorshkov, Oleg V; Mokshina, Natalia E; Gorshkova, Tatyana A
2015-05-01
Specific α- l -arabinofuranosidases are involved in the realisation of elongation growth process in cells with type II cell walls. Elongation growth in a plant cell is largely based on modification of the cell wall. In type II cell walls, the Ara/Xyl ratio is known to decrease during elongation due to the partial removal of Ara residues from glucuronoarabinoxylan. We searched within the maize genome for the genes of all predicted α-L-arabinofuranosidases that may be responsible for such a process and related their expression to the activity of the enzyme and the amount of free arabinose measured in six zones of a growing maize root. Eight genes of the GH51 family (ZmaABFs) and one gene of the GH3 family (ZmaARA-I) were identified. The abundance of ZmaABF1 and 3-6 transcripts was highly correlated with the measured enzymatic activity and free arabinose content that significantly increased during elongation. The transcript abundances also coincided with the pattern of changes in the Ara/Xyl ratio of the xylanase-extractable glucuronoarabinoxylan described in previous studies. The expression of ZmaABF3, 5 and 6 was especially up-regulated during elongation although corresponding proteins are devoid of the catalytic glutamate at the proper position. ZmaABF2 transcripts were specifically enriched in the root cap and meristem. A single ZmaARA-I gene was not expressed as a whole gene but instead as splice variants that encode the C-terminal end of the protein. Changes in the ZmaARA-I transcript level were rather moderate and had no significant correlation with free arabinose content. Thus, elongation growth of cells with type II cell walls is accompanied by the up-regulation of specific and predicted α-L-arabinofuranosidase genes, and the corresponding activity is indeed pronounced and is important for the modification of glucuronoarabinoxylan, which plays a key role in the modification of the cell wall supramolecular organisation.
Hormonal responses during early embryogenesis in maize.
Chen, Junyi; Lausser, Andreas; Dresselhaus, Thomas
2014-04-01
Plant hormones have been shown to regulate key processes during embryogenesis in the model plant Arabidopsis thaliana, but the mechanisms that determine the peculiar embryo pattern formation of monocots are largely unknown. Using the auxin and cytokinin response markers DR5 and TCSv2 (two-component system, cytokinin-responsive promoter version #2), as well as the auxin efflux carrier protein PIN1a (PINFORMED1a), we have studied the hormonal response during early embryogenesis (zygote towards transition stage) in the model and crop plant maize. Compared with the hormonal response in Arabidopsis, we found that detectable hormone activities inside the developing maize embryo appeared much later. Our observations indicate further an important role of auxin, PIN1a and cytokinin in endosperm formation shortly after fertilization. Apparent auxin signals within adaxial endosperm cells and cytokinin responses in the basal endosperm transfer layer as well as chalazal endosperm are characteristic for early seed development in maize. Moreover, auxin signalling in endosperm cells is likely to be involved in exogenous embryo patterning as auxin responses in the endosperm located around the embryo proper correlate with adaxial embryo differentiation and outgrowth. Overall, the comparison between Arabidopsis and maize hormone response and flux suggests intriguing mechanisms in monocots that are used to direct their embryo patterning, which is significantly different from that of eudicots.
Weed Dynamics during Transition to Conservation Agriculture in Western Kenya Maize Production.
Directory of Open Access Journals (Sweden)
Judith A Odhiambo
Full Text Available Weed competition is a significant problem in maize (Zea mays, L. production in Sub-Saharan Africa. Better understanding of weed management and costs in maize intercropped with beans (Phaseolus vulgaris, L. during transition to conservation agricultural systems is needed. Changes in weed population and maize growth were assessed for a period of three years at Bungoma where crops are grown twice per year and at Trans-Nzoia where crops are grown once per year. Treatments included three tillage practices: minimum (MT, no-till (NT and conventional (CT applied to three cropping systems: continuous maize/bean intercropping (TYPICAL, maize/bean intercropping with relayed mucuna after bean harvest (RELAY and maize, bean and mucuna planted in a strip intercropping arrangement (STRIP. Herbicides were used in NT, shallow hand hoeing and herbicides were used in MT and deep hoeing with no herbicides were used in CT. Weed and maize performance in the maize phase of each cropping system were assessed at both locations and costs of weed control were estimated at Manor House only. Weed density of grass and forb species declined significantly under MT and NT at Manor House and of grass species only at Mabanga. The greatest declines of more than 50% were observed as early as within one year of the transition to MT and NT in STRIP and TYPICAL cropping systems at Manor House. Transitioning to conservation based systems resulted in a decline of four out of five most dominant weed species. At the same time, no negative impact of MT or NT on maize growth was observed. Corresponding costs of weed management were reduced by $148.40 ha(-1 in MT and $149.60 ha(-1 in NT compared with CT. In conclusion, farmers can benefit from effective and less expensive weed management alternatives early in the process of transitioning to reduced tillage operations.
Weed Dynamics during Transition to Conservation Agriculture in Western Kenya Maize Production.
Odhiambo, Judith A; Norton, Urszula; Ashilenje, Dennis; Omondi, Emmanuel C; Norton, Jay B
2015-01-01
Weed competition is a significant problem in maize (Zea mays, L.) production in Sub-Saharan Africa. Better understanding of weed management and costs in maize intercropped with beans (Phaseolus vulgaris, L.) during transition to conservation agricultural systems is needed. Changes in weed population and maize growth were assessed for a period of three years at Bungoma where crops are grown twice per year and at Trans-Nzoia where crops are grown once per year. Treatments included three tillage practices: minimum (MT), no-till (NT) and conventional (CT) applied to three cropping systems: continuous maize/bean intercropping (TYPICAL), maize/bean intercropping with relayed mucuna after bean harvest (RELAY) and maize, bean and mucuna planted in a strip intercropping arrangement (STRIP). Herbicides were used in NT, shallow hand hoeing and herbicides were used in MT and deep hoeing with no herbicides were used in CT. Weed and maize performance in the maize phase of each cropping system were assessed at both locations and costs of weed control were estimated at Manor House only. Weed density of grass and forb species declined significantly under MT and NT at Manor House and of grass species only at Mabanga. The greatest declines of more than 50% were observed as early as within one year of the transition to MT and NT in STRIP and TYPICAL cropping systems at Manor House. Transitioning to conservation based systems resulted in a decline of four out of five most dominant weed species. At the same time, no negative impact of MT or NT on maize growth was observed. Corresponding costs of weed management were reduced by $148.40 ha(-1) in MT and $149.60 ha(-1) in NT compared with CT. In conclusion, farmers can benefit from effective and less expensive weed management alternatives early in the process of transitioning to reduced tillage operations.
Wang, P Jeremy; Page, David C
2002-09-15
TAF(II)250, the largest subunit of the general transcription factor TFIID, is expressed from the human X chromosome, at least in somatic cells. In male meiosis, however, the sex chromosomes are transcriptionally silenced, while the autosomes remain active. How then are protein-encoding genes transcribed during human male meiosis? Here we present a novel autosomal human gene, TAF1L, which is homologous to TAF(II)250 and is expressed specifically in the testis, apparently in germ cells. We hypothesize that during male meiosis, transcription of protein-encoding genes relies upon TAF1L as a functional substitute for TAF(II)250. Like TAF(II)250, the human TAF1L protein can bind directly to TATA-binding protein, an essential component of TFIID. Most importantly, transfection with human TAF1L rescued the temperature-sensitive lethality of a hamster cell line mutant in TAF(II)250. TAF1L lacks introns and evidently arose by retroposition of a processed TAF(II)250 mRNA during primate evolution. The observation that TAF1L can functionally replace TAF(II)250 provides experimental support for the hypothesis that during male meiosis, autosomes provide cellular functions usually supplied by the X chromosome in somatic cells.
Aflatoxin variations in maize flour and grains collected from various ...
African Journals Online (AJOL)
In Kenya, maize remains an important staple food in every household. ... upper limit is 10ppb, indicating good manufacturing practices (GMP) by the millers. ... In summary, the study found aflatoxin contamination in maize grains especially in ...
Narrowing Maize Yield Gaps Under Rain-fed conditions in Tanzania ...
African Journals Online (AJOL)
Abstract. The wide gap between potential and actual yields of maize in Tanzania, due low productivity is the major constraint to ... An International Journal of Basic and Applied Research ... for determining maize grain yield followed by water.
Directory of Open Access Journals (Sweden)
M Madadizadeh
2017-10-01
Full Text Available Introduction Nitrogen is one of the most abundant elements on earth and major essential for crop growth and development that is heavily used in modern agriculture to maximize yields. Among cereals, maize (Zea mays L. is an important food and feed crop which ranks third after wheat and rice in the world. As N fertilizer costs remain relatively high and environmental concerns over excessive N application increase, the objectives of the present study were: (i to compare maize hybrids growth and yield responses to N rates, (ii to determine optimum N rate for maize grain yield production, (iii to explore the physiological functions controlling maize growth and yield and (iv to identify more effective physiological indices in maize grain production under N stress as well as potential condition. Materials and Methods Two field experiments were conducted in 2014 and 2015 at the Experimental Field of Kerman Agricultural and Natural Resources Research Center, Kerman, Iran. The experiment was laid out as a randomized complete block design with factorial arrangement of treatments and three replications. Four nitrogen rates (0, 92, 220 and 368 kg N ha-1 were applied to three maize hybrids (KSC 704, Maxima and TWC 604. Statistical analysis was done using SAS software (version 9.4. Results and Discussion Due to a significant lack of homogeneity of variance across the two years, data from the two years were treated as independent experiments and analyzed separately. Results showed that both N rates and hybrids had significant effect on growth indices and maize grain yield. The interaction between genotype and N rate was significant for grain yield in 2015 (P < 0.01. Thus, physical slicing was used to do mean comparison. Results showed that KSC 704 and Maxima had quite similar responses to N rates and with an increase in N fertilization, their grain yield also increased. This response, however, was different in case of TWC 604 so that 92 kg N ha-1 showed maximum
Jégu, Teddy; Aeby, Eric; Lee, Jeannie T
2017-06-01
Extensive 3D folding is required to package a genome into the tiny nuclear space, and this packaging must be compatible with proper gene expression. Thus, in the well-hierarchized nucleus, chromosomes occupy discrete territories and adopt specific 3D organizational structures that facilitate interactions between regulatory elements for gene expression. The mammalian X chromosome exemplifies this structure-function relationship. Recent studies have shown that, upon X-chromosome inactivation, active and inactive X chromosomes localize to different subnuclear positions and adopt distinct chromosomal architectures that reflect their activity states. Here, we review the roles of long non-coding RNAs, chromosomal organizational structures and the subnuclear localization of chromosomes as they relate to X-linked gene expression.
Preceramic maize from Paredones and Huaca Prieta, Peru.
Grobman, Alexander; Bonavia, Duccio; Dillehay, Tom D; Piperno, Dolores R; Iriarte, José; Holst, Irene
2012-01-31
Maize (Zea mays ssp. mays) is among the world's most important and ancient domesticated crops. Although the chronology of its domestication and initial dispersals out of Mexico into Central and South America has become more clear due to molecular and multiproxy archaeobotanical research, important problems remain. Among them is the paucity of information on maize's early morphological evolution and racial diversification brought about in part by the poor preservation of macrofossils dating to the pre-5000 calibrated years before the present period from obligate dispersal routes located in the tropical forest. We report newly discovered macrobotanical and microbotanical remains of maize that shed significant light on the chronology, land race evolution, and cultural contexts associated with the crop's early movements into South America and adaptation to new environments. The evidence comes from the coastal Peruvian sites of Paredones and Huaca Prieta, Peru; dates from the middle and late preceramic and early ceramic periods (between ca. 6700 and 3000 calibrated years before the present); and constitutes some of the earliest known cobs, husks, stalks, and tassels. The macrobotanical record indicates that a diversity of racial complexes characteristic of the Andean region emerged during the preceramic era. In addition, accelerator mass spectrometry radiocarbon determinations carried out directly on different structures of preserved maize plants strongly suggest that assays on burned cobs are more reliable than those on unburned cobs. Our findings contribute to knowledge of the early diffusion of maize and agriculture and have broader implications for understanding the development of early preindustrial human societies.
The parental origin of the extra X chromosome in 47,XXX females.
May, K M; Jacobs, P A; Lee, M; Ratcliffe, S; Robinson, A; Nielsen, J; Hassold, T J
1990-01-01
We used X-linked DNA polymorphisms to study the parental origin of X chromosome nondisjunction in 28 47,XXX live-born females. Errors in oogenesis accounted for 26 of the cases, with the majority of these being attributable to an error at meiosis I. We observed an association between advanced parental age and meiosis I nondisjunction--but not meiosis II nondisjunction--in the maternally derived cases. In studies of recombination we found little evidence for an association between pairing failure and X chromosome nondisjunction, but our results suggest that increased recombination near the centromere may play a role in the etiology of the 47,XXX condition. Images Figure 1 Figure 2 PMID:2316522
Combining ability for maize grain yield and other agronomic ...
African Journals Online (AJOL)
Field experiments were conducted at the University of Ilorin Teaching and Research Farm in 2005 and 2006 cropping seasons with the objective to evaluate the combining ability for maize grain yield and other agronomic characters in 10 open pollinated maize varieties, which have been selected for high yield and stress ...
Studies on biochemical changes in maize wastes fermented with ...
African Journals Online (AJOL)
In an attempt to transform the agricultural waste products of maize cobs and shafts into useful products such as animal feeds and reduce the pollution effects of these wastes during maize seasons, they were fermented using Aspergillus niger for 72 hours. The fermented residues were analyzed with regard to proximate ...
Classification of maize kernels using NIR hyperspectral imaging
DEFF Research Database (Denmark)
Williams, Paul; Kucheryavskiy, Sergey V.
2016-01-01
NIR hyperspectral imaging was evaluated to classify maize kernels of three hardness categories: hard, medium and soft. Two approaches, pixel-wise and object-wise, were investigated to group kernels according to hardness. The pixel-wise classification assigned a class to every pixel from individual...... and specificity of 0.95 and 0.93). Both feature extraction methods can be recommended for classification of maize kernels on production scale....
Directory of Open Access Journals (Sweden)
Jayaraman Aravind
2017-06-01
Full Text Available MicroRNA-mediated gene regulation plays a crucial role in controlling drought tolerance. In the present investigation, 13 drought-associated miRNA families consisting of 65 members and regulating 42 unique target mRNAs were identified from drought-associated microarray expression data in maize and were subjected to structural and functional characterization. The largest number of members (14 was found in the zma-miR166 and zma-miR395 families, with several targets. However, zma-miR160, zma-miR390, zma-miR393, and zma-miR2275 each showed a single target. Twenty-three major drought-responsive cis-regulatory elements were found in the upstream regions of miRNAs. Many drought-related transcription factors, such as GAMYB, HD-Zip III, and NAC, were associated with the target mRNAs. Furthermore, two contrasting subtropical maize genotypes (tolerant: HKI-1532 and sensitive: V-372 were used to understand the miRNA-assisted regulation of target mRNA under drought stress. Approximately 35 and 31% of miRNAs were up-regulated in HKI-1532 and V-372, respectively. The up-regulation of target mRNAs was as high as 14.2% in HKI-1532 but was only 2.38% in V-372. The expression patterns of miRNA-target mRNA pairs were classified into four different types: Type I- up-regulation, Type II- down-regulation, Type III- neutral regulation, and Type IV- opposite regulation. HKI-1532 displayed 46 Type I, 13 Type II, and 23 Type III patterns, whereas V-372 had mostly Type IV interactions (151. A low level of negative regulations of miRNA associated with a higher level of mRNA activity in the tolerant genotype helped to maintain crucial biological functions such as ABA signaling, the auxin response pathway, the light-responsive pathway and endosperm expression under stress conditions, thereby leading to drought tolerance. Our study identified candidate miRNAs and mRNAs operating in important pathways under drought stress conditions, and these candidates will be useful in the
Genetic variation of european maize genotypes (zea mays l. Detected using ssr markers
Directory of Open Access Journals (Sweden)
Martin Vivodík
2017-01-01
Full Text Available The SSR molecular markers were used to assess genetic diversity in 40 old European maize genotypes. Ten SSR primers revealed a total of 65 alleles ranging from 4 (UMC1060 to 8 (UMC2002 and UMC1155 alleles per locus with a mean value of 6.50 alleles per locus. The PIC values ranged from 0.713 (UMC1060 to 0.842 (UMC2002 with an average value of 0.810 and the DI value ranged from 0.734 (UMC1060 to 0.848 (UMC2002 with an average value of 0.819. 100% of used SSR markers had PIC and DI values higher than 0.7 that means high polymorphism of chosen markers used for analysis. Probability of identity (PI was low ranged from 0.004 (UMC1072 to 0.022 (UMC1060 with an average of 0.008. A dendrogram was constructed from a genetic distance matrix based on profiles of the 10 maize SSR loci using the unweighted pair-group method with the arithmetic average (UPGMA. According to analysis, the collection of 40 diverse accessions of maize was clustered into four clusters. The first cluster contained nine genotypes of maize, while the second cluster contained the four genotypes of maize. The third cluster contained 5 maize genotypes. Cluster 4 contained five genotypes from Hungary (22.73%, two genotypes from Poland (9.10%, seven genotypes of maize from Union of Soviet Socialist Republics (31.81%, six genotypes from Czechoslovakia (27.27%, one genotype from Slovak Republic (4.55% and one genotype of maize is from Yugoslavia (4.55%. We could not distinguish 4 maize genotypes grouped in cluster 4, (Voroneskaja and Kocovska Skora and 2 Hungarian maize genotypes - Feheres Sarga Filleres and Mindszentpusztai Feher, which are genetically the closest.
Foraging in maize field areas: A risky business?
Boily, Monique; Aras, Philippe; Jumarie, Catherine
2017-12-01
In Quebec, Canada, the cultivation of maize dominates the agricultural territory. This crop requires a sustained supply of fertilizers from different sources: chemical, natural or from residual materials (sludge). These amendments contain metallic trace elements, which may lead to metal-contaminated maize pollen, a possible source of prooxidants for the foraging bees. Our objective was to determine whether maize fields environment influences the oxidation processes and the accumulation of metals in bees. A few days prior to pollen shedding, beehives were installed in maize fields: one organically grown (site A) and three conventionally grown (sites B, C and D). Soil, maize pollen and bees were analyzed for metal content. Every 15days, bees were collected and analyzed for peroxidation of lipids, metallothionein-like proteins (MTLPs), proteins, retinoids and lipophilic antioxidants (carotenoids and α-tocopherol). The compound β-carotene was the most abundant in bees from all sites, followed by α-carotene, β-cryptoxanthin, α-cryptoxanthin, zeaxanthin and lutein. Retinaldehyde and retinol varied according to times and sites without demonstrating clear trends. However, significant differences between sites were noted in 13-cis-retinoic acid and two retinoic acid metabolites measured in bees, suggesting alteration in the reduction-oxidation processes. In line with these results, the level of lipid peroxidation was globally higher in sites B, C and D compared with the organic site. Higher concentrations of metals were observed in soil and pollen from the field A, but bees metal contents were equal or less than those measured in bees from other sites. Higher bee MTLP levels were measured in sites B, C and D. For most sampling times, the discriminant analysis revealed that the conditions were distinguished by the oxidation processes in bees. Our data suggest that bees foraging in conventionally grown maize fields are at risk of increased oxidative damages which can
Subchronic feeding study of DAS-59122-7 maize grain in Sprague-Dawley rats.
Malley, Linda A; Everds, Nancy E; Reynolds, Julia; Mann, Peter C; Lamb, Ian; Rood, Tracy; Schmidt, Jean; Layton, Raymond J; Prochaska, Lee M; Hinds, Mark; Locke, Mary; Chui, Chok-Fun; Claussen, Fred; Mattsson, Joel L; Delaney, Bryan
2007-07-01
59122 is a transgenic maize line containing event DAS-59122-7 that expresses the corn rootworm (CRW) specific pesticidal Cry34Ab1 and Cry35Ab1 proteins from Bacillus thuringiensis (Bt) Berliner strain PS149B1 and the phosphinothricin-N-acetyltransferase (PAT) protein from Streptomyces viridochromogenes for tolerance to the herbicidal ingredient glufosinate-ammonium. For the current study, 59122 maize grain, non-transgenic near-isogenic maize grain (091), and a commercially available non-transgenic reference maize grain (33R77) were grown under conditions simulating commercial farming practices. Adult Sprague-Dawley rats (12/sex/group) were fed diets formulated with 35% maize grain from either 59122, 091, or 33R77, or one of two separate lots of commercially available rodent chow prepared with commercially available corn (35%) in accordance with the standards of Purina Mills Labdiet 5002 for approximately 90 days. All diets possessed similar nutritional and contaminant profiles. The transgenic proteins were detected only in diets prepared with 59122 maize grain and were stable over the course of the study. Compared to control groups, no adverse diet-related differences were observed in rats fed diets formulated with 59122 maize grain with respect to body weight/gain, food consumption/efficiency, clinical signs of toxicity, mortality, ophthalmology, neurobehavioral (FOB and motor activity) assessments, clinical pathology (hematology, clinical chemistry, coagulation, and urinalysis), and pathology (organ weights and gross and microscopic pathology). Results from this study indicate that 59122 maize grain is nutritionally equivalent to and as safe as conventional maize grain.
New Y chromosomes and early stages of sex chromosome ...
Indian Academy of Sciences (India)
2010-09-06
Sep 6, 2010 ... chromosomes are evolutionary consequences of that func- tion. Given sufficient ... (for a review, see Charlesworth et al. 2005). ... In the present paper, I review sex deter- mination .... part had apparently been exchanged against the homologous ... age group III-Y chromosomes were successful while in well-.
Temperatures and the growth and development of maize and rice
DEFF Research Database (Denmark)
Sánchez, Berta; Rasmussen, Anton; Porter, John Roy
2014-01-01
and maize crop responses to temperature in different, but consistent, phenological phases and development stages. A literature review and data compilation of around 140 scientific articles have determined the key temperature thresholds and response to extreme temperature effects for rice and maize...... defined in all three crops. Anthesis and ripening are the most sensitive temperature stages in rice as well as in wheat and maize. We call for further experimental studies of the effects of transgressing threshold temperatures so such responses can be included into crop impact and adaptation models....
Jeske, Y W A; So, A; Kelemen, L; Sukor, N; Willys, C; Bulmer, B; Gordon, R D; Duffy, D; Stowasser, M
2008-04-01
1. There are two types of familial hyperaldosteronism (FH): FH-I and FH-II. FH-I is caused by a hybrid CYP11B1/CYP11B2 gene mutation. The genetic cause of FH-II, which is more common, is unknown. Adrenal hyperplasia and adenomas are features. We previously reported linkage of FH-II to a approximately 5 Mb region on chromosome 7p22. We subsequently reported finding no causative mutations in the retinoblastoma-associated Kruppel-associated box gene (RBaK), a candidate at 7p22 involved in tumorigenesis and cell cycle control. 2. In the current study we investigated RBaK regulatory regions and two other candidate genes: postmeiotic segregation increased 2 (PMS2, involved in DNA mismatch repair and tumour predisposition) and guanine nucleotide-binding protein alpha-12 (GNA12, a transforming oncogene). 3. The GNA12 and PMS2 genes were examined in two affected (A1, A2) and two unaffected (U1, U2) subjects from a large 7p22-linked FH-II family (family 1). No mutations were found. 4. The RBaK and PMS2 distal promoters were sequenced to -2150 bp from the transcription start site for RBaK and-2800 bp for PMS2. Five unreported single nucleotide polymorphisms (SNPs) were found in subjects A1, A2 but not in U1 or U2; A(-2031 bp)T, T(-2030 bp)G, G(-834 bp)C, C(-821 bp)G in RBaK and A(-876 bp)G in PMS2. Additional affected and unaffected subjects from family 1 and from two other 7p22-linked FH-II families and 58 unrelated normotensive control subjects were genotyped for these SNPs. 5. The five novel SNPs were found to be present in a significant proportion of normotensive controls. The four RBaK promoter SNPs were found to be in linkage disequilibrium in the normal population. The RBaK promoter (-)2031T/2030G/834C/821T allele was found to be in linkage disequilibrium with the causative mutation in FH-II family 1, but not in families 2 and 3. The PMS2 promoter (-)876G allele was also found to be linked to affected phenotypes in family 1. 6. The RBaK and PMS2 promoter SNPs alter the
Directory of Open Access Journals (Sweden)
MA Rahaman, MM Rahman, S Roy, M Ahmed, MS Bhuyan
2015-12-01
Full Text Available An experiment was conducted in charland at the Multi Location Testing (MLT site Bhuapur, Tangail during 2012-13 and 2013-14 under AEZ-8 to find out the suitable intercropping system of hybrid maize with different short duration vegetables with economic return. The experiment was laid out in RCB design with six dispersed (six farmers’ field replications. The hybrid maize (ver. BARI Hybrid maize-7, potato (Diamant, spinach (local, red amaranth (BARI Lalsak-1, Radish (BARI Mula-1 were used as the planting materials. Five treatment combinations viz. T1= Sole Maize, T2= 100% Maize (maize paired row + Potato (var. Diamant, T3= 100% Maize (maize paired row + Spinach (var. local, T4= 100% Maize (maize paired row + Red amaranth (var. BARI Lalshak-1 and T5= 100% Maize (Maize paired row + Radish (var. BARI Mula-1 were studied. Maize grain yield in intercropped combination varied from 5.59-7.62 t ha-1. But the highest grain yield (8.17 t ha-1 was obtained from sole maize. Maize equivalent yields in the intercrops situation ranged from 11.39-19.68 t ha-1 where highest maize equivalent yield 19.68 t ha-1 was recorded from the treatment T3 (100 % maize + spinach. The same combinations also gave highest gross return (Tk. 373930 ha-1 and gross margin (Tk. 258585 ha-1 as well as benefit cost ratio (3.24. Though highest grain yield was recorded from sole maize but equivalent yield and economic return was much lower than the treatment T3.
The Effect of Pollination on Cd Phytoextraction From Soil by Maize (Zea mays L.).
Xu, Wending; Lu, Guining; Wang, Rui; Guo, Chuling; Liao, Changjun; Yi, Xiaoyun; Dang, Zhi
2015-01-01
A pot experiment was conducted to investigate the effects of pollination on cadmium (Cd) phytoextraction from soil by mature maize plants. The results showed that the unpollinated maize plants accumulated 50% more Cd than that of the pollinated plants, even though the dry weight of the former plants was 15% less than that of the latter plants. The Cd accumulation in root and leaf of the unpollinated maize plant was 0.47 and 0.89 times higher than that of the pollinated plant, respectively. The Cd concentration in the cob was significantly decreased because of pollination. Preventing pollination is a promising approach for enhancing the effectiveness of phytoextraction in Cd-contaminated soils by maize. This study suggested that in low Cd-contaminated soil pollination should be encouraged because accumulation of Cd in maize grains is very little and maize seeds can bring farmers economic benefits, while in high Cd-contaminated soil, inhibition of pollination can be applied to enhance phytoextraction of Cd from soil by maize plant.
International Nuclear Information System (INIS)
Annoh, C. E
2003-01-01
Gy), the latter produced almost sterile individuals (96%, with doses above 100 Gy) In the F J generation, both fecundity and fertility were inversely related to increased doses of radiation. Crosses involving FJ males showed lower fertility than their corresponding FJ females Fertility was reduced to 10% with radiation dose of 100 Gy in the former, whilst similar reduction in F, females required about 150 Gy or more. The overall sex ratio of emerged adults in FJ and F2 generations shifted in favour of males. Thirty pairs of chromosomes were observed in normal meoitic gametes (metaphase I) of E. saccharina. Chromosomal aberrations resulting from induced radiations were found in the form of fragments, rings and chains In experimental field cages, moths treated with radiation dose of 150 Gy, resulted in decrease in fecundity and fertility of FJ generation when the ratios of sterile to fertile moths was increased Fecundity was reduced by 47% with rano of I sterile to I fertile and 79% with mating rano of 5 sterile to I fertile, as compared with the control of I fertile to I fertile. Since significant reduction in fecundity and fertility was observed with radiation doses between 120-180 Gy, it is suggested that this range could be used to induce inherited sterility in F saccharina. The substantial reduction of population of the borer species due to induced sterility in the progeny implies that inherited sterility could be used as a control strategy to suppress the stem borer populations in insect pest management programme in Ghana. Radio-sterilization study was conducted on the biology of two lepidopterous maize stem borers, Eldana saccharina Walker and Sesamia calamistis Hampson to induce inherited sterility for insect pest management programme in Ghana. Bioecology of the two borer species was also studied for a 3-year period, 1997-1999 at Medie, a predominantly maize growing community in the Ga District of Greater Accra Region, to determine the population dynamics and
Using 3-color chromosome painting to decide between chromosome aberration models
International Nuclear Information System (INIS)
Lucas, J.N.; Sachs, R.K.
1993-01-01
Ionizing radiation produces chromosome aberrations when DNA double strand breaks (DSB) interact pairwise. For more than 30 years there have been two main, competing theories of such binary DSB interactions. The classical theory asserts that an unrepaired DSB makes two ends which separate, with each end subsequently able to join any similar (non-telomeric) end. The exchange theory asserts that the two DSB ends remain associated until repair or a reciprocal chromosome exchange involving a second DSB occurs. The authors conducted an experiment to test these models, using 3-color chromosome painting. After in vitro irradiation of resting human lymphocytes, they observed cells with three-color triplets at first metaphase: three derivative chromosomes having permuted colors, as if three broken chromosomes had played musical chairs. On the exchange model in its standard form such 3-color triplets cannot occur. On the classical model the expected frequency can be calculated. They report data and computer calculations which exclude the exchange model and favor the classical model
NS maize hybrids in production regions of Serbia
Directory of Open Access Journals (Sweden)
Stojaković Milisav
2010-01-01
Full Text Available Fifteen NS maize hybrids of FAO 300-700 maturity groups were evaluated in strip trials (plot size 1,120 m2 at 30 locations in Serbia. In all locations including all production regions, the most yielding hybrid was NS 6030 with average yield of 10.9 t ha-1. The additive Main Effects and Multiplicative Interaction (AMMI and the sites regression (SREG models were used to study basic structure of G x E interactions and the possible existence of different mega-environments in Serbian maize growing regions in 2009. The results of the 15 hybrids x 10 locations for grain yield in maize showed by biplot technique indicate several specific location-hybrid deviations (the AMMI biplot, and possible existence of at least one mega-environment (the GGE biplot. .
Evaluating Terra MODIS Satellite Sensor Data Products for Maize ...
African Journals Online (AJOL)
Evaluating Terra MODIS Satellite Sensor Data Products for Maize Yield Estimation in South Africa. C Frost, N Thiebaut, T Newby. Abstract. The Free State Province of the Republic of South Africa contains some of the most important maize-producing areas in South Africa. For this reason this province has also been selected ...
design, construction and performance analysis of a maize thresher
African Journals Online (AJOL)
ES Obe
and evaluate a low cost maize sheller for rural farmers in Nigeria. ... between the human performance index for shelling and the machine .... maize in a mechanized system is the size of the ... factors are the design of the power transmis- .... and reliability in line with [11]). .... PGD thesis, Department of Mechanical En-.
Regeneration of Sudanese maize inbred lines and open pollinated ...
African Journals Online (AJOL)
STORAGESEVER
2008-06-03
Jun 3, 2008 ... Keywords: Sudanese maize genotypes, embryogenic callus, regeneration, and tissue culture. INTRODUCTION. Maize is an important food and forage crop in the North- ern and Southern regions of ... Skoog, 1965) containing 60 g l-1 sucrose and lacking 2,4-D (referred to as maturation or RI medium) and ...
Evaluating Terra MODIS Satellite Sensor Data Products for Maize ...
African Journals Online (AJOL)
Celeste
Maize plants mature on average from 120 to 165 days after planting. ... is a maize yield estimation timing model, developed using data from the ... The objective yields were surveyed and randomly selected from results of the stratified point ... are used in formulae (Frost, 2006) to derive plant population and a predicted ...
Early phosphorus nutrition, mycorrhizae development, dry matter partitioning and yield of maize
DEFF Research Database (Denmark)
Gavito, M.E.; Miller, M.H.
1998-01-01
to a mycorrhizal mycelium network (no-tillage treatments). Maize yield and harvest index were lower after cropping With canola. The yield for conventional tillage was higher than that for no-tillage but the harvest index was lower. The hypothesis was supported at early stages of maize growth by the effect...... was used with previous crop (Zea mays L.-maize and Brassica napus L.-canola), tillage practices (no-tillage or conventional tillage) and P fertilization (5 levels) as factors chosen to modify mycorrhizae development at early developmental stages of maize. Previous cropping with canola resulted in decreased......We conducted a field experiment to test the hypothesis that improved phosphorus nutrition occurs in maize plants with rapid arbuscular (AM) mycorrhizae development at early developmental stages and that this also is reflected in dry matter allocation and final yield. A split-split plot design...
Zaccaria, Alfonso; Valenti, Anna Maria; Donti, Emilio; Gozzetti, Alessandro; Ronconi, Sonia; Spedicato, Francesco
2007-04-01
Five Philadelphia chromosome positive (Ph+) chronic myeloid leukemia (CML) patients with additional chromosome abnormalities at diagnosis have been followed during Imatinib therapy. In all, the Ph chromosome disappeared, while the 5 cases, additional abnormalities [dup(1); del(5), +8 (2 patients) and +14] persisted in the subsequent studies, performed over a period of 11 to 49 months, either alone or together with a karyotypically normal cell population. This finding is consistent with a secondary origin of the Ph chromosome in these patients. It is still to early to evaluate the possible prognostic value of these additional abnormalities.
Heterosis expression in crosses between maize populations: ear yield
Directory of Open Access Journals (Sweden)
Silva Ricardo Machado da
2003-01-01
Full Text Available The phenomenon of heterosis has been exploited extensively in maize (Zea mays L. breeding. The objective of this study was to evaluate the genetic potential of ten maize populations for ear yield following the diallel mating scheme. Six parental populations were obtained through phenotypic selection of open-pollinated ears in Rio Verde, GO, Brazil, (GO populations and four parental populations were synthesized in Piracicaba, SP, Brazil (GN populations: GO-D (DENTADO, GO- F (FLINT, GO-A (AMARELO, GO-B (BRANCO, GO-L (LONGO, GO-G (GROSSO, GN-01, GN-02, GN-03 and GN-04. Experiments were carried out in three environments: Anhembi (SP and Rio Verde (GO in 1998/99 (normal season crop and Piracicaba (SP in 1999 (off-season crop. All experiments were in completely randomized blocks with six replications. Analysis of variance grouped over environments showed high significance for heterosis and its components, although mid-parent heterosis and average heterosis were of low expression. The interaction treatments x environments was not significant. Total mid-parent heterosis effects ranged from de -4.3% to 17.3% with an average heterosis of 3.37%. Population with the highest yield (7.4 t ha-1 and with the highest effect of population (v i = 0.746 was GN-03, while the highest yielding cross was GO-B x GN-03 with 7,567 t ha-1. The highest specific heterosis effect (s ii' = 0.547 was observed in the cross GO-B x GN-03.
Some aspects of cultivation and utilization of waxy maize (Zea mays L. ssp. ceratina
Directory of Open Access Journals (Sweden)
Agnieszka Klimek-Kopyra
2012-10-01
Full Text Available This paper is a review of available literature on Zea mays L.ssp.ceratina. It contains information on the origin, cul- tivation and utilization of waxy maize in the world and can be a contribution to the development of new research on maize cultivation and starch processing technology. Maize, as an old and economically important cereal, played an enormous role in the ancient civilisations of the New World. Among the maize subspecies compared, Z. mays ssp. indurata and Z. mays ssp. indentata are now the most important in Poland. The subspecies Z. mays ssp. saccharata has a marginal role, while Z. mays ssp. ceratina has not been hitherto cultivated. Decisions to introduce the subspecies Z. mays ssp. ceratina into cultivation are based on different grounds, taking into account both agro-climatic conditions and industrial uses of grain processing products. The growing demand for maize grain, stimulated by the increased demand for maize starch and oil in the global market as raw materials that are important in food production, is an impulse for the development of agrobiological research. The development of the starch industry, associated with the demand for industrial starch, will probably contribute to increased interest in this subspecies in Central Europe, also including Poland. Waxy maize grain can be a major ingredient of high-energy feeds for livestock, replacing in this role the type of maize that has been grown for this purpose until now. A great advantage of waxy maize is its specific structure of starch, due to its unique and high amylopectin content (95-98%, which creates unlimited possibilities of industrial use. Currently, waxy maize acreage in Europe does not exceed 2% of the maize crop area in this continent.
Chromosomal instability and double minute chromosomes in a breast cancer patient
International Nuclear Information System (INIS)
Lalic, H.; Radosevic-Stasic, B.
2004-01-01
Cytogenetic analysis was performed in peripheral blood lymphocytes (PBL) of a woman with ductal breast carcinoma, who as a hospital employee was exposed professionally for 15 years to low doses of ionizing radiation. The most important finding after the chemotherapy in combination with radiotherapy was the presence of double minutes (DM) chromosomes, in combination with other chromosomal abnormalities (on 200 scored metaphases were found 2 chromatid breaks, 10 dicentrics, 11 acentric fragments, 2 gaps, and 3 double min chromosomes). In a repeated analysis (after 6 months), DM chromosomes were still present. To rule out the possibility that the patient was overexposed to ionizing radiation at work, her blood test was compared with a group of coworkers as well as with a group of professionally unexposed people. The data rejected this possibility, but the retroactive analysis showed that the patient even at the time of employment had a moderately increased number of chromosomal aberrations (3.5%) consisting of 3 isochromatids and 4 gaps, suggesting that her initial genomic instability enhanced the later development. The finding of a continuous presence of rare DM chromosomes in her PBL (4 and 10 months after radio-chemotherapy) was considered as an indicator of additional risk, which might have some prognostic significance. (author)
Testing public Bt maize events for control of stem borers in the first ...
African Journals Online (AJOL)
Transgenic maize (Zea mays L), developed using modified genes from the bacterium Bacillus thuringiensis (Bt), controls stem borers without observable negative effects to humans, livestock or the environment, and is now sown on 134 million hectares globally. Bt maize could contribute to increasing maize production in ...
Genome-Wide Association Mapping of and Aspergillus flavus Aflatoxin Accumulation Resistance in Maize
Marilyn L. Warburton; Juliet D. Tang; Gary L. Windham; Leigh K. Hawkins; Seth C. Murray; Wenwei Xu; Debbie Boykin; Andy Perkins; W. Paul Williams
2015-01-01
Contamination of maize (Zea mays L.) with aflatoxin, produced by the fungus Aspergillus flavus Link, has severe health and economic consequences. Efforts to reduce aflatoxin accumulation in maize have focused on identifying and selecting germplasm with natural host resistance factors, and several maize lines with significantly...
International Nuclear Information System (INIS)
Jordan, R.; Schwartz, J.L.
1994-01-01
Fluorescence in situ hybridization procedures were used to examine the influence of chromosome locus on the frequency and type of chromosome aberrations induced by 60 Co γ rays in the human lymphoblastoid cell line TK6. Aberrations involving the X chromosome were compared to those involving the similarly sized autosome chromosome 7. When corrected for DNA content, acentric fragments were induced with equal frequency in the X and 7 chromosomes. Dose-dependent increases in chromosomal interchanges involving chromosome 7 were noted, and the frequencies of balanced translocations and dicentrics produced were approximately equal. Chromosome interchanges involving the X chromosome were rare and showed no apparent dose dependence. Thus, while chromosomes 7 and X are equally sensitive to the induction of chromosome breaks, the X chromosome is much less likely to interact with autosomes than chromosome 7. The noninvolvement of the X chromosome in translocations with autosomes may reflect a more peripheral and separate location for the X chromosome in the mammalian nucleus. 20 refs., 2 figs., 1 tab
Improving the AEATRI-motorized maize sheller to meet the market ...
African Journals Online (AJOL)
Mo
which have low productivity and result into maize grain of low market value. Earlier studies ... The old model of the sheller has a feeding hopper, which rests on a .... the sheller, two people supply maize cobs to the person feeding and remove ...
Adverse effects of lindane in a maize agro-ecosystem in Uganda
International Nuclear Information System (INIS)
Tukarhirwa, E.M.; Tinzaara, W.; Kiremire, B.T.
1997-01-01
The impact of lindane, at commercial rates of application, on invertebrate fauna, soil microbial activity, earthworm populations, crop damage and yields in a maize agro-ecosystem was studied and compared with unsprayed control plots of maize using a pitfall trap, D-Vac suction, litter bag, the earthworm formalin expulsion and crop assessment methods. The findings of the study generally portrayed lindane as having very few effects on the maize agro-ecosystem. (author). 5 refs, 9 tabs
Pozar, Gilberto; Butruille, David; Silva, Heyder Diniz; McCuddin, Zoe Patterson; Penna, Julio Cesar Viglioni
2009-02-01
Breeding for resistance to gray leaf spot, caused by Cercospora zeae-maydis (Cz) is paramount for many maize environments, in particular under warm and humid growing conditions. In this study, we mapped and characterized quantitative trait loci (QTL) involved in the resistance of maize against Cz. We confirmed the impact of the QTL on disease severity using near-isogenic lines (NILs), and estimated their effects on three major agronomic traits using their respective near isogenic hybrids (NIHs), which we obtained by crossing the NILs with an inbred from a complementary heterotic pool. We further validated three of the four QTL that were mapped using the Multiple Interval Mapping approach and showed LOD values>2.5. NILs genotype included all combinations between favorable alleles of the two QTL located in chromosome 1 (Q1 in bin 1.05 and Q2 in bin 1.07), and the allele in chromosome 3 (Q3 in bin 3.07). Each of the three QTL separately significantly reduced the severity of Cz. However, we found an unfavorable epistatic interaction between Q1 and Q2: presence of the favorable allele at one of the QTL allele effectively nullified the effect of the favorable allele at the other. In contrast, the interaction between Q2 and Q3 was additive, promoting the reduction of the severity to a greater extent than the sum of their individual effects. When evaluating the NIH we found significant individual effects for Q1 and Q3 on gray leaf spot severity, for Q2 on stalk lodging and grain yield, and for Q3 on grain moisture and stalk lodging. We detected significant epitasis between Q1 and Q2 for grain moisture and between Q1 and Q3 for stalk lodging. These results suggest that the combination of QTL impacts the effectiveness of marker-assisted selection procedures in commercial product development programs.
Directory of Open Access Journals (Sweden)
Jing Nie
2015-11-01
Full Text Available In soil ecotoxicological studies, a toxic metal is usually added in the form of either an inorganic or organic salt with relatively high solubility. Nitrate, chloride, acetate, or sulfate are commonly considered as valid options for that aim. However, recent studies have shown that different salts of the same metal at the same cationic concentration may exhibit different toxicities to plants and soil organisms. This information should be considered when selecting data to use for developing toxicological criteria for soil environment. A comparative study was carried out to evaluate the toxicity of five nickel (Ni salts: NiCl2, NiSO4, Ni(II-citrate, Ni(CH3COO2, and Ni(II-EDTA (ethylenediaminetetraacetate, on maize seedlings. The plant metrics used were plant height, shoot and root biomass, leaf soluble sugars and starch, and the Ni contents of the shoots and roots. The results indicated that when Ni was added to the soil, toxicity varied with the selected anionic partner with the following toxicity ranking NiSO4 < Ni(CH3COO2 < Ni(II-citrate < NiCl2 < Ni(II-EDTA. Taking the plant-height metric as an example, the effective concentrations for 50% inhibition (EC50 were 3148 mg·kg−1 for NiSO4, 1315 mg·kg−1 for NiCl2, and 89 mg·kg−1 for Ni(II-EDTA. Compared with the Ni in the other salts, that in Ni(II-EDTA was taken up the most efficiently by the maize roots and, thus, resulted in the greatest toxic effects on the plants. Nickel generally reduced leaf soluble sugars, which indicated an effect on plant carbohydrate metabolism. The outcome of the study demonstrates that different salts of the same metal have quite different ecotoxicities. Therefore, the anionic counterpart of a potentially toxic metal cation must be taken into account in the development of ecotoxicological criteria for evaluating the soil environment, and a preferred approach of leaching soil to reduce the anionic partner should also be considered.
Impact of selection on maize root traits and rhizosphere interactions
Schmidt, J. E.; Gaudin, A. C. M.
2017-12-01
Effects of domestication and breeding on maize have been well-characterized aboveground, but impacts on root traits and rhizosphere processes remain unclear. Breeding in high-inorganic-input environments may have negatively affected the ability of modern maize to acquire nutrients through foraging and microbial interactions in marginal and/or organically managed soils. Twelve maize genotypes representing a selection gradient (teosintes, landraces, open-pollinated parents of modern elite germplasm, and modern hybrids released 1934-2015) were grown in three soils varying in intensity of long-term management (unfertilized, organic, conventional) in the greenhouse. Recruitment of rhizosphere microbial communities, nutrient acquisition, and plant productivity were affected by genotype-by-soil interactions. Maize genotypes exhibit significant variation in their ability to obtain nutrients from soils of different management history, indicating the potential for re-integration of beneficial root and rhizosphere traits to increase adaptation to low-input agroecosystems.