International Nuclear Information System (INIS)
Grimm, K.N.; Meneghetti, D.
1989-01-01
Reactivity transfer functions are important in determining the reactivity history during a power transient. Overall nodal transfer functions have been calculated for different subassembly types in the Experimental Breeder Reactor II (EBR-II). Steady-state calculations for temperature changes and, hence, reactivities for power changes have been separated into power and power-to-flow-dependent terms. Axial nodal transfer functions separated into power and power-to-flow-dependent components are reported in this paper for a typical EBR-II fuel pin. This provides an improved understanding of the time dependence of these components in transient situations
International Nuclear Information System (INIS)
Loewenstein, W.B.
1962-01-01
The physics design oi EBR-II. Calculations of the static, dynamic and long-term reactivity behaviour of EBR-II are reported together with results and analysis of EBR-II dry critical and ZPR-III mock-up experiments. Particular emphasis is given to reactor-physics design problems which arise after the conceptual design is established and before the reactor is built or placed into operation. Reactor-safety analyses and hazards-evaluation considerations are described with their influence on the reactor design. The manner of utilizing the EBR-II mock-up on ZPR-III data and the EBR-II dry critical data is described. These experiments, their analysis and theoretical predictions are the basis for predetermining the physics behaviour of the reactor system. The limitations inherent in applying the experimental data to the performance of the power-reactor system are explored in some detail. This includes the specification of reactor core size and/or fuel-alloy enrichment, provisions for adequate operating and shut-down reactivity, determination of operative temperature and power coefficients of reactivity, and details of power- and flux-distribution as a function of position within the reactor structure. The overall problem of transferring information from simple idealized analytical or experimental geometry to actual hexagonal reactor geometry is described. Nuclear performance, including breeding, of the actual reactor system is compared with that of the idealized conceptual system. The long-term reactivity and power behaviour of the reactor blanket is described within the framework of the proposed cycling of the fuel and blanket alloy. Safety considerations, including normal and abnormal rates of reactivity-insertion, the implication of postulated reactivity effects based on the physical behaviour of the fuel alloy and reactor structure as well as extrapolation of TREAT experiments to the EBR-II system are analysed. The EBR-II core melt-down problem is reviewed. (author
EBR-II: summary of operating experience
International Nuclear Information System (INIS)
Perry, W.H.; Leman, J.D.; Lentz, G.L.; Longua, K.J.; Olson, W.H.; Shields, J.A.; Wolz, G.C.
1978-01-01
Experimental Breeder Reactor II (EBR-II) is an unmoderated, sodium-cooled reactor with a design power of 62.5 MWt. The primary cooling system is a submerged-pool type. The early operation of the reactor successfully demonstrated the feasibility of a sodium-cooled fast breeder reactor operating as an integrated reactor, power plant, and fuel-processing facility. In 1967, the role of EBR-II was reoriented from a demonstration plant to an irradiation facility. Many changes have been made and are continuing to be made to increase the usefulness of EBR-II for irradiation and safety tests. A review of EBR-II's operating history reveals a plant that has demonstrated high availability, stable and safe operating characteristics, and excellent performance of sodium components. Levels of radiation exposure to the operating and maintenance workers have been low; and fission-gas releases to the atmosphere have been minimal. Driver-fuel performance has been excellent. The repairability of radioactive sodium components has been successfully demonstrated a number of times. Recent highlights include installation and successful operation of (1) the hydrogen-meter leak detectors for the steam generators, (2) the cover-gas-cleanup system and (3) the cesium trap in the primary sodium. Irradiations now being conducted in EBR-II include the run-beyond-cladding breach fuel tests for mixed-oxide and carbide elements. Studies are in progress to determine EBR-II's capability for conducting important ''operational safety'' tests. These tests would extend the need and usefulness of EBR-II into the 1980's
EBR-II: twenty years of operating experience
International Nuclear Information System (INIS)
Lentz, G.L.; Buschman, H.W.; Smith, R.N.
1985-01-01
Experimental Breeder Reactor No. 2 (EBR-II) is an unmoderated, sodium-cooled reactor with a design power of 62.5 MWt. For the last 20 years EBR-II has operated safely, has demonstrated stable operating characteristics, has shown excellent performance of its sodium components, and has had an excellent plant factor. These years of operating experience provide a valuable resource to the nuclear community for the development and design of future liquid metal fast reactors. This report provides a brief description of the EBR-II plant and its early operating experience, describes some recent problems of interest to the nuclear community, and also mentions some of the significant operating achievements of EBR-II. Finally, a few words and speculations on EBR-II's future are offered. 4 figs., 1 tab
System modeling and simulation at EBR-II
International Nuclear Information System (INIS)
Dean, E.M.; Lehto, W.K.; Larson, H.A.
1986-01-01
The codes being developed and verified using EBR-II data are the NATDEMO, DSNP and CSYRED. NATDEMO is a variation of the Westinghouse DEMO code coupled to the NATCON code previously used to simulate perturbations of reactor flow and inlet temperature and loss-of-flow transients leading to natural convection in EBR-II. CSYRED uses the Continuous System Modeling Program (CSMP) to simulate the EBR-II core, including power, temperature, control-rod movement reactivity effects and flow and is used primarily to model reactivity induced power transients. The Dynamic Simulator for Nuclear Power Plants (DSNP) allows a whole plant, thermal-hydraulic simulation using specific component and system models called from libraries. It has been used to simulate flow coastdown transients, reactivity insertion events and balance-of-plant perturbations
EBR-II high-ramp transients under computer control
International Nuclear Information System (INIS)
Forrester, R.J.; Larson, H.A.; Christensen, L.J.; Booty, W.F.; Dean, E.M.
1983-01-01
During reactor run 122, EBR-II was subjected to 13 computer-controlled overpower transients at ramps of 4 MWt/s to qualify the facility and fuel for transient testing of LMFBR oxide fuels as part of the EBR-II operational-reliability-testing (ORT) program. A computer-controlled automatic control-rod drive system (ACRDS), designed by EBR-II personnel, permitted automatic control on demand power during the transients
Operating and test experience of EBR-II
International Nuclear Information System (INIS)
Sackett, J.I.
1991-01-01
EBR-II has operated for 27 years, the longest for any Liquid Metal Reactor (LMR) power plant. During that time, much has been learned about successful LMR operation and design. The basic lesson is that conservatism in design can pay significant dividends in operating reliability. Furthermore, such conservatism need not mean high cost. The EBR-II system emphasizes simplicity, minimizing the number of valves in the heat transport system, for example, and simplifying the primary heat-transport-system layout. Another lesson is that emphasizing reliability of the steam generating system at the sodium-water interface (by using duplex tubes in the case of EBR-II) has been well worth the higher initial costs; no problems with leakage have been encountered in EBR-II's operating history. Locating spent fuel storage in the primary tank and providing for decay heat removal by natural connective flow have also been contributors to EBR-II's success. The ability to accommodate loss of forced cooling or loss of heat sink passively has resulted in benefits for simplification, primarily through less reliance on emergency power and in not requiring the secondary sodium or steam systems to be safety grade. Also, the 'piped-pool' arrangement minimizes thermal stress to the primary tank and enhances natural convective flow. These benefits have been realized through a history of operation that has seen EBR-II evolve through four major phases in its test programs, culminating in its present mission as the Integral Fast Reactor (IFR) prototype. (author)
Operating and test experience of EBR-II
International Nuclear Information System (INIS)
Sackett, J.I.
1991-01-01
EBR-2 has operated for 27 years, the longest for any Liquid Metal Reactor (LMR) power plant. During that time, much has been learned about successful LMR operation and design. The basic lesson is that conversatism in design can pay significant dividends in operating reliability. Furthermore, such conservatism need not mean high cost. The EBR-2 system emphasizes simplicity, minimizing the number of valves in the heat transport system, for example, and simplifying the primary heat-transport-system layout. Another lesson is that emphasizing reliability of the steam generating system at the sodium-water interface (by using duplex tubes in the case of EBR-2) has been well worth the higher initial costs; no problems with leakage have been encountered in EBR-2's operating history. Locating spent fuel storage in the primary tank and providing for decay heat removal by natural connective flow have also been contributors to EBR-2's success. The ability to accommodate loss of forced cooling or loss of heat sink passively has resulted in benefits for simplification, primarily through less reliance on emergency power and in not requiring the secondary sodium or steam systems to be safety grade. Also, the ''piped-pool '' arrangement minimizes thermal stress to the primary tank and enhances natural convective flow. These benefits have been realized through a history of operation that has seen EBR-2 evolve through four major phases in its test programs, culminating in its present mission as the Integral Fast Rector (IFR) prototype. 20 refs., 8 figs., 1 tab
Effect of a time varying power level in EBR-II on mixed-oxide fuel burnup
International Nuclear Information System (INIS)
Stone, I.Z.; Jost, J.W.; Baker, R.B.
1979-01-01
A refined prediction of burnup of mixed-oxide fuel in EBR-2 is compared with measured data. The calculation utilizes a time-varying power factor and results in a general improvement to previous calculations
Reliability and extended-life potential of EBR-II
International Nuclear Information System (INIS)
King, R.W.
1985-01-01
Although the longlife potential of liquid-metal-cooled reactors (LMRs) has been only partially demonstrated, many factors point to the potential for exceptionally long life. EBR-II has the opportunity to become the first LMR to achieve an operational lifetime of 30 years or more. In 1984 a study of the extended-life potential of EBR-II identified the factors that contribute to the continued successful operation of EBR-II as a power reactor and experimental facility. Also identified were factors that could cause disruptions in the useful life of the facility. Although no factors were found that would inherently limit the life of EBR-II, measures were identified that could help ensure continued plant availability. These measures include the implementation of more effective surveillance, diagnostic, and control systems to complement the inherent safety and reliability features of EBR-II. An operating lifetime of well beyond 30 years is certainly feasible
Demonstration of passive safety features in EBR-II
International Nuclear Information System (INIS)
Planchon, H.P. Jr.; Golden, G.H.; Sackett, J.I.
1987-01-01
Two tests of great importance to the design of future commercial nuclear power plants were carried out in the Experimental Breeder Reactor-II on April 3, 1986. These tests, (viewed by about 60 visitors, including 13 foreign LMR specialists) were a loss of flow without scram and a loss of heat sink without scram, both from 100% initial power. In these tests, inherent feedback shut the reactor down without damage to the fuel or other reactor components. This resulted primarily from advantageous characteristics of the metal driver fuel used in EBR-II. Work is currently underway at EBR-II to develop a control strategy that promotes inherent safety characteristics, including survivability of transient overpower accidents. In parallel, work is underway at EBR-II on the development of state-of-the-art plant diagnostic techniques
Safety and operating experience at EBR-II: lessons for the future
International Nuclear Information System (INIS)
Sackett, J.I.; Golden, G.H.
1981-01-01
EBR-II is a small LMFBR power plant that has performed safely and reliably for 16 years. Much has been learned from operating it to facilitate the design, licensing, and operation of large commercial LMFBR power plants in the US. EBR-II has been found relatively easy to keep in conformity with evolving safety requirements, largely because of inherent safety features of the plant. Such features reduce dependence on active safety systems to protect against accidents. EBR-II has experienced a number of plant-transient incidents, some planned, others inadvertent; none has resulted in any significant plant damage. The operating experience with EBR-II has led to the formulation of an Operational Reliability Test Program (ORTP), aimed at showing inherently safe performance of fuel and plant systems
EBR-2 [Experimental Breeder Reactor-2] test programs
International Nuclear Information System (INIS)
Sackett, J.I.; Lehto, W.K.; Lindsay, R.W.; Planchon, H.P.; Lambert, J.D.B.; Hill, D.J.
1990-01-01
The Experimental Breeder Reactor-2 (EBR-2) is a sodium cooled power reactor supplying about 20 MWe to the Idaho National Engineering Laboratory (INEL) grid and, in addition, is the key component in the development of the Integral Fast Reactor (IFR). EBR-2's testing capability is extensive and has seen four major phases: (1) demonstration of LMFBR power plant feasibility, (2) irradiation testing for fuel and material development, (3) testing the off-normal performance of fuel and plant systems and (4) operation as the IFR prototype, developing and demonstrating the IFR technology associated with fuel and plant design. Specific programs being carried out in support of the IFR include advanced fuels and materials development, advanced control system development, plant diagnostics development and component testing. This paper discusses EBR-2 as the IFR prototype and the associated testing programs. 29 refs
Tightly coupled transient analysis of EBR-II
International Nuclear Information System (INIS)
Makowitz, H.; Lehto, W.K.; Sackett, J.I.
1988-01-01
A Tightly Coupled transient analysis system for the Experimental Breeder Reactor-II (EBR-II) is currently being tested. The system consists of a faster than real time high fidelity reactor simulation, advanced graphics displays, expert system coupling, and real time data coupling via the EBR-II data acquisition system to and from the plant and the control system. The base, first generation software has been developed and is presently being tested. Various subsystem couplings and the total system integration are being checked out. This system should enhance the diagnostic and prognostic capability of EBR-II in the near term and provide automatic control during startup and power maneuvering in the future, as well as serve as a testbed for new control system development for advanced reactors
Evolution of thermal-hydraulics testing in EBR-II
International Nuclear Information System (INIS)
Golden, G.H.; Planchon, H.P.; Sackett, J.I.; Singer, R.M.
1987-01-01
A thermal-hydraulics testing and modeling program has been underway at the Experimental Breeder Reactor-II (EBR-II) for 12 years. This work culminated in two tests of historical importance to commercial nuclear power, a loss of flow without scram and a loss of heat sink wihout scram, both from 100% initial power. These tests showed that natural processes will shut EBR-II down and maintain cooling without automatic control rod action or operator intervention. Supporting analyses indicate that these results are characteristic of a range of sizes of liquid metal cooled reactors (LMRs), if these reactors use metal driver fuel. This type of fuel is being developed as part of the Integral Fast Reactor Program at Argonne National Laboratory. Work is now underway at EBR-II to exploit the inherent safety of metal-fueled LMRs with regard to development of improved plant control strategies. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Loewenstein, W. B. [Argonne National Laboratory, Argonne, IL (United States)
1962-03-15
The physics design oi EBR-II. Calculations of the static, dynamic and long-term reactivity behaviour of EBR-II are reported together with results and analysis of EBR-II dry critical and ZPR-III mock-up experiments. Particular emphasis is given to reactor-physics design problems which arise after the conceptual design is established and before the reactor is built or placed into operation. Reactor-safety analyses and hazards-evaluation considerations are described with their influence on the reactor design. The manner of utilizing the EBR-II mock-up on ZPR-III data and the EBR-II dry critical data is described. These experiments, their analysis and theoretical predictions are the basis for predetermining the physics behaviour of the reactor system. The limitations inherent in applying the experimental data to the performance of the power-reactor system are explored in some detail. This includes the specification of reactor core size and/or fuel-alloy enrichment, provisions for adequate operating and shut-down reactivity, determination of operative temperature and power coefficients of reactivity, and details of power- and flux-distribution as a function of position within the reactor structure. The overall problem of transferring information from simple idealized analytical or experimental geometry to actual hexagonal reactor geometry is described. Nuclear performance, including breeding, of the actual reactor system is compared with that of the idealized conceptual system. The long-term reactivity and power behaviour of the reactor blanket is described within the framework of the proposed cycling of the fuel and blanket alloy. Safety considerations, including normal and abnormal rates of reactivity-insertion, the implication of postulated reactivity effects based on the physical behaviour of the fuel alloy and reactor structure as well as extrapolation of TREAT experiments to the EBR-II system are analysed. The EBR-II core melt-down problem is reviewed. (author
International Nuclear Information System (INIS)
Smith, C.R.F.
1978-07-01
Operation of the EBR-2 reactor is presented concerning the performance of the heat removal system; reactor materials; fuel handling system; sodium purification and sampling system; cover-gas purification; plant diagnostics and instrumentation; recent improvements in identifying fission product sources in EBR-2; and EBR-2 safety
Comparisons of PRD [power-reactivity-decrements] components for various EBR-II configurations
International Nuclear Information System (INIS)
Meneghetti, D.; Kucera, D.A.
1986-01-01
Comparison of detailed calculations of contributions by region and component of the power-reactivity-decrements (PRD) for four differing loading configurations of the Experimental Breeder Reactor-II (EBR-II) are given. The linear components and Doppler components are calculated. The non-linear (primarily subassembly bowing) components are deduced by differences relative to measured total PRD values. Variations in linear components range from about 10% to as much as about 100% depending upon the component. The deduced non-linear components differ both in magnitude and sign as functions of reactor power. Effects of differing assumptions of the nature of the fuel-to-clad interactions upon the PRD components are also calculated
Component configuration control system development at EBR-II
International Nuclear Information System (INIS)
Monson, L.R.; Stratton, R.C.
1984-01-01
One ofthe major programs being pursued by the EBR-II Division of Argonne National Laboratory is to improve the reliability of plant control and protection systems. This effort involves looking closely at the present state of the art and needs associated with plant diagnostic, control and protection systems. One of the areas of development at EBR-II involves a component configuration control system (CCCS). This system is a computerized control and planning aid for the nuclear power operator
Irradiation of microphones in the EBR-II core
International Nuclear Information System (INIS)
Gavin, A.P.; Anderson, T.T.; Bobis, J.P.
1976-06-01
Six ANL developed high temperature microphone (acoustic detectors) have been exposed in flowing sodium in the In-Core Instrument Test Facility (INCOT) in the Experimental Breeder Reactor-II (EBR-II) for seven months without any indications of serious degradation of signal output due to the exposure. The YY05 experiment (EBR-II INCOT experiment designation) was performed to obtain data which would be useful in evaluating the ability of the microphones whose active elements are lithium niobate to serve as sensors for acoustic surveillance of fast breeder reactors. The reactor was at full power for 136 days of the experiment exposure period. The microphone temperatures varied from 371 0 C (700 0 F) to 621 0 C (1150 0 F). Neutron exposure varied from 2.64 x 10 22 nvt for the microphone at the elevation of the bottom of the EBR-II core to 0.24 x 10 22 nvt for the microphone at the elevation of the top of an EBR-II fuel assembly. The maximum gamma dose was 5 x 10 12 rads
Experience with advanced driver fuels in EBR-II
International Nuclear Information System (INIS)
Lahm, C.E.; Koenig, J.F.; Pahl, R.G.; Porter, D.L.; Crawford, D.C.
1992-01-01
The Experimental Breeder Reactor II (EBR-II) is a complete nuclear power plant, incorporating a pool-type liquid-metal reactor (LMR) with a fuel-power thermal output of 62.5 MW and an electrical output of 20 MW. Initial criticality was in 1961, utilizing a metallic driver fuel design called the Mark-I. The fuel design has evolved over the last 30 yr, and significant progress has been made on improving performance. The first major innovations were incorporated into the Mark-II design, and burnup then increased dramatically. This design performed successfully, and fuel element lifetime was limited by subassembly hardware performance rather than the fuel element itself. Transient performance of the fuel was also acceptable and demonstrated the ability of EBR-II to survive severe upsets such as a loss of flow without scram. In the mid 1980s, with renewed interest in metallic fuels and Argonne's integral fast reactor (IFR) concept, the Mark-II design was used as the basis for new designs, the Mark-III and Mark-IV. In 1987, the Mark-III design began qualification testing to become a driver fuel for EBR-II. This was followed in 1989 by the Mark-IIIA and Mark-IV designs. The next fuel design, the Mark-V, is being planned to demonstrate the utilization of recycled fuel. The fuel cycle facility attached to EBR-II is being refurbished to produce pyroprocessed recycled fuel as part of the demonstration of the IFR
The EBR-II Probabilistic Risk Assessment: Results and insights
International Nuclear Information System (INIS)
Hill, D.J.; Ragland, W.A.; Roglans, J.
1993-01-01
This paper summarizes the results from the recently completed EBR-II Probabilistic Risk Assessment (PRA) and provides an analysis of the source of risk of the operation of EBR-II from both internal and external initiating events. The EBR-II PRA explicitly accounts for the role of reactivity feedbacks in reducing fuel damage. The results show that the expected core damage frequency from internal initiating events at EBR-II is very low, 1. 6 10 -6 yr -1 , even with a wide definition of core damage (essentially that of exceeding Technical Specification limits). The probability of damage, primarily due to liquid metal fires, from externally initiated events (excluding earthquake) is 3.6 10 -6 yr -1 . overall these results are considerably better than results for other research reactors and the nuclear industry in general and stem from three main sources: low likelihood of loss of coolant due to low system pressure and top entry double, vessels; low likelihood of loss of decay heat removal due to reliance on passive means; and low likelihood of power/flow mismatch due to both passive feedbacks and reliability of rod scram capability
Recent operating experiences and programs at EBR-II
International Nuclear Information System (INIS)
Lentz, G.L.
1984-01-01
Experimental Breeder Reactor No. II (EBR-II) is a pool-type, unmoderated, sodium-cooled reactor with a design power of 62.5 MWt and an electrical generation capability of 20 MW. It has been operated by Argonne National Laboratory for the US government for almost 20 years. During that time, it has operated safely and has demonstrated stable operating characteristics, high availability, and excellent performance of its sodium components. The 20 years of operating experience of EBR-II is a valuable resource to the nuclear community for the development and design of future LMFBR's. Since past operating experience has been extensively reported, this report will focus on recent programs and events
EBR-2 [Experimental Breeder Reactor-2], IFR [Integral Fast Reactor] prototype testing programs
International Nuclear Information System (INIS)
Lehto, W.K.; Sackett, J.I.; Lindsay, R.W.; Planchon, H.P.; Lambert, J.D.B.
1990-01-01
The Experimental Breeder Reactor-2 (EBR-2) is a sodium cooled power reactor supplying about 20 MWe to the Idaho National Engineering Laboratory (INEL) grid and, in addition, is the key component in the development of the Integral Fast Reactor (IFR). EBR-2's testing capability is extensive and has seen four major phases: (1) demonstration of LMFBR power plant feasibility, (2) irradiation testing for fuel and material development. (3) testing the off-normal performance of fuel and plant systems and (4) operation as the IFR prototype, developing and demonstrating the IFR technology associated with fuel and plant design. Specific programs being carried out in support of the IFR include advanced fuels and materials development and component testing. This paper discusses EBR-2 as the IFR prototype and the associated testing programs. 29 refs
Assessment calculation of MARS-LMR using EBR-II SHRT-45R
Energy Technology Data Exchange (ETDEWEB)
Choi, C.; Ha, K.S.
2016-10-15
Highlights: • Neutronic and thermal-hydraulic behavior predicted by MARS-LMR is validated with EBR-II SHRT-45R test data. • Decay heat model of ANS-94 give better prediction of the fission power. • The core power is well predicted by reactivity feedback during initial transient, however, the predicted power after approximately 200 s is over-estimated. The study of the reactivity feedback model of the EBR-II is necessary for the better calculation of the power. • Heat transfer between inter-subassemblies is the most important parameter, especially, a low flow and power subassembly, like non-fueled subassembly. - Abstract: KAERI has designed a prototype Gen-IV SFR (PGSFR) with metallic fuel. And the safety analysis code for the PGSFR, MARS-LMR, is based on the MARS code, and supplemented with various liquid metal related features including sodium properties, heat transfer, pressure drop, and reactivity feedback models. In order to validate the newly developed MARS-LMR, KAERI has joined the International Atomic Energy Agency (IAEA) coordinated research project (CRP) on “Benchmark Analysis of an EBR-II Shutdown Heat Removal Test (SHRT)”. Argonne National Laboratory (ANL) has technically supported and participated in this program. One of benchmark analysis tests is SHRT-45R, which is an unprotected loss of flow test in an EBR-II. So, sodium natural circulation and reactivity feedbacks are major phenomena of interest. A benchmark analysis was conducted using MARS-LMR with original input data provided by ANL. MARS-LMR well predicts the core flow and power change by reactivity feedbacks in the core. Except the results of the XX10, the temperature and flow in the XX09 agreed well with the experiments. Moreover, sensitivity tests were carried out for a decay heat model, reactivity feedback model, inter-subassembly heat transfer, internal heat structures and so on, to evaluate their sensitivity and get a better prediction. The decay heat model of ANS-94 shows
Assessment calculation of MARS-LMR using EBR-II SHRT-45R
International Nuclear Information System (INIS)
Choi, C.; Ha, K.S.
2016-01-01
Highlights: • Neutronic and thermal-hydraulic behavior predicted by MARS-LMR is validated with EBR-II SHRT-45R test data. • Decay heat model of ANS-94 give better prediction of the fission power. • The core power is well predicted by reactivity feedback during initial transient, however, the predicted power after approximately 200 s is over-estimated. The study of the reactivity feedback model of the EBR-II is necessary for the better calculation of the power. • Heat transfer between inter-subassemblies is the most important parameter, especially, a low flow and power subassembly, like non-fueled subassembly. - Abstract: KAERI has designed a prototype Gen-IV SFR (PGSFR) with metallic fuel. And the safety analysis code for the PGSFR, MARS-LMR, is based on the MARS code, and supplemented with various liquid metal related features including sodium properties, heat transfer, pressure drop, and reactivity feedback models. In order to validate the newly developed MARS-LMR, KAERI has joined the International Atomic Energy Agency (IAEA) coordinated research project (CRP) on “Benchmark Analysis of an EBR-II Shutdown Heat Removal Test (SHRT)”. Argonne National Laboratory (ANL) has technically supported and participated in this program. One of benchmark analysis tests is SHRT-45R, which is an unprotected loss of flow test in an EBR-II. So, sodium natural circulation and reactivity feedbacks are major phenomena of interest. A benchmark analysis was conducted using MARS-LMR with original input data provided by ANL. MARS-LMR well predicts the core flow and power change by reactivity feedbacks in the core. Except the results of the XX10, the temperature and flow in the XX09 agreed well with the experiments. Moreover, sensitivity tests were carried out for a decay heat model, reactivity feedback model, inter-subassembly heat transfer, internal heat structures and so on, to evaluate their sensitivity and get a better prediction. The decay heat model of ANS-94 shows
Simulation and operation of the EBR-II automatic control rod drive system
International Nuclear Information System (INIS)
Lehto, W.K.; Larson, H.A.; Dean, E.M.; Christensen, L.J.
1985-01-01
An automatic control rod drive system (ACRDS) installed at EBR-II produces shaped power transients from 40% to full reactor power at a linear ramp rate of 4 MWt/s. A digital computer and modified control-rod-drive provides this capability. Simulation and analysis of ACRDS experiments establish the safety envelope for reactor transient operation. Tailored transients are required as part of USDOE Operational Reliability Testing program for prototypic fast reactor fuel cladding breach behavior studies. After initial EBR-II driver fuel testing and system checkout, test subassemblies were subjected to both slow and fast transients. In addition, the ACRDS is used for steady-state operation and will be qualified to control power ascent from initial critical to full power
Simulation and operation of the EBR-II automatic control rod drive system
International Nuclear Information System (INIS)
Lehto, W.K.; Larson, H.A.; Dean, E.M.; Christensen, L.J.
1985-01-01
An automatic control rod drive system (ACRDS) installed at EBR-II produces shaped power transients from 40% to full reactor power at a linear ramp rate of 4 MWt/s. A digital computer and modified control-rod-drive provides this capability. Simulation and analysis of ACRDS experiments establish the safety envelope for reactor transient operation. Tailored transients are required as part of USDOE Operational Reliability Testing program for prototypic fast reactor fuel cladding breach behavior studies. After initial EBR-II driver fuel testing and system checkout, test subassemblies were subjected to both slow and fast transients. In additions, the ACRDS is used for steady-state operation and will be qualified to control power ascent from initial critical to full power
Experience with lifetime limits for EBR-II core components
International Nuclear Information System (INIS)
Lambert, J.D.B.; Smith, R.N.; Golden, G.H.
1987-01-01
The Experimental Breeder Reactor No. 2 (EBR-II) is operated for the US Department of Energy by Argonne National Laboratory and is located on the Idaho National Engineering Laboratory where most types of American reactor were originally tested. EBR-II is a complete electricity-producing power plant now in its twenty-fourth year of successful operation. During this long history the reactor has had several concurrent missions, such as demonstration of a closed Liquid-Metal Reactor (LMR) fuel cycle (1964-69); as a steady-state irradiation facility for fuels and materials (1970 onwards); for investigating effects of operational transients on fuel elements (from 1981); for research into the inherent safety aspects of metal-fueled LMR's (from 1983); and, most recently, for demonstration of the Integral Fast Reactor (IFR) concept using U-Pu-Zr fuels. This paper describes experience gained at EBR-II in defining lifetime limits for LMR core components, particularly fuel elements
International Nuclear Information System (INIS)
Stevenson, C.E.
1987-01-01
This volume on the history of the Experimental Breeder Reactor (EBR) program and the Fuel Cycle Facility (FCF) offers both the historical perspective and ''reasons why'' the project was so successful. The operation of the FCF in conjunction with the EBR-II was prepared because of the unique nature of the pyrmetallurgical processing system that was demonstrated at the time. Following brief descriptions and histories of the EBR-I and EBR-II reactors, the FCF and its process requirements are described. The seven principal process steps are presented, including for each one, the development, equipment used, operating procedures, results, problems and other data. Scrap and waste disposition, analytical control, safety, management, and cost of the FCF are also included
Energy Technology Data Exchange (ETDEWEB)
Yoon, Su-Jong [Idaho National Lab. (INL), Idaho Falls, ID (United States); Rabiti, Cristian [Idaho National Lab. (INL), Idaho Falls, ID (United States); Sackett, John [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2014-08-01
1. Objectives To produce a validation database out of those recorded signals it will be necessary also to identify the documents need to reconstruct the status of reactor at the time of the beginning of the recordings. This should comprehends the core loading specification (assemblies type and location and burn-up) along with this data the assemblies drawings and the core drawings will be identified. The first task of the project will be identify the location of the sensors, with respect the reactor plant layout, and the physical quantities recorded by the Experimental Breeder Reactor-II (EBR-II) data acquisition system. This first task will allow guiding and prioritizing the selection of drawings needed to numerically reproduce those signals. 1.1 Scopes and Deliverables The deliverables of this project are the list of sensors in EBR-II system, the identification of storing location of those sensors, identification of a core isotopic composition at the moment of the start of system recording. Information of the sensors in EBR-II reactor system was summarized from the EBR-II system design descriptions listed in Section 1.2.
EBRPOCO - a program to calculate detailed contributions of power reactivity components of EBR-II
International Nuclear Information System (INIS)
Meneghetti, D.; Kucera, D.A.
1981-01-01
The EBRPOCO program has been developed to facilitate the calculations of the power coefficients of reactivity of EBR-II loadings. The program enables contributions of various components of the power coefficient to be delineated axially for every subassembly. The program computes the reactivity contributions of the power coefficients resulting from: density reduction of sodium coolant due to temperature; displacement of sodium coolant by thermal expansions of cladding, structural rods, subassembly cans, and lower and upper axial reflectors; density reductions of these steel components due to temperature; displacement of bond-sodium (if present) in gaps by differential thermal expansions of fuel and cladding; density reduction of bond-sodium (if present) in gaps due to temperature; free axial expansion of fuel if unrestricted by cladding or restricted axial expansion of fuel determined by axial expansion of cladding. Isotopic spatial contributions to the Doppler component my also be obtained. (orig.) [de
EBR-II: search for the lost subassembly
International Nuclear Information System (INIS)
King, R.W.; Buschman, H.W.; Poloncsik, J.; Remsburg, J.S.; Sine, H.W.
1983-01-01
Experimental Breeder Reactor II (EBR-II) has been operating for nearly 20 years as part of the foundation of the US Department of Energy's LMFBR development program. During that time, the EBR-II fuel-handling system has performed extremely well, especially considering the conditions under which much of the system operates and the reliability required to maintain the high plant factor routinely demonstrated by EBR-II. Since EBR-II is a pool-type reactor, much of the fuel handling is done remotely within the sodium-filled primary tank at 371 0 C. Activities involved in locating a misplaced fuel subassembly in the primary tank are described
Analysis of EBR-II neutron and photon physics by multidimensional transport-theory techniques
International Nuclear Information System (INIS)
Jacqmin, R.P.; Finck, P.J.; Palmiotti, G.
1994-01-01
This paper contains a review of the challenges specific to the EBR-II core physics, a description of the methods and techniques which have been developed for addressing these challenges, and the results of some validation studies relative to power-distribution calculations. Numerical tests have shown that the VARIANT nodal code yields eigenvalue and power predictions as accurate as finite difference and discrete ordinates transport codes, at a small fraction of the cost. Comparisons with continuous-energy Monte Carlo results have proven that the errors introduced by the use of the diffusion-theory approximation in the collapsing procedure to obtain broad-group cross sections, kerma factors, and photon-production matrices, have a small impact on the EBR-II neutron/photon power distribution
Operating experience of the EBR-II steam generating system
International Nuclear Information System (INIS)
Buschman, H.W.; Penney, W.H.; Quilici, M.D.; Radtke, W.H.
1981-01-01
The Experimental Breeder Reactor II (EBR-II) is a Liquid Metal Fast Breeder Reactor (LMFBR) with integrated power producing capability. Superheated steam is produced by eight natural circulation evaporators, two superheaters, and a conventional steam drum. Steam throttle conditions are 438 C (820 F) and 8.62 MPa (1250 psi). The designs of the evaporators and superheaters are essentially identical; both are counterflow units with low pressure nonradioactive sodium on the shell side. Safety and reliability are maximized by using duplex tubes and tubesheets. The performance of the system has been excellent and essentially trouble free. The operating experience of EBR-II provides confidence that the technology can be applied to commercial LMFBR's for an abundant supply of energy for the future. 5 refs
The EBR-II Probabilistic Risk Assessment: lessons learned regarding passive safety
International Nuclear Information System (INIS)
Hill, D.J.; Ragland, W.A.; Roglans, J.
1998-01-01
This paper summarizes the results from the EBR-II Probabilistic Risk Assessment (PRA) and provides an analysis of the source of risk of the operation of EBR-II from both internal and external initiating events. The EBR-II PRA explicitly accounts for the role of reactivity feedbacks in reducing fuel damage. The results show that the expected core damage frequency from internal initiating events at EBR-II is very low, 1.6 10 -6 yr -1 , even with a wide definition of core damage (essentially that of exceeding Technical Specification limits). The annual frequency of damage, primarily due to liquid metal fires, from externally initiated events (excluding earthquakes) is 3.6 10 -6 yr -1 and the contribution of seismic events is 1.7 10 -5 yr -1 . Overall these results are considerably better than results for other research reactors and the nuclear industry in general and stem from three main sources: low likelihood of loss of coolant due to low system pressure and top entry double vessels; low likelihood of loss of decay heat removal due to reliance on passive means; and low likelihood of power/flow mismatch due to both passive feedbacks and reliability of rod scram capability
The EBR-II Probabilistic Risk Assessment: lessons learned regarding passive safety
Energy Technology Data Exchange (ETDEWEB)
Hill, D J; Ragland, W A; Roglans, J
1998-11-01
This paper summarizes the results from the EBR-II Probabilistic Risk Assessment (PRA) and provides an analysis of the source of risk of the operation of EBR-II from both internal and external initiating events. The EBR-II PRA explicitly accounts for the role of reactivity feedbacks in reducing fuel damage. The results show that the expected core damage frequency from internal initiating events at EBR-II is very low, 1.6 10{sup -6} yr{sup -1}, even with a wide definition of core damage (essentially that of exceeding Technical Specification limits). The annual frequency of damage, primarily due to liquid metal fires, from externally initiated events (excluding earthquakes) is 3.6 10{sup -6} yr{sup -1} and the contribution of seismic events is 1.7 10{sup -5} yr{sup -1}. Overall these results are considerably better than results for other research reactors and the nuclear industry in general and stem from three main sources: low likelihood of loss of coolant due to low system pressure and top entry double vessels; low likelihood of loss of decay heat removal due to reliance on passive means; and low likelihood of power/flow mismatch due to both passive feedbacks and reliability of rod scram capability.
The EBR-II probabilistic risk assessment lessons learned regarding passive safety
International Nuclear Information System (INIS)
Hill, D.J.; Ragland, W.A.; Roglans, J.
1994-01-01
This paper summarizes the results from the recently completed EBR-II Probabilistic Risk Assessment (PRA) and provides an analysis of the source of risk of the operation of EBR-II from both internal and external initiating events. The EBR-II PRA explicitly accounts for the role of reactivity feedbacks in reducing fuel damage. The results show that the expected core damage frequency from internal initiating events at EBR-II is very low, 1.6 10 -6 yr -1 , even with a wide definition of core damage (essentially that of exceeding Technical Specification limits). The annual frequency of damage, primarily due to liquid metal fires, from externally initiated events (excluding earthquakes) is 3.6 10 -6 yr -1 and the contribution of seismic events is 1.7 10 -5 yr -1 . Overall these results are considerably better than results for other research reactors and the nuclear industry in general and stem from three main sources: low likelihood of loss of coolant due to low system pressure and top entry double vessels; low likelihood of loss of decay heat removal due to reliance on passive means; and low likelihood of power/flow mismatch due to both passive feedbacks and reliability of rod scram capability
The EBR-II steam generating system - operation, maintenance, and inspection
International Nuclear Information System (INIS)
Buschman, H.W.; Penney, W.H.; Longua, K.J.
2002-01-01
The Experimental Breeder Reactor II (EBR-II) has operated for 20 years at the Idaho National Engineering Laboratory near Idaho Falls. EBR-II is a Liquid Metal Fast Breeder Reactor (LMFBR) with integrated power producing capability. EBR-II has operated at a capacity factor over 70% in the past few years. Superheated steam is produced by eight natural circulation evaporators, two superheaters, and a conventional steam drum. Steam throttle conditions are 438 C and 8.62 MPa. The designs of the evaporators and superheaters are essentially identical; both are counterflow units with low pressure nonradioactive sodium on the shell side. During the 20 years of operation, components of the steam generator have been subjected to a variety of inspections including visual, dimensional, and ultrasonic. One superheater was removed from service because of anomalous performance and was replaced with an evaporator which was removed, examined, and converted into a superheater. Overall operating experience of the system has been excellent and essentially trouble free. Inspections have not revealed any conditions that are performance or life limiting. (author)
The roles of EBR-II and TREAT [Transient Reactor Test] in establishing liquid metal reactor safety
International Nuclear Information System (INIS)
Sackett, J.I.; Lehto, W.K.; Solbrig, C.W.
1990-01-01
This paper examines the role of the Experimental Breeder Reactor II (EBR-II) and Transient Reactor Test (TREAT) facilities in contributing to the understanding and resolution of key safety issues in liquid metal reactor safety during the decade of the 80's. Fuels and materials testing has been carried out to address questions on fuels behavior during steady-state and upset conditions. In addition, EBR-II has conducted plant tests to demonstrate passive response to ATWS events and to develop control and diagnostic strategies for safe operation of advanced LMRs. TREAT and EBR-II complement each other and between them provide a transient testing capability that covers the whole range of concerns during overpower conditions. EBR-II, with use of the special Automatic Control Rod Drive System, can generate power change rates that overlap the lower end of the TREAT capability. 21 refs
Feedback components of a U20Pu10Zr-fueled compared to a U10Zr-fueled EBR-II
International Nuclear Information System (INIS)
Meneghetti, D.; Kucera, D.A.
1988-01-01
Calculated feedback components of the regional contributions of the power reactivity decrements (PRDs) and of the temperature coefficients of reactivity of a U20Pu10Zr-fueled and of a U10Zr-fueled Experimental Breeder Reactor II (EBR-II) are compared. The PRD components are also separated into power-to-flow dependent and solely power dependent parts. The effects of these values upon quantities useful for indicating the comparative potential inherent safety characteristics of these EBR-II loadings are presented
Transient performance of EBR-II driver fuel
International Nuclear Information System (INIS)
Buzzell, J.A.; Hudman, G.D.; Porter, D.L.
1981-01-01
The first phases of qualification of the EBR-II driver fuel for repeated transient overpower operation have recently been completed. The accomplishments include prediction of the transient fuel and cladding performance through ex-core testing and fuel-element modeling studies, localized in-core power testing during steady-state operation, and whole-core multiple transient testing. The metallic driver fuel successfully survived 56 transients, spaced over a 45-day period, with power increases of approx. 160% at rates of approx. 1%/s with a 720-second hold at full power. The performance results obtained from both ex-core and n-core tests indicate that the fuel is capable of repeated transient operation
7 CFR 51.694 - Similar varietal characteristics.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Similar varietal characteristics. 51.694 Section 51.694 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards..., and Arizona) Definitions § 51.694 Similar varietal characteristics. Similar varietal characteristics...
Studies related to emergency decay heat removal in EBR-II
International Nuclear Information System (INIS)
Singer, R.M.; Gillette, J.L.; Mohr, D.; Tokar, J.V.; Sullivan, J.E.; Dean, E.M.
1979-01-01
Experimental and analytical studies related to emergency decay heat removal by natural circulation in the EBR-II heat transport circuits are described. Three general categories of natural circulation plant transients are discussed and the resultant reactor flow and temperature response to these events are presented. these categories include the following: (1) loss of forced flow from decay power and low initial flow rates; (2) reactor scram with a delayed loss of forced flow; and (3) loss of forced flow with a plant protective system activated scram. In all cases, the transition from forced to natural convective flow was smooth and the peak in-core temperature rises were small to moderate. Comparisons between experimental measurements in EBR-II and analytical predictions of the NATDEMO code are included
Stability Analysis of the EBR-I Mark-II Core Meltdown Accident
Energy Technology Data Exchange (ETDEWEB)
Lim, Jae-Yong; Kang, Chang Mu [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2016-10-15
The purpose of this paper is to analyze the stability of the EBR-I core meltdown accident using the NuSTAB code. The result of NuSTAB analysis is compared with previous stability analysis by Sandmeier using the root locus method. The Experimental Breeder Reactor I (EBR-1) at Argonne National Laboratory was designed to demonstrate fast reactor breeding and to prove the use of liquid-metal coolant for power production and reached criticality in August 1951. The EBR-I reactor was undergoing a series of physics experiments and the Mark-II core was melted accidentally on Nov. 29, 1955. The experiment was going to increase core temperature to 500C to see if the reactor loses reactivity, and scram when the power reached 1500 kW or doubling of fission rate per second. However the operator scrammed with a slow moving control and missed the shutdown by two seconds and caused the core meltdown. The NuSTAB code has an advantage of analyzing space-dependent fast reactors and predicting regional oscillations compared to the point kinetics. Also, NuSTAB can be useful when the coupled neutronic-thermal-hydraulic codes cannot be used for stability analysis. Future work includes analyses of the PGSFR for various operating conditions as well as further validation of the NuSTAB calculations against SFR stability experiments when such experiments become available.
A transient overpower experiment in EBR-II
International Nuclear Information System (INIS)
Herzog, J.P.; Tsai, H.; Dean, E.M.; Aoyama, T.; Yamamoto, K.
1994-01-01
The TOPI-IE test was a transient overpower test on irradiate mixed-oxide fuel pins in the Experimental Breeder Reactor-II (EBR-II). The test, the fifth in a series, was part of a cooperative program between the US Department of Energy and the Power Reactor and Nuclear Fuel Development Corporation of Japan to conduct operational transient testing on mixed-oxide fuel pins in the metal-fueled EBR-II. The principle objective of the TOPI-1E test was to assess breaching margins for irradiated mixed-oxide fuel pins over the Plant Protection System (PPS) thresholds during a slow, extended overpower transient. This paper describes the effect of the TOPI-1E experiment on reactor components and the impact of the experiment on the long-term operability of the reactor. The paper discusses the role that SASSYS played in the pre-test safety analysis of the experiment. The ability of SASSYS to model transient overpower events is detailed by comparisons of data from the experiment with computed reactor variables from a SASSYS post-test simulation of the experiment
Bowing-reactivity trends in EBR-II assuming zero-swelling ducts
International Nuclear Information System (INIS)
Meneghetti, D.
1994-01-01
Predicted trends of duct-bowing reactivities for the Experimental Breeder Reactor II (EBR-II) are correlated with predicted row-wise duct deflections assuming use of idealized zero-void-swelling subassembly ducts. These assume no irradiation induced swellings of ducts but include estimates of the effects of irradiation-creep relaxation of thermally induced bowing stresses. The results illustrate the manners in which at-power creeps may affect subsequent duct deflections at zero power and thereby the trends of the bowing component of a subsequent power reactivity decrement
Time constants and feedback transfer functions of EBR-II subassembly types
International Nuclear Information System (INIS)
Grimm, K.N.; Meneghetti, D.
1986-01-01
Time constants, feedback reactivity transfer functions and power coefficients are calculated for stereotypical subassemblies in the EBR-II reactor. These quantities are calculated from nodal reactivities obtained from a reactor kinetic code analysis for a step change in power. Due to the multiplicity of eigenvalues, there are several time constants for each nodal position in a subassembly. Compared with these calculated values are analytically derived values for the initial node of a given channel
Time constants and feedback transfer functions of EBR-II subassembly types
International Nuclear Information System (INIS)
Grimm, K.N.; Meneghetti, D.
1987-01-01
Time constants, feedback reactivity transfer functions and power coefficients are calculated for stereotypical subassemblies in the EBR-II reactor. These quantities are calculated from nodal reactivities obtained from a reactor kinetic code analysis for a step change in power. Due to the multiplicity of eigenvalues, there are several time constants for each nodal position in a subassembly. Compared with these calculated values are analytically derived values for the initial node of a given channel. (author)
LMFBR operational safety: the EBR-II experience
International Nuclear Information System (INIS)
Sackett, J.I.; Allen, N.L.; Dean, E.M.; Fryer, R.M.; Larson, H.A.; Lehto, W.K.
1978-01-01
The mission of the Experimental Breeder Reactor II (EBR-II) has evolved from that of a small LMFBR demonstration plant to a major irradiation-test facility. Because of that evolution, many operational-safety issues have been encountered. The paper describes the EBR-II operational-safety experience in four areas: protection-system design, safety-document preparation, tests of off-normal reactor conditions, and tests of elements with breached cladding
Decontamination and decommissioning of the EBR-I Complex. Final report
International Nuclear Information System (INIS)
Kendall, E.W.; Wang, D.K.
1975-07-01
This final report covers the Decontamination and Decommissioning (D and D) of the Experimental Breeder Reactor No. 1 (EBR-I) Complex funded under Contract No. AT(10-1)-1375. The major effort consisted of removal and processing of 5500 gallons of sodium/potassium (NaK) coolant from the EBR-I reactor system. Tests were performed to assess the explosive hazards of NaK and KO 2 in various environments and in contact with various contaminants likely to be encountered in the removal and processing operations. A NaK process plant was designed and constructed and the operation was successfully completed. Lesser effort was required for D and D of the Zero Power Reactor (ZPR-III) Facility, the Argonne Fast Source Reactor (AFSR) Shielding, and removal of contaminated NaK from the storage pit. The D and D effort was completed by 13 June 1975, ahead of schedule. (auth)
Applications of the EBR-II Probabilistic Risk Assessment
International Nuclear Information System (INIS)
Roglans, J.: Ragland, W.A.; Hill, D.J.
1993-01-01
A Probabilistic Risk Assessment (PRA) of the Experimental Breeder Reactor 11 (EBR-11), a Department of Energy (DOE) Category A research reactor, has recently been completed at Argonne National Laboratory (ANL), and has been performed with close collaboration between PRA analysts and engineering and operations staff. A product of this Involvement of plant personnel has been a excellent acceptance of the PRA as a tool, which has already resulted In a variety of applications of the EBR-11 PRA. The EBR-11 has been used in support of plant hardware and procedure modifications and In new system design work. A new application in support of the refueling safety analysis will be completed in the near future
Improvements in EBR-2 core depletion calculations
International Nuclear Information System (INIS)
Finck, P.J.; Hill, R.N.; Sakamoto, S.
1991-01-01
The need for accurate core depletion calculations in Experimental Breeder Reactor No. 2 (EBR-2) is discussed. Because of the unique physics characteristics of EBR-2, it is difficult to obtain accurate and computationally efficient multigroup flux predictions. This paper describes the effect of various conventional and higher order schemes for group constant generation and for flux computations; results indicate that higher-order methods are required, particularly in the outer regions (i.e. the radial blanket). A methodology based on Nodal Equivalence Theory (N.E.T.) is developed which allows retention of the accuracy of a higher order solution with the computational efficiency of a few group nodal diffusion solution. The application of this methodology to three-dimensional EBR-2 flux predictions is demonstrated; this improved methodology allows accurate core depletion calculations at reasonable cost. 13 refs., 4 figs., 3 tabs
International Nuclear Information System (INIS)
Gillette, J.L.; Singer, R.M.; Tokar, J.V.; Sullivan, J.E.
1979-01-01
A series of tests have been conducted in EBR-II which studied the dynamics of the transition from forced to natural circulation flow in a liquid-metal-cooled fast breeder reactor (LMFBR). Each test was initiated by abruptly tripping an electromagnetic pump which supplies 5 to 6% of the normal full operational primary flow rate. The ensuing flow coast-down reached a minimum value after which the flow increased as natural circulation was established. The effects of secondary system flow through the intermediate heat exchanger and reactor decay power level on the minimum in-core flow rates and maximum in-core temperatures were examined
International Nuclear Information System (INIS)
Larson, H.A.; Dean, E.M.
1985-01-01
The two computer programs are successful in modeling the EBR-II ACRDS. In fact, this is very convenient for a presampling of the consequences of a desired power movement. The ACRDS is to be modified so that the error signal is a comparison between demand position and measured position. Purpose of this change is to permit pseudo-random binary types of reactivity transfer function experiments at EBR-II. Questions asked about the computer software and hardware to accommodate this change can be quickly answered with either of the verified codes discussed here
Operational-safety advantages of LMFBR's: the EBR-II experience and testing program
International Nuclear Information System (INIS)
Sackett, J.I.; Lindsay, R.W.; Golden, G.H.
1982-01-01
LMFBR's contain many inherent characteristics that simplify control and improve operating safety and reliability. The EBR-II design is such that good advantage was taken of these characteristics, resulting in a vary favorable operating history and allowing for a program of off-normal testing to further demonstrate the safe response of LMFBR's to upsets. The experience already gained, and that expected from the future testing program, will contribute to further development of design and safety criteria for LMFBR's. Inherently safe characteristics are emphasized and include natural convective flow for decay heat removal, minimal need for emergency power and a large negative reactivity feedback coefficient. These characteristics at EBR-II allow for ready application of computer diagnosis and control to demonstrate their effectiveness in response to simulated plant accidents. This latter testing objective is an important part in improvements in the man-machine interface
Embedded computer systems for control applications in EBR-II
International Nuclear Information System (INIS)
Carlson, R.B.; Start, S.E.
1993-01-01
The purpose of this paper is to describe the embedded computer systems approach taken at Experimental Breeder Reactor II (EBR-II) for non-safety related systems. The hardware and software structures for typical embedded systems are presented The embedded systems development process is described. Three examples are given which illustrate typical embedded computer applications in EBR-II
International Nuclear Information System (INIS)
Makowitz, H.; Barber, D.G.; Dean, E.M.
1989-01-01
A ''Tightly Coupled'' transient analysis system for the Experimental Breeder Reactor-II (FBR-II) is presently under development. The system consists of a faster-than-real-time high fidelity reactor simulation, advanced graphics displays, expert system coupling, and real-time data coupling via the EBR-II data acquisition system to and from the plant and the control system. The first generation software has been developed and tested. Various subsystem couplings and the total system integration have been checked out. A ''Lightly Coupled'' EBR-II reactor startup was conducted in August of 1988 as a demonstration of the system. This system should enhance the diagnostic and prognostic capability of EBR-II in the near term and provide automatic control during startup and power maneuvering in the future, as well as serve as a testbed for new control system development for advanced reactors. 8 refs., 7 figs., 1 tab
Pattern-recognition system application to EBR-II plant-life extension
International Nuclear Information System (INIS)
King, R.W.; Radtke, W.H.; Mott, J.E.
1988-01-01
A computer-based pattern-recognition system, the System State Analyzer (SSA), is being used as part of the EBR-II plant-life extension program for detection of degradation and other abnormalities in plant systems. The SSA is used for surveillance of the EBR-II primary system instrumentation, primary sodium pumps, and plant heat balances. Early results of this surveillance indicate that the SSA can detect instrumentation degradation and system performance degradation over varying time intervals, and can provide derived signal values to replace signals from failed critical sensors. These results are being used in planning for extended-life operation of EBR-II
Results and implications of the EBR-II inherent safety demonstration tests
International Nuclear Information System (INIS)
Planchon, H.P.; Golden, G.H.; Sackett, J.I.; Mohr, D.; Chang, L.K.; Feldman, E.E.; Betten, P.R.
1987-01-01
On April 3, 1986 two milestone tests were conducted in Experimental Breeder Reactor-2 (EBR-II). The first test was a loss of flow without scram and the second was a loss of heat sink without scram. Both tests were initiated from 100% power and in both tests the reactor was shut down by natural processes, principally thermal expansion, without automatic scram, operator intervention or the help of special in-core devices. The temperature transients during the tests were mild, as predicted, and there was no damage to the core or reactor plant structures. In a general sense, therefore, the tests plus supporting analysis demonstrated the feasibility of inherent passive shutdown for undercooling accidents in metal-fueled LMRs. The results provide a technical basis for future experiments in EBR-II to demonstrate inherent safety for overpower accidents and provide data for validation of computer codes used for design and safety analysis of inherently safe reactor plants
SASSYS validation with the EBR-II shutdown heat removal tests
International Nuclear Information System (INIS)
Herzog, J.P.
1989-01-01
SASSYS is a coupled neutronic and thermal hydraulic code developed for the analysis of transients in liquid metal cooled reactors (LMRs). The code is especially suited for evaluating of normal reactor transients -- protected (design basis) and unprotected (anticipated transient without scram) transients. Because SASSYS is heavily used in support of the IFR concept and of innovative LMR designs, such as PRISM, a strong validation base for the code must exist. Part of the validation process for SASSYS is analysis of experiments performed on operating reactors, such as the metal fueled Experimental Breeder Reactor -- II (EBR-II). During the course of a series of historic whole-plant experiments, EBR-II illustrated key safety features of metal fueled LMRs. These experiments, the Shutdown Heat Removal Tests (SHRT), culminated in unprotected loss of flow and loss of heat sink transients from full power and flow. Analysis of these and earlier SHRT experiments constitutes a vital part of SASSYS validation, because it facilitates scrutiny of specific SASSYS models and of integrated code capability. 12 refs., 11 figs
Reactivity-induced time-dependencies of EBR-II linear and non-linear feedbacks
International Nuclear Information System (INIS)
Grimm, K.N.; Meneghetti, D.
1988-01-01
Time-dependent linear feedback reactivities are calculated for stereotypical subassemblies in the EBR-II reactor. These quantities are calculated from nodal reactivities obtained from a kinetic code analysis of an experiment in which the change in power resulted from the dropping of a control rod. Shown with these linear reactivities are the reactivity associated with the control-rod shaft contraction and also time-dependent non-linear (mainly bowing) component deduced from the inverse kinetics of the experimentally measured fission power and the calculated linear reactivities. (author)
International Nuclear Information System (INIS)
Grimm, K.N.; Meneghetti, D.
1986-09-01
Time constants, feedback reactivity transfer functions and power coefficients are calculated for stereotypical subassemblies in the EBR-II reactor. These quantities are calculated from nodal reactivities obtained from a reactor kinetic code analysis for a step change in power. Due to the multiplicity of eigenvalues, there are several time constants for each nodal position in a subassembly. Compared with these calculated values are analytically derived values for the initial node of a given channel
Experimental studies of U-Pu-Zr fast reactor fuel pins in EBR-II [Experimental Breeder Reactor
International Nuclear Information System (INIS)
Pahl, R.G.; Porter, D.L.; Lahm, C.E.; Hofman, G.L.
1988-01-01
The Integral Fast Reactor (IFR) is a generic reactor concept under development by Argonne National Laboratory. Much of the technology for the IFR is being demonstrated at the Experimental Breeder Reactor II (EBR-II) on the Department of Energy site near Idaho Falls, Idaho. The IFR concept relies on four technical features to achieve breakthroughs in nuclear power economics and safety: (1) a pool-type reactor configuration, (2) liquid sodium cooling, (3) metallic fuel, and (4) an integral fuel cycle with on-site reprocessing. The purpose of this paper will be to summarize our latest results of irradiation testing uranium-plutonium-zirconium (U-Pu-Zr) fuel in the EBR-II. 10 refs., 13 figs., 2 tabs
International Nuclear Information System (INIS)
Smith, M.S.; Ragland, W.A.
1989-01-01
The National Academy of Sciences review of US Department of Energy (DOE) class 1 reactors recommended that the Experimental Breeder Reactor II (EBR-II), operated by Argonne National Laboratory (ANL), develop a level 1 probabilistic risk assessment (PRA) and make provisions for level 2 and level 3 PRAs based on the results of the level 1 PRA. The PRA analysis group at ANL will utilize the Centralized Reliability Data Organization (CREDO) at Oak Ridge National Laboratory to support the PRA data needs. CREDO contains many years of empirical liquid-metal reactor component data from EBR-II. CREDO is a mutual data- and cost-sharing system sponsored by DOE and the Power Reactor and Nuclear Fuels Development Corporation of Japan. CREDO is a component based data system; data are collected on components that are liquid-metal specific, associated with a liquid-metal environment, contained in systems that interface with liquid-metal environments, or are safety related for use in reliability/availability/maintainability (RAM) analyses of advanced reactors. The links between the EBR-II PRA development effort and the CREDO data collection at EBR-II extend beyond the sharing of data. The PRA provides a measure of the relative contribution to risk of the various components. This information can be used to prioritize future CREDO data collection activities at EBR-II and other sites
Remote, under-sodium fuel handling experience at EBR-II
International Nuclear Information System (INIS)
King, R.W.; Planchon, H.P.
1995-01-01
The EBR-II is a pool-type design; the reactor fuel handling components and entire primary-sodium coolant system are submerged in the primary tank, which is 26 feet in diameter, 26 feet high, and contains 86,000 gallons of sodium. Since the reactor is submerged in sodium, fuel handling operations must be performed blind, making exact positioning and precision control of the fuel handling system components essential. EBR-II operated for 30 years, and the fuel handling system has performed approximately 25,000 fuel transfer operations in that time. Due to termination of the IFR program, EBR-II was shut down on September 30, 1994. In preparation for decommissioning, all fuel in the reactor will be transferred out of EBR-II to interim storage. This intensive fuel handling campaign will last approximately two years, and the number of transfers will be equivalent to the fuel handling done over about nine years of normal reactor operation. With this demand on the system, system reliability will be extremely important. Because of this increased demand, and considering that the system has been operating for about 32 years, system upgrades to increase reliability and efficiency are proceeding. Upgrades to the system to install new digital, solid state controls, and to take advantage of new visualization technology, are underway. Future reactor designs using liquid metal coolant will be able to incorporate imaging technology now being investigated, such as ultraviolet laser imaging and ultrasonic imaging
Technical assessment of continued wet storage of EBR-II fuel
International Nuclear Information System (INIS)
Pahl, R.G.; Franklin, E.M.; Ebner, M.A.
1996-01-01
A technical assessment of the continued wet storage of EBR-II fuel has been made. Previous experience has shown that in-basin cladding failure occurs by intergranular attack of sensitized cladding, likely assisted by basin water chlorides. Subsequent fuel oxidation is rapid and leads to loss of configuration and release of fission products. The current inventory of EBR-II fuel stored in the ICPP basins is at risk from similar corrosion reactions
EBR-II experience with sodium cleaning and radioactivity decontamination
International Nuclear Information System (INIS)
Ruther, W.E.; Smith, C.R.F.
1978-01-01
The EBR-II is now in Its 13th year of operation. During that period more than 2400 subassemblies have been cleaned of sodium without a serious incident of any kind by a two-step process developed at Argonne. Sodium cleaning and decontamination of other reactor components has been performed only on the relatively few occasions in which a repair or replacement has been required. A summary of the EBR-II experience will be presented. A new facility will be described for the improved cleaning and maintenance of sodium-wetted primary components
EBR-II experience with sodium cleaning and radioactivity decontamination
Energy Technology Data Exchange (ETDEWEB)
Ruther, W E; Smith, C R.F. [Argonne National Laboratory, Argonne (United States)
1978-08-01
The EBR-II is now in Its 13th year of operation. During that period more than 2400 subassemblies have been cleaned of sodium without a serious incident of any kind by a two-step process developed at Argonne. Sodium cleaning and decontamination of other reactor components has been performed only on the relatively few occasions in which a repair or replacement has been required. A summary of the EBR-II experience will be presented. A new facility will be described for the improved cleaning and maintenance of sodium-wetted primary components.
Comparison of measured and calculated composition of irradiated EBR-II blanket assemblies
International Nuclear Information System (INIS)
Grimm, K. N.
1998-01-01
In anticipation of processing irradiated EBR-II depleted uranium blanket subassemblies in the Fuel Conditioning Facility (FCF) at ANL-West, it has been possible to obtain a limited set of destructive chemical analyses of samples from a single EBR-II blanket subassembly. Comparison of calculated values with these measurements is being used to validate a depletion methodology based on a limited number of generic models of EBR-II to simulate the irradiation history of these subassemblies. Initial comparisons indicate these methods are adequate to meet the operations and material control and accountancy (MC and A) requirements for the FCF, but also indicate several shortcomings which may be corrected or improved
Review process and quality assurance in the EBR-II probabilistic risk assessment
International Nuclear Information System (INIS)
Roglans, J.; Hill, D.J.; Ragland, W.A.
1992-01-01
A Probabilistic Risk Assessment (PRA) of the Experimental Breeder Reactor II (EBR-II), a Department of Energy (DOE) Category A reactor, has recently been completed at Argonne National Laboratory (ANL). Within the scope of the ANL QA Programs, a QA Plan specifically for the EBR-II PRA was developed. The QA Plan covered all aspects of the PRA development, with emphasis on the procedures for document and software control, and the internal and external review process. The effort spent in the quality assurance tasks for the EBR-II PRA has reciprocated by providing acceptance of the work and confidence in the quality of the results
Safety analysis report. Decontamination and decommissioning of the EBR-I Complex
International Nuclear Information System (INIS)
Commander, J.C.; Macbeth, P.J.; Michels, D.E.
1975-06-01
The safety aspects of the planned EBR-I Complex decontamination and decommissioning operations are assessed. The major operations are: (1) removal of NaK from the EBR-I primary and secondary coolant systems, (2) processing of the NaK to produce solid caustic for disposal, (3) decontamination of contaminated areas of EBR-I and ZPR-III, (4) removal of items that cannot be decontaminated economically to acceptably safe levels, (5) isolation of contaminated areas, (6) demolition of the AFSR Shielding, and (7) removal of contaminated vessels from the NaK storage pit. It may be concluded that although potential hazards do exist from explosion, chemical burns and low-level radioactive exposure from the D and D operation, these hazards represent acceptable risks provided that the established procedures and precautions are followed. (U.S.)
Development and testing of a diagnostic system for intelligen distributed control at EBR-2
International Nuclear Information System (INIS)
Edwards, R.M.; Ruhl, D.W.; Klevans, E.H.; Robinson, G.E.
1990-01-01
A diagnostic system is under development for demonstration of Intelligent Distributed Control at the Experimental Breeder Reactor (EBR--II). In the first phase of the project a diagnostic system is being developed for the EBR-II steam plant based on the DISYS expert systems approach. Current testing uses recorded plant data and data from simulated plant faults. The dynamical simulation of the EBR-II steam plant uses the Babcock and Wilcox (B ampersand W) Modular Modeling System (MMS). At EBR-II the diagnostic system operates in the UNIX workstation and receives live plant data from the plant Data Acquisition System (DAS). Future work will seek implementation of the steam plant diagnostic in a distributed manner using UNIX based computers and Bailey microprocessor-based control system. 10 refs., 6 figs
Experience with advanced driver fuels in EBR-II
International Nuclear Information System (INIS)
Lahm, C.E.; Koenig, J.F.; Pahl, R.G.; Porter, D.L.; Crawford, D.C.
1992-01-01
This paper discusses several metallic fuel element designs which have been tested and used as driver fuel in Experimental Breeder Reactor II (EBR-II). The most recent advanced designs have all performed acceptably in EBR-H and can provide reliable performance to high burnups. Fuel elements tested have included use of U-l0Zr metallic fuel with either D9, 316 or HT9 stainless steel cladding; the D9 and 316-clad designs have been used as standard driver fuel. Experimental data indicate that fuel performance characteristics are very similar for the various designs tested. Cladding materials can be selected that optimize performance based on reactor design and operational goals
Nuclear instrumentation system operating experience and nuclear instrument testing in the EBR-II
International Nuclear Information System (INIS)
Yingling, G.E.; Curran, R.N.
1980-01-01
In March of 1972 three wide range nuclear channels were purchased from Gulf Atomics Corporation and installed in EBR-II as a test. The three channels were operated as a test until April 1975 when they became a permanent part of the reactor shutdown system. Also described are the activities involved in evaluating and qualifying neutron detectors for LMFBR applications. Included are descriptions of the ANL Components Technology Division Test Program and the EBR-II Nuclear Instrument Test Facilities (NITF) used for the in-reactor testing and a summary of program test results from EBR-II
Proof tests of irradiated and unirradiated EBR-II subassembly ducts
International Nuclear Information System (INIS)
Ruther, W.E.; Chopra, P.S.; Lambert, J.D.B.
1977-01-01
A series of dynamic pressure tests have been conducted within EBR-II subassembly ducts. The tests were designed to simulate bursting of a driver-fuel element in a cluster of such elements at their burnup limit during off-normal conditions in EBR-II. The major objective of the tests was to assure that such failure, which might cause rapid release of stored fission gas, would not deform or otherwise damage subassembly ducts in a way that would hinder movement of a control rod. The test results are described
Run-beyond-clad-breach oxide testing in EBR-2
International Nuclear Information System (INIS)
Lambert, J.D.B.; Bottcher, J.H.; Strain, R.V.; Gross, K.C.; Lee, M.J.; Webb, J.P.; Colburn, R.P.; Ukai, S.; Nomura, S.; Odo, T.; Shikakura, S.
1990-01-01
Fourteen tests sponsored by the US and Japan were used to study reliability of breached LMR oxide fuel pins during continued operation in EBR-II for a range of conditions and parameters. The fuel-sodium reaction product governed pin behavior. It extended primary breaches by swelling and promoted secondary failures, yet it inhibited loss of fuel and fission products and enhanced release of delayed neutrons used in monitoring breach condition. Fission gas and cesium, the main contaminants from failures, could be adequately controlled. This positive EBR-II experience suggested that limited operation with failed fuel may be feasible in commercial LMR's. 16 refs., 14 figs., 4 tabs
Deactivation of the EBR-II complex
Energy Technology Data Exchange (ETDEWEB)
Michelbacher, J.A.; Earle, O.K.; Henslee, S.P. [and others
1997-12-31
In January of 1994, the Department of Energy mandated the termination of the Integral Fast Reactor (IFR) Program, effective October 1, 1994. To comply with this decision, Argonne National Laboratory-West (ANL-W) prepared a plan providing detailed requirements to place the Experimental Breeder Reactor-II (EBR-II) in a radiologically and industrially safe condition, including removal of all irradiated fuel assemblies from the reactor plant, and removal and stabilization of the primary and secondary sodium, a liquid metal used to transfer heat within the reactor plant. The ultimate goal of the deactivation process is to place the EBR-II complex in a stable condition until a decontamination and decommissioning (D&D) plan can be prepared, thereby minimizing requirements for maintenance and surveillance and maximizing the amount of time for radioactive decay. The final closure state will be achieved in full compliance with federal, state and local environmental, safety, and health regulations and requirements. The decision to delay the development of a detailed D&D plan has necessitated this current action. The EBR-II is a pool-type reactor. The primary system contains approximately 87,000 gallons of sodium, while the secondary system has 13,000 gallons. In order to properly dispose of the sodium in compliance with the Resource Conservation and Recovery Act (RCRA), a facility has been built to react the sodium to a dry carbonate powder in a two stage process. Deactivation of a liquid metal fast breeder reactor (LMFBR) presents unique concerns. Residual amounts of sodium remaining in the primary and secondary systems must be either reacted or inerted to preclude future concerns with sodium-air reactions that generate explosive mixtures of hydrogen and leave corrosive compounds. Residual amounts of sodium on components will effectively {open_quotes}solder{close_quotes} components in place, making future operation or removal unfeasible.
Deactivation of the EBR-II complex
International Nuclear Information System (INIS)
Michelbacher, J.A.; Earle, O.K.; Henslee, S.P.
1997-01-01
In January of 1994, the Department of Energy mandated the termination of the Integral Fast Reactor (IFR) Program, effective October 1, 1994. To comply with this decision, Argonne National Laboratory-West (ANL-W) prepared a plan providing detailed requirements to place the Experimental Breeder Reactor-II (EBR-II) in a radiologically and industrially safe condition, including removal of all irradiated fuel assemblies from the reactor plant, and removal and stabilization of the primary and secondary sodium, a liquid metal used to transfer heat within the reactor plant. The ultimate goal of the deactivation process is to place the EBR-II complex in a stable condition until a decontamination and decommissioning (D ampersand D) plan can be prepared, thereby minimizing requirements for maintenance and surveillance and maximizing the amount of time for radioactive decay. The final closure state will be achieved in full compliance with federal, state and local environmental, safety, and health regulations and requirements. The decision to delay the development of a detailed D ampersand D plan has necessitated this current action. The EBR-II is a pool-type reactor. The primary system contains approximately 87,000 gallons of sodium, while the secondary system has 13,000 gallons. In order to properly dispose of the sodium in compliance with the Resource Conservation and Recovery Act (RCRA), a facility has been built to react the sodium to a dry carbonate powder in a two stage process. Deactivation of a liquid metal fast breeder reactor (LMFBR) presents unique concerns. Residual amounts of sodium remaining in the primary and secondary systems must be either reacted or inerted to preclude future concerns with sodium-air reactions that generate explosive mixtures of hydrogen and leave corrosive compounds. Residual amounts of sodium on components will effectively open-quotes solderclose quotes components in place, making future operation or removal unfeasible
Data handling at EBR-II [Experimental Breeder Reactor II] for advanced diagnostics and control work
International Nuclear Information System (INIS)
Lindsay, R.W.; Schorzman, L.W.
1988-01-01
Improved control and diagnostics systems are being developed for nuclear and other applications. The Experimental Breeder Reactor II (EBR-II) Division of Argonne National Laboratory has embarked on a project to upgrade the EBR-II control and data handling systems. The nature of the work at EBR-II requires that reactor plant data be readily available for experimenters, and that the plant control systems be flexible to accommodate testing and development needs. In addition, operational concerns require that improved operator interfaces and computerized diagnostics be included in the reactor plant control system. The EBR-II systems have been upgraded to incorporate new data handling computers, new digital plant process controllers, and new displays and diagnostics are being developed and tested for permanent use. In addition, improved engineering surveillance will be possible with the new systems
System modelling to support accelerated fuel transfer rate at EBR-II
International Nuclear Information System (INIS)
Imel, G.R.; Houshyar, A.; Planchon, H.P.; Cutforth, D.C.
1995-01-01
The Experimental Breeder Reactor-II (EBR-II) ia a 62.5 MW(th) liquid metal reactor operated by Argonne National Laboratory for The United States Department of Energy. The reactor is located near Idaho Falls, Idaho at the Argonne-West site (ANL-W). Full power operation was achieved in 1964,- the reactor operated continuously since that time until October 1994 in a variety of configurations depending on the programmatic mission. A three year program was initiated in October, 1993 to replace the 330 depleted uranium blanket subassemblies (S/As) with stainless steel reflectors. It was intended to operate the reactor during the three year blanket unloading program, followed by about a half year of driver fuel unloading. However, in the summer of 1994, Congress dictacted that EBR-II be shut down October 1, and complete defueling without operation. To assist in the planning for resources needed for this defueling campaign, a mathematical model of the fuel handling sequence was developed utilizing the appropriate reliability factors and inherent mm constraints of each stage of the process. The model allows predictions of transfer rates under different scenarios. Additionally, it has facilitated planning of maintenance activities, as well as optimization of resources regarding manpower and modification effort. The model and its application is described in this paper
Deactivation of the EBR-II complex
International Nuclear Information System (INIS)
Michelbacher, J.A.; Earle, O.K.; Henslee, S.P.; Wells, P.B.; Zahn, T.P.
1996-01-01
In January of 1994, the Department of Energy mandated the termination of the Integral Fast Reactor (IFR) Program, effective October 1, 1994. To comply with this decision, Argonne National Laboratory-West (ANL-W) prepared a plan providing detailed requirements to place the Experimental Breeder Reactor-II (EBR-II) in a radiologically and industrially safe condition, including removal of all irradiated fuel assemblies from the reactor plant, and removal and stabilization of the primary and secondary sodium, a liquid metal used to transfer heat within the reactor plant. The ultimate goal of the deactivation process is to place the EBR-II complex in a stable condition until a decontamination and decommissioning (D and D) plan can be prepared, thereby minimizing requirements for maintenance and surveillance and maximizing the amount of time for radioactive decay. The final closure state will be achieved in full compliance with federal, state and local environmental, safety, and health regulations and requirements. The decision to delay the development of a detailed D and D plan has necessitated this current action
Deactivation of the EBR-II complex
Energy Technology Data Exchange (ETDEWEB)
Michelbacher, J A; Earle, O K; Henslee, S P; Wells, P B; Zahn, T P
1996-01-01
In January of 1994, the Department of Energy mandated the termination of the Integral Fast Reactor (IFR) Program, effective October 1, 1994. To comply with this decision, Argonne National Laboratory-West (ANL-W) prepared a plan providing detailed requirements to place the Experimental Breeder Reactor-II (EBR-II) in a radiologically and industrially safe condition, including removal of all irradiated fuel assemblies from the reactor plant, and removal and stabilization of the primary and secondary sodium, a liquid metal used to transfer heat within the reactor plant. The ultimate goal of the deactivation process is to place the EBR-II complex in a stable condition until a decontamination and decommissioning (D and D) plan can be prepared, thereby minimizing requirements for maintenance and surveillance and maximizing the amount of time for radioactive decay. The final closure state will be achieved in full compliance with federal, state and local environmental, safety, and health regulations and requirements. The decision to delay the development of a detailed D and D plan has necessitated this current action.
Performance of commercially produced mixed-oxide fuels in EBR-II
International Nuclear Information System (INIS)
Hales, J.W.; Lawrence, L.A.
1980-11-01
Commercially produced fuels for the Fast Flux Test Facility (FFTF) were irradiated in EBR-II under conditions of high cladding temperature (approx. 700 0 C) and low power (approx. 200 W/cm) to verify that manufacturing processes did not introduce variables which significantly affect general fuel performance. Four interim examinations and a terminal examination were completed to a peak burnup of 5.2 at. % to provide irradiation data pertaining to fuel restructuring and dimensional stability at low fuel temperature, fuel-cladding reactions at high cladding temperature and general fuel behavior. The examinations indicate completely satisfactory irradiation performance for low heat rates and high cladding temperatures to 5.2 at. % burnup
Safety philosophy in upgrading the EBR-II plant protection system
International Nuclear Information System (INIS)
Sackett, J.I.
1976-01-01
The EBR-II plant protection system (PPS) has been substantially modified, upgrading its performance to more fully comply with modern safety philosophy and criteria. The upgrading effort required that the total reactor system be evaluated for possible faults and that a PPS be designed to accommodate them. The result was deletion of a number of existing trip functions and upgrading of others. Particular attention was given to loss of primary pumping power and reactivity insertion events. The design and performance criteria for the PPS has been more firmly established, understanding of the PPS function has been improved and the reactor has been subjected to fewer spurious trips, improving operational reliability
Characterization of spent EBR-II driver fuel
International Nuclear Information System (INIS)
McKnight, R. D.
1998-01-01
Operations and material control and accountancy requirements for the Fuel Conditioning Facility demand accurate prediction of the mass flow of spent EBR-II driver fuel into the facility. This requires validated calculational tools that can predict the burnup and isotopic distribution in irradiated Zr-alloy fueled driver assemblies. Detailed core-follow depletion calculations have been performed for an extensive series of EBR-II runs to produce a database of material inventories for the spent fuel to be processed. As this fuel is processed, comparison of calculated values with measured data obtained from samples of this fuel is producing a growing set of validation data. A more extensive set of samples and measurements from the initial processing of irradiated driver fuel has produced valuable estimates of the biases and uncertainties in both the measured and calculated values. Results of these comparisons are presented herein and indicate the calculated values adequately predict the mass flows
Breached fuel pin contamination from Run Beyond Cladding Breach (RBCB) tests in EBR-II
International Nuclear Information System (INIS)
Colburn, R.P.; Strain, R.V.; Lambert, J.D.B.; Ukai, S.; Shibahara, I.
1988-09-01
Studies indicate there may be a large economic incentive to permit some continued reactor operation with breached fuel pin cladding. A major concern for this type of operation is the potential spread of contamination in the primary coolant system and its impact on plant maintenance. A study of the release and transport of contamination from naturally breached mixed oxide Liquid Metal Reactor (LMR) fuel pins was performed as part of the US Department of Energy/Power Reactor and Nuclear Fuel Development Corporation (DOE/PNC) Run Beyond Cladding Breach (RBCB) Program at EBR-II. The measurements were made using the Breached Fuel Test Facility (BFTF) at EBR-II with replaceable deposition samplers located approximately 1.5 meters from the breached fuel test assemblies. The effluent from the test assemblies containing the breached fuel pins was routed up through the samplers and past dedicated instrumentation in the BFTF before mixing with the main coolant flow stream. This paper discusses the first three contamination tests in this program. 2 refs., 5 figs., 2 tabs
Current status of experimental breeder reactor-II [EBR-II] shutdown planning
International Nuclear Information System (INIS)
McDermott, M. D.; Griffin, C. D.; Michelbacher, J. A.; Earle, O. K.
2000-01-01
The Experimental Breeder Reactor--II (EBR-II) at Argonne National Laboratory--West (ANL-W) in Idaho, was shutdown in September, 1994 as mandated by the US Department of Energy. This sodium cooled reactor had been in service since 1964, and was to be placed in an industrially and radiologically safe condition for ultimate decommissioning. The deactivation of a liquid metal reactor presents unique concerns. The first major task associated with the project was the removal of all fueled assemblies. In addition, sodium must be drained from systems and processed for ultimate disposal. Residual quantities of sodium remaining in systems must be deactivated or inerted to preclude future hazards associated with pyrophoricity and generation of potentially explosive hydrogen gas. A Sodium Process Facility was designed and constructed to react the elemental sodium from the EBR-II primary and secondary systems to sodium hydroxide for disposal. This facility has a design capacity to allow the reaction of the complete inventory of sodium at ANL-W in less than two years. Additional quantities of sodium from the Fermi-1 reactor are also being treated at the Sodium Process Facility. The sodium environment and the EBR-II configuration, combined with the radiation and contamination associated with thirty years of reactor operation, posed problems specific to liquid metal reactor deactivation. The methods being developed and implemented at EBR-II can be applied to other similar situations in the US and abroad
27 CFR 6.94 - Educational seminars.
2010-04-01
... OF THE TREASURY LIQUORS âTIED-HOUSEâ Exceptions § 6.94 Educational seminars. An industry member may give or sponsor educational seminars for employees of retailers either at the industry member's... equipment, training seminars for employees of retailers, or tours of industry member's plant premises. This...
Off-normal performance of EBR-II [Experimental Breeder Reactor] driver fuel
International Nuclear Information System (INIS)
Seidel, B.R.; Batte, G.L.; Lahm, C.E.; Fryer, R.M.; Koenig, J.F.; Hofman, G.L.
1986-09-01
The off-normal performance of EBR-II Mark-II driver fuel has been more than satisfactory as demonstrated by robust reliability under repeated transient overpower and undercooled loss-of-flow tests, by benign run-beyond-cladding-breach behavior, and by forgiving response to fabrication defects including lack of bond. Test results have verified that the metallic driver fuel is very tolerant of off-normal events. This behavior has allowed EBR-II to operate in a combined steady-state and transient mode to provide test capability without limitation from the metallic driver fuel
Experience with automatic reactor control at EBR-II
International Nuclear Information System (INIS)
Lehto, W.K.; Larson, H.A.; Christensen, L.J.
1985-01-01
Satisfactory operation of the ACRDS has extended the capabilities of EBR-II to a transient test facility, achieving automatic transient control. Test assemblies can now be irradiated in transient conditions overlapping the slower transient capability of the TREAT reactor
Analysis of carbon transport in the EBR-II and FFTF primary sodium systems
International Nuclear Information System (INIS)
Snyder, R.B.; Natesan, K.; Kassner, T.F.
1976-01-01
An analysis of the carburization-decarburization behavior of austenitic stainless steels in the primary heat-transport systems of the EBR-II and FFTF has been made that is based upon a kinetic model for the diffusion process and the surface area of steel in contact with flowing sodium at various temperatures in the two systems. The analysis was performed for operating conditions that result in sodium outlet temperatures of 474 and 566 0 C in the FFTF and 470 0 C in the EBR-II. If there was no external source of carbon to the system, i.e., other than the carbon initially present in the steel and the sodium, the dynamic-equilibrium carbon concentrations calculated for the FFTF primary sodium were approximately 0.025 and approximately 0.065 ppm for the 474 and 566 0 C outlet temperatures, respectively, and approximately 0.018 ppm for the EBR-II primary system. The analysis indicated that a carbon-source rate of approximately 250 g/y would be required to increase the carbon concentration of the EBR-II sodium to the measured range of approximately 0.16--0.19 ppm. An evaluation of possible carbon sources and the amount of carbonaceous material introduced into the reactor cover gas and sodium suggests that the magnitude of the calculated contamination rate is reasonable. For a 566 0 C outlet temperature, carbonaceous material would have to be introduced into the FFTF primary system at a rate approximately 4--6 times higher than in EBR-II to achieve the same carbon concentration in the sodium in the two systems. Since contamination rates of approximately 1500 g/y are unlikely, high-temperature fuel cladding in the FFTF should exhibit decarburization similar to that observed in laboratory loop systems, in contrast to the minimal compositional changes that result after exposure of Type 316 stainless steel to EBR-II sodium at temperatures between approximately 625 and 650 0 C
Design of a reactor inlet temperature controller for EBR-2 using state feedback
International Nuclear Information System (INIS)
Vilim, R.B.; Planchon, H.P.
1990-01-01
A new reactor inlet temperature controller for pool type liquid-metal reactors has been developed and will be tested in EBR-II. The controller makes use of modern control techniques to take into account stratification and mixing in the cold pool during normal operation. Secondary flowrate is varied so that the reactor inlet temperature tracks a setpoint while reactor outlet temperature, primary flowrate and secondary cold leg temperature are treated as exogenous disturbances and are free to vary. A disturbance rejection technique minimizes the effect of these disturbances on inlet temperature. A linear quadratic regulator improves inlet temperature response. Tests in EBR-II will provide experimental data for assessing the performance improvements that modern control can produce over the existing EBR-II analog inlet temperature controller. 10 refs., 8 figs
Planning for closure and deactivation of the EBR-II complex
International Nuclear Information System (INIS)
Michelbacher, J.A.; Henslee, S.P.; Poland, H.F.; Wells, P.B.
1997-01-01
In January 1994, DOE terminated the Integral Fast Reactor (IFR) Program. Argonne National Laboratory-West (ANL-W) prepared a detailed plan to put Experimental Breeder Reactor-II (EBR-II) in a safe condition, including removal of irradiated fueled subassemblies from the plant, transfer of subassemblies, and removal and stabilization of primary and secondary sodium liquid heat transfer metal. The goal of deactivation is to stabilize the EBR-II complex until decontamination and decommissioning (D ampersand D) is implemented, thereby minimizing maintenance and surveillance. Deactivation of a sodium cooled reactor presents unique concerns. Residual sodium in the primary and secondary systems must be either reacted or inerted to preclude concerns with explosive sodium-air reactions. Also, residual sodium on components will effectively solder these items in place, making removal unfeasible. Several special cases reside in the primary system, including primary cold traps, a cesium trap, a cover gas condenser, and systems containing sodium-potassium alloy. The sodium or sodium-potassium alloy in these components must be reacted in place or the components removed. The Sodium Components Maintenance Shop at ANL-W provides the capability for washing primary components, removing residual quantities of sodium while providing some decontamination capacity. Considerations need to be given to component removal necessary for providing access to primary tank internals for D ampersand D activities, removal of hazardous materials, and removal of stored energy sources. ANL-W's plan for the deactivation of EBR-II addresses these issues, providing for an industrially and radiologically safe complex, requiring minimal surveillance during the interim period between deactivation and D ampersand D. Throughout the deactivation and closure of the EBR-II complex, federal environmental concerns will be addressed, including obtaining the proper permits for facility condition and waste processing
International Nuclear Information System (INIS)
Kisner, R.A.
1989-01-01
Oak Ridge National Laboratory (ORNL) and Argonne National Laboratory (ANL) are undertaking a joint project to develop control philosophies, strategies, and algorithms for computer control of the start-up mode of the Experimental Breeder Reactor II (EBR-II). The major objective of this project is to show that advanced liquid-metal reactor (LMR) plants can be operated from low power to full power using computer control. Development of an automated control system with this objective in view will help resolve specific issues and provide proof through demonstration that automatic control for plant start-up is feasible. This paper describes the approach that will be used to develop such a system and some of the features it is expected to have. Structured, rule-based methods, which will provide start-up capability from a variety of initial plant conditions and degrees of equipment operability, will be used for accomplishing mode changes during plant start-up. Several innovative features will be incorporated such as signal, command, and strategy validation to maximize reliability, flexibility to accommodate a wide range of plant conditions, and overall utility. Continuous control design will utilize figures of merit to evaluate how well the controller meets the mission requirements. The operator interface will have unique ''look ahead'' features to let the operator see what will happen next. 15 refs., 7 figs., 1 tab
SASSYS-1 computer code verification with EBR-II test data
International Nuclear Information System (INIS)
Warinner, D.K.; Dunn, F.E.
1985-01-01
The EBR-II natural circulation experiment, XX08 Test 8A, is simulated with the SASSYS-1 computer code and the results for the latter are compared with published data taken during the transient at selected points in the core. The SASSYS-1 results provide transient temperature and flow responses for all points of interest simultaneously during one run, once such basic parameters as pipe sizes, initial core flows, and elevations are specified. The SASSYS-1 simulation results for the EBR-II experiment XX08 Test 8A, conducted in March 1979, are within the published plant data uncertainties and, thereby, serve as a partial verification/validation of the SASSYS-1 code
Simulation of LMFBR pump transients and comparison to LOF that occurred at EBR-II
International Nuclear Information System (INIS)
Koenig, F.F.; Dean, E.M.
1985-01-01
In a large LMFBR plant design, a number of pumps in parallel will feed the core. It must be demonstrated that the plant can continue to operate with the loss of one of the primary pumps. It is desirable not to have check valves in the loop from a reliability and economic standpoint. Simulations have been made to determine the consequences of a loss of one pump in a four-loop pool plant in which no plant protection action is taken. This analysis would be used to determine the required power rundown that would accompany pump loss. The two primary centrifugal pumps in EBR-II feed the core and blanket plenums in two parallel flow paths. The loss of one pump will result in decrease core flow and reverse flow through the down pump since no check valves are present in the system. For a large pool plant with four primary pumps, the loss of one pump will also result in reverse flow through the down pump if check valves of flow diodes are not included. The resulting flow transient has been modeled for EBR-II and the large plant using the DNSP program
Operating limits for subassembly deformation in EBR-II
International Nuclear Information System (INIS)
Bottcher, J.H.
1977-01-01
The deformation of a subassembly in response to the core environment is frequently the life limiting factor for that component in an LMFBR. Deformation can occur as diametral and axial growth or bowing of the subassembly. Such deformation has caused several handling problems in both the core and the storage basket of EBR-II and may also have contributed to reactivity anomalies during reactor operation. These problems generally affect plant availability but the reactivity anomalies could lead to a potential safety hazard. Because of these effects the deformation mechanisms must be understood and modeled. Diametral and axial growth of subassembly ducts in EBR-II is due to swelling and creep and is a function of temperature, neutron fluence and stress. The source of stress in a duct is the hydraulic pressure difference across the wall. By coupling the calculated subassembly growth rate to the available clearance in the core or storage basket a limiting neutron fluence, or exposure, can be established
Water treatment in the EBR-II steam system
International Nuclear Information System (INIS)
Klein, M.A.; Hurst, H.
1975-01-01
Boiler-water treatment in the EBR-II steam system consists of demineralizing makeup water and using hydrazine to remove traces of oxygen and morpholine to adjust pH to 8.8-9.2. This treatment is called a ''zero-solids'' method, because the chemical agents and reaction products are either volatile or form water and do not contribute solids to the boiler water. A continuous blowdown is cooled, filtered, and deionized to remove impurities and maintain high purity of the water. If a cooling-water leak occurs, phosphate is added to control scaling, and the ''zero-solids'' eatment is suspended until the leak is repaired. Water streams are sampled at six points to control water purity. Examination of the steam drum and an evaporator show the metal surfaces to be in excellent condition with minimal corrosion. The EBR-II steam-generating plant has accumulated over 85,000 hours of in-service operation and has operated successfully for over ten years with the ''zero-solids'' treatment. (auth)
Microstructural comparison of HT-9 irradiated in HFIR and EBR-II
International Nuclear Information System (INIS)
Gelles, D.S.
1985-05-01
A series of specimens of HT-9 heat 91354 have been examined following irradiation in HFIR to 39 dpa at 300, 400, 500 and 600 0 C and following irradiation in EBR-II to 29 dpa at 390 and 500 0 C. HFIR irradiation was found to have promoted helium bubble formation at all temperatures and voids at 400 0 C. Cavitation had not been observed at lower fluence, nor was it found in EBR-II irradiated specimens. The onset of void swelling in HFIR is attributed to helium generation. The observations provide an explanation for saturation of ductile-brittle transition temperature shifts with increasing fluence
Energy Technology Data Exchange (ETDEWEB)
Steven R. Sherman
2005-04-01
Residual sodium is defined as sodium metal that remains behind in pipes, vessels, and tanks after the bulk sodium metal has been melted and drained from such components. The residual sodium has the same chemical properties as bulk sodium, and differs from bulk sodium only in the thickness of the sodium deposit. Typically, sodium is considered residual when the thickness of the deposit is less than 5-6 cm. This residual sodium must be removed or deactivated when a pipe, vessel, system, or entire reactor is permanently taken out of service, in order to make the component or system safer and/or to comply with decommissioning regulations. As an alternative to the established residual sodium deactivation techniques (steam-and-nitrogen, wet vapor nitrogen, etc.), a technique involving the use of moisture and carbon dioxide has been developed. With this technique, sodium metal is converted into sodium bicarbonate by reacting it with humid carbon dioxide. Hydrogen is emitted as a by-product. This technique was first developed in the laboratory by exposing sodium samples to humidified carbon dioxide under controlled conditions, and then demonstrated on a larger scale by treating residual sodium within the Experimental Breeder Reactor II (EBR-II) secondary cooling system, followed by the primary cooling system, respectively. The EBR-II facility is located at the Idaho National Laboratory (INL) in southeastern Idaho, U.S.A. This report is Part 1 of a two-part report. It is divided into three sections. The first section describes the chemistry of carbon dioxide-water-sodium reactions. The second section covers the laboratory experiments that were conducted in order to develop the residual sodium deactivation process. The third section discusses the application of the deactivation process to the treatment of residual sodium within the EBR-II secondary sodium cooling system. Part 2 of the report, under separate cover, describes the application of the technique to residual sodium
EVN observations of the OH megamaser galaxies Mrk 231 and IC 694
Klockner, HR; Baan, WA; Migenes,; Reid, MJ
2002-01-01
We present EVN observations of hydroxyl (OH) main-line emission in two megamaser sources Mrk 231 and IC 694. The observations indicate that the broad maser emission lines originate within the nuclear regions. A single 1667 MHz main-line feature is seen at the nucleus of IC 694. In Mrk 231 both
Advances in criticality predictions for EBR-II
International Nuclear Information System (INIS)
Schaefer, R.W.; Imel, G.R.
1994-01-01
Improvements to startup criticality predictions for the EBR-II reactor have been made. More exact calculational models, methods and data are now used, and better procedures for obtaining experimental data that enter into the prediction are in place. Accuracy improved by more than a factor of two and the largest ECP error observed since the changes is only 18 cents. An experimental method using subcritical counts is also being implemented
Ma, Min; Okuyama, Masayuki; Sato, Megumi; Tagami, Takayoshi; Klahan, Patcharapa; Kumagai, Yuya; Mori, Haruhide; Kimura, Atsuo
2017-08-01
Aspergillus niger α-glucosidase (ANG), a member of glycoside hydrolase family 31, catalyzes hydrolysis of α-glucosidic linkages at the non-reducing end. In the presence of high concentrations of maltose, the enzyme also catalyzes the formation of α-(1→6)-glucosyl products by transglucosylation and it is used for production of the industrially useful panose and isomaltooligosaccharides. The initial transglucosylation by wild-type ANG in the presence of 100 mM maltose [Glc(α1-4)Glc] yields both α-(1→6)- and α-(1→4)-glucosidic linkages, the latter constituting ~25% of the total transfer reaction product. The maltotriose [Glc(α1-4)Glc(α1-4)Glc], α-(1→4)-glucosyl product disappears quickly, whereas the α-(1→6)-glucosyl products panose [Glc(α1-6)Glc(α1-4)Glc], isomaltose [Glc(α1-6)Glc], and isomaltotriose [Glc(α1-6)Glc(α1-6)Glc] accumulate. To modify the transglucosylation properties of ANG, residue Asn694, which was predicted to be involved in formation of the plus subsites of ANG, was replaced with Ala, Leu, Phe, and Trp. Except for N694A, the mutations enhanced the initial velocity of the α-(1→4)-transfer reaction to produce maltotriose, which was then degraded at a rate similar to that by wild-type ANG. With increasing reaction time, N694F and N694W mutations led to the accumulation of larger amounts of isomaltose and isomaltotriose than achieved with the wild-type enzyme. In the final stage of the reaction, the major product was panose (N694A and N694L) or isomaltose (N694F and N694W).
EBR-II Primary Tank Wash-Water Alternatives Evaluation
International Nuclear Information System (INIS)
Demmer, R.; Heintzelman, J.; Squires, L.; Meservey, R.
2009-01-01
The EBR-II reactor at Idaho National Laboratory was a liquid sodium metal cooled reactor that operated for 30 years. Approximately 1100 kg of residual sodium remained in the primary system after draining the bulk sodium. To stabilize the remaining sodium, both the primary and secondary systems were treated with a purge of moist carbon dioxide. The passivation treatment was stopped in 2005 and the primary system is maintained under a blanket of dry carbon dioxide. Approximately 670 kg of sodium metal remains in the primary system in locations that were inaccessible to passivation treatment or in pools of sodium that were too deep for complete penetration of the passivation treatment. The EBR-II reactor was permitted by the Idaho Department of Environmental Quality (DEQ) in 2002 under a RCRA permit that requires removal of all remaining sodium. The proposed baseline closure method would remove the large components from the primary tank, fill the primary system with water, react the remaining sodium with the water and dissolve the reaction products in about 100,000 gallons of wash water. On February 19-20, 2008, a workshop was held in Idaho Falls, Idaho, to evaluate alternatives that could meet the RCRA permit clean closure requirements and minimize the quantity of hazardous waste generated by the cleanup process. The workshop convened a panel of national and international sodium cleanup specialists, subject matter experts from the INL, and the EBR-II Wash Water Project team that organized the workshop. The workshop was conducted by a trained facilitator using Value Engineering techniques to elicit the most technically sound solutions from the workshop participants. A brainstorming session was held to identify possible alternative treatment methods that would meet the primary functions and criteria of neutralizing the hazards, maximizing byproduct removal and minimizing waste generation. An initial list of some 20 probable alternatives was evaluated and refined down
Response of EBR-II to a complete loss of primary forced flow during power operation
International Nuclear Information System (INIS)
Singer, R.M.; Gillette, J.L.; Mohr, D.; Tokar, J.V.; Sullivan, J.E.; Dean, E.M.
1980-01-01
Detailed measurements of the thermal, hydraulic, and neutronic response of EBR-II to a complete loss of primary forced flow followed by a PPS-activated scram are presented. The experimental results clearly indicate a smooth transition to natural convective flow with a quite modest incore temperature transient. The accompanying calculations using the NATDEMO code agree quite well with the measured temperatures and flow rates throughout the primary system. The only region of the plant where a significant discrepancy between the measurements and calculations occurred was in the IHX. The reasons for this result could not be definitively determined, but it is speculated that the one-dimensional assumptions used in the modeling may not be valid in the IHX during buoyancy driver flows
An evaluation of multigroup flux predictions in the EBR-II core
International Nuclear Information System (INIS)
Hill, R.N.; Fanning, T.H.; Finck, P.J.
1991-01-01
The unique physics characteristics of EBR-II which are difficult to model with conventional neutronic methodologies are identified; the high neutron leakage fraction and importance of neutron reflection cause errors when conventional calculational approximations are utilized. In this paper, various conventional and higher-order group constant evaluations and flux computation methods are compared for a simplified R-Z model of the EBR-II system. Although conventional methods do provide adequate predictions of the flux in the core region, significant mispredictions are observed in the reflector and radial blanket regions. Calculational comparisons indicate that a fine energy group structure is required for accurate predictions of the eigenvalue and flux distribution; greater detail is needed in the iron resonance scattering treatment. Calculational comparisons also indicate that transport theory with detailed anisotropic scattering treatment is required
An evaluation of multigroup flux predictions in the EBR-II core
Energy Technology Data Exchange (ETDEWEB)
Hill, R.N.; Fanning, T.H.; Finck, P.J.
1991-12-31
The unique physics characteristics of EBR-II which are difficult to model with conventional neutronic methodologies are identified; the high neutron leakage fraction and importance of neutron reflection cause errors when conventional calculational approximations are utilized. In this paper, various conventional and higher-order group constant evaluations and flux computation methods are compared for a simplified R-Z model of the EBR-II system. Although conventional methods do provide adequate predictions of the flux in the core region, significant mispredictions are observed in the reflector and radial blanket regions. Calculational comparisons indicate that a fine energy group structure is required for accurate predictions of the eigenvalue and flux distribution; greater detail is needed in the iron resonance scattering treatment. Calculational comparisons also indicate that transport theory with detailed anisotropic scattering treatment is required.
An evaluation of multigroup flux predictions in the EBR-II core
Energy Technology Data Exchange (ETDEWEB)
Hill, R.N.; Fanning, T.H.; Finck, P.J.
1991-01-01
The unique physics characteristics of EBR-II which are difficult to model with conventional neutronic methodologies are identified; the high neutron leakage fraction and importance of neutron reflection cause errors when conventional calculational approximations are utilized. In this paper, various conventional and higher-order group constant evaluations and flux computation methods are compared for a simplified R-Z model of the EBR-II system. Although conventional methods do provide adequate predictions of the flux in the core region, significant mispredictions are observed in the reflector and radial blanket regions. Calculational comparisons indicate that a fine energy group structure is required for accurate predictions of the eigenvalue and flux distribution; greater detail is needed in the iron resonance scattering treatment. Calculational comparisons also indicate that transport theory with detailed anisotropic scattering treatment is required.
Performance of advanced oxide fuel pins in EBR-II
International Nuclear Information System (INIS)
Lawrence, L.A.; Jensen, S.M.; Hales, J.W.; Karnesky, R.A.; Makenas, B.J.
1986-05-01
The effects of design and operating parameters on mixed-oxide fuel pin irradiation performance were established for the Hanford Engineering Development Laboratory (HEDL) advanced oxide EBR-II test series. Fourteen fuel pins breached in-reactor with reference 316 SS cladding. Seven of the breaches are attributed to FCMI. Of the remaining seven breached pins, three are attributed to local cladding over-temperatures similar to the breach mechanism for the reference oxide pins irradiated in EBR-II. FCCI was found to be a contributing factor in two high burnup, i.e., 11.7 at. % breaches. The remaining two breaches were attributed to mechanical interaction of UO 2 fuel and fission products accumulated in the lower cladding insulator gap, and a loss of cladding ductility possibly due to liquid metal embrittlement. Fuel smear density appears to have the most significant impact on lifetime. Quantitative evaluations of cladding diameter increases attributed to FCMI, established fuel smear density, burnup, and cladding thickness-to-diameter ratio as the major parameters influencing the extent of cladding strain
Safety aspects of advanced fuels irradiations in EBR-II
International Nuclear Information System (INIS)
Lehto, W.K.
1975-09-01
Basic safety questions such as MFCI, loss-of-Na bond, pin behavior during design basis transients, and failure propagation were evaluated as they pertain to advanced fuels in EBR-II. With the exception of pin response to the unlikely loss-of-flow transient, the study indicates that irradiation of significant numbers of advanced fueled subassemblies in EBR-II should pose no safety problems. The analysis predicts, however, that Na boiling may occur during the postulated design basis unlikely loss-of-flow transient in subassemblies containing He-bonded fuel pins with the larger fuel-clad gaps. The calculations indicate that coolant temperatures at top of core in the limiting S/A's, containing the He bonded pins, would reach approximately 1480 0 F during the transient without application of uncertainty factors. Inclusion of uncertainties could result in temperature predictions which approach coolant boiling temperatures (1640 0 F). Further analysis of He-bonded pins is being done in this potential problem area, e.g., to apply best estimates of uncertainty factors and to determine the sensitivity of the preliminary results to gap conductance
EBR-II Primary Tank Wash-Water Alternatives Evaluation
Energy Technology Data Exchange (ETDEWEB)
Demmer, R. L.; Heintzelman, J. B.; Merservey, R. H.; Squires, L. N.
2008-05-01
The EBR-II reactor at Idaho National Laboratory was a liquid sodium metal cooled reactor that operated for 30 years. It was shut down in 1994; the fuel was removed by 1996; and the bulk of sodium metal coolant was removed from the reactor by 2001. Approximately 1100 kg of residual sodium remained in the primary system after draining the bulk sodium. To stabilize the remaining sodium, both the primary and secondary systems were treated with a purge of moist carbon dioxide. Most of the residual sodium reacted with the carbon dioxide and water vapor to form a passivation layer of primarily sodium bicarbonate. The passivation treatment was stopped in 2005 and the primary system is maintained under a blanket of dry carbon dioxide. Approximately 670 kg of sodium metal remains in the primary system in locations that were inaccessible to passivation treatment or in pools of sodium that were too deep for complete penetration of the passivation treatment. The EBR-II reactor was permitted by the Idaho Department of Environmental Quality (DEQ) in 2002 under a RCRA permit that requires removal of all remaining sodium in the primary and secondary systems by 2022. The proposed baseline closure method would remove the large components from the primary tank, fill the primary system with water, react the remaining sodium with the water and dissolve the reaction products in the wash water. This method would generate a minimum of 100,000 gallons of caustic, liquid, low level radioactive, hazardous waste water that must be disposed of in a permitted facility. On February 19-20, 2008, a workshop was held in Idaho Falls, Idaho, to look at alternatives that could meet the RCRA permit clean closure requirements and minimize the quantity of hazardous waste generated by the cleanup process. The workshop convened a panel of national and international sodium cleanup specialists, subject matter experts from the INL, and the EBR-II Wash Water Project team that organized the workshop. The
Evidence of fast non-linear feedback in EBR-II rod-drop measurements
International Nuclear Information System (INIS)
Grimm, K.N.; Meneghetti, D.
1987-06-01
Feedback reactivities determine the time dependence of a reactor during and after a transient initiating event. Recent analysis of control-rod drops in the Experimental Breeder Reactor II (EBR-II) Reactor has indicated that some relatively fast feedback may exist which cannot be accounted for by the linear feedback mechanisms. The linear and deduced non-linear feedback reactivities from a control-rod drop in EBR-II run 93A using detailed temperature coefficients of reactivity in the EROS kinetics code have been reported. The transient analyses have now been examined in more detail for times close to the drop to ascertain if additional positive reactivity is being built-in early in the drop which could be gradually released later in the drop
EBR-II water-to-sodium leak detection system
International Nuclear Information System (INIS)
Wrightson, M.M.; McKinley, K.; Ruther, W.E.; Holmes, J.T.
1976-01-01
The water-to-sodium leak detection system installed at EBR-II in April, 1975, is described in detail. Topics covered include operational characteristics, maintenance problems, alarm functions, background hydrogen level data, and future plans for refinements to the system. Particular emphasis is given to the failures of eight of the ten leak detectors due to sodium-to-vacuum leakage, and the program anticipated for complete recovery of the system
34 CFR 694.7 - What are the matching requirements for a GEAR UP Partnership?
2010-07-01
... Partnership? 694.7 Section 694.7 Education Regulations of the Offices of the Department of Education... Partnership? (a) In general. A Partnership must— (1) State in its application the percentage of the cost of the GEAR UP project the Partnership will provide for each year from non-Federal funds, subject to the...
EBR-II rotating plug seal maintenance
International Nuclear Information System (INIS)
Allen, K.J.
1986-01-01
The EBR-II rotating plug seals require frequent cleaning and maintenance to keep the plugs from sticking during fuel handling. Time consuming cleaning on the cover gas and air sides of the dip ring seal is required to remove oxidation and sodium reaction products that accumulate and stop plug rotation. Despite severely limited access, effective seal cleaning techniques have removed 11 800 lb (5 352 kg) of deposits from the seals since 1964. Temperature control modifications and repairs have also required major maintenance work. Suggested seal design recommendations could significantly reduce maintenance on future similar seals
EBR-II and TREAT Digitization Project
Energy Technology Data Exchange (ETDEWEB)
Griffith, George W. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Rabiti, Cristian [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2015-09-01
Digitizing the technical drawings for EBR-II and TREAT provides multiple benefits. Moving the scanned or hard copy drawings to modern 3-D CAD (Computer Aided Drawing) format saves data that could be lost over time. The 3-D drawings produce models that can interface with other drawings to make complex assemblies. The 3-D CAD format can also include detailed material properties and parametric coding that can tie critical dimensions together allowing easier modification. Creating the new files from the old drawings has found multiple inconsistencies that are being flagged or corrected improving understanding of the reactor(s).
EBR-II and TREAT Digitization Project
International Nuclear Information System (INIS)
Griffith, George W.; Rabiti, Cristian
2015-01-01
Digitizing the technical drawings for EBR-II and TREAT provides multiple benefits. Moving the scanned or hard copy drawings to modern 3-D CAD (Computer Aided Drawing) format saves data that could be lost over time. The 3-D drawings produce models that can interface with other drawings to make complex assemblies. The 3-D CAD format can also include detailed material properties and parametric coding that can tie critical dimensions together allowing easier modification. Creating the new files from the old drawings has found multiple inconsistencies that are being flagged or corrected improving understanding of the reactor(s).
Surveillance application using patten recognition software at the EBR-II Reactor Facility
International Nuclear Information System (INIS)
Olson, D.L.
1992-01-01
The System State Analyzer (SSA) is a software based pattern recognition system. For the past several year this system has been used at Argonne National Laboratory's Experimental Breeder Reactor 2 (EBR-2) reactor for detection of degradation and other abnormalities in plant systems. Currently there are two versions of the SSA being used at EBR-2. One version of SSA is used for daily surveillance and trending of the reactor delta-T and startups of the reactor. Another version of the SSA is the QSSA which is used to monitor individual systems of the reactor such as the Secondary Sodium System, Secondary Sodium Pumps, and Steam Generator. This system has been able to detect problems such as signals being affected by temperature variations due to a failing temperature controller
Thermal-structural response of EBR-II major components under reactor operational transients
International Nuclear Information System (INIS)
Chang, L.K.; Lee, M.J.
1983-01-01
Until recently, the LMFBR safety research has been focused primarily on severe but highly unlikely accident, such as hypothetical-core-disruptive accidents (HCDA's), and not enough attention has been given to accident prevention, which is less severe but more likely sequence. The objective of the EBR-II operational reliability testing (ORT) is to demonstrate that the reactor can be designed and operated to prevent accident. A series of mild duty cycles and overpower transients were designed for accident prevention tests. An assessment of the EBR-II major plant components has been performed to assure structural integrity of the reactor plant for the ORT program. In this paper, the thermal-structural response and structural evaluation of the reactor vessel, the reactor-vessel cover, the intermediate heat exchanger (IHX) and the superheater are presented
Behavior of EBR-II Mk-V-type fuel elements in simulated loss-of-flow tests
International Nuclear Information System (INIS)
Liu, Y.Y.; Tsai, H.; Billone, M.C.; Holland, J.W.; Kramer, J.M.
1993-01-01
Three furnace heating tests were conducted with irradiated, HT9-clad and U-19wt%Pu-10wt%Zr-alloy, EBR-II Mk-V-type fuel elements to evaluate the behavior that could be expected during a loss-of-flow event in the reactor. In general, very significant safety margins for cladding breaching have been demonstrated in these tests, under conditions that would envelop a bounding unlikely loss-of-flow event in EBR-II. Highlights of the test results are presented, as are discussions of the cladding breaching mechanisms, axial fuel motion, and fuel surface liquefaction that were found in these tests. (orig.)
X447 EBR-II Experiment Benchmark for Verification of Audit Code of SFR Metal Fuel
Energy Technology Data Exchange (ETDEWEB)
Choi, Yong Won; Bae, Moo-Hoon; Shin, Andong; Suh, Namduk [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)
2016-10-15
In KINS (Korea Institute of Nuclear Safety), to prepare audit calculation of PGSFR licensing review, the project has been started to develop the regulatory technology for SFR system including a fuel area. To evaluate the fuel integrity and safety during an irradiation, the fuel performance code must be used for audit calculation. In this study, to verify the new code system, the benchmark analysis is performed. In the benchmark, X447 EBR-II experiment data are used. Additionally, the sensitivity analysis according to mass flux change of coolant is performed. In case of LWR fuel performance modeling, various and advanced models have been proposed and validated based on sufficient in-reactor test results. However, due to the lack of experience of SFR operation, the current understanding of SFR fuel behavior is limited. In this study, X447 EBR-II Experiment data are used for benchmark. The fuel composition of X447 assembly is U-10Zr and PGSFR also uses this composition in initial phase. So we select X447 EBR-II experiment for benchmark analysis. Due to the lack of experience of SFR operation and data, the current understanding of SFR fuel behavior is limited. However, in order to prepare the licensing of PGSFR, regulatory audit technologies of SFR must be secured. So, in this study, to verify the new audit fuel performance analysis code, the benchmark analysis is performed using X447 EBR-II experiment data. Also, the sensitivity analysis with mass flux change of coolant is performed. In terms of verification, it is considered that the results of benchmark and sensitivity analysis are reasonable.
X447 EBR-II Experiment Benchmark for Verification of Audit Code of SFR Metal Fuel
International Nuclear Information System (INIS)
Choi, Yong Won; Bae, Moo-Hoon; Shin, Andong; Suh, Namduk
2016-01-01
In KINS (Korea Institute of Nuclear Safety), to prepare audit calculation of PGSFR licensing review, the project has been started to develop the regulatory technology for SFR system including a fuel area. To evaluate the fuel integrity and safety during an irradiation, the fuel performance code must be used for audit calculation. In this study, to verify the new code system, the benchmark analysis is performed. In the benchmark, X447 EBR-II experiment data are used. Additionally, the sensitivity analysis according to mass flux change of coolant is performed. In case of LWR fuel performance modeling, various and advanced models have been proposed and validated based on sufficient in-reactor test results. However, due to the lack of experience of SFR operation, the current understanding of SFR fuel behavior is limited. In this study, X447 EBR-II Experiment data are used for benchmark. The fuel composition of X447 assembly is U-10Zr and PGSFR also uses this composition in initial phase. So we select X447 EBR-II experiment for benchmark analysis. Due to the lack of experience of SFR operation and data, the current understanding of SFR fuel behavior is limited. However, in order to prepare the licensing of PGSFR, regulatory audit technologies of SFR must be secured. So, in this study, to verify the new audit fuel performance analysis code, the benchmark analysis is performed using X447 EBR-II experiment data. Also, the sensitivity analysis with mass flux change of coolant is performed. In terms of verification, it is considered that the results of benchmark and sensitivity analysis are reasonable
Parametric investigation of fracture of EBR-II ducts
International Nuclear Information System (INIS)
Chopra, P.S.; Moustakakis, B.
1977-01-01
Results of preliminary static and dynamic finite element fracture mechanics analyses that were conducted to analytically simulate the dynamic fracture behavior of EBR-II ducts are presented. The loads considered are those that may arise because of rapid release of fission gases from a failed fuel element inside a duct, obtained from some previous tests and a recent analytical model. In spite of the motivation for the present work, the analytical procedures described may have a wider general application in the fail-safe design of structures
Transforming criticality control methods for EBR-II fuel handling during reactor decommissioning
International Nuclear Information System (INIS)
Eberle, C.S.; Dean, E.M.; Angelo, P.L.
1995-01-01
A review of the Department of Energy (DOE) request to decommission the Experimental Breeder Reactor-II (EBR-II) was conducted in order to develop a scope of work and analysis method for performing the safety review of the facility. Evaluation of the current national standards, DOE orders, EBR-II nuclear safeguards and criticality control practices showed that a decommissioning policy for maintaining criticality safety during a long term fuel transfer process did not exist. The purpose of this research was to provide a technical basis for transforming the reactor from an instrumentation and measurement controlled system to a system that provides both physical constraint and administrative controls to prevent criticality accidents. Essentially, this was done by modifying the reactor core configuration, reactor operations procedures and system instrumentation to meet the safety practices of ANS-8.1-1983. Subcritical limits were determined by applying established liquid metal reactor methods for both the experimental and computational validations
Tensile properties of helium-injected V-15Cr-5Ti after irradiation in EBR-II
International Nuclear Information System (INIS)
Grossbeck, M.L.; Horak, J.A.
1985-01-01
Miniature specimens of V-15Cr-5Ti were prepared in the annealed condition and with 10, 20, and 30% cold work. The annealed specimens were cyclotron injected with helium and irradiated in sodium in EBR-II. The cold-worked specimens were irradiated in EBR-II but not helium injected. The specimens were irradiated at 400, 525, 625, and 700 0 C and received a fluence of 4.1 to 5.5 x 10 26 neutrons/m 2 (E > 0.1 meV). Tensile testing revealed very significant embrittlement as a result of the neutron irradiation but a much smaller change, mostly at 400 0 C, resulting from helium injection. 5 references, 9 figures, 2 tables
Modification of EBR-II plant to conduct loss-of-flow-without-scram tests
Energy Technology Data Exchange (ETDEWEB)
Messick, N C; Betten, P R; Booty, W F; Christensen, L J; Fryer, R M; Mohr, D; Planchon, H P; Radtke, W H
1987-04-01
This paper describes the details of and the philosophy behind changes made to the EBR-II plant in order to conduct loss-of-flow-without-scram tests. No changes were required to conduct loss-of-heat-sink-without-scram tests.
Modification of EBR-II plant to conduct loss-of-flow-without-scram tests
International Nuclear Information System (INIS)
Messick, N.C.; Betten, P.R.; Booty, W.F.; Christensen, L.J.; Fryer, R.M.; Mohr, D.; Planchon, H.P.; Radtke, W.H.
1987-01-01
This paper describes the details of and the philosophy behind changes made to the EBR-II plant in order to conduct loss-of-flow-without-scram tests. No changes were required to conduct loss-of-heat-sink-without-scram tests. (orig.)
Data systems in FFTF and EBR-II
International Nuclear Information System (INIS)
Warrick, R.P.; Ritter, W.M.
1980-02-01
This paper describes the Data System used to monitor operation and collect experimental data in FFTF. This data system has evolved since initial inception from a relatively simple, single computer system monitoring a relatively few (approx. 1000) instrument channels important for operation to one which has increased capability to support the long-range testing needs in FFTF. The system, while still relatively simple, now contains multiple computers which normally perform independent functions. The computers, however, provide backup processing for certain simple tasks. Operator interfacing is provided through CRT's. The output capabilities of the system are described. A description of the Data System in EBR-II is also included
International Nuclear Information System (INIS)
Holmes, J.T.; Smith, C.R.F.; Olson, W.H.
1976-01-01
Since the installation of purity monitoring systems in 1967, the control of the purity of the primary and secondary sodium and cover gas systems at the Experimental Breeder Reactor II (EBR-II) has been excellent. A rigorous monitoring program is being used to assure that operating limits for more than 25 chemical and radioactive impurities are not exceeded. The program involves the use of sophisticated sampling and analysis techniques and on-line monitors for both sodium and cover gas systems. Sodium purity control is accomplished by essentially continuous cold trapping of a small side stream of the total circulating sodium. The cold traps have been found to be very effective for the removal of the major chemical impurities (oxygen and hydrogen) and tritium but are almost ineffective for 131 I and 137 Cs that enter the sodium from fuel cladding breaks. Purging with pure argon maintains the cover gas purity
Experience with EBR-II [Experimental Breeder Reactor] driver fuel
International Nuclear Information System (INIS)
Seidel, B.R.; Porter, D.L.; Walters, L.C.; Hofman, G.L.
1986-01-01
The exceptional performance of Experimental Breeder Reactor-II (EBR-II) metallic driver fuel has been demonstrated by the irradiation of a large number of elements under steady-state, transient overpower, and loss-of-flow conditions. High burnup with high reliability has been achieved by a close coupling of element design and materials selection. Quantification of reliability has allowed full utilization of element lifetime. Improved design and duct materials currently under test are expected to increase the burnup from 8 to 14 at.%
Anatomy of a merger - CO in Arp 299 (IC 694-NGC 3690)
International Nuclear Information System (INIS)
Sargent, A.; Scoville, N.
1991-01-01
High-resolution (2.4-arcsec) CO observations of the interacting system Arp 299 (Mrk 171: IC 694 and NGC 3690) reveal major gas condensations at the nuclei of both galaxies and in the disk overlap region. The 0.9 x 10 to the 9th solar masses of H2 at the nucleus of NGC 3690 extends to radii of 310 pc and probably sustains a starburst. A compact source (radius not greater than 250 pc) of mass 3.9 x 10 to the 9th solar masses is found at the nucleus of IC 694; this galaxy may harbor an AGN. At least three discrete subcondensations, probably active star-forming knots, are detected in the 1800 x 640 pc overlap region. 24 refs
Seismic response of the EBR-II to the Mt. Borah earthquake
International Nuclear Information System (INIS)
Gale, J.G.; Lehto, W.K.
1985-01-01
On October 28, 1983, an earthquake of magnitude 7.3 occurred in the mountains of central Idaho at a distance of 114-km from the ANL-West site. The earthquake tripped the seismic sensors in the EBR-II reactor shutdown system causing a reactor scram. Visual and operability checks of structures, components, and systems showed no indication of damage or system abnormalities and reactor restart was initiated. As a result of the earthquake, questions arose as to the magnitude of the actual stress levels in critical components and what value of ground acceleration could be experienced without damage to reactor structures. EBR-II was designed prior to implementation of present day requirements for seismic qualification and appropriate analyses had not been conducted. A lumped-mass, finite element model of the primary tank, support structure, and the reactor was generated and analyzed using the response spectrum technique. The analysis showed that the stress levels in the primary tank system were very low during the Mount Borah earthquake and that the system could experience seismic loadings three to four times those of the Mount Borah earthquake without exceeding yield stresses in any of the components
Advanced condition monitoring techniques and plant life extension studies at EBR-2
International Nuclear Information System (INIS)
Singer, R.M.; Gross, K.C.; Perry, W.H.; King, R.W.
1991-01-01
Numerous advanced techniques have been evaluated and tested at EBR-2 as part of a plant-life extension program for detection of degradation and other abnormalities in plant systems. Two techniques have been determined to be of considerable assistance in planning for the extended-life operation of EBR-2. The first, a computer-based pattern-recognition system (System State Analyzer or SSA) is used for surveillance of the primary system instrumentation, primary sodium pumps and plant heat balances. This surveillance has indicated that the SSA can detect instrumentation degradation and system performance degradation over varying time intervals and can be used to provide derived signal values to replace signals from failed sensors. The second technique, also a computer-based pattern-recognition system (Sequential Probability Ratio Test or SPRT) is used to validate signals and to detect incipient failures in sensors and components or systems. It is being used on the failed fuel detection system and is experimentally used on the primary coolant pumps. Both techniques are described and experience with their operation presented
Computer imaging of EBR-II handling equipment
International Nuclear Information System (INIS)
Hansen, L.H.; Peters, G.G.
1994-10-01
This paper describes a three-dimensional graphics application used to visualize the positions of remotely operated fuel handling equipment in the EBR-II reactor. The system described in this paper uses actual signals to move a three-dimensional graphics model in real-time in response to movements of equipment in the plant. A three-dimensional (3D) visualization technique is necessary to simulate direct visual observation of the transfers of fuel and experiments into and out of the reactor because the fuel handling equipment is submerged in liquid sodium and therefore is not visible to the operator. This paper will present details on how the 3D model was created and how real-time dynamic behavior was added to each of the moving components
Dynamic modeling and simulation of EBR-II steam generator system
International Nuclear Information System (INIS)
Berkan, R.C.; Upadhyaya, B.R.
1989-01-01
This paper presents a low order dynamic model of the Experimental breeder Reactor-II (EBR-II) steam generator system. The model development includes the application of energy, mass and momentum balance equations in state-space form. The model also includes a three-element controller for the drum water level control problem. The simulation results for low-level perturbations exhibit the inherently stable characteristics of the steam generator. The predictions of test transients also verify the consistency of this low order model
On-line sodium and cover as purity monitors gas operating tools at EBR-II
International Nuclear Information System (INIS)
Smith, C.R.F.; Richardson, W.J.; Holmes, J.T.
1976-01-01
Plugging temperature indicators, electrochemical oxygen meters and hydrogen diffusion meters are the on-line sodium purity monitors now in use at EBR-II. On-line gas chromatographs are used to monitor helium, hydrogen, oxygen and nitrogen impurities in the argon cover gases. Monitors for tritium-in-sodium and for hydrocarbons-in-cover gas have been developed and are scheduled for installation in the near future. An important advantage of on-line monitors over the conventional grab-sampling techniques is the speed of response to changing reactor conditions. This helps us to identify the source of the impurity, whether the cause may be transient or constant, and take corrective action as necessary. The oxygen meter is calibrated monthly against oxygen in sodium determined by the vanadium wire equilibration method. The other instruments either do not require calibration or are self-calibrating. The ranges, sensitivity and response times of all of the on-line purity monitors has proven satisfactory under EBR-II operating conditions
System modeling of spent fuel transfers at EBR-II
International Nuclear Information System (INIS)
Imel, G.R.; Houshyar, A.
1994-01-01
The unloading of spent fuel from the Experimental Breeder Reactor-II (EBR-II) for interim storage and subsequent processing in the Fuel Cycle Facility (FCF) is a multi-stage process, involving complex operations at a minimum of four different facilities at the Argonne National Laboratory-West (ANL-W) site. Each stage typically has complicated handling and/or cooling equipment that must be periodically maintained, leading to both planned and unplanned downtime. A program was initiated in October, 1993 to replace the 330 depleted uranium blanket subassemblies (S/As) with stainless steel reflectors. Routine operation of the reactor for fuels performance and materials testing occurred simultaneously in FY 1994 with the blanket unloading. In the summer of 1994, Congress dictated the October 1, 1994 shutdown of EBR-2. Consequently, all blanket S/As and fueled drivers will be removed from the reactor tank and replaced with stainless steel assemblies (which are needed to maintain a precise configuration within the grid so that the under sodium fuel handling equipment can function). A system modeling effort was conducted to determine the means to achieve the objective for the blanket and fuel unloading program, which under the current plan requires complete unloading of the primary tank of all fueled assemblies in 2 1/2 years. A simulation model of the fuel handling system at ANL-W was developed and used to analyze different unloading scenarios; the model has provided valuable information about required resources and modifications to equipment and procedures. This paper reports the results of this modeling effort
IFR fuel cycle demonstration in the EBR-II Fuel Cycle Facility
International Nuclear Information System (INIS)
Lineberry, M.J.; Phipps, R.D.; Rigg, R.H.; Benedict, R.W.; Carnes, M.D.; Herceg, J.E.; Holtz, R.E.
1991-01-01
The next major milestone of the IFR (Integral Fast Reactor) program is engineering-scale demonstration of the pyroprocess fuel cycle. The EBR-II Fuel Cycle Facility has just entered a startup phase which includes completion of facility modifications, and installation and cold checkout of process equipment. This paper reviews the design and construction of the facility, the design and fabrication of the process equipment, and the schedule and initial plan for its operation. (author)
IFR fuel cycle demonstration in the EBR-II Fuel Cycle Facility
International Nuclear Information System (INIS)
Lineberry, M.J.; Phipps, R.D.; Rigg, R.H.; Benedict, R.W.; Carnes, M.D.; Herceg, J.E.; Holtz, R.E.
1991-01-01
The next major milestone of the IFR program is engineering-scale demonstration of the pyroprocess fuel cycle. The EBR-II Fuel Cycle Facility has just entered a startup phase which includes completion of facility modifications, and installation and cold checkout of process equipment. This paper reviews the design and construction of the facility, the design and fabrication of the process equipment, and the schedule and initial plan for its operation. 5 refs., 4 figs
EBR-II fuel handling console digital upgrade
International Nuclear Information System (INIS)
Peters, G.G.; Wiege, D.D.; Christensen, L.J.
1995-01-01
The main fuel handling console and control system at the Experimental Breeder Reactor II (EBR-II) are being upgraded to a computerized system using high-end workstations for the operator interface and a programmable logic controller (PLC) for the control system. Two-dimensional (2D) and three-dimensional (3D) computer graphics will be provided for the operator which will show the relative position of under-sodium fuel handling equipment. This equipment is operated remotely with no means of directly viewing the transfer. This paper describes various aspects of the modification including reasons for the upgrade, capabilities the new system provides over the old control system, philosophies and rationale behind the new design, testing and simulation work, diagnostic features, and the advanced graphics techniques used to display information to the operator
Considerations for advanced reactor design based on EBR-II experience
International Nuclear Information System (INIS)
King, R. W.
1999-01-01
The long-term success of the Experimental Breeder Reactor-II (EBR-II) provides several insights into fundamental characteristics and design features of a nuclear generating station that enhance safety, operability, and maintainability. Some of these same characteristics, together with other features, offer the potential for operational lifetimes well beyond the current licensing time frame, and improved reliability that could potentially reduce amortized capital costs as well as overall operation and maintenance costs if incorporated into advanced plant designs. These features and characteristics are described and the associated benefits are discussed
The 6/94 gap in health impact assessment
International Nuclear Information System (INIS)
Erlanger, Tobias E.; Krieger, Gary R.; Singer, Burton H.; Utzinger, Juerg
2008-01-01
Health impact assessment (HIA), a methodology that aims to facilitate the mitigation of negative and enhancement of positive health effects due to projects, programmes and policies, has been developed over the past 20-30 years. There is an underlying assumption that HIA has become a full fledged critical piece of the impact assessment process with a stature equal to both environmental and social impact assessments. This assumption needs to be supported by evidence however. Within the context of projects in developing country settings, HIA is simply a slogan without a clearly articulated and relevant methodology, offered by academia and having little or no salience in the decision-making process regarding impacts. This harsh assertion is supported by posing a simple question: 'Where in the world have HIAs been carried out?' To answer this question, we systematically searched the peer-reviewed literature and online HIA-specific databases. We identified 237 HIA-related publications, but only 6% of these publications had a focus on the developing world. What emerges is, therefore, a huge disparity, which we coin the 6/94 gap in HIA, even worse than the widely known 10/90 gap in health research (10% of health research funding is utilized for diseases causing 90% of the global burden of disease). Implications of this 6/94 gap in HIA are discussed with pointed emphasis on extractive industries (oil/gas and mining) and water resources development. We conclude that there is a pressing need to institutionalize HIA in the developing world, as a consequence of current predictions of major extractive industry and water resources development, with China's investments in these sectors across Africa being particularly salient
Behavior of EBR-II Mk-V-type fuel elements in simulated loss-of-flow tests
International Nuclear Information System (INIS)
Liu, Y.Y.; Tsai, H.; Billone, M.C.; Kramer, J.M.
1992-01-01
The next step in the development of metal fuels for the integral fast reactor (IFR) is the conversion of the Experimental Breeder Reactor II (EBR-II) core to one containing the ternary U-20 Pu-10 Zr alloy clad with HT-9 cladding, i.e., the Mk-V core. This paper presents results of three hot-cell furnace simulation tests on irradiated Mk-V-type fuel elements (U-19 Pu-10 Zr/HT-9), which were performed to support the safety case for the Mk-V core. These tests were designed to envelop an umbrella (bounding) unlikely loss-of-flow (LOF) event in EBR-II during which the calculated peak cladding temperature would reach 776 degree C for < 2 min. The principal objectives of these tests were (a) demonstration of the safety margin of the fuel element, (b) investigation of cladding breaching behavior, and (c) provision of data for validation of the FPIN2 and LIFE-METAL codes
Fail-safety of the EBR-II steam generator system
International Nuclear Information System (INIS)
Chopra, P.S.; Stone, C.C.; Hutter, E.; Barney, W.K.; Staker, R.G.
1976-01-01
Fail-safe analyses of the EBR-II steam-generator system show that a postulated non-instantaneous leak of water or steam into sodium, through a duplex tube or a tubesheet, at credible leak rates will not structurally damage the evaporators and superheaters. However, contamination of the system and possible shell wastage by sodium-water reaction products may render the system inoperable for a period exceeding six months. This period would be shortened to three months if the system were modified by adding a remotely operated water dump system, a steam vent system, a secondary sodium superheater relief line, and a tubesheet leak-detection system
Sensitivity Analysis of Uncertainty Parameter based on MARS-LMR Code on SHRT-45R of EBR II
Energy Technology Data Exchange (ETDEWEB)
Kang, Seok-Ju; Kang, Doo-Hyuk; Seo, Jae-Seung [System Engineering and Technology Co., Daejeon (Korea, Republic of); Bae, Sung-Won [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Jeong, Hae-Yong [Sejong University, Seoul (Korea, Republic of)
2016-10-15
In order to assess the uncertainty quantification of the MARS-LMR code, the code has been improved by modifying the source code to accommodate calculation process required for uncertainty quantification. In the present study, a transient of Unprotected Loss of Flow(ULOF) is selected as typical cases of as Anticipated Transient without Scram(ATWS) which belongs to DEC category. The MARS-LMR input generation for EBR II SHRT-45R and execution works are performed by using the PAPIRUS program. The sensitivity analysis is carried out with Uncertainty Parameter of the MARS-LMR code for EBR-II SHRT-45R. Based on the results of sensitivity analysis, dominant parameters with large sensitivity to FoM are picked out. Dominant parameters selected are closely related to the development process of ULOF event.
Enthesitis in a 16-Year-Old Boy with M694V Mutation
Directory of Open Access Journals (Sweden)
Syert Luidolf Nienhuis
2016-01-01
Full Text Available Introduction. FMF (Familial Mediterranean Fever is characterized by recurrent attacks of fever and articular pain. Enthesitis is the hallmark of pain in spondyloarthropathy. Literature suggests association of M694V mutation and enthesitis. We report a case of a 16-year-old boy with enthesitis and FMF. Case Presentation. A 16-year-old boy of Turkish origin with a history of FMF presented with localized tenderness of the heel and severe disability. MRI showed an enthesitis of the plantar fascia. Standard treatment of FMF and enthesitis was not successful. After referral to a university hospital and expert opinion of a professor in rheumatology, this enthesitis should be treated as an enthesitis related arthritis. With this treatment, our patient fully recovered 8 months after the onset of the disease symptoms. Conclusion. M694V mutation related enthesitis should be considered in FMF patients with enthesitis. We would suggest treatment for enthesitis related arthritis in similar cases. This is of clinical importance because the treatment is different from treatment of enthesitis or articular pain caused by FMF.
EBR-II argon cooling system restricted fuel handling I and C upgrade
International Nuclear Information System (INIS)
Start, S.E.; Carlson, R.B.; Gehrman, R.L.
1995-01-01
The instrumentation and control of the Argon Cooling System (ACS) restricted fuel handling control system at Experimental Breeder Reactor II (EBR-II) is being upgraded from a system comprised of many discrete components and controllers to a computerized system with a graphical user interface (GUI). This paper describes the aspects of the upgrade including reasons for the upgrade, the old control system, upgrade goals, design decisions, philosophies and rationale, and the new control system hardware and software
Computer imaging of EBR-II fuel handling equipment
International Nuclear Information System (INIS)
Peters, G.G.; Hansen, L.H.
1995-01-01
This paper describes a three-dimensional graphics application used to visualize the positions of remotely operated fuel handling equipment in the EBR-II reactor. A three-dimensional (3D) visualization technique is necessary to simulate direct visual observation of the transfers of fuel and experiments into and out of the reactor because the fuel handling equipment is submerged in liquid sodium and therefore is not visible to the operator. The system described in this paper uses actual signals to drive a three-dimensional computer-generated model in real-time in response to movements of equipment in the plant This paper will present details on how the 3D model of the intank equipment was created and how real-time dynamic behavior was added to each of the moving components
International Nuclear Information System (INIS)
Chopra, P.S.; Srinivas, S.
1975-01-01
In order to assess the potential damage to hexagonal subassembly ducts (cans) that may result from rapid gas release from a failed element the EBR-II project has conducted experiments and analyses. Additional experimental and analytical investigations are now being conducted to assure fail-safety of the ducts. Fail-safety is defined as the ability of a duct to withstand pressure pulses from failed elements during all reactor conditions without damage to adjacent ducts or any other problems in fuel handling. The results of 93 EBR-II duct tests conducted primarily by Koenig have been reported previously. The results of empirical correlations of some of these tests to determine the influence of several variables on the pressure pulse experienced by a duct and on the duct deformation are presented. The variables include the type of gas contained in the simulated element (tube), the element and duct materials, the presence or absence of flow restrictors in the element, and the way gas was released. 8 references. (auth)
EBR-II facility for cleaning and maintenance of LMR components
International Nuclear Information System (INIS)
Washburn, R.A.
1986-01-01
The cleaning and maintenance of EBR-II sodium wetted components is accomplished in a separate hands-on maintenance facility known as the Sodium Components Maintenance Shop (SCMS). Sodium removal is mostly done using alcohol but steam or water is used. The SCMS has three alcohol cleaning systems: one for small nonradioactive components, one for small radioactive components, and one for large radioactive components. The SCMS also has a water-wash station for the removal of sodium with steam or water. An Alcohol Recovery Facility removes radioactive contaminants from the alcohol and reclaims the alcohol for reuse. Associated with the large components cleaning system is a major component handling system
In-reactor cladding breach of EBR-II driver-fuel elements
International Nuclear Information System (INIS)
Seidel, B.R.; Einziger, R.E.
1977-01-01
Knowledge of performance and minimum useful element lifetime of Mark-II driver-fuel elements is required to maintain a high plant operating capacity factor with maximum fuel utilization. To obtain such knowledge, intentional cladding breach has been obtained in four run-to-cladding-breach Mark-II experimental driver-fuel subassemblies operating under normal conditions in EBR-II. Breach and subsequent fission-product release proved benign to reactor operations. The breaches originated on the outer surface of the cladding in the root of the restrainer dimples and were intergranular. The Weibull distribution of lifetime accurately predicts the observed minimum useful element lifetime of 10 at.% burnup, with breach ensuing shortly thereafter
International Nuclear Information System (INIS)
Srinivas, S.; Chopra, P.S.; Stone, C.C.
1976-01-01
The paper presents evaluations of the dynamic response of a steam generator system to postulated leaks of steam and water into sodium. This work is part of a comprehensive fail-safe analysis of the EBR-II steam generator system
Systematic variation of threshold reaction rates in EBR-II
International Nuclear Information System (INIS)
Lippincott, E.P.; Combs, B.L.; Davis, A.I.
1976-01-01
Characterization of neutron flux, fluence, and spectra in fast reactor irradiation environments is presently being carried out at HEDL utilizing the multiple foil technique. These fluences and spectra are then used to correlate damage effects data to produce damage functions or equations to predict materials effects under future irradiation conditions. The neutron flux and spectrum, then, act as a transfer function to relate present observations to future effects in the same or different environments and thus consistent fluence evaluations are of utmost importance. As part of a continuing program to establish the data base to meet consistency requirements, a systematic correlation of data from a recent dosimetry test in EBR-II is being made. The paper presents preliminary results of some of these correlations involving threshold reactions
Operational reliability testing of FBR fuel in EBR-II
International Nuclear Information System (INIS)
Asaga, Takeo; Ukai, Shigeharu; Nomura, Shigeo; Shikakura, Sakae
1991-01-01
The operational reliability testing of FBR fuel has been conducting in EBR-II as a DOE/PNC collaboration program. This paper reviews the achieved summary of Phase-I test as well as outline of progressing Phase-II test. In Phase-I test, the reliability of FBR fuel pins including 'MONJU' fuel was demonstrated at the event of operational transient. Continued operation of the failed pins was also shown to be feasible without affecting the plant operation. The objectives of the Phase-II test is to extend the data base relating with the operational reliability for long life fuel, and to supply the highly quantitative evaluation. The valuable insight obtained in Phase-II test are considerably expected to be useful toward the achievement of commercial FBR. (author)
Use of EBR-II as a principal fast breeder reactor irradiation test facility in the U.S
International Nuclear Information System (INIS)
Staker, R.G.; Seim, O.S.; Beck, W.N.; Golden, G.H.; Walters, L.C.
1975-01-01
The EBR-II as originally designed and operated by the Argonne National Laboratory was successful in demonstrating the operation of a sodium-cooled fast breeder power plant with a closed fuel reprocessing cycle. Subsequent operation has been as an experimental facility where thousands of irradiation tests have been performed. Conversion to this application entailed the design and fabrication of special irradiation subassemblies for in-core irradiations, additions to existing facilities for out-of-core irradiations, and additions to existing facilities for out-of-core experiments. Experimental subassemblies now constitute about one third of the core, and changes in the core configuration occur about monthly, requiring neutronic and thermal-hydraulics analyses and monitoring of the reactor dynamic behavior. The surveillance programs provided a wealth of information on irradiation induced swelling and creep, in-reactor fracture behavior, and the compatibility of materials with liquid sodium. (U.S.)
EBR-II Static Neutronic Calculations by PHISICS / MCNP6 codes
Energy Technology Data Exchange (ETDEWEB)
Paolo Balestra; Carlo Parisi; Andrea Alfonsi
2016-02-01
The International Atomic Energy Agency (IAEA) launched a Coordinated Research Project (CRP) on the Shutdown Heat Removal Tests (SHRT) performed in the '80s at the Experimental fast Breeder Reactor EBR-II, USA. The scope of the CRP is to improve and validate the simulation tools for the study and the design of the liquid metal cooled fast reactors. Moreover, training of the next generation of fast reactor analysts is being also considered the other scope of the CRP. In this framework, a static neutronic model was developed, using state-of-the art neutron transport codes like SCALE/PHISICS (deterministic solution) and MCNP6 (stochastic solution). Comparison between both solutions is briefly illustrated in this summary.
The EBR-II materials-surveillance program. 4: Results of SURV-4 and SURV-6
International Nuclear Information System (INIS)
Ruther, W.E.; Hayner, G.O.; Carlson, B.G.; Ebersole, E.R.; Allen, T.R.
1998-01-01
In March of 1965, a set of surveillance (SURV) samples was placed in the EBR-II reactor to determine the effect of irradiation, thermal aging, and sodium corrosion on reactor materials. Eight subassemblies were placed into row 12 positions of EBR-II to determine the effect of irradiation at 370 C. Two subassemblies were placed into the primary sodium basket to determine the effect of thermal aging at 370 C. For both the irradiated and thermally aged samples, one half of all samples were exposed to primary system sodium while one half were sealed in capsules with a helium atmosphere. Fifteen different structural materials were tested in the SURV program. In addition to the fifteen types of metal samples, graphite blocks were irradiated in the SURV subassemblies to determine the effect of irradiation on the graphite neutron shield. In this report, the properties of these materials irradiated at 370 C to a total fluence of 2.2 x 10 22 n/cm 2 (over 2,994 days) are compared with those of similar specimens thermally aged at 370 C for 2,994 days in the storage basket of the reactor. The properties analyzed were weight, density, microstructure, hardness, tensile and yield strength, impact strength, and creep
2010-07-08
... DEPARTMENT OF HOMELAND SECURITY U.S. Citizenship and Immigration Services Agency Information... Department of Homeland Security, U.S. Citizenship and Immigration Services (USCIS) will be submitting the... the Department of Homeland Security sponsoring the collection: Form I-694; U.S. Citizenship and...
EBR-II Cover Gas Cleanup System upgrade process control system structure
International Nuclear Information System (INIS)
Carlson, R.B.; Staffon, J.D.
1992-01-01
The Experimental Breeder Reactor II (EBR-II) Cover Gas Cleanup System (CGCS) control system was upgraded in 1991 to improve control and provide a graphical operator interface. The upgrade consisted of a main control computer, a distributed control computer, a front end input/output computer, a main graphics interface terminal, and a remote graphics interface terminal. This paper briefly describes the Cover Gas Cleanup System and the overall control system; describes the main control computer hardware and system software features in more detail; and, then, describes the real-time control tasks, and how they interact with each other, and how they interact with the operator interface task
Seventeen years of LMFBR experience: Experimental Breeder Reactor II (EBR-II)
International Nuclear Information System (INIS)
Perry, W.H.; Lentz, G.L.; Richardson, W.J.; Wolz, G.C.
1982-01-01
Operating experience at EBR-II over the past 17 years has shown that a sodium-cooled pool-type reactor can be safely and efficiently operated and maintained. The reactor has performed predictably and benignly during normal operation and during both unplanned and planned plant upsets. The duplex-tube evaporators and superheaters have never experienced a sodium/water leak, and the rest of the steam-generating system has operated without incident. There has been no noticeable degradation of the heat transfer efficiency of the evaporators and superheaters, except for the one superheater replaced in 1981. There has been no need to perform any chemical cleaning of steam-system components
Experimental Breeder Reactor II (EBR-II) Fuel-Performance Test Facility (FPTF)
International Nuclear Information System (INIS)
Pardini, J.A.; Brubaker, R.C.; Veith, D.J.; Giorgis, G.C.; Walker, D.E.; Seim, O.S.
1982-01-01
The Fuel-Performance Test Facility (FPTF) is the latest in a series of special EBR-II instrumented in-core test facilities. A flow control valve in the facility is programmed to vary the coolant flow, and thus the temperature, in an experimental-irradiation subassembly beneath it and coupled to it. In this way, thermal transients can be simulated in that subassembly without changing the temperatures in surrounding subassemblies. The FPTF also monitors sodium flow and temperature, and detects delayed neutrons in the sodium effluent from the experimental-irradiation subassembly beneath it. This facility also has an acoustical detector (high-temperature microphone) for detecting sodium boiling
Criticality safety requirements for transporting EBR-II fuel bottles stored at INTEC
International Nuclear Information System (INIS)
Lell, R. M.; Pope, C. L.
2000-01-01
Two carrier/shipping cask options are being developed to transport bottles of EBR-II fuel elements stored at INTEC. Some fuel bottles are intact, but some have developed leaks. Reactivity control requirements to maintain subcriticality during the hypothetical transport accident have been examined for both transport options for intact and leaking bottles. Poison rods, poison sleeves, and dummy filler bottles were considered; several possible poison materials and several possible dummy filler materials were studied. The minimum number of poison rods or dummy filler bottles has been determined for each carrier for transport of intact and leaking bottles
Degradation of EBR-II driver fuel during wet storage
International Nuclear Information System (INIS)
Pahl, R. G.
2000-01-01
Characterization data are reported for sodium bonded EBR-II reactor fuel which had been stored underwater in containers since the 1981--1982 timeframe. Ten stainless steel storage containers, which had leaked water during storage due to improper sealing, were retrieved from the ICPP-603 storage basin at the Idaho National Engineering and Environmental Laboratory (INEEL) in Idaho. In the container chosen for detailed destructive analysis, the stainless steel cladding on the uranium alloy fuel had ruptured and fuel oxide sludge filled the bottom of the container. Headspace gas sampling determined that greater than 99% hydrogen was present. Cesium 137, which had leached out of the fuel during the aqueous corrosion process, dominated the radionuclide source term of the water. The metallic sodium from the fuel element bond had reacted with the water, forming a concentrated caustic solution of NaOH
The EBR-II materials-surveillance program. 5: Results of SURV-5
International Nuclear Information System (INIS)
Ruther, W.E.; Staffon, J.D.; Carlson, B.G.; Allen, T.R.
1998-01-01
In March of 1965, a set of surveillance (SURV) samples was placed in the EBR-II reactor to determine the effect of irradiation, thermal aging, and sodium corrosion on reactor materials. Eight subassemblies were placed into row 12 positions of EBR-II to determine the effect of irradiation at 370 C. Two subassemblies were placed into the primary sodium basket to determine the effect of thermal aging at 370 C. One half of all samples were exposed to primary system sodium while one half were sealed in capsules with a helium atmosphere. Fifteen different structural materials were tested in the SURV program. In this work, the properties of these materials irradiated at 370 C to a total fluence of 3.2 x 10 22 n/cm 2 were determined. These materials are the fifth set of irradiated subassemblies to be examined as part of the SURV program (SURV-5). The properties analyzed were weight, density, microstructure, hardness, tensile and yield strength, and fracture resistance. Of all the alloys examined in SURV-5, only Berylco-25 showed any significant weight loss. Stainless steel (both 304 and 347) had the largest density decrease, although the density decrease from irradiation for all alloys was less than 0.4 percent. The microstructure of both Berylco-25 and the aluminum-bronze alloy was altered significantly. Iron- and nickel-base alloys showed little change in microstructure. Austenitic steels (304 and 347) harden with irradiation. The hardness of Inconel X750 did not change significantly with irradiation. The ultimate tensile strength of Inconel X750, 304 stainless steel, 420 stainless steel and welded 304 changed little due to a fluence increase from 2.2 x 10 22 n/cm 2 (the maximum fluence of the SURV-4 samples) to 3.2 x 10 22 n/cm 2
EBR-II Cover Gas Cleanup System (CGCS) upgrade graphical interface design
International Nuclear Information System (INIS)
Staffon, J.D.; Peters, G.G.
1992-01-01
Technology advances in the past few years have prompted an effort at Argonne National Laboratory to replace existing equipment with high performance digital computers and color graphic displays. Improved operation of process systems can be achieved by utilizing state-of-the-art computer technology in the areas of process control and process monitoring. The Cover Gas Cleanup System (CGCS) at EBR-II is the first system to be upgraded with high performance digital equipment. The upgrade consisted of a main control computer, a distributed control computer, a front end input/output computer, a main graphics interface terminal, and a remote graphics interface terminal. This paper describes the main control computer and the operator interface control software
Potential safety enhancements to nuclear plant control: proof testing at EBR-II
International Nuclear Information System (INIS)
Lindsay, R.W.; Chisholm, G.H.
1984-01-01
Future changes in nuclear plant control and protective systems will reflect an evolutionary improvement through increased use of computers coupled with a better integration of man and machine. Before improvements can be accepted into the licensed commercial plant environment, significant testing must be accomplished to answer safety questions and to prove the worth of new ideas. The Experimental Breeder Reactor-II (EBR-II) is being used as a test-bed for both in-house development and testing for others in a DOE sponsored Man-Machine Integration program. The ultimate result of the development and testing would be a control system for which safety credit could be taken in the licensing process
Directory of Open Access Journals (Sweden)
Stankevičius Evaldas
2014-10-01
Full Text Available This paper presents the sharing analysis of the 694–790 MHz frequency band for Mobile services IMT and Aeronautical radio-navigation services (ARNS using SEAMCAT (established by CEPT software based on the statistical simulation (Monte-Carlo method. In 2012 the World Radiocommunication Conference (WRC-12 decided to allocate the 694–790 MHz frequency band (the so-called 700 MHz band to mobile services IMT (excluding aeronautical mobile after WRC-15 conference. But this agreement raises electromagnetic compatibility problems, which should be solved until WRC-15 [1]. This study was carried out in two phases: first applying theoretical analysis, then statistical Monte-Carlo simulations with SEAMCAT software tool in order to verify results obtained in theoretical approach. Analytical calculations shows that the required protection distances between ARNS stations and the MS base stations are 132 km. The obtained results from SEAMCAT simulations indicate that separation distance should be above 100 km. These results illustrate that the systems are not electromagnetically compatible. The possible mitigation technic could be antenna pattern correction.
EBR-II secondary sodium loop Plugging Temperature Indicator control system upgrade
International Nuclear Information System (INIS)
Carlson, R.B.; Gehrman, R.L.
1995-01-01
The Experimental Breeder Reactor II (EBR-II) secondary sodium coolant loop Plugging Temperature Indicator (PTI) control system was upgraded in 1993 to a real-time computer based system. This was done to improve control, to remove obsolete and high maintenance equipment, and to provide a graphical CRT based operator interface. A goal was to accomplish this inexpensively using small, reliable computer and display hardware with a minimum of purchased software. This paper describes the PTI system, the upgraded control system and its operator interface, and development methods and tools. The paper then assesses how well the system met its goals, discusses lessons learned and operational improvements noted, and provides some recommendations and suggestions on applying small real-time control systems of this type
Safety related considerations for operation with defected elements in EBR-II
International Nuclear Information System (INIS)
Fryer, R.M.; Sackett, J.I.; Lambert, J.D.B.
1976-01-01
Traditionally, EBR-II has employed the 'shutdown and remove' philosophy when breached fuel elements are encountered. This mode of operation maintained in-plant inventories of fission products at low levels and allowed certain fission product detection systems to be employed as automatic plant shutdown devices. Information from fuel failure propagation studies and fast reactor operation indicates that shutdown under these conditions is unwarranted. Analytical studies, as well as fast reactor experience, further indicate that failure propagation, if it occurs at all, will not cross adjacent subassembly boundaries. Therefore, the 'shutdown and remove' philosophy can be liberalized to allow the demonstration of safety during a run-beyond-clad-breach mode of operation. This mode of operation is essential to the demonstration of the economics of commercial LMFBR systems
International Nuclear Information System (INIS)
Herrmann, S. D.; Buzzell, J. A.; Holzemer, M. J.
1998-01-01
Sodium/potassium (NaK) liquid metal coolant, contaminated with fission products from the core meltdown of Experimental Breeder Reactor I (EBR-I) and classified as a mixed waste, has been deactivated and converted to a contact-handled, low-level waste at Argonne's Sodium Component Maintenance Shop and land disposed at the Radioactive Waste Management Complex. Treatment of the EBR-I NaK involved converting the sodium and potassium to its respective hydroxide via reaction with air and water, followed by conversion to its respective carbonate via reaction with carbon dioxide. The resultant aqueous carbonate solution was solidified in 55-gallon drums. Challenges in the NaK treatment involved processing a mixed waste which was incompletely characterized and difficult to handle. The NaK was highly radioactive, i.e. up to 4.5 R/hr on contact with the mixed waste drums. In addition, the potential existed for plutonium and toxic characteristic metals to be present in the NaK, resultant from the location of the partial core meltdown of EBR-I in 1955. Moreover, the NaK was susceptible to degradation after more than 40 years of storage in unmonitored conditions. Such degradation raised the possibility of energetic exothermic reactions between the liquid NaK and its crust, which could have consisted of potassium superoxide as well as hydrated sodium/potassium hydroxides
Energy Technology Data Exchange (ETDEWEB)
Herrmann, S. D.; Buzzell, J. A.; Holzemer, M. J.
1998-02-03
Sodium/potassium (NaK) liquid metal coolant, contaminated with fission products from the core meltdown of Experimental Breeder Reactor I (EBR-I) and classified as a mixed waste, has been deactivated and converted to a contact-handled, low-level waste at Argonne's Sodium Component Maintenance Shop and land disposed at the Radioactive Waste Management Complex. Treatment of the EBR-I NaK involved converting the sodium and potassium to its respective hydroxide via reaction with air and water, followed by conversion to its respective carbonate via reaction with carbon dioxide. The resultant aqueous carbonate solution was solidified in 55-gallon drums. Challenges in the NaK treatment involved processing a mixed waste which was incompletely characterized and difficult to handle. The NaK was highly radioactive, i.e. up to 4.5 R/hr on contact with the mixed waste drums. In addition, the potential existed for plutonium and toxic characteristic metals to be present in the NaK, resultant from the location of the partial core meltdown of EBR-I in 1955. Moreover, the NaK was susceptible to degradation after more than 40 years of storage in unmonitored conditions. Such degradation raised the possibility of energetic exothermic reactions between the liquid NaK and its crust, which could have consisted of potassium superoxide as well as hydrated sodium/potassium hydroxides.
Software engineering for the EBR-II data acquisition system conversion
International Nuclear Information System (INIS)
Schorzman, W.
1988-01-01
The original data acquisition system (DAS) for the Experimental Breeder Reactor II (EBR-II) was placed into service with state-of-the-art computer and peripherals in 1970. Software engineering principles for real-time data acquisition were in their infancy, and the original software design was dictated by limited hardware resources. The functional requirements evolved from creative ways to gather and display data. This abstract concept developed into an invaluable tool for system analysis, data reporting, and as a plant monitor for operations. In this paper the approach is outlined to the software conversion project with the restraints of operational transparency and 6 weeks for final conversion and testing. The outline is then compared with the formal principles of software engineering to show the way that bridge the gap can be bridged between the theoretical and real world by analyzing the work and listing the lessons learned
Eutectic penetration times in irradiated EBR-II driver fuel elements
International Nuclear Information System (INIS)
Betten, P.R.; Bottcher, J.H.; Seidel, B.R.
1983-01-01
The experimental test procedure employed the use of a high-temperature furnace which heated pre-irradiated elements to temperature and maintained the environment until element-cladding breach occurred. Pre-irradiated elements of the Mark-II design were first encapsulated in a close-fitting sealed tube that was instrumented with a pressure transducer at the top of the tube and a thermocouple at the element's top-of-fuel axial location. The volume of the capsule was evacuated in order to better identify the pressure pulse which would occur on breach and to minimize contaminants. Next, a three-zone fast-recovery furnace was heated and an axial temperature profile, similar to that experienced in the EBR-II core, was established. The encapsulated element was then quickly inserted into the furnace and remained there until clad breach occurred. The element was then removed from the furnace immediately. Visual and metallurgical examination of the rupture site was done later. A total of seven elements were tested in the above manner
EBR-II spent fuel treatment demonstration project
International Nuclear Information System (INIS)
Benedict, R.W.; Henslee, S.P.
1997-01-01
For approximately 10 years, Argonne National Laboratory was developed a fast reactor fuel cycle based on dry processing. When the US fast reactor program was canceled in 1994, the fuel processing technology, called the electrometallurgical technique, was adapted for treating unstable spent nuclear fuel for disposal. While this technique, which involves electrorefining fuel in a molten salt bath, is being developed for several different fuel categories, its initial application is for sodium-bonded metallic spent fuel. In June 1996, the Department of Energy (DOE) approved a radiation demonstration program in which 100 spent driver assemblies and 25 spent blanket assemblies from the Experimental Breeder Reactor-II (EBR-II) will be treated over a three-year period. This demonstrated will provide data that address issues in the National Research Council's evaluation of the technology. The planned operations will neutralize the reactive component (elemental sodium) in the fuel and produce a low enriched uranium product, a ceramic waste and a metal waste. The fission products and transuranium elements, which accumulate in the electrorefining salt, will be stabilized in the glass-bonded ceramic waste form. The stainless steel cladding hulls, noble metal fission products, and insoluble residues from the process will be stabilized in a stainless steel/zirconium alloy. Upon completion of a successful demonstration and additional environmental evaluation, the current plans are to process the remainder of the DOE sodium bonded fuel
Whole-core damage analysis of EBR-II driver fuel elements following SHRT program
International Nuclear Information System (INIS)
Chang, L.K.; Koenig, J.F.; Porter, D.L.
1987-01-01
In the Shutdown Heat Removal Testing (SHRT) program in EBR-II, fuel element cladding temperatures of some driver subassemblies were predicted to exceed temperatures at which cladding breach may occur. A whole-core thermal analysis of driver subassemblies was performed to determine the cladding temperatures of fuel elemnts, and these temperatures were used for fuel element damage calculation. The accumulated cladding damage of fuel element was found to be very small and fuel element failure resulting from SHRT transients is unlikely. No element breach was noted during the SHRT transients. The reactor was immediately restarted after the most severe SHRT transient had been completed and no driver fuel breach has been noted to date. (orig.)
EBR-II Cover Gas Cleanup System upgrade distributed control and front end computer systems
International Nuclear Information System (INIS)
Carlson, R.B.
1992-01-01
The Experimental Breeder Reactor II (EBR-II) Cover Gas Cleanup System (CGCS) control system was upgraded in 1991 to improve control and provide a graphical operator interface. The upgrade consisted of a main control computer, a distributed control computer, a front end input/output computer, a main graphics interface terminal, and a remote graphics interface terminal. This paper briefly describes the Cover Gas Cleanup System and the overall control system; gives reasons behind the computer system structure; and then gives a detailed description of the distributed control computer, the front end computer, and how these computers interact with the main control computer. The descriptions cover both hardware and software
International Nuclear Information System (INIS)
Commander, J.C.; Lewis, L.; Hammer, R.
1975-06-01
Decontamination and decommissioning of the Experimental Breeder Reactor No. 1 (EBR-I) requires processing of the primary coolant, an eutectic solution of sodium and potassium (NaK), remaining in the EBR-I primary and secondary coolant systems. While developing design criteria for the NaK processing system, reasonable justification was provided for the development of a pilot test plant for field testing some of the process concepts and proposed hardware. The objective of this activity was to prove the process concept on a low-cost, small-scale test bed. The pilot test plant criteria provided a general description of the test including: the purpose, location, description of test equipment available, waste disposal requirements, and a flow diagram and conceptual equipment layout. The pilot plant test operations procedure provided a detailed step-by-step procedure for operation of the pilot plant to obtain the desired test data and operational experience. It also spelled out the safety precautions to be used by operating personnel, including the requirement for alkali metals training certification, use of protective clothing, availability of fire protection equipment, and caustic handling procedures. The pilot plant test was performed on May 16, 1974. During the test, 32.5 gallons or 240 lb of NaK was successfully converted to caustic by reaction with water in a caustic solution. (auth)
EBR-II blanket fuel leaching test using simulated J-13 well water.
Energy Technology Data Exchange (ETDEWEB)
Fonnesbeck, J. E.
1998-05-15
A pulsed-flow leaching test is being conducted using three EBR-II blanket fuel segments. These samples are immersed in simulated J-13 well water. The samples are kept at a constant temperature of 90 C. Leachate is exchanged weekly and analyzed for various nuclides which are of interest from a mobility and longevity point of view. Our primary interest is in the longer-lived species such as {sup 99}Tc, {sup 237}Np, and {sup 241}Am. In addition, the behavior of U, Pu, {sup 90}Sr, and {sup 137}Cs are being analyzed. During the course of this experiment, an interesting observation has been made involving one of the samples which could indicate the possible rapid ''anoxic'' oxidation of uranium metal to UO{sub 2}.
Near-infrared mapping of ARP 299 (IC 694-NGC 3690) - colliding galaxies unveiled
International Nuclear Information System (INIS)
Telesco, C.M.; Decher, R.; Gatley, I.; Edinburgh Royal Observatory, England)
1985-01-01
Near-infrared maps and multicolor photometry of the interacting galaxies IC 694 and NGC 3690 which form Arp 299 (= Markarian 171) are presented. These data reveal for the first time the distribution of nuclei and old red stars in a cataclysmically interacting system. The nuclei are considerably offset from the visual centroids of the galaxies but not from the mass centroids. The near-infrared colors of the most active regions are strongly affected by extinction, emission form hot dust, and bremsstrahlung. Near-infrared emission is also identified with secondary regions of star formation, probably resulting from the galaxies interaction. 24 references
Reconfigurable control of a power plant deaerator using learning automata
International Nuclear Information System (INIS)
Garcia, H.E.; Ray, A.; Edwards, R.M.
1991-01-01
A deaerating feedwater heater, equipped with a water level controller and a pressure controller, has been chosen to investigate the feasibility of a reconfigurable control scheme for power plants by incorporating the concept of learning automata. In this paper simulation results based on a model of the Experimental Breeder Reactor (EBR-II) at the Argonne National Laboratory site in Idaho are presented to demonstrate the efficacy of the reconfigurable control scheme
Expert system applications in support of system diagnostics and prognostics at EBR-II
International Nuclear Information System (INIS)
Lehto, W.K.; Gross, K.C.
1989-01-01
Expert systems have been developed to aid in the monitoring and diagnostics of the Experimental Breeder Reactor-II (EBR-II) at the Idaho National Engineering Laboratory (INEL) in Idaho Falls, Idaho. Systems have been developed for failed fuel surveillance and diagnostics and reactor coolant pump monitoring and diagnostics. A third project is being done jointly by ANL-W and EG ampersand G Idaho to develop a transient analysis system to enhance overall plant diagnostic and prognostic capability. The failed fuel surveillance and diagnosis system monitors, processes, and interprets information from nine key plant sensors. It displays to the reactor operator diagnostic information needed to make proper decisions regarding technical specification conformance during reactor operation with failed fuel. 8 refs., 9 figs., 2 tabs
EBR-II [Experimental Breeder Reactor-II] system surveillance using pattern recognition software
International Nuclear Information System (INIS)
Mott, J.E.; Radtke, W.H.; King, R.W.
1986-02-01
The problem of most accurately determining the Experimental Breeder Reactor-II (EBR-II) reactor outlet temperature from currently available plant signals is investigated. Historically, the reactor outlet pipe was originally instrumented with 8 temperature sensors but, during 22 years of operation, all these instruments have failed except for one remaining thermocouple, and its output had recently become suspect. Using pattern recognition methods to compare values of 129 plant signals for similarities over a 7 month period spanning reconfiguration of the core and recalibration of many plant signals, it was determined that the remaining reactor outlet pipe thermocouple is still useful as an indicator of true mixed mean reactor outlet temperature. Application of this methodology to investigate one specific signal has automatically validated the vast majority of the 129 signals used for pattern recognition and also highlighted a few inconsistent signals for further investigation
Benchmark analyses for EBR-II shutdown heat removal tests SHRT-17 and SHRT-45R
Energy Technology Data Exchange (ETDEWEB)
Mochizuki, Hiroyasu, E-mail: mochizki@u-fukui.ac.jp [Research Institute of Nuclear Engineering, University of Fukui (Japan); Muranaka, Kohmei; Asai, Takayuki [Graduate School of Engineering, University of Fukui (Japan); Rooijen, W.F.G. van, E-mail: rooijen@u-fukui.ac.jp [Research Institute of Nuclear Engineering, University of Fukui (Japan)
2014-08-15
Highlights: • The IAEA EBR-II benchmarks SHRT-17 and SHRT-45R are analyzed with a 1D system code. • The calculated result of SHRT-17 corresponds well to the measured results. • For SHRT-45R ERANOS is used for various core parameters and reactivity coefficients. • SHRT-45R peak temperature is overestimated with the ERANOS feedback coefficients. • The peak temperature is well predicted when the feedback coefficient is reduced. - Abstract: Benchmark problems of several experiments in EBR-II, proposed by ANL and coordinated by the IAEA, are analyzed using the plant system code NETFLOW++ and the neutronics code ERANOS. The SHRT-17 test conducted as a loss-of-flow test is calculated using only the NETFLOW++ code because it is a purely thermal–hydraulic problem. The measured data were made available to the benchmark participants after the results of the blind benchmark calculations were submitted. Our work shows that major parameters of the plant are predicted with good accuracy. The SHRT-45R test, an unprotected loss of flow test is calculated using the NETFLOW++ code with the aid of delayed neutron data and reactivity coefficients calculated by the ERANOS code. These parameters are used in the NETFLOW++ code to perform a semi-coupled analysis of the neutronics – thermal–hydraulic problem. The measured data are compared with our calculated results. In our work, the peak temperature is underestimated, indicating that the reactivity feedback coefficients are too strong. When the reactivity feedback coefficient for thermal expansion is adjusted, good agreement is obtained in general for the calculated plant parameters, with a few exceptions.
Metal waste forms from treatment of EBR-II spent fuel
International Nuclear Information System (INIS)
Abraham, D. P.
1998-01-01
Demonstration of Argonne National Laboratory's electrometallurgical treatment of spent nuclear fuel is currently being conducted on irradiated, metallic driver fuel and blanket fuel elements from the Experimental Breeder Reactor-II (EBR-II) in Idaho. The residual metallic material from the electrometallurgical treatment process is consolidated into an ingot, the metal waste form (MWF), by employing an induction furnace in a hot cell. Scanning electron microscopy (SEM) and chemical analyses have been performed on irradiated cladding hulls from the driver fuel, and on samples from the alloy ingots. This paper presents the microstructures of the radioactive ingots and compares them with observations on simulated waste forms prepared using non-irradiated material. These simulated waste forms have the baseline composition of stainless steel - 15 wt % zirconium (SS-15Zr). Additions of noble metal elements, which serve as surrogates for fission products, and actinides are made to that baseline composition. The partitioning of noble metal and actinide elements into alloy phases and the role of zirconium for incorporating these elements is discussed in this paper
Behavior of EBR-II Mk-V-type fuel elements in simulated loss-of-flow tests
International Nuclear Information System (INIS)
Liu, Y.Y.; Tsai, H.; Billone, M.C.; Holland, J.W.; Kramer, J.M.
1992-11-01
This report discusses three furnace heating tests which were conducted with irradiated, HT9-clad and U-19wt.%Pu-l0wt.%Zr-alloy fuel, Mk-V-type fuel elements in the Alpha-Gamma Hot Cell Facility at Argonne National Laboratory, Illinois. In general, very significant safety margins for fuel-element cladding breaching have been demonstrated in these tests, under conditions that would envelop a bounding unlikely loss-of-flow event in EBR-II. Highlights of the test results will be given, as well as discussions of the cladding breaching mechanisms, axial fuel motion, and fuel surface liquefaction found in high-temperature testing of irradiated metallic fuel elements
Conceptual design report: Decontamination and decommissioning of the EBR-1 Mark-2 NaK
International Nuclear Information System (INIS)
Brown, B.W.; La Rue, D.M.; Stoll, F.E.; Dolenc, M.R.; Crandall, D.L.
1987-09-01
A conceptual design of a processing system for approximately 180 gallons of contaminated NaK (sodium/potassium eutectic alloy) is presented. This NaK resulted from an incident at EBR-1 at the Idaho National Engineering Laboratory in 1955. The proposed method of decommissioning the NaK is to chemically deactivate it by combining it with gaseous chlorine. This process will produce a solid mass of potassium chloride and sodium chloride salts which will mitigate the consequences of further chemical reaction of the NaK should the storage containers be breached in any way. Following the processing of the NaK, the storage vessels will be transferred to an appropriate storage facility for radioactive wastes. 10 refs., 12 figs., 1 tab
The EBR-II X501 Minor Actinide Burning Experiment
Energy Technology Data Exchange (ETDEWEB)
W. J. Carmack; M. K. Meyer; S. L. Hayes; H. Tsai
2008-01-01
The X501 experiment was conducted in EBR II as part of the Integral Fast Reactor program to demonstrate minor actinide burning through the use of a homogeneous recycle scheme. The X501 subassembly contained two metallic fuel elements loaded with relatively small quantities of americium and neptunium. Interest in the behavior of minor actinides (MA) during fuel irradiation has prompted further examination of existing X501 data and generation of new data where needed in support of the U.S. waste transmutation effort. The X501 experiment is one of the few MA bearing fuel irradiation tests conducted worldwide, and knowledge can be gained by understanding the changes in fuel behavior due to addition of MAs. Of primary interest are the effect of the MAs on fuel cladding chemical interaction and the redistribution behavior of americium. The quantity of helium gas release from the fuel and any effects of helium on fuel performance are also of interest. It must be stressed that information presented at this time is based on the limited PIE conducted in 1995–1996 and, currently, represents a set of observations rather than a complete understanding of fuel behavior. This report provides a summary of the X501 fabrication, characterization, irradiation, and post irradiation examination.
CSER 94-014: Storage of metal-fuel loaded EBR-II casks in concrete vault on PFP grounds
International Nuclear Information System (INIS)
Hess, A.L.
1994-01-01
A criticality safety evaluation is presented to permit EBR-2 spent fuel casks loaded with metallic fuel rods to be stored in an 8-ft diameter, cylindrical concrete vault inside the PFP security perimeter. The specific transfer of three casks with Pu alloy fuel from the Los Alamos Molten Plutonium Reactor Experiment from the burial grounds to the vault is thus covered. Up to seven casks may be emplaced in the casing with 30 inches center to center spacing. Criticality safety is assured by definitive packaging rules which keep the fissile medium dry and at a low effective volumetric density
Application of PCT to the EBR II ceramic waste form
International Nuclear Information System (INIS)
Ebert, W. L.; Lewis, M. A.; Johnson, S. G.
2002-01-01
We are evaluating the use of the Product Consistency Test (PCT) developed to monitor the consistency of borosilicate glass waste forms for application to the multiphase ceramic waste form (CWF) that will be used to immobilize waste salts generated during the electrometallurgical conditioning of spent sodium-bonded nuclear fuel from the Experimental Breeder Reactor No. 2 (EBR II). The CWF is a multiphase waste form comprised of about 70% sodalite, 25% borosilicate glass binder, and small amounts of halite and oxide inclusions. It must be qualified for disposal as a non-standard high-level waste (HLW) form. One of the requirements in the DOE Waste Acceptance System Requirements Document (WASRD) for HLW waste forms is that the consistency of the waste forms be monitored.[1] Use of the PCT is being considered for the CWF because of the similarities of the dissolution behaviors of both the sodalite and glass binder phases in the CWF to borosilicate HLW glasses. This paper provides (1) a summary of the approach taken in selecting a consistency test for CWF production and (2) results of tests conducted to measure the precision and sensitivity of the PCT conducted with simulated CWF
EBR Strengthening Technique for Concrete, Long-Term Behaviour and Historical Survey
Directory of Open Access Journals (Sweden)
Christoph Czaderski
2018-01-01
Full Text Available Epoxy bonded steel plates (externally bonded reinforcemen: EBR for the strengthening of concrete structures were introduced to the construction industry in the late 1960s, and the use of fibre reinforced polymers (FRPs was introduced in the 1990s, which means that these techniques have already been used in construction for 50 and 25 years, respectively. In the first part of the paper, a historical survey of the development and introduction of these strengthening techniques into the construction industry are presented. The monitoring of such applications in construction is very important and gives more confidence to this strengthening technique. Therefore, in the second part of the paper, two long-term monitoring campaigns over an extraordinarily long duration will be presented. Firstly, a 47-year monitoring campaign on a concrete beam with an epoxy bonded steel plate and, secondly, a 20-year monitoring campaign on a road bridge with epoxy bonded CFRP (carbon fibre reinforced polymers strips are described. The paper is an expanded version of the paper presented at the SMAR2017 Conference.
International Nuclear Information System (INIS)
Klueh, R.L.; Vitek, J.M.
1984-01-01
The effect of irradiated on the tensile properties of 2 1/4 Cr-1 Mo steel was determined for specimens irradiation in EBR-II at 390 to 550 0 C. Unirradiated control specimens and specimens aged for 5000 h at the irradiation temperatures were also tested. Irradiation to approximately 9 dpa at 390 0 C increased the strength and decreased the ductility compared with the unirradiated and aged specimens. Softening occurred in samples irradiated and tested at 450, 500, and 550 0 C
Weckenmann, Albert; Schmidt, Lorenz-Peter; Bookjans, Martin
Within the collaborative research centre 694 'Integration of electronic components into mobile systems' intelligent mechatronic systems are explored for application at the place of action. Especially in the automotive sector highest requirements on system safety are combined with an enormous importance of the production for the whole national economy. Therefore the collaborative research centre is led by the vision to integrate electronic components in sensors and actors of mobile systems. About 30 scientists at nine participating academic and non-academic institutions in Erlangen explore mechatronic solutions for the requirements on manufacturing processes, electronic systems and quality management techniques within the car of the future.
Visual imagery and the user model applied to fuel handling at EBR-II
International Nuclear Information System (INIS)
Brown-VanHoozer, S.A.
1995-01-01
The material presented in this paper is based on two studies involving visual display designs and the user's perspective model of a system. The studies involved a methodology known as Neuro-Linguistic Programming (NLP), and its use in expanding design choices which included the ''comfort parameters'' and ''perspective reality'' of the user's model of the world. In developing visual displays for the EBR-II fuel handling system, the focus would be to incorporate the comfort parameters that overlap from each of the representation systems: visual, auditory and kinesthetic then incorporate the comfort parameters of the most prominent group of the population, and last, blend in the other two representational system comfort parameters. The focus of this informal study was to use the techniques of meta-modeling and synesthesia to develop a virtual environment that closely resembled the operator's perspective of the fuel handling system of Argonne's Experimental Breeder Reactor - II. An informal study was conducted using NLP as the behavioral model in a v reality (VR) setting
Validation of the REBUS-3/RCT methodologies for EBR-II core-follow analysis
International Nuclear Information System (INIS)
McKnight, R.D.
1992-01-01
One of the many tasks to be completed at EBR-2/FCF (Fuel Cycle Facility) regarding fuel cycle closure for the Integral Fast Reactor (IFR) is to develop and install the systems to be used for fissile material accountancy and control. The IFR fuel cycle and pyrometallurgical process scheme determine the degree of actinide of actinide buildup in the reload fuel assemblies. Inventories of curium, americium and neptunium in the fuel will affect the radiation and thermal environmental conditions at the fuel fabrication stations, the chemistry of reprocessing, and the neutronic performance of the core. Thus, it is important that validated calculational tools be put in place for accurately determining isotopic mass and neutronic inputs to FCF for both operational and material control and accountancy purposes. The primary goal of this work is to validate the REBUS-2/RCT codes as tools which can adequately compute the burnup and isotopic distribution in binary- and ternary-fueled Mark-3, Mark-4, and Mark-5 subassemblies. 6 refs
Microsegregation observed in Fe-35.5Ni-7.5Cr irradiated in EBR-II
International Nuclear Information System (INIS)
Brager, H.R.; Garner, F.A.
1984-01-01
At 593 0 C one alloy, Fe-35.5Ni-7.5Cr, which was particularly resistant to swelling in EBR-II, increased in density 0.9% at 7.6 x 10 22 n/cm 2 (E > 0.1 MeV). Examination by energy dispersive x-ray analysis revealed that substantial oscillations occur in the nickel content of the alloy, varying from 25 to 53% about the nominal level of 35.5%. These oscillations exhibit a period of approx.200 nm. Regions enriched in nickel are depleted in chromium and iron, and the reverse is true in regions of low nickel content. This spinodal-like process produces a net densification and also appears to eventually destroy the swelling resistance of the alloy. Once voids form in the nickel-poor chromium-rich regions, further segregation of nickel to void surfaces is expected to accelerate the loss of swelling resistance
Intelligent distributed control for nuclear power plants
International Nuclear Information System (INIS)
Klevans, E.H.
1991-01-01
In September of 1989 work began on the DOE University Program grant DE-FG07-89ER12889. The grant provides support for a three year project to develop and demonstrate Intelligent Distributed Control (IDC) for Nuclear Power Plants. The body of this First Annual Technical Progress report summarizes the first year tasks while the appendices provide detailed information presented at conference meetings. One major addendum report, authored by M.A. Schultz, describes the ultimate goals and projected structure of an automatic distributed control system for EBR-2. The remaining tasks of the project develop specific implementations of various components required to demonstrate the intelligent distributed control concept
Tensile and fracture properties of EBR-II-irradiated V-15Cr-5Ti containing helium
International Nuclear Information System (INIS)
Grossbeck, M.L.; Horak, J.A.
1986-01-01
The alloy V-15Cr-5Ti was cyclotron-implanted with 80 appM He and subsequently irradiated in the Experimental Breeder Reactor (EBR-II) to 30 dpa. The same alloy was also irradiated in the 10, 20, and 30% cold-worked conditions. Irradiation temperatures ranged from 400 to 700 0 C. No significant effects of helium on mechanical properties were found in this temperature range although the neutron irradiation shifted the temperature of transition from cleavage to ductile fracture to about 625 0 C. Ten percent cold work was found to have a beneficial effect in reducing the tendency for cleavage fracture following irradiation, but high levels (20%) were observed to reduce ductility. Still higher levels (30%) improved ductility by inducing recovery during the elevated-temperature irradiation. Swelling was found to be negligible, but precipitates - titanium oxides or carbonitrides - contained substantial cavities
Software engineering for the EBR-II data acquisition system conversion
International Nuclear Information System (INIS)
Schorzman, W.
1988-01-01
The purpose of this paper is to outline how EBR-II engineering approached the data acquisition system (DAS) software conversion project with the restraints of operational transparency and six weeks for final implementation and testing. Software engineering is a relatively new discipline that provides a structured philosopy for software conversion. The software life cycle is structured into six basic steps: 1) initiation, 2) requirements definition, 3) design, 4) programming, 5) testing, and 6) operations. These steps are loosely defined and can be altered to fit specific software applications. DAS software is encompassed from three sources: 1) custom software, 2) system software, and 3) in-house application software. A data flow structure is used to describe the DAS software. The categories are: 1) software used to bring signals into the central processer, 2) software that transforms the analog data to engineering units and then logs the data in the data store, and 3) software used to transport and display the data. The focus of this paper is to describe how the conversion team used a structured engineering approach and utilized the resources available to produce a quality system on time. Although successful, the conversion process provided some pit falls and stumbling blocks. Working through these obstacles enhanced our understanding and surfaced in the form of LESSONS LEARNED, which are gracefully shared in this paper
Intelligent distributed control for nuclear power plants
International Nuclear Information System (INIS)
Klevans, E.H.
1993-01-01
This project was initiated in September 1989 as a three year project to develop and demonstrate Intelligent Distributed Control (IDC) for Nuclear Power Plants. There were two primary goals of this research project. The first goal was to combine diagnostics and control to achieve a highly automated power plant as described by M.A. Schultz. The second goal was to apply this research to develop a prototype demonstration on an actual power plant system, the EBR-2 steam plant. Described in this Final (Third Annual) Technical Progress Report is the accomplishment of the project's final milestone, an in-plant intelligent control experiment conducted on April 1, 1993. The development of the experiment included: simulation validation, experiment formulation and final programming, procedure development and approval, and experimental results. Other third year developments summarized in this report are: (1) a theoretical foundation for Reconfigurable Hybrid Supervisory Control, (2) a steam plant diagnostic system, (3) control console design tools and (4) other advanced and intelligent control
Fuzzy logic and artificial neural networks for nuclear power plant applications
International Nuclear Information System (INIS)
Berkan, R.C.; Eryurek, E.; Upadhyaya, B.R.
1992-01-01
This paper discusses the feasibility of applying fuzzy logic and neural networks to plant-wide monitoring, diagnostics, and control problems. Different data sets are gathered from several sources including two commercial Pressurized Water Reactors (PWR), the Experimental Breeder Reactor-II (EBR-II), and the conceptual design of Modular Liquid-Metal Reactor (PRISM). These data sets are used to illustrate applications to operating processes, and to PRISM design. The results show that the artificial intelligence approach to a number of operational tasks can considerably improve the safety and availability of nuclear power generation
Energy Technology Data Exchange (ETDEWEB)
Planchon, H.P.; Singleterry, R.C. Jr.
1995-12-01
Upon the termination of EBR-II operation in 1994, the mission has progressed to decommissioning and waste cleanup of the facility. The simplest method to achieve this goal is to bury the raw fuel and activated steel in an approved burial ground or deep geologic repository. While this might be simple, it could be very expensive, consume much needed burial space for other materials, and leave large amounts of fissile easily available to future generations. Also, as with any operation, an associated risk to personnel and the public from the buried waste exists. To try and reduce these costs and risks, alternatives to burial are sought. One alternative explored here for EBR-II is to condition the fuel and store the fission products and steel either permanently or temporarily in the sealed primary boundary of the decommissioned reactor. The first problem is to identify which subassemblies are going to be conditioned and their current composition and decay time. The next problem is to identify the conditioning process and determine the composition and form of the waste streams. The volume, mass, heat, and curie load of the waste streams needs to be determined so a waste-assembly can be designed. The reactor vessel and internals need to be analyzed to determine if they can handle these loads. If permanent storage is the goal, then mechanisms for placing the waste-assembly in the reactor vessel and sealing the vessel are needed. If temporary storage is the goal, then mechanisms for waste-assembly placement and retrieval are needed. This paper answers the technical questions of volume, mass, heat, and curie loads while just addressing the other questions found in a safety analysis. The final conclusion will compare estimated risks from the burial option and this option.
Swelling and tensile properties of EBR-II-irradiated tantalum alloys for space reactor applications
International Nuclear Information System (INIS)
Grossbeck, M.L.; Wiffen, F.W.
1985-01-01
The tantalum alloys T-111, ASTAR-811C, Ta-10 W, and unalloyed tantalum were examined following EBR-II irradiation to a fluence of 1.7 x 10 26 neutrons/m 2 (E > 0.1 MeV) at temperatures from 650 to 950 K. Swelling was found to be negligible for all alloys; only tantalum was found to exhibit swelling, 0.36%. Tensile testing revealed that irradiated T-111 and Ta-10 W are susceptible to plastic instability, but ASTAR-811C and tantalum were not. The tensile properties of ASTAR-811C appeared adequate for current SP-100 space nuclear reactor designs. Irradiated, oxygen-doped T-111 exhibited no plastic deformation, and the abrupt failure was intergranular in nature. The absence of plastic instability in ASTAR-811C is encouraging for alloys containing carbide precipitates. These fine precipitates might prevent dislocation channeling, which leads to plastic instability in many bcc metals after irradiation. 10 refs., 13 figs., 8 tabs
Visual imagery and the user model applied to fuel handling at EBR-II
Energy Technology Data Exchange (ETDEWEB)
Brown-VanHoozer, S.A.
1995-06-01
The material presented in this paper is based on two studies involving visual display designs and the user`s perspective model of a system. The studies involved a methodology known as Neuro-Linguistic Programming (NLP), and its use in expanding design choices which included the ``comfort parameters`` and ``perspective reality`` of the user`s model of the world. In developing visual displays for the EBR-II fuel handling system, the focus would be to incorporate the comfort parameters that overlap from each of the representation systems: visual, auditory and kinesthetic then incorporate the comfort parameters of the most prominent group of the population, and last, blend in the other two representational system comfort parameters. The focus of this informal study was to use the techniques of meta-modeling and synesthesia to develop a virtual environment that closely resembled the operator`s perspective of the fuel handling system of Argonne`s Experimental Breeder Reactor - II. An informal study was conducted using NLP as the behavioral model in a v reality (VR) setting.
Flux line lattice melting transition in YBa2Cu3O6.94 observed in specific heat experiments
International Nuclear Information System (INIS)
Roulin, M.; Junod, A.; Walker, E.
1996-01-01
When a magnetic field penetrates a type II superconductor, it forms a lattice of thin quantized filaments called magnetic vortices. Resistance, magnetization, and neutron diffraction experiments have shown that the vortex lattice of high-temperature superconductors can melt along a line in the field-temperature plane. The calorimetric signature of melting on this line was observed in a high-accuracy adiabatic specific heat experiment performed on YBa 2 Cu 3 O 6.94 . The specific heat of the vortex liquid was greater than that of the vortex solid. 17 refs., 3 figs
Tensile and fracture properties of EBR-II-irradiated V-15Cr-5Ti containing helium
Energy Technology Data Exchange (ETDEWEB)
Grossbeck, M.L.; Horak, J.A.
1986-01-01
The alloy V-15Cr-5Ti was cyclotron-implanted with 80 appM He and subsequently irradiated in the Experimental Breeder Reactor (EBR-II) to 30 dpa. The same alloy was also irradiated in the 10, 20, and 30% cold-worked conditions. Irradiation temperatures ranged from 400 to 700/sup 0/C. No significant effects of helium on mechanical properties were found in this temperature range although the neutron irradiation shifted the temperature of transition from cleavage to ductile fracture to about 625/sup 0/C. Ten percent cold work was found to have a beneficial effect in reducing the tendency for cleavage fracture following irradiation, but high levels (20%) were observed to reduce ductility. Still higher levels (30%) improved ductility by inducing recovery during the elevated-temperature irradiation. Swelling was found to be negligible, but precipitates - titanium oxides or carbonitrides - contained substantial cavities.
The graphics-based human interface to the DISYS diagnostic/control guidance system at EBR-2
International Nuclear Information System (INIS)
Edwards, R.M.; Chavez, C.; Kamarthi, S.; Dharap, S.; Lindsay, R.W.; Staffon, J.
1990-01-01
An initial graphics based interface to the real-time DISYS diagnostic system has been developed using the multi-tasking capabilities of the UNIX operating system and X-Windows 11 Xlib graphics library. This system is interfaced to live plant data at the Experimental Breeder Reactor (EBR-2) for the Argon Cooling System of fuel handling operations and the steam plant. The interface includes an intelligent process schematic which highlights problematic components and sensors based on the results of the diagnostic computations. If further explanation of a faulted component is required, the user can call up a display of the diagnostic computations presented in a tree-like diagram. Numerical data on the process schematic and optional diagnostic tree are updated as new real-time data becomes available. The initial X-Windows 11 based interface will be further enhanced using VI Corporation DATAVIEWS graphical data base software. 5 refs., 6 figs
International Nuclear Information System (INIS)
Garner, P.L.; Briggs, L.L.; Gross, K.C.; Ku, J.Y.; Staffon, J.D.
1994-01-01
The SASSYS computer program for safety analyses of liquid-metal- cooled fast reactors has been adapted for use as the simulation engine under the graphical user interface provided by the GRAFUN and HIST programs and the Data Views software package under the X Window System on UNIX-based computer workstations to provide a high fidelity, real-time, interactive simulator of the Experimental Breeder Reactor Number II (EBR-II) plant. In addition to providing analysts with an interactive way of performing safety case studies, the simulator can be used to investigate new control room technologies and to supplement current operator training
Intelligent distributed control for nuclear power plants
International Nuclear Information System (INIS)
Klevans, E.H.
1992-01-01
This project was initiated in September 1989 as a three year project to develop and demonstrate Intelligent Distributed Control (IDC) for Nuclear Power Plants. The body of this Third Annual Technical Progress report summarizes the period from September 1991 to October 1992. There were two primary goals of this research project. The first goal was to combine diagnostics and control to achieve a highly automated power plant as described by M.A. Schultz. His philosophy, is to improve public perception of the safety of nuclear power plants by incorporating a high degree of automation where a greatly simplified operator control console minimizes the possibility of human error in power plant operations. To achieve this goal, a hierarchically distributed control system with automated responses to plant upset conditions was pursued in this research. The second goal was to apply this research to develop a prototype demonstration on an actual power plant system, the EBR-2 stem plant. Emphasized in this Third Annual Technical Progress Report is the continuing development of the in-plant intelligent control demonstration for the final project milestone and includes: simulation validation and the initial approach to experiment formulation
International Nuclear Information System (INIS)
1982-10-01
The meeting at Idaho Falls was the follow-up meeting of the first expert meeting on EBR II- Rapsodie- KNK II operating experience, which took place at the Karlsruhe Research Center in March 1980. The present report compiles the ten German papers presented at the Idaho Falls meeting, discussing various aspects of experience gained by the operation of KNK II
Energy Technology Data Exchange (ETDEWEB)
Smith, H. H.; Bateman, J. L.; Quastler, H.; Rossi, H. H. [Biology and Medical Departments, Brookhaven National Laboratory, Upton, NY (United States)
1964-05-15
The maize used in these experiments has the advantage for RBE studies of yielding a basically first-order dose-response curve with low as well as with high LET radiations. An exposure apparatus was used which produced essentially equal dose rates in five rings of seeds placed so as to intercept neutrons of 0.43, 0.65, 1.00, 1.50 and 1.80 MeV. The mutant sectors produced in leaves are believed to be due mostly to simple chromosome breakage and deletion. Experiments were performed at dosages that gave responses which were linear, below saturation levels, and overlapping in range for the monoenergetic fast neutrons and 250 kVp X-rays. RBE values, calculated from relative slopes of linear-regression lines for neutrons and X-rays ranged from 42 to 135 with an overall average of about 70. Fast neutrons of 0.43 MeV energy were the most efficient, of those used, in producing g{sub 2} mutant sectors. (author) [French] Pour les etudes sur l'EBR, le maft utilise au cours des experiences offre l'avantage de donner une courbe dose-reponse qui est essentiellement de premier ordre, que le TLE du rayonnement soit faible ou eleve. Les auteurs ont utilise un appareil d'irradiation assurant des debits de dose pratiquement egaux dans cinq couronnes de semences disposees de maniere a intercepter les neutrons de 0,43, 0,65, 1,00, 1,50 et 1,80 MeV. On pense que les secteurs mutants produits dans les feuilles sont dus essentiellement a une rupture et une disparition de chromosomes simples. Les auteurs ont fait des experiences a des doses qui ont donne des reponses lineaires, inferieures au niveau de saturation et se chevauchant dans le cas des neutrons rapides et des rayons X de 250 kV-crete. Les valeurs de l'EBR calculees d'apres la comparaison des pentes des courbes de regression lineaire pour les neutrons et les rayons X varient de 42 a 135, avec une valeur moyenne d'environ 70. Parmi les neutrons utilises, les neutrons rapides de 0,43 MeV ont ete les plus efficaces pour produire des
Review of behavior of mixed-oxide fuel elements in extended overpower transient tests in EBR-II
International Nuclear Information System (INIS)
Tsai, H.; Neimark, L.A.
1994-10-01
From a series of five tests conducted in EBR-II, a substantial data base has been established on the performance of mixed-oxide fuel elements in a liquid-metal-cooled reactor under slow-ramp transient overpower conditions. Each test contained 19 preirradiated fuel elements with varying design and prior operating histories. Elements with aggressive design features, such as high fuel smear density and/or thin cladding, were included to accentuate transient effects. The ramp rates were either 0.1 or 10% ΔP/P/s and the overpowers ranged between ∼60 and 100% of the elements' prior power ratings. Six elements breached during the tests, all with aggressive design parameters. The other elements, including all those with moderate design features for the reference or advanced long-life drivers for PNC's prototype fast reactor Monju, maintained their cladding integrity during the tests. Posttest examination results indicated that fuel/cladding mechanical interaction (FCMI) was the most significant mechanism causing the cladding strain and breach. In contrast, pressure loading from the fission gas in the element plenum was less important, even in high-burnup elements. During an overpower transient, FCMI arises from fuel/cladding differential thermal expansion, transient fuel swelling, and, significantly, the gas pressure in the sealed central cavity of elements with substantial centerline fuel melting. Fuel performance data from these tests, including cladding breaching margin and transient cladding strain, are correlatable with fuel-element design and operating parameters. These correlations are being incorporated into fuel-element behavior codes. At the two tested ramp rates, fuel element behavior appears to be insensitive to transient ramp rate and there appears to be no particular vulnerability to slow ramp transients as previously perceived
Intelligent distributed control for nuclear power plants
International Nuclear Information System (INIS)
Klevans, E.H.; Edwards, R.M.; Ray, A.; Lee, K.Y.; Garcia, H.E.: Chavez, C.M.; Turso, J.A.; BenAbdennour, A.
1991-01-01
In September of 1989 work began on the DOE University Program grant DE-FG07-89ER12889. The grant provides support for a three year project to develop and demonstrate Intelligent Distributed Control (IDC) for Nuclear Power Plants. The body of this Second Annual Technical Progress report covers the period from September 1990 to September 1991. It summarizes the second year accomplishments while the appendices provide detailed information presented at conference meetings. These are two primary goals of this research. The first is to combine diagnostics and control to achieve a highly automated power plant as described by M.A. Schultz, a project consultant during the first year of the project. This philosophy, as presented in the first annual technical progress report, is to improve public perception of the safety of nuclear power plants by incorporating a high degree automation where greatly simplified operator control console minimizes the possibility of human error in power plant operations. A hierarchically distributed control system with automated responses to plant upset conditions is the focus of our research to achieve this goal. The second goal is to apply this research to develop a prototype demonstration on an actual power plant system, the EBR-II steam plant
2006 nuclear power world report
International Nuclear Information System (INIS)
Anon.
2007-01-01
At the turn of 2006/2007, 437 nuclear power plants were available for energy supply, or were being commissioned, in 31 countries of the world. This is seven plants less than at the turn of 2005/2006. The aggregate gross power of the plants amounted to approx. 389.5 GWe, the aggregate net power, to 370.5 GWe. This indicates a slight decrease of gross power by some 0.15 GWe compared to the level the year before, while the available net power increased, also slightly, by approx. 0.2 GWe. The Tarapur 3 nuclear generating unit in India, a D 2 O PWR of 540 MWe gross power, was newly commissioned. In 2006, 8 nuclear power plants in Europe (4 in the United Kingdom, 2 in Bulgaria, 1 each in the Slovak Republic and in Spain) discontinued power operation for good. 29 nuclear generating units, i.e. 6 plants more than at the end of 2005, were under construction in late 2006 in 9 countries with an aggregate gross power of approx. 25.5 GWe. Worldwide, some 40 new nuclear power plants are in the concrete project design, planning, and licensing phases; in some of these cases, contracts have already been signed. Net electricity generation in nuclear power plants worldwide in 2006 achieved another top ranking level of approx. 2,660 billion kWh (2005: approx. 2,750 billion kWh). Since the first generation of electricity in a nuclear power plant in the EBR-1 fast breeder (USA) on December 20, 1951, cumulated gross production has reached approx. 56,875 billion kWh, and operating experience has grown to some 12,399 reactor years. (orig.)
EBR-II blanket fuel leaching test using simulated J-13 well water
International Nuclear Information System (INIS)
Fonnesbeck, J. E.
1999-01-01
This paper discusses the results of a pulsed-flow leaching test using simulated J-13 well water leachant. This test was performed on three blanket fuel segments from the ANL-W EBR-II nuclear reactor which were originally made up of depleted uranium (DU). This experiment was designed to mimic conditions which would exist if, upon disposal of this material in a geological repository, it came in direct contact with groundwater. These segments were contained in pressure vessels and maintained at a constant temperature of 90 C. Weekly aliquots of leachate were taken from the three vessels and replaced with an equal volume of fresh leachant. These weekly aliquots were analyzed for both 90 Sr and 137 Cs. The results of the pulsed-flow leach test showed the formation of uranium oxide (UO 2 ) and uranium hydride (UH 3 ) particulate with rapid release of the 137 Cs and 90 Sr to the leachant. On the fifth week of sampling, one of the vessels became over pressurized and vented gas when opened. The most reasonable explanation for the presence of gas in this vessel is that the unoxidized uranium metal in the blanket segment could have reacted with the surrounding water leachant to form hydrogen. However, an investigation is currently being undertaken to both qualify and quantify H 2 formation during uranium spent nuclear fuel corrosion in water
Energy Technology Data Exchange (ETDEWEB)
Hermann, S.D.; Gese, N.J. [Separations Department, Idaho National Laboratory, P.O. Box 1625, Idaho Falls, ID 83415 (United States); Wurth, L.A. [Zinc Air Inc., 5314-A US Hwy 2 West, Columbia Falls, MT 59912 (United States)
2013-07-01
An experimental study was conducted to assess pyrochemical treatment options for degraded EBR-II fuel. As oxidized material, the degraded fuel would need to be converted back to metal to enable electrorefining within an existing electro-metallurgical treatment process. A lithium-based electrolytic reduction process was studied to assess the efficacy of converting oxide materials to metal with a particular focus on the impact of zirconium oxide and sodium oxide on this process. Bench-scale electrolytic reduction experiments were performed in LiCl-Li{sub 2}O at 650 C. degrees with combinations of manganese oxide (used as a surrogate for uranium oxide), zirconium oxide, and sodium oxide. In the absence of zirconium or sodium oxide, the electrolytic reduction of MnO showed nearly complete conversion to metal. The electrolytic reduction of a blend of MnO-ZrO{sub 2} in LiCl - 1 wt% Li{sub 2}O showed substantial reduction of manganese, but only 8.5% of the zirconium was found in the metal phase. The electrolytic reduction of the same blend of MnO-ZrO{sub 2} in LiCl - 1 wt% Li{sub 2}O - 6.2 wt% Na{sub 2}O showed substantial reduction of manganese, but zirconium reduction was even less at 2.4%. This study concluded that ZrO{sub 2} cannot be substantially reduced to metal in an electrolytic reduction system with LiCl - 1 wt% Li{sub 2}O at 650 C. degrees due to the perceived preferential formation of lithium zirconate. This study also identified a possible interference that sodium oxide may have on the same system by introducing a parasitic and cyclic reaction of dissolved sodium metal between oxidation at the anode and reduction at the cathode. When applied to oxidized sodium-bonded EBR-II fuel (e.g., U-10Zr), the prescribed electrolytic reduction system would not be expected to substantially reduce zirconium oxide, and the accumulation of sodium in the electrolyte could interfere with the reduction of uranium oxide, or at least render it less efficient.
2009 nuclear power world report
International Nuclear Information System (INIS)
Anon.
2010-01-01
At the end of 2009, 437 nuclear power plants were available for energy supply in 30 countries of the world. This is 1 plant less than at the end of 2008. The aggregate gross power of the plants amounted to approx. 391.5 GWe, the aggregate net power, to 371.3 GWe. This capacity numbers are a little bit less than one year before (gross: 392.6 GWe, net: 372.2 GWe). Two units were commissioned in 2009; 1 unit in India (Rajasthan 5) and 1 unit in Japan (Tomari 3). Three nuclear power plant were shut down permanently in 2009 in Japan (Hamaoka 1 and Hamaoka 2) and in Lithuania (Ignalina 2). 52 nuclear generating units, i.e. 9 plants more than at the end of 2008, were under construction in late 2009 in 14 countries with an aggregate gross power of approx. 51.2 GWe. Worldwide, some 80 new nuclear power plants are in the concrete project design, planning, and licensing phases; in some of these cases license applications have been submitted or contracts have already been signed. Some 130 further projects are planned. Net electricity generation in nuclear power plants worldwide in 2009 achieved another reasonable ranking level of approx. 2,558 billion kWh (2008: approx. 2,628 billion kWh). Since the first generation of electricity in a nuclear power plant in the EBR-I fast breeder (USA) on December 20, 1951, cumulated net production has reached approx. 60,500 billion kWh, and operating experience has grown to some 13,950 reactor years. (orig.)
Tensile properties of vanadium alloys irradiated at 390{degrees}C in EBR-II
Energy Technology Data Exchange (ETDEWEB)
Chung, H.M.; Tsai, H.C.; Nowicki, L.J. [Argonne National Lab., IL (United States)] [and others
1997-08-01
Vanadium alloys were irradiated in Li-bonded stainless steel capsules to {approx}390{degrees}C in the EBR-II X-530 experiment. This report presents results of postirradiation tests of tensile properties of two large-scale (100 and 500 kg) heats of V-4Cr-Ti and laboratory (15-30 kg) heats of boron-doped V-4Cr-4Ti, V-8Cr-6Ti, V-5Ti, and V-3Ti-1Si alloys. Tensile specimens, divided into two groups, were irradiated in two different capsules under nominally similar conditions. The 500-kg heat (No. 832665) and the 100-kg heat (VX-8) of V-4Cr-4Ti irradiated in one of the subcapsules exhibited complete loss of work-hardening capability, which was manifested by very low uniform plastic strain. In contrast, the 100-kg heat of V-4Cr-4Ti irradiated in another subcapsule exhibited good tensile properties (uniform plastic strain 2.8-4.0%). A laboratory heat of V-3Ti-1Si irradiated in the latter subcapsule also exhibited good tensile properties. These results indicate that work-hardening capability at low irradiation temperatures varies significantly from heat to heat and is influenced by nominally small differences in irradiation conditions.
High burnup, high power irradiation behavior of helium-bonded mixed carbide fuel pins
International Nuclear Information System (INIS)
Levine, P.J.; Nayak, U.P.; Boltax, A.
1983-01-01
Large diameter (9.4 mm) helium-bonded mixed carbide fuel pins were successfully irradiated in EBR-II to high burnup (12%) at high power levels (100 kW/m) with peak cladding midwall temperatures of 550 0 C. The wire-wrapped pins were clad with 0.51-mm-thick, 20% cold-worked Type 316 stainless steel and contained hyperstoichiometric (Usub(0.8)Pusub(0.2))C fuel covering the smeared density range from 75-82% TD. Post-irradiation examinations revealed: extensive fuel-cladding mechanical interaction over the entire length of the fuel column, 35% fission gas release at 12% burnup, cladding carburization and fuel restructuring. (orig.)
The Birth of Nuclear-Generated Electricity
1999-09-01
The Experimental Breeder Reactor-I (EBR-I), built in Idaho in 1949, generated the first usable electricity from nuclear power on December 20, 1951. More importantly, the reactor was used to prove that it was possible to create more nuclear fuel in the reactor than it consumed during operation -- fuel breeding. The EBR-I facility is now a National Historic Landmark open to the public.
The Birth of Nuclear-Generated Electricity
International Nuclear Information System (INIS)
Claflin, D.J. POC
1999-01-01
The Experimental Breeder Reactor-I (EBR-I), built in Idaho in 1949, generated the first usable electricity from nuclear power on December 20, 1951. More importantly, the reactor was used to prove that it was possible to create more nuclear fuel in the reactor than it consumed during operation -- fuel breeding. The EBR-I facility is now a National Historic Landmark open to the public
International Nuclear Information System (INIS)
Keiser, D.D. Jr.; Mariani, R.D.
1999-01-01
Argonne National Laboratory is developing an electrometallurgical treatment for spent nuclear fuels. The initial demonstration of this process is being conducted on U-Zr alloy fuel elements irradiated in the experimental breeder reactor II (EBR-II). We report the first metallographic characterization of cladding hull remains for the electrometallurgical treatment of spent metallic fuel. During the electrorefining process, Zr-rich layers, with some U, deposit on all exposed surfaces of irradiated cladding segments (hulls) that originally contained the fuel alloy that was being treated. In some cases, not only was residual Zr (and U) found inside the cladding hulls, but a Zr-rind was also observed near the interior cladding hull surface. The Zr-rind was originally formed during the fuel casting process on the fuel slug. The observation of Zr deposits on all exposed cladding surfaces is explained with thermodynamic principles, when two conditions are met. These conditions are partial oxidation of Zr and the presence of residual uranium in the hulls when the electrorefining experiment is terminated. Comparisons are made between the structure of the initial irradiated fuel before electrorefining and the morphology of the material remaining in the cladding hulls after electrorefining. (orig.)
Occhipinti, Paola; Morguí, Josep Anton; Àgueda, Alba; Batet, Oscar; Borràs, Sílvia; Cañas, Lídia; Curcoll, Roger; Grossi, Claudia; Nofuentes, Manel; Vazquez, Eusebi; Rodó, Xavier
2015-04-01
In the framework of the ClimaDat project, IC3 has established a network of eight monitoring stations across the Iberian Peninsula and the Canarian Archipelago with the aim of studying climate processes. The monitoring station at the Ebre River Delta (DEC3) is located in the Ebre River Delta Natural Park (40° 44' N; 0° 47' E) and it is characterized by the typical North-Western Mediterranean climate. Since 2013, atmospheric greenhouse gases (GHG) and 222Rn tracer gas together with the meteorological parameters are continuously measured from a 10 m a.g.l. height tower. Atmospheric GHG (CO2, CH4, CO and N2O) concentrations are determined using a Picarro analyzer G2301 (CO2 and CH4) and a modified gas chromatograph (GC) Agilent 6890N (CO2, CH4, CO and N2O). Open data access is available from the www.climadat.es website. Data collected at the DEC3 station are also submitted to the InGOS platform since this station is part of the InGOS European infrastructure project. Researchers from the Laboratory of the Atmosphere and the Oceans (LAO) at IC3 have performed an intercomparison study at the DEC3 site between three different Picarro analyzers (two Picarro G2301 and one Picarro G2301M), a Los Gatos Research (LGR) analyzer and the GC system already installed at the station. The aim of this study is to compare and assess the measuring agreement between the four optical gas analyzers and the GC. In the first part of the experiment, all instruments have been calibrated using NOAA gases as primary standards analyzing five Praxair provided targets to evaluate the precision of the measuring instruments. Max Plank Institute (MPI) gases have been used as secondary standards for the GC whereas Praxair provided tanks are used as secondary standards for the Picarro and the LGR analyzers. In the second part of the experiment, atmospheric GHG were measured from natural atmospheric air taken from a 10 m a.g.l. inlet. Daily cycles of GHG measurements were carried out using different
Data package addendum for COBRA-1A2 life extension to 400 EFPD
International Nuclear Information System (INIS)
Hecht, S.L.; Ermi, A.M.
1994-01-01
The COBRA-1A experiment was originally designed for irradiations up to 350 effective full power days (EFPD) in EBR-II. Three of the seven B7A test capsules were discharged after 88.6 EFPD (COBRA-1A1; EBR-II designation X516), while the remaining four capsules continued to be irradiated to a goal exposure of 300 EFPD (COBRA-1A2; EBR-II designation X516A). However, it was recently decided that COBRA-1A2 was to remain in the reactor during Run 170, giving and nominal end-of-life (EOL) exposure of 375 EFPD. Since the revised test exposure exceeds the design basis given in supporting analyses, amended analyses are provided herein, giving the technical bases for the extended irradiation. This report describes the safety analysis for the extension of the COBRA-1A2 test (X516A) to 400 effective full power days in FBR-II
Nuclear power world report 2013
International Nuclear Information System (INIS)
Anon.
2014-01-01
At the end of 2013, 435 nuclear power plants were available for energy supply in 31 countries of the world. This means that the number decreased by 2 units compared to the previous year's number on 31 December 2012. The aggregate gross power of the plants amounted to approx. 398,861 MWe, the aggregate net power, to 378,070 MWe (gross: 392,793 MWe, net: 372,572 MWe, new data base as of 2013: nameplate capacities). Four units were commissioned in 2014; three units in China and one in India. Eight units were shut down permanently in 2013; 2 units in Japan, and four units in the USA. Two units in Canada were declared permanently shut-down after a long-term shutdown. 70 nuclear generating units - 2 more than at the end of 2012 - were under construction in late 2013 in 15 countries with an aggregate gross power of approx. 73,814 MWe and net power of approx. 69,279 MWe. Six new projects have been started in 2013 in four countries (Belarus, China, the Republic of Korea, and the United Arab Emirates). Worldwide, some 125 new nuclear power plants are in the concrete project design, planning, and licensing phases; in some of these cases license applications have been submitted or contracts have already been signed. Some 100 further projects are planned. Net electricity generation in nuclear power plants worldwide in 2013 achieved a level of approx. 2,364.15 billion (109) kWh (2012: approx. 2,350.80 billion kWh). Since the first generation of electricity in a nuclear power plant in the EBR-I fast breeder (USA) on December 20, 1951, cumulated net production has reached approx. 70,310 billion kWh, and operating experience has grown to some 15,400 reactor years. (orig.)
Nuclear power world report 2013
Energy Technology Data Exchange (ETDEWEB)
Anon.
2014-07-15
At the end of 2013, 435 nuclear power plants were available for energy supply in 31 countries of the world. This means that the number decreased by 2 units compared to the previous year's number on 31 December 2012. The aggregate gross power of the plants amounted to approx. 398,861 MWe, the aggregate net power, to 378,070 MWe (gross: 392,793 MWe, net: 372,572 MWe, new data base as of 2013: nameplate capacities). Four units were commissioned in 2014; three units in China and one in India. Eight units were shut down permanently in 2013; 2 units in Japan, and four units in the USA. Two units in Canada were declared permanently shut-down after a long-term shutdown. 70 nuclear generating units - 2 more than at the end of 2012 - were under construction in late 2013 in 15 countries with an aggregate gross power of approx. 73,814 MWe and net power of approx. 69,279 MWe. Six new projects have been started in 2013 in four countries (Belarus, China, the Republic of Korea, and the United Arab Emirates). Worldwide, some 125 new nuclear power plants are in the concrete project design, planning, and licensing phases; in some of these cases license applications have been submitted or contracts have already been signed. Some 100 further projects are planned. Net electricity generation in nuclear power plants worldwide in 2013 achieved a level of approx. 2,364.15 billion (109) kWh (2012: approx. 2,350.80 billion kWh). Since the first generation of electricity in a nuclear power plant in the EBR-I fast breeder (USA) on December 20, 1951, cumulated net production has reached approx. 70,310 billion kWh, and operating experience has grown to some 15,400 reactor years. (orig.)
2010 nuclear power world report
International Nuclear Information System (INIS)
Anon.
2011-01-01
At the end of 2010, 443 nuclear power plants were available for energy supply in 30 countries of the world. This are 6 plants more than at the end of 2009. The aggregate gross power of the plants amounted to approx. 396,118 MWe, the aggregate net power, to 375,947 MWe. This capacity numbers are a little bit more than one year before (gross: 391,551 MWe, net: 371,331 MWe). Six unites were commissioned in 2010; 2 units in China and India each and one unit in the Republic of Korea and Russia each. One unit, the Fast Breeder Pilot Reactor Monju in Japan, was connected to the grid after a long-term shutdown. One nuclear power plant, the Prototype Fast Breeder Reactor Phenix in France, was shut down permanently in 2010. 62 nuclear generating units, i.e. 9 plants more than at the end of 2009, were under construction in late 2010 in 15 countries with an aggregate gross power of approx. 63,998 MWe. Worldwide, some 90 new nuclear power plants are in the concrete project design, planning, and licensing phases; in some of these cases license applications have been submitted or contracts have already been signed. Some 120 further projects are planned. Net electricity generation in nuclear power plants worldwide in 2010 achieved another reasonable ranking level of approx. 2,627.5 billion kWh (2009: approx. 2,558 billion kWh). Since the first generation of electricity in a nuclear power plant in the EBR-I fast breeder (USA) on December 20, 1951, cumulated net production has reached approx. 63,100 billion kWh, and operating experience has grown to some 14,400 reactor years. (orig.)
Reirradiation of mixed-oxide fuel pins at increased temperatures
International Nuclear Information System (INIS)
Lawrence, L.A.; Weber, E.T.
1976-05-01
Mixed-oxide fuel pins from EBR-II irradiations were reirradiated in the General Electric Test Reactor (GETR) at higher temperatures than experienced in EBR-II to study effects of the increased operating temperatures on thermal/mechanical and chemical behavior. The response of a mixed-oxide fuel pin to a power increase after having operated at a lower power for a significant portion of its life-time is an area of performance evaluation where little information currently exists. Results show that the cladding diameter changes resulting from the reirradiation are strongly dependent upon both prior burnup level and the magnitude of the temperature increase. Results provide the initial rough outlines of boundaries within which mixed-oxide fuel pins can or cannot tolerate power increases after substantial prior burnup at lower powers
Liquid metal reactor cover gas purification and analysis in the USA
International Nuclear Information System (INIS)
Allen, K.J.; Meadows, G.E.; Schuck, W.J.
1986-09-01
Two sodium cooled reactors are currently being operated in the United States of America for the US Department of Energy. These are Experimental Breeder Reactor 11, EBR-11, and the Fast Flux Test Facility, FFTF. EBR-11 is located near Idaho Falls, Idaho, and the FFTF is near Richland, Washington. These reactors are currently engaged in a wide range of testing including fuels and materials tests, and plant system performance and safety development. The US DOE program also includes designs of a next generation sodium cooled power reactor. The FFTF and EBR-11 communities are providing input to these designs. This paper discusses the efforts to develop and operate cover gas systems for the sodium cooled nuclear reactor program in the USA
Energy Technology Data Exchange (ETDEWEB)
Dong, Y. [Department of Materials Science and Engineering, University of Michigan, Ann Arbor, MI 48109 (United States); Sencer, B.H. [Idaho National Laboratory, Idaho Falls, ID 83402 (United States); Garner, F.A. [Radiation Effects Consulting, Richland, WA 99354 (United States); Marquis, E.A., E-mail: emarq@umich.edu [Department of Materials Science and Engineering, University of Michigan, Ann Arbor, MI 48109 (United States)
2015-12-15
AISI 304 stainless steel was irradiated at 416 °C and 450 °C at a 4.4 × 10{sup −9} and 3.05 × 10{sup −7} dpa/s to ∼0.4 and ∼28 dpa, respectively, in the reflector of the EBR-II fast reactor. Both unirradiated and irradiated conditions were examined using standard and scanning transmission electron microscopy, energy dispersive spectroscopy, and atom probe tomography on very small specimens produced by focused ion beam milling. These results are compared with previous electron microscopy examination of 3 mm disks from essentially the same material. By comparing a very low dose specimen with a much higher dose specimen, both derived from a single reactor assembly, it has been demonstrated that the coupled microstructural and microchemical evolution of dislocation loops and other sinks begins very early, with elemental segregation producing at these sinks what appears to be measurable precursors to fully formed precipitates found at higher doses. The nature of these sinks and their possible precursors are examined in detail.
Dong, Y.; Sencer, B. H.; Garner, F. A.; Marquis, E. A.
2015-12-01
AISI 304 stainless steel was irradiated at 416 °C and 450 °C at a 4.4 × 10-9 and 3.05 × 10-7 dpa/s to ∼0.4 and ∼28 dpa, respectively, in the reflector of the EBR-II fast reactor. Both unirradiated and irradiated conditions were examined using standard and scanning transmission electron microscopy, energy dispersive spectroscopy, and atom probe tomography on very small specimens produced by focused ion beam milling. These results are compared with previous electron microscopy examination of 3 mm disks from essentially the same material. By comparing a very low dose specimen with a much higher dose specimen, both derived from a single reactor assembly, it has been demonstrated that the coupled microstructural and microchemical evolution of dislocation loops and other sinks begins very early, with elemental segregation producing at these sinks what appears to be measurable precursors to fully formed precipitates found at higher doses. The nature of these sinks and their possible precursors are examined in detail.
Frequency response testing at Experimental Breeder Reactor II using discrete-level periodic signals
International Nuclear Information System (INIS)
Rhodes, W.D.; Larson, H.A.
1990-01-01
The Experimental Breeder Reactor 2 (EBR-2) reactivity-to-power frequency-response function was measured with pseudo-random, discrete-level, periodic signals. The reactor power deviation was small with insignificant perturbation of normal operation and in-place irradiation experiments. Comparison of results with measured rod oscillator data and with theoretical predictions show good agreement. Moreover, measures of input signal quality (autocorrelation function and energy spectra) confirm the ability to enable this type of frequency response determination at EBR-2. Measurements were made with the pseudo-random binary sequence, quadratic residue binary sequence, pseudo-random ternary sequence, and the multifrequency binary sequence. 10 refs., 7 figs., 3 tabs
Results from an in-plant demonstration of intelligent control
International Nuclear Information System (INIS)
Edwards, R.M.; Garcia, H.E.; Messick, N.
1993-01-01
A learning systems-based reconfigurable controller was demonstrated on the deaerating feedwater heater at the Experimental Breeder Reactor II (EBR-II) on April 1, 1993. Failures of the normal pressure regulating process were introduced by reducing the steam flow to the heater by as much as 10%. The controller maintained pressure in the heater at acceptable levels for several minutes, whereas operator intervention would have otherwise been required within a few seconds. This experiment demonstrates the potential of advanced control techniques for improving safety, reliability, and performance of power plant operations as well as the utility of EBR-II as an experimental power plant controls facility
Diloli Fons, Jordi
2009-01-01
Not available
Los trabajos arqueológicos efectuados en el asentamiento protohistórico de L’Assut (Tivenys, Baix Ebre, Tarragona) han permitido localizar una torre fortificada de planta circular (T3), construida durante el siglo VI a.n.e. Este tipo de estructuras se ha relacionado en áreas vecinas con una intencionalidad elitista ejercida por un grupo de poder emergente mediante el simbolismo arquitectónico, desapareciendo el modelo a inicios del Ibérico Pleno. En el caso de...
Development of an integrated signal validation system and application to operating power plants
International Nuclear Information System (INIS)
Upadhyaya, B.R.; Holbert, K.E.; Kerlin, T.W.
1989-01-01
The objective of the university-industry joint research program at the University of Tennessee and Combustion Engineering, Inc. is to develop and implement a comprehensive signal validation system for current power plants and future advanced reactors. The integrated system consists of several parallel signal processing modules. The multi-modular decision information is combined to detect, isolate and characterize faulty signals. The signal validation system has been implemented in a VAX workstation and applied to operational data from a pressurized water reactor (PWR) and the Experimental Breeder Reactor-II (EBR-II). The use of the various signal validation techniques may be extended to predictive maintenance advising, instrument calibration verification, and to the development of intelligent instrumentation systems. 18 refs., 6 figs
International Nuclear Information System (INIS)
Liu, C.; Yuan, F.; Gen, Z.; Wang, L.; Cui, Y.G.; Wan, J.F.; Zhang, J.H.; Rong, Y.H.
2016-01-01
Temperature-dependence surface relief during cubic↔tetragonal martensitic transformation (MT) in Mn_6_9_._4Fe_2_6_._0Cu_4_._6 antiferromegnetic shape memory alloy was studied by means of in-situ atomic force microscopy. The surface morphology memory effect was found and the crystallography reversibility of the transformation and its shearing characters were directly verified. Twin shearing is suggested as the main mechanism of formation of tent-type surface relief. The surface relief angle (θ_α|θ_β)<0.5° was firstly measured and might be the smallest compared with that in other shape memory alloys. A Landau model was proposed to consider the shearing strain related with surface relief of MT varying with the coupling effect between second-order antiferromagnetic transition and first-order MT. According to this model, the Mn_6_9_._4Fe_2_6_._0Cu_4_._6 alloy belongs to the weak coupling system and this kind of weak coupling effect makes the main contribution to the small relief angle. - Highlights: • Temperature-dependence surface relief in Mn-Fe-Cu alloy was firstly studied. • The surface morphology memory effect in Mn-Fe-Cu alloy was found. • Smallest surface relief angle (θ_α|θ_β).
International Nuclear Information System (INIS)
Christensen, L.J.; Sackett, J.I.; Dayal, Y.; Wagner, W.K.
1989-01-01
This paper describes work at EBR-II in the development and demonstration of new control equipment and methods and associated schemes for plant prognosis, diagnosis, and automation. The development work has attracted the interest of other national laboratories, universities, and commercial companies. New initiatives include use of new control strategies, expert systems, advanced diagnostics, and operator displays. The unique opportunity offered by EBR-II is as a test bed where a total integrated approach to automatic reactor control can be directly tested under real power plant conditions
International Nuclear Information System (INIS)
King, R.W.; Perry, W.H.
1991-06-01
Experimental Breeder Reactor 2 (EBR-2) is a pool-type sodium-cooled fast reactor that supports extensive experimental, test and demonstration programs while providing electrical power to the local grid. EBR-2 is a US Department of Energy Facility located at the Idaho National Engineering Laboratory and operated by Argonne National Laboratory (ANL). The current mission of EBR-2 is to serve as the operational prototype for the Integral Fast Reactor demonstration program. This mission and other programs require EBR-2 to operate reliability to a 40-year lifetime, a significant extension beyond the five to ten year life originally planned for the facility. The benefits of operating EBR-2 in the extended-life mode are important for providing long-term operational performance data for a sodium-cooled fast reactor that is not available elsewhere. Identification and preliminary assessment of potential life-limiting factors indicate that, with appropriate consideration given in the design phase, the sodium-cooled plant has potential for a very long operational lifetime. Achievement of a 40-year lifetime with high reliability is important not only for achieving the near-term goals of the EBR-2/IFR programs, but for the advancement of the liquid-metal-cooled reactor concept to the demonstration/commercialization phase. Key features make extended-life operation feasible based on the use of sodium as the primary coolant: low-pressure, high thermal capacity primary system and a low-pressure secondary system requiring no active valves; and limited corrosion of components. 2 refs
Core and shielding analysis of the SCM-100
International Nuclear Information System (INIS)
Olson, A. P.
2002-01-01
It is widely accepted that an intense neutron source can be produced in a suitable target by spallation neutrons generated by a high-current high-energy proton beam. Typical beam energy for such an accelerator is 400 to 2000 MeV. A conventional critical reactor can readily be replaced by a ''sub-critical reactor'' driven by this source. A 5 MW proton beam at 600 MeV can drive a sub-critical reactor to 100 MWt. The accelerator and the associated plant support equipment at these design specifications are complex systems, but they are well within recent technology. The purpose of this study was to examine core design and shielding design issues for a 100 MWt sodium-cooled fast-spectrum Sub-Critical Multiplier (SCM-100) based on LMFBR technology, but driven by an intense neutron source created by spallation reactions. SCM-100 is a component of the Accelerator Driven Test Facility. In this report we provide an overview of the SCM-100 concept. Two designs were investigated: (1) a vertical entry for the beam on the axial centerline; and (2) an inclined entry design where the core is ''C'' shaped and the beam enters the side of the target at an angle of 32 degrees. A brief overview of relevant shielding design data from EBR-II is also provided. The key result of this report is that the inclined entry design cannot achieve design objectives for radial power peaking. Consequently it cannot achieve design objectives for peak neutron flux. Axial power peaking factors are controlled by the axial fuel height and the axial reflector properties. These dimensions and compositions are very similar in SCM-100 to those of EBR-II. EBR-II had an axial power peaking factor of 1.093, and a radial power peaking factor of about 1.46. The radial power peaking of SCM-100 with the inclined entry is too extreme at 2.15, and cannot be made acceptable by modifying the size and detailed shape of the ''C'' shaped core and reflector. The axial power peaking of SCM-100 is very close to that of EBR
International Nuclear Information System (INIS)
Fukuda, S.K.
1978-05-01
Examinations of HEDL 61-pin subassemblies comprised of 5.84 mm (0.230) inch diameter mixed-oxide fuel pins with 1.02 mm (0.040'') diameter spacer wire (PNL-9, -10, -11, HEDL-N-E, -N-F), showed severe cladding and spacer wire wear after irradiation in EBR-II. A comparison of a large number of design, fabrication, and irradiation parameters for all of the HEDL subassemblies indicated that the porosity per ring of fuel pins correlated significantly with the occurrence of wear on the fuel pins. The porosity per ring is the clearance between the flat-to-flat pin bundle dimension and the inner hex can dimension divided by the number of hexagonal fuel pin rings in the subassembly. The porosity per ring for PNL-9, -10, -11 and HEDL-N-E was 0.15 mm/ring (6 mils/ring) and 0.18 mm/ring (7 mils/ring) for the HEDL-N-F subassembly. Since the original FTR subassembly design had a porosity/ring spread of 0.04 mm/ring to 0.16 mm/ring (1.67 to 6.11 mils/ring) an additional series of irradiation tests was conducted to confirm that a tighter fuel pin bundle would eliminate the wear
Real time operating system for a nuclear power plant computer
International Nuclear Information System (INIS)
Alger, L.S.; Lala, J.H.
1986-01-01
A quadruply redundant synchronous fault tolerant processor (FTP) is now under fabrication at the C.S. Draper Laboratory to be used initially as a trip monitor for the Experimental Breeder Reactor EBR-II operated by the Argonne National Laboratory in Idaho Falls, Idaho. The real time operating system for this processor is described
Neural networks for sensor validation and plant monitoring
International Nuclear Information System (INIS)
Upadhyaya, B.R.; Eryurek, E.; Mathai, G.
1990-01-01
Sensor and process monitoring in power plants require the estimation of one or more process variables. Neural network paradigms are suitable for establishing general nonlinear relationships among a set of plant variables. Multiple-input multiple-output autoassociative networks can follow changes in plant-wide behavior. The backpropagation algorithm has been applied for training feedforward networks. A new and enhanced algorithm for training neural networks (BPN) has been developed and implemented in a VAX workstation. Operational data from the Experimental Breeder Reactor-II (EBR-II) have been used to study the performance of BPN. Several results of application to the EBR-II are presented
Use of a pattern recognition scheme to compensate for critical sensor failures
International Nuclear Information System (INIS)
Singer, R.M.; King, R.W.; Mott, J.
1989-01-01
A general mathematical approach (the SSA code) for embodying learned data from a complex system and combining it with a current observation to estimate the true current state of the system has been applied to a nuclear power plant (EBR-II). Sensor validation and generation of estimates signals based upon the plant operating state are used for replacement of signals from multiple faulted sensors on a near real-time basis. A direct experimental demonstration of the capability of the code to perform these tasks is presented in which multiple sensor faults in EBR-II are simulated. 2 refs., 4 figs
Observations of in-reactor endurance and rupture life for fueled and unfueled FTR cladding
International Nuclear Information System (INIS)
Lovell, A.J.; Christensen, B.Y.; Chin, B.A.
1979-01-01
Reactor component endurance limits are important to nuclear experimenters and operators. This paper investigates endurance limits of 316 CW fuel pin cladding. The objective of this paper is to compare and analyze two different sets of FTR fuel pin cladding data. The first data set is from unfueled pressurized cladding irradiated in the Experimental Breeder Reactor No. II (EBR-II). This data set was generated in an assembly in which the temperature was monitored and controlled. The second data set contains observations of breached and unbreached EBR-II test fuel pins covering a large range of temperature, power and burnup conditions
International Nuclear Information System (INIS)
1994-01-01
No. 1 plant in Mihama Power Station started the commercial power generation in November, 1970, and has continued the operation for more than 23 years. During this period, the counter measures to troubles, periodic inspections and the maintenance by the electric power company have been carried out. These states of No. 1 plant in Mihama Power Station for more than 23 years are to be recollected from the view-points of the comprehensive evaluation of operation experiences and the reflection of latest technological knowledge, and the safety and reliability are to be further improved in the periodic safety review. Agency of Natural Resources and Energy evaluated the report of the periodic safety review for No. 1 plant in Mihama Power Station made by Kansai Electric Power Co., and summarized the results. The course of the evaluation of the report is shown. The facility utilization factor is 43.3% on the average of about 23 years, but in the last 10 years, it was improved to 69.4%. In the last five years, the rate of occurrence of unexpected shutoff was 0.6 times/year. These are the results of preventive maintenance and the improvement of the facilities and operation management. Operation management, maintenance management, fuel management, radiation control, and radioactive waste management have been carried out properly. The work plan for preventing disasters was established, and the experience of troubles and the latest technological knowledge were well reflected to improve the safety. (K.I.)
International Nuclear Information System (INIS)
Brown, B.W.; Crandall, D.L.; Dafoe, R.E.; Dolenc, M.R.; LaRue, D.M.
1987-09-01
Approximately 180 gal of sodium/potassium (NaK) eutectic liquid metal were severely radioactively contaminated during a meltdown of the Mark-II core of the Experimental Breeder Reactor-I (EBR-I) in November 1955. This contaminated NaK, which is contained in four vessels, is currently stored in an underground bunker located at the Army Reentry Vehicle Facility Site (ARVFS) located approximately at the center of the Idaho National Engineering Laboratory (INEL). This document presents the Functional and Operational Requirements (F and ORs) for the D and D of the contaminated NaK and the ARVFS bunker site. This project will chemically deactivate the NaK; dispose of the radioactively contaminated product at a designated burial site; chemically deactivate any residual NaK in the containers, and dispose of the containers at a designated burial site; decontaminate and decommission any contaminated process equipment used in these operations, and decontaminate and decommission the ARVFS bunker site. Completion of the above technical objectives will allow for the effective disposition of the NaK, and will return the ARFVS bunker and immediate area to a reusable condition. Upon completion, the ARVFS NaK, which is now considered a significant potential hazard, will be removed from the Surplus Facilities Management Program priority listing of projects. 33 refs., 8 figs
Spontaneous eye blink rate as predictor of dopamine-related cognitive function-A review.
Jongkees, Bryant J; Colzato, Lorenza S
2016-12-01
An extensive body of research suggests the spontaneous eye blink rate (EBR) is a non-invasive indirect marker of central dopamine (DA) function, with higher EBR predicting higher DA function. In the present review we provide a comprehensive overview of this literature. We broadly divide the available research in studies that aim to disentangle the dopaminergic underpinnings of EBR, investigate its utility in diagnosis of DA-related disorders and responsivity to drug treatment, and, lastly, investigate EBR as predictor of individual differences in DA-related cognitive performance. We conclude (i) EBR can reflect both DA receptor subtype D1 and D2 activity, although baseline EBR might be most strongly related to the latter, (ii) EBR can predict hypo- and hyperdopaminergic activity as well as normalization of this activity following treatment, and (iii) EBR can reliably predict individual differences in performance on many cognitive tasks, in particular those related to reward-driven behavior and cognitive flexibility. In sum, this review establishes EBR as a useful predictor of DA in a wide variety of contexts. Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Edwards, R.M.; Lee, K.Y.; Kumara, S.; Levine, S.H.
1989-01-01
An approach for an integrated real-time diagnostic system is being developed for inclusion as an integral part of a power plant automatic control system. In order to participate in control decisions and automatic closed loop operation, the diagnostic system must operate in real-time. Thus far, an expert system with real-time capabilities has been developed and installed on a subsystem at the Experimental Breeder Reactor (EBR-II) in Idaho, USA. Real-time simulation testing of advanced power plant concepts at the Pennsylvania State University has been developed and was used to support the expert system development and installation at EBR-II. Recently, the US National Science Foundation (NSF) and the US Department of Energy (DOE) have funded a Penn State research program to further enhance application of real-time diagnostic systems by pursuing implementation in a distributed power plant computer system including microprocessor based controllers. This paper summarizes past, current, planned, and possible future approaches to power plant diagnostic systems research at Penn State. 34 refs., 9 figs
Safety Research Experiment Facility Project. Conceptual design report. Volume III. Utilities
International Nuclear Information System (INIS)
1975-12-01
The SAREF Electric Power System supplies and distributes power from the EBR-II switchgear for operation of all normal facilities on the site, from an on-site Experiment Diesel Generator for operation of all experiment related loads, and from an emergency engine generator and/or an uninterruptible power supply for operation of all essential and critical loads during a failure of both of the other two systems
International Nuclear Information System (INIS)
Garner, F.A.; Gilbert, E.R.
2007-01-01
Irradiation creep of stainless steels is thought not to be very responsive to material and environmental variables. To test this perception earlier unpublished experiments conducted in the EBR-II reactor on AISI 316 have been analyzed. While swelling is dependent on the cold-work level at 400-480 o C, the post-transient irradiation creep rate, often called the creep compliance B0, is not dependent on cold-work level. If the tube reaches pressures on reactor start-up that generate above-yield stresses in unirradiated steel, then plastic strains occur prior to significant irradiation, but the post-transient strain rate is identical to that of material that did not exceed the yield stress on start-up. It is shown that both stress-free and stress-affected swelling are isotropic and that the Soderberg relationship is maintained. At temperatures above ∼540 o C thermal creep and stored energy begin to assert themselves, with creep rates accelerating with cold-work and becoming non-linear with stress. These results are in agreement with a similar study on titanium-modified 316 steel in FFTF. (author)
Advanced automation concepts applied to Experimental Breeder Reactor-II startup
International Nuclear Information System (INIS)
Berkan, R.C.; Upadhyaya, B.R.; Bywater, R.L.
1991-08-01
The major objective of this work is to demonstrate through simulations that advanced liquid-metal reactor plants can be operated from low power by computer control. Development of an automatic control system with this objective will help resolve specific issues and provide proof through demonstration that automatic control for plant startup is feasible. This paper presents an advanced control system design for startup of the Experimental Breeder Reactor-2 (EBR-2) located at Idaho Falls, Idaho. The design incorporates recent methods in nonlinear control with advanced diagnostics techniques such as neural networks to form an integrated architecture. The preliminary evaluations are obtained in a simulated environment by a low-order, valid nonlinear model. Within the framework of phase 1 research, the design includes an inverse dynamics controller, a fuzzy controller, and an artificial neural network controller. These three nonlinear control modules are designed to follow the EBR-2 startup trajectories in a multi-input/output regime. They are coordinated by a supervisory routine to yield a fault-tolerant, parallel operation. The control system operates in three modes: manual, semiautomatic, and fully automatic control. The simulation results of the EBR-2 startup transients proved the effectiveness of the advanced concepts. The work presented in this paper is a preliminary feasibility analysis and does not constitute a final design of an automated startup control system for EBR-2. 14 refs., 43 figs
International Nuclear Information System (INIS)
Latimer, T.W.; Barner, J.O.; Kerrisk, J.F.; Green, J.L.
1976-02-01
An evaluation was made of the performance of 74 helium-bonded uranium-plutonium carbide fuel elements that were irradiated in EBR-II at 38-96 kW/m to 2-12 at. percent burnup. Only 38 of these elements have completed postirradiation examination. The higher failure rate found in fuel elements which contained high-density (greater than 95 percent theoretical density) fuel than those which contained low-density (77-91 percent theoretical density) fuel was attributed to the limited ability of the high-density fuel to swell into the void space provided in the fuel element. Increasing cladding thickness and original fuel-cladding gap size were both found to influence the failure rates for elements containing low-density fuel. Lower cladding strain and higher fission-gas release were found in high-burnup fuel elements having smear densities of less than 81 percent. Fission-gas release was usually less than 5 percent for high-density fuel, but increased with burnup to a maximum of 37 percent in low-density fuel. Maximum carburization in elements attaining 5-10 at. percent burnup and clad in Types 304 or 316 stainless steel and Incoloy 800 ranged from 36-80 μm and 38-52 μm, respectively. Strontium and barium were the fission products most frequently found in contact with the cladding but no penetration of the cladding by uranium, plutonium, or fission products was observed
2012 nuclear power world report; Kernenergie Weltreport 2012
Energy Technology Data Exchange (ETDEWEB)
Anon.
2013-06-15
At the end of 2012, 437 nuclear power plants were available for energy supply in 31 countries of the world. This means that the number was unchanged compared to the previous year's number on 31 December 2011. The aggregate gross power of the plants amounted to approx. 392,793 MWe, the aggregate net power, to 372,572 MWe. This indicates a slight increase of gross and net capacity (gross: 389,367 MWe, net: 369,371 MWe) Two units were commissioned in 2012; 1 unit in China and the Republic of Korea each. Two reactors in Canada resumed commercial operation after a long-term shutdown. The units have been layed-up since the mid 1990ies. Four units were shut down permanently in 2012; 2 units in the United Kingdom, and one unit in Canada and Spain each. The shut-downs in the United Kingdom and Canada have been planned on a long-term base. 68 nuclear generating units - 5 more than at the end of 2011 - were under construction in late 2012 in 14 countries with an aggregate gross power of approx. 70,933 MWe and net power of approx. 66,244 MWe. 9 new projects have been started in 2012 in 3 countries (China, United Arab Emirates, USA). Worldwide, some 110 new nuclear power plants are in the concrete project design, planning, and licensing phases; in some of these cases license applications have been submitted or contracts have already been signed. Some 100 further projects are planned. Net electricity generation in nuclear power plants worldwide in 2012 achieved a level of approx. 2,346.16 billion kWh (2011: approx. 2,497.1 billion kWh). The main cause for the lower production have been the permanent shut-downs of almost all nuclear power plants in Japan since the natural disaster on 11 March 2011. Since the first generation of electricity in a nuclear power plant in the EBR-I fast breeder (USA) on December 20, 1951, cumulated net production has reached approx. 67,946 billion kWh, and operating experience has grown to some 15,050 reactor years. (orig.)
International Nuclear Information System (INIS)
Ahammed, Golam Jalal; Li, Xin; Xia, Xiao-Jian; Shi, Kai; Zhou, Yan-Hong; Yu, Jing-Quan
2015-01-01
Photosynthesis, the basal manufacturing process in the earth is habitually restricted by airborne micropollutants such as phenanthrene (PHE). Here, we show that 24-epibrassinolide (EBR), a bioactive plant steroid is able to keep higher photosynthetic capacity consistently for a long period under a shoot-imposed PHE stress in tomato. EBR-promoted photosynthetic capacity and efficiency eventually resulted in a 37.5% increase of biomass under PHE stress. As primary response, transcripts of antioxidant genes were remarkably induced by EBR in PHE-treated plants. Activities of antioxidant and detoxification enzymes were also enhanced by EBR. Notably, EBR-induced higher antioxidant potential was associated with reduced levels of H 2 O 2 and O 2 · — , resulting in a 32.7% decrease of content of malondialdehyde in the end of experiment and relatively healthy chloroplast ultrastructure in EBR + PHE treatment compared with PHE alone. These results indicate that EBR alleviates shoot-imposed PHE phytotoxicity by maintaining a consistently higher photosynthetic capacity and antioxidant potential in tomato. - Highlights: • PHE mist spray gradually inhibits photosynthesis and eventually reduces biomass. • EBR maintains a consistently higher photosynthesis even under PHE stress. • EBR upregulates expression of antioxidant genes as initial response to PHE stress. • EBR reduces oxidative stress by constantly activating strong antioxidant potential. • EBR-induced efficient neutralization of ROS protects chloroplast ultrastructure. - 24-epibrassinolide protects tomato plants from airborne phenanthrene-induced damages by maintaining a consistently higher photosynthetic capacity and antioxidant potential
Zhou, Yali; Yuan, Chunlong; Ruan, Shicheng; Zhang, Zhenwen; Meng, Jiangfei; Xi, Zhumei
2018-01-09
Anthocyanins and proanthocyanidins (PAs) are crucial factors that affect the quality of grapes and the making of wine, which were stimulated by various stimuli and environment factors (sugar, hormones, light, and temperature). The aim of the study was to investigate the influence of exogenous 24-Epibrassinolide (EBR) and light on the mechanism of anthocyanins and PAs accumulation in grape berries. Grape clusters were sprayed with EBR (0.4 mg/L) under light and darkness conditions (EBR + L, EBR + D), or sprayed with deionized water under light and darkness conditions as controls (L, D), at the onset of veraison. A large amount of anthocyanins accumulated in the grape skins and was measured under EBR + L and L treatments, whereas EBR + D and D treatments severely suppressed anthocyanin accumulation. This indicated that EBR treatment could produce overlay effects under light, in comparison to that in dark. Real-time quantitative PCR analysis indicated that EBR application up-regulated the expression of genes ( VvCHI1 , VvCHS2 , VvCHS3 , VvDFR , VvLDOX , VvMYBA1 ) under light conditions. Under darkness conditions, only early biosynthetic genes of anthocyanin biosynthesis responded to EBR. Furthermore, we also analyzed the expression levels of the BR-regulated transcription factor VvBZR1 (Brassinazole-resistant 1) and light-regulated transcription factor VvHY5 (Elongated hypocotyl 5). Our results suggested that EBR and light had synergistic effects on the expression of genes in the anthocyanin biosynthesis pathway.
Directory of Open Access Journals (Sweden)
Yali Zhou
2018-01-01
Full Text Available Anthocyanins and proanthocyanidins (PAs are crucial factors that affect the quality of grapes and the making of wine, which were stimulated by various stimuli and environment factors (sugar, hormones, light, and temperature. The aim of the study was to investigate the influence of exogenous 24-Epibrassinolide (EBR and light on the mechanism of anthocyanins and PAs accumulation in grape berries. Grape clusters were sprayed with EBR (0.4 mg/L under light and darkness conditions (EBR + L, EBR + D, or sprayed with deionized water under light and darkness conditions as controls (L, D, at the onset of veraison. A large amount of anthocyanins accumulated in the grape skins and was measured under EBR + L and L treatments, whereas EBR + D and D treatments severely suppressed anthocyanin accumulation. This indicated that EBR treatment could produce overlay effects under light, in comparison to that in dark. Real-time quantitative PCR analysis indicated that EBR application up-regulated the expression of genes (VvCHI1, VvCHS2, VvCHS3, VvDFR, VvLDOX, VvMYBA1 under light conditions. Under darkness conditions, only early biosynthetic genes of anthocyanin biosynthesis responded to EBR. Furthermore, we also analyzed the expression levels of the BR-regulated transcription factor VvBZR1 (Brassinazole-resistant 1 and light-regulated transcription factor VvHY5 (Elongated hypocotyl 5. Our results suggested that EBR and light had synergistic effects on the expression of genes in the anthocyanin biosynthesis pathway.
Liquid metal reactor cover gas purification and analysis in the USA
Energy Technology Data Exchange (ETDEWEB)
Allen, K J [Argonne National Laboratory, EBR-II Division, Idaho Falls, ID (United States); Meadows, G E; Schuck, W J [Westinghouse Hanford Company, Richland, WA (United States)
1987-07-01
Two sodium cooled reactors are currently being operated In the United States of America for the U.S. Department of Energy. These are Experimental Breeder Reactor II, EBR-ll, and the Fast Flux Test Facility, FFTF. EBR-ll is located near Idaho Falls, Idaho and the FFTF is near Rich land, Washington. These reactors are currently engaged In a wide range of testing including fuels and materials tests, and plant system performance and safety development. The U.S. DOE program also includes designs of a next generation sodium cooled power reactor. This paper discusses the efforts to develop and operate cover gas systems for the sodium cooled nuclear reactor program in the USA.
Liquid metal reactor cover gas purification and analysis in the USA
International Nuclear Information System (INIS)
Allen, K.J.; Meadows, G.E.; Schuck, W.J.
1987-01-01
Two sodium cooled reactors are currently being operated In the United States of America for the U.S. Department of Energy. These are Experimental Breeder Reactor II, EBR-ll, and the Fast Flux Test Facility, FFTF. EBR-ll is located near Idaho Falls, Idaho and the FFTF is near Rich land, Washington. These reactors are currently engaged In a wide range of testing including fuels and materials tests, and plant system performance and safety development. The U.S. DOE program also includes designs of a next generation sodium cooled power reactor. This paper discusses the efforts to develop and operate cover gas systems for the sodium cooled nuclear reactor program in the USA
A Byzantine resilient fault tolerant computer for nuclear power plant applications
International Nuclear Information System (INIS)
Lala, J.H.
1986-01-01
A quadruply redundant synchronous fault tolerant processor, capable of tolerating Byzantine faults, is now under fabrication at the C.S. Draper Laboratory to be used initially as a trip monitor for the Experimental Breeder Reactor EBR-II operated by the Argonne National Laboratory in Idaho Falls, Idaho. This paper describes the hardware architecture of this processor and discusses certain issues unique to quadruply redundant computers
Adaptive robust control of the EBR-II reactor
International Nuclear Information System (INIS)
Power, M.A.; Edwards, R.M.
1996-01-01
Simulation results are presented for an adaptive H ∞ controller, a fixed H ∞ controller, and a classical controller. The controllers are applied to a simulation of the Experimental Breeder Reactor II primary system. The controllers are tested for the best robustness and performance by step-changing the demanded reactor power and by varying the combined uncertainty in initial reactor power and control rod worth. The adaptive H ∞ controller shows the fastest settling time, fastest rise time and smallest peak overshoot when compared to the fixed H ∞ and classical controllers. This makes for a superior and more robust controller
Temperature and Burnup Correlated FCCI in U-10Zr Metallic Fuel
Energy Technology Data Exchange (ETDEWEB)
William J. Carmack
2012-05-01
Metallic fuels are proposed for use in advanced sodium cooled fast reactors. The experience basis for metallic fuels is extensive and includes development and qualification of fuels for the Experimental Breeder Reactor I, the Experimental Breeder Reactor II, FERMI-I, and the Fast Flux Test Facility (FFTF) reactors. Metallic fuels provide a number of advantages over other fuel types in terms of fabricability, performance, recyclability, and safety. Key to the performance of all nuclear fuel systems is the resistance to “breach” and subsequent release of fission products and fuel constituents to the primary coolant system of the nuclear power plant. In metallic fuel, the experience is that significant fuel-cladding chemical (FCCI) interaction occurs and becomes prevalent at high power-high temperature operation and ultimately leads to fuel pin breach and failure. Empirical relationships for metallic fuel pin failure have been developed from a large body of in-pile and out of pile research, development, and experimentation. It has been found that significant in-pile acceleration of the FCCI rate is experienced over similar condition out-of-pile experiments. The study of FCCI in metallic fuels has led to the quantification of in-pile failure rates to establish an empirical time and temperature dependent failure limit for fuel elements. Up until now the understanding of FCCI layer formation has been limited to data generated in EBR-II experiments. This dissertation provides new FCCI data extracted from the MFF-series of metallic fuel irradiations performed in the FFTF. These fuel assemblies contain valuable information on the formation of FCCI in metallic fuels at a variety of temperature and burnup conditions and in fuel with axial fuel height three times longer than EBR-II experiments. The longer fuel column in the FFTF and the fuel pins examined have significantly different flux, power, temperature, and FCCI profiles than that found in similar tests conducted in
Obakan-Yerlikaya, Pinar; Arisan, Elif Damla; Coker-Gurkan, Ajda; Adacan, Kaan; Ozbey, Utku; Somuncu, Berna; Baran, Didem; Palavan-Unsal, Narcin
2017-06-01
Epibrassinolide (EBR), a member of brassinostreoids plant hormones with cell proliferation promoting role in plants, is a natural polyhydroxysteroid with structural similarity to steroid hormones of vertebrates. EBR has antiproliferative and apoptosis-inducing effect in various cancer cells. Although EBR has been shown to affect survival and mitochondria-mediated apoptosis pathways in a p53-independent manner, the exact molecular targets of EBR are still under investigation. Our recent SILAC (Stable Isotope Labeling by Amino Acids in Cell Culture) data showed that the most significantly altered protein after EBR treatment was calreticulin (CALR). CALR, a chaperone localized in endoplasmic reticulum (ER) lumen, plays role in protein folding and buffering Ca 2+ ions. The alteration of CALR may cause ER stress and unfolded protein response correspondingly the induction of apoptosis. Unfolded proteins are conducted to 26S proteasomal degradation following ubiquitination. Our study revealed that EBR treatment caused ER stress and UPR by altering CALR expression causing caspase-dependent apoptosis in HCT 116, HT29, DLD-1, and SW480 colon cancer cells. Furthermore, 48 h EBR treatment did not caused UPR in Fetal Human Colon cells (FHC) and Mouse Embryonic Fibroblast cells (MEF). In addition our findings showed that HCT 116 colon cancer cells lacking Bax and Puma expression still undergo UPR and related apoptosis. CALR silencing and rapamycin co-treatment prevented EBR-induced UPR and apoptosis, whereas 26S proteasome inhibition further increased the effect of EBR in colon cancer cells. All these findings showed that EBR is an ER stress and apoptotic inducer in colon cancer cells without affecting non-malignant cells. © 2017 Wiley Periodicals, Inc.
Development of a risk-based in-service inspection program for an LMR
International Nuclear Information System (INIS)
King, R.W.; Buschman, H.W.
1996-01-01
The emerging application of risk-based assessment technology to the operation and maintenance of nuclear power plants holds considerable promise for improving efficiency and reducing operating costs. Experimental Breeder Reactor II (EBR-II) is a liquid-metal-cooled fast reactor (LMR) that operated for 30 yr before shutting down in September 1994 due to program termination. Prior to the shutdown of EBR-II, an in-service inspection (ISI) program was developed that exploited certain advantages of the LMR design. For example, it demonstrated passive response to plant upset events, low-pressure primary coolant, and compatibility of the coolant and reactor materials. This ISI program was based on work currently being done by an American Society of Mechanical Engineers (ASME) Research Task Force on Risk-Based Inspection
Lima, J V; Lobato, A K S
2017-01-01
Water deficit is considered the main abiotic stress that limits agricultural production worldwide. Brassinosteroids (BRs) are natural substances that play roles in plant tolerance against abiotic stresses, including water deficit. This research aims to determine whether BRs can mitigate the negative effects caused by water deficiency, revealing how BRs act and their possible contribution to increased tolerance of cowpea plants to water deficit. The experiment was a factorial design with the factors completely randomised, with two water conditions (control and water deficit) and three levels of brassinosteroids (0, 50 and 100 nM 24-epibrassinolide; EBR is an active BRs). Plants sprayed with 100 nM EBR under the water deficit presented significant increases in Φ PSII , q P and ETR compared with plants subjected to the water deficit without EBR. With respect to gas exchange, P N , E and g s exhibited significant reductions after water deficit, but application of 100 nM EBR caused increases in these variables of 96, 24 and 33%, respectively, compared to the water deficit + 0 nM EBR treatment. To antioxidant enzymes, EBR resulted in increases in SOD, CAT, APX and POX, indicating that EBR acts on the antioxidant system, reducing cell damage. The water deficit caused significant reductions in Chl a , Chl b and total Chl, while plants sprayed with 100 nM EBR showed significant increases of 26, 58 and 33% in Chl a , Chl b and total Chl, respectively. This study revealed that EBR improves photosystem II efficiency, inducing increases in Φ PSII , q P and ETR. This substance also mitigated the negative effects on gas exchange and growth induced by the water deficit. Increases in SOD, CAT, APX and POX of plants treated with EBR indicate that this steroid clearly increased the tolerance to the water deficit, reducing reactive oxygen species, cell damage, and maintaining the photosynthetic pigments. Additionally, 100 nM EBR resulted in a better dose-response of cowpea
Ansari, Shaheryar F; Moore, Reilin J; Boaz, Joel C; Fulkerson, Daniel H
2016-04-01
OBJECT Radioactive phosphorus-32 (P32) has been used as brachytherapy for craniopharyngiomas with the hope of providing local control of enlarging tumor cysts. Brachytherapy has commonly been used as an adjunct to the standard treatment of surgery and external-beam radiation (EBR). Historically, multimodal treatment, including EBR, has shown tumor control rates as high as 70% at 10 years after treatment. However, EBR is associated with significant long-term risks, including visual deficits, endocrine dysfunction, and cognitive decline. Theoretically, brachytherapy may provide focused local radiation that controls or shrinks a symptomatic cyst without exposing the patient to the risks of EBR. For this study, the authors reviewed their experiences with craniopharyngioma patients treated with P32 brachytherapy as the primary treatment without EBR. The authors reviewed these patients' records to evaluate whether this strategy effectively controls tumor growth, thus avoiding the need for further surgery or EBR. METHODS The authors performed a retrospective review of pediatric patients treated for craniopharyngioma between 1997 and 2004. This was the time period during which the authors' institution had a relatively high use of P32 for treatment of cystic craniopharyngioma. All patients who had surgery and injection of P32 without EBR were identified. The patient records were analyzed for complications, cyst control, need for further surgery, and need for future EBR. RESULTS Thirty-eight patients were treated for craniopharyngioma during the study period. Nine patients (23.7%) were identified who had surgery (resection or biopsy) with P32 brachytherapy but without initial EBR. These 9 patients represented the study group. For 1 patient (11.1%), there was a complication with the brachytherapy procedure. Five patients (55.5%) required subsequent surgery. Seven patients (77.7%) required subsequent EBR for tumor growth. The mean time between the injection of P32 and
Directory of Open Access Journals (Sweden)
Wenli Wu
2017-06-01
Full Text Available Brassinosteroids (BR regulate plant tolerance to salt stress but the mechanisms underlying are not fully understood. This study was to investigate physiological mechanisms of 24-epibrassinolide (EBR's impact on salt stress tolerance in perennial ryegrass (Lolium perenne L. The grass seedlings were treated with EBR at 0, 10, and 100 nM, and subjected to salt stress (250 mM NaCl. The grass irrigated with regular water without EBR served as the control. Salt stress increased leaf electrolyte leakage (EL, malondialdehyde (MDA, and reduced photosynthetic rate (Pn. Exogenous EBR reduced EL and MDA, increased Pn, chlorophyll content, and stomatal conductance (gs. The EBR applications also alleviated decline of superoxide dismutase (SOD and catalase (CAT and ascorbate peroxidase (APX activity when compared to salt treatment alone. Salt stress increased leaf abscisic acid (ABA and gibberellin A4 (GA4 content but reduced indole-3-acetic acid (IAA, zeatin riboside (ZR, isopentenyl adenosine (iPA, and salicylic acid (SA. Exogenous EBR at 10 nm and 100 nM increased ABA, and iPA content under salt stress. The EBR treatment at 100 nM also increased leaf IAA, ZR, JA, and SA. In addition, EBR treatments increased leaf proline and ions (K+, Mg2+, and Ca2+ content, and reduced Na+/K+ in leaf tissues. The results of this study suggest that EBR treatment may improve salt stress tolerance by increasing the level of selected hormones and antioxidant enzyme (SOD and CAT activity, promoting accumulation of proline and ions (K+, Ca2+, and Mg2+ in perennial ryegrass.
Effects of 24-epibrassinolide on photosynthesis of eggplant ...
African Journals Online (AJOL)
In this study, 24-epibrassinolide (EBR), an active brassinosteroid, was exogenously applied to investigate photosynthetic performance of salt-stressed eggplant (Solanum melongena L.). EBR, especially 100 nM, dramatically alleviated growth suppression caused by salt stress. Similarly, the application of 100 nM EBR, the ...
Directory of Open Access Journals (Sweden)
Taeho Oh
2017-12-01
Full Text Available Piezoelectric vibration based energy harvesting systems have been widely utilized and researched as powering modules for various types of sensor systems due to their ease of integration and relatively high energy density compared to RF, thermal, and electrostatic based energy harvesting systems. In this paper, a low-power CMOS full-bridge rectifier is presented as a potential solution for an efficient energy harvesting system for piezoelectric transducers. The energy harvesting circuit consists of two n-channel MOSFETs (NMOS and two p-channel MOSFETs (PMOS devices implementing a full-bridge rectifier coupled with a switch control circuit based on a PMOS device driven by a comparator. With a load of 45 kΩ, the output rectifier voltage and the input piezoelectric transducer voltage are 694 mV and 703 mV, respectably, while the VOUT versus VIN conversion ratio is 98.7% with a PCE of 52.2%. The energy harvesting circuit has been designed using 130 nm standard CMOS process.
Fast reactor operation in the United States
International Nuclear Information System (INIS)
Smith, R.R.; Cissel, D.W.
1978-01-01
Of the many American facilities dedicated to fast reactor technology, six qualify as liquid-metal-cooled fast reactors. All of these satisfy the following criteria: an unmoderated neutron spectrum, highly enriched fuel material, substantial heat production, and the use of a liquid metal coolant. These include the following: EBR-I Clementine, LAMPRE, EBR-II, EFFBR, and SEFOR. Collectively, these facilities encompassed all of the more important features of liquid-metal-cooled fast reactor technology. Coolant types ranged from mercury in Clementine, to NaK in EBR-I, and sodium in the others. Fuels included enriched-uranium metallic alloys in EBR-I, EBR-II, and EFFBR; metallic plutonium in Clementine; molten plutonium alloy in LAMPRE; and a mixed UO 2 -PuO 2 ceramic in SEFOR. Heat removal techniques ranged from air-blast cooling in LAMPRE and SEFOR; steam-electrical generation in EBR-I, EBR-II, and EFFBR; to a mercury-to-water heat dump in Clementine. Operational experience with such diverse systems has contributed heavily to the U.S. Each of the six systems is described from the viewpoints of purpose, history, design, and operation. Attempts are made to limit descriptive material to the most important features and to refer the reader to a few select references if additional information is needed
Zhigal'Skii, A. A.; Mukhachev, V. A.; Troyan, P. E.
1994-04-01
Breakdown delay times (tdel) for films of managanese-doped zinc sulfide (ZnS:Mn) were measured in the range 10-6-10-1 s. The maximum value was tdel=10-3-10-2 s. The electrical strength (Ebr) was found to increase as the voltage pulse duration was reduced, the more so the thinner the ZnS:Mn film. The temperature dependence of Ebr exhibited a weak reduction in Ebr as the temperature was raised to roughly 80°C and a sharp reduction in Ebr for T>130°C. A maximum in Ebr was observed at T≈130°C which is presumably explained by a structural modification of the ZnS:Mn film. The experimental results obtained are explained in terms of a combined electronic and thermal breakdown mechanism.
High power CO2 lasers and their applications in nuclear industry
International Nuclear Information System (INIS)
Nath, A.K.
2002-01-01
Carbon dioxide laser is one of the most popular lasers in industry for material processing applications. It has very high power capability and high efficiency, can be operated in continuous wave (CW), modulated and pulsed modes, and has relatively low cost. Due to these characteristics high power CO 2 lasers are being used worldwide in different industries for a wide variety of materials processing operations. In nuclear industry, CO 2 laser has made its way in many applications. Some of the tasks performed by multikilowatt CO 2 laser are cutting operations necessary to remove unprocessible hardware from reactor fuel assemblies, sealing/fixing/removing radioactive contaminations onto/from concrete surfaces and surface modification of engineering components for improved surface mechanical and metallurgical characteristics. We have developed various models of CW CO 2 lasers of power up to 12 kW and a high repetitive rate TEA (Transversely Excited Atmospheric pressure) CO 2 laser of 500 W average power operating at 500 Hz repetition rates. We have carried many materials processing applications of direct relevance to DAE. Recent work includes laser welding of end plug PFBR fuel tubes, martensitic stainless steel and titanium alloy, surface cladding of turbine blades made of Ni-super alloy with stellite 694, fabrication on graded material of stainless steel and stellite, and laser scabbling, drilling and cutting of concrete which have potential application in decontamination and decommissioning of nuclear facilities. A brief overview of these indigenous developments will be presented. (author)
Development of a risk-based inservice inspection program for a liquid metal reactor
International Nuclear Information System (INIS)
King, R.W.; Buschman, H.W.
1996-01-01
The emerging application of risk-based assessment technology to the operation and maintenance of nuclear power plants holds considerable promise for improving efficiency and reducing operating costs. EBR-II is liquid-metal-cooled fast reactor which operated for thirty years before shutting down in September 1994 due to program termination. Prior to the shutdown of EBR-II, an in-service inspection (ISI) program was developed that exploited certain advantages of the liquid-metal reactor design, e.g., demonstrated passive response to plant upset events, low pressure primary coolant and compatibility of the coolant and reactor materials. Many of the systems cannot be inspected due to inaccessibility of the components. However, application of a risk-based approach provided the basis for reducing or eliminating inspections in some areas that would otherwise be required. Development and implementation of the risk-based ISI program was interrupted by the DOE-mandated shutdown of EBR-II, so the potential benefits of this approach in terms of reduced O and M costs have yet to be realized. Through the development of this program, however it is clear that there is potential for substantial cost-savings while improving the risk-profile of the facility through this approach
International Nuclear Information System (INIS)
Olivier, C.; Morland, H.J.
1991-01-01
By using particle induced prompt photon spectrometry, PIPPS, the ratios of the average stopping powers in samples and standards can be used to determine elemental compositions. Since the average stopping powers in the samples are in general unknown, this procedure poses a problem. It has been shown that by spiking the sample with a known amount of a compound with known stopping power and containing a non-analyte element, appropriate stopping powers in the samples can be determined by measuring the prompt gamma-ray yields induced in the spike. Using 5-MeV protons and lithium compounds as non-analyte spikes, sodium and phosphorus were determined in ivory, while sodium was determined in geological samples. For the stopping power determinations in the samples the 429-keV 7 Li n(1,0) and 478-keV 7 Li (1,0) gamma rays were measured, while for phosphorus and sodium determinations the high yield 1,266-keV 31 P (1,0), 440-keV 23 Na (1,0), 1,634-keV, Na 23 α(1,0) and 1,637-keV 23 Na (2,1) gamma rays were used. The method was tested by analyzing the standard reference materials SRM 91, 120c and 694
Assessment of MATRA-LMR-FB with the SHRT-17 Core Subassembly Data
Energy Technology Data Exchange (ETDEWEB)
Chang, Won-Pyo; Yoo, Jin Yoo; Lee, Seung Won; Seong, Seung Hwan; Ahn, Sang June; Choi, Chi-Woong; Lee, Kwi Lim; Jeong, Jae-Ho; Jeong, Taekyeong; Ha, Kwi-Seok [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2015-05-15
Since the MATRA-LMRFB code is scheduled to be applied to a partial flow blockage analysis in a PGSFR (Prototype Generation IV Sodium-cooled Fast Reactor) subassembly, code verification is an essential part for the design review. Most of its verification efforts have been devoted to local sub-channel blockages, and thus the predictions were compared to those of other codes as well as experimental data. Verifications using pin bundles with a wire-wrap spacer had to be concentrated to 19-pin bundles, because available experimental data for such a bundle were relatively affluent in world-wide literatures. Therefore, more assessments with diverse pin numbers are necessary for MATRA-LMR-FB to be a more reliable code. Thus far, MATRA-LMR-FB has been applied to a 37-pin subassembly with wire-wrap spacers at most. In this regard, the present comparative study using data produced from the SHRT-17 which was carried out in a 61-pin test subassembly (XX09) placed in the EBR-II (Experimental Breeder Reactor II) core will be a meaningful demonstration for its extensive applicability. The power operation of the EBR-II was begun by ANL (Argonne National Lab.) in 1964 and the SHRT program was carried out in EBR-II between 1984 and 1986 in order to provide not only test data for validation of the computer codes but also demonstration of a passive reactor shutdown and decay heat removal in response of the protected and unprotected transients. The EBR-II SHRT-17 test data were used to demonstrate the prediction capability of MATRA-LMRFB on a radial distribution of the subassembly outlet temperatures during the steady state.
Assessment of MATRA-LMR-FB with the SHRT-17 Core Subassembly Data
International Nuclear Information System (INIS)
Chang, Won-Pyo; Yoo, Jin Yoo; Lee, Seung Won; Seong, Seung Hwan; Ahn, Sang June; Choi, Chi-Woong; Lee, Kwi Lim; Jeong, Jae-Ho; Jeong, Taekyeong; Ha, Kwi-Seok
2015-01-01
Since the MATRA-LMRFB code is scheduled to be applied to a partial flow blockage analysis in a PGSFR (Prototype Generation IV Sodium-cooled Fast Reactor) subassembly, code verification is an essential part for the design review. Most of its verification efforts have been devoted to local sub-channel blockages, and thus the predictions were compared to those of other codes as well as experimental data. Verifications using pin bundles with a wire-wrap spacer had to be concentrated to 19-pin bundles, because available experimental data for such a bundle were relatively affluent in world-wide literatures. Therefore, more assessments with diverse pin numbers are necessary for MATRA-LMR-FB to be a more reliable code. Thus far, MATRA-LMR-FB has been applied to a 37-pin subassembly with wire-wrap spacers at most. In this regard, the present comparative study using data produced from the SHRT-17 which was carried out in a 61-pin test subassembly (XX09) placed in the EBR-II (Experimental Breeder Reactor II) core will be a meaningful demonstration for its extensive applicability. The power operation of the EBR-II was begun by ANL (Argonne National Lab.) in 1964 and the SHRT program was carried out in EBR-II between 1984 and 1986 in order to provide not only test data for validation of the computer codes but also demonstration of a passive reactor shutdown and decay heat removal in response of the protected and unprotected transients. The EBR-II SHRT-17 test data were used to demonstrate the prediction capability of MATRA-LMRFB on a radial distribution of the subassembly outlet temperatures during the steady state
International Nuclear Information System (INIS)
Dobrikova, A.; Vladkova, R.; Stanoeva, D.; Popova, A.; Velitchkova, M.
2013-01-01
In the present work, the effects of 24-epibrassinolide (EBR) on the UV-B-induced changes in the pigment content of pea leaves were studied. Control (non-EBR-treated) and EBR-treated plants were irradiated with UV-B for 3 h and pigment analysis was performed after 24 and 48 h. The results show that EBR spraying of plants 48 h prior to UV-B exposure alleviates its detrimental effect on chlorophyll a and b (Chl a and Chl b) content in comparison with control pea leaves. An increase in carotenoids (Car) and UV-B absorbing compounds was also observed at low dose of UV-B radiation. For the first time, it is shown that UV-B damage effect on control leaves is accompanied by a significant (more than 50%) increase in their pheophytin a (Pheo a) content 48 h after the UV-B exposure and that the EBR pre-treatment prevents the increase of Pheo a content in UV-B irradiated leaves. In addition, it is demonstrated that EBR application modifies UV-B-induced alterations of energy distribution between the main pigment-protein complexes in pea thylakoid membranes
Xu, Fan; Luan, Li-Ying; Zhang, Zhen-Wen; Huo, Shan-Shan; Gao, Xiang; Fang, Yu-Lin; Xi, Zhu-Mei
2014-07-14
The grape berries of two varieties, Yan73 (Vitis vinifera L.) and Cabernet Sauvignon (CS) (Vitis vinifera L.) were treated with 0.40 mg/L 24-epibrassinolide (EBR), 1.00 mg/L brassinazole (Brz), and deionized water (control), at the veraison period. The EBR treatment significantly increased total phenolic content (TPC), total tannin content (TTC) and total anthocyanin content (TAC) of Yan73 and CS wines, whereas Brz treatment decreased TPC, total flavonoid content (TFC), TAC in the two wines. Moreover, the content of most of the phenolic compounds identified by HPLC-DAD/ESI-MS in EBR-treated wines was significantly higher than that in control. The antioxidant capacities, which determined using DPPH, ABTS and HRSA methods, of the wines were increased by EBR treatment as well. There was a good correlation between the antioxidant capacity and phenolic content. The results demonstrated that EBR could enhance the phenolic compounds and antioxidant capacity of Yan73 and CS wines, but the effects may vary by different cultivars.
Multifrequency tests in the EBR-II reactor plant
International Nuclear Information System (INIS)
Feldman, E.E.; Mohr, D.; Gross, K.C.
1989-01-01
A series of eight multifrequency tests was conducted on the Experimental Breeder Reactor II. In half of the tests a control rod was oscillated and in the other half the controller input voltage to the intermediate-loop-sodium pump was perturbed. In each test the input disturbance consisted of several superimposed single-frequency sinusoidal harmonics of the same fundamental. The tests are described along with the theoretical and practical aspects of their development and design. Samples of measured frequency responses are also provided for both the reactor and the power plant. 22 refs., 5 figs., 2 tabs
Experimental Breeder Reactor-II automatic control-rod-drive system
International Nuclear Information System (INIS)
Christensen, L.J.
1983-01-01
A computer-controlled automatic control rod drive system (ACRDS) was designed and operated in EBR-II during reactor runs 121 and 122. The ACRDS was operated in a checkout mode during run 121 using a low worth control rod. During run 122 a high worth control rod was used to perform overpower transient tests as part of the LMFBR oxide fuels transient testing program. The testing program required an increase in power of 4 MW/s, a hold time of 12 minutes and a power decrease of 4 MW/s. During run 122, 13 power transients were performed
Plant-life extension planning for an operating LMFBR
International Nuclear Information System (INIS)
King, R.W.
1985-01-01
The study concluded that continued EBR-II operation is certainly feasible for well beyond 10 more years, and that continued demonstration of the unique inherent safety and operability features of a pool-type liquid-metal-cooled reactor and the demonstration of a reasonable operating lifetime are very important and will provide invaluable information for the design and development of the next generation nuclear power plants
International Nuclear Information System (INIS)
Vilim, R.B.
1990-01-01
A measurement-based method for predicting the response of an LMR core to unprotected accidents has been developed. The method processes plant measurements taken at normal operation to generate a stochastic model for the core dynamics. This model can be used to predict three sigma confidence intervals for the core temperature and power response. Preliminary numerical simulations performed for EBR-2 appear promising. 6 refs., 2 figs
Events of radioactive waste management - a chronological table
International Nuclear Information System (INIS)
1985-01-01
In chronological order the leaflet abstracted points out the essential data of German radioactive waste management. The data reach from December 1951 with EBR I (Idaho/USA) being the first one to feed electric power to the distribution grid to February 1985 known as the date of the submission of building applications for the first partial license of the Wackersdorf reprocessing plant. (HSCH) [de
Directory of Open Access Journals (Sweden)
Fan Xu
2014-07-01
Full Text Available The grape berries of two varieties, Yan73 (Vitis vinifera L. and Cabernet Sauvignon (CS (Vitis vinifera L. were treated with 0.40 mg/L 24-epibrassinolide (EBR, 1.00 mg/L brassinazole (Brz, and deionized water (control, at the veraison period. The EBR treatment significantly increased total phenolic content (TPC, total tannin content (TTC and total anthocyanin content (TAC of Yan73 and CS wines, whereas Brz treatment decreased TPC, total flavonoid content (TFC, TAC in the two wines. Moreover, the content of most of the phenolic compounds identified by HPLC-DAD/ESI-MS in EBR-treated wines was significantly higher than that in control. The antioxidant capacities, which determined using DPPH, ABTS and HRSA methods, of the wines were increased by EBR treatment as well. There was a good correlation between the antioxidant capacity and phenolic content. The results demonstrated that EBR could enhance the phenolic compounds and antioxidant capacity of Yan73 and CS wines, but the effects may vary by different cultivars.
Cui, Lirong; Zou, Zhirong; Zhang, Jing; Zhao, Yanyan; Yan, Fei
2016-01-01
Brassinosteroids (Brs) are a newly recognized group of active steroidal hormones that occur at low concentrations in all plant parts and one of the active and stable forms is 24-epibrassinolide (EBR). We investigated the effect of EBR on tomato (Lycopersicon esculentum Mill.) and its mechanism when seedlings were exposed to low temperature and poor light stress conditions. Leaves of stress-tolerant 'Zhongza9' and stress-sensitive 'Zhongshu4' cultivars were pre-treated with spray solutions containing either 0.1 μM EBR or no EBR (control). The plants were then transferred to chambers where they were exposed to low temperatures of 12 °C/6 °C (day/night) under a low light (LL) level of 80 μmol · m(-2) · s(-1). Exogenous application of EBR significantly increased the antioxidant activity of superoxide dismutase, catalase and peroxidase, and decreased the rate of O2 · (-) formation and H2O2 and malondialdehyde contents. Additionally, the ATP synthase β subunit content was increased by exogenous hormone application. Based on these results, we conclude that exogenous EBR can elicit synergism between the antioxidant enzyme systems and the ATP synthase β subunit so that scavenging of reactive oxygen species becomes more efficient. These activities enable plants to cope better under combined low temperature and poor light stresses.
Vascular radiation therapy using Ho-166 for prevention of cardiovascular restenosis
Energy Technology Data Exchange (ETDEWEB)
Park, Chan Hee; Choi, Byung Il; Kim, Han Soo; Kim, Won; Chun, Mi Son; Kang, Hae Jin; Oh, Young Taek; Kang, Seung Hee; Cho, Chul Woo [Ajou University, Suwon (Korea, Republic of)
1997-07-01
Endovascular irradiation with either a gamma or a beta source has been shown to reduce neo intimal proliferation. However, the effect of external beam radiation (EBR) on neo intimal hyperplasia in the various animal models is controversial. To determine the effect of the different doses of EBR on neo intimal hyperplasia, 36 Sprague-Dawley rats underwent carotid injury by using 2F Fogarty ballon and EBR with doses ranging from 5 to 20 Gy. Rats were= sacrificed after 2 weeks. The arteries were perfusion-fixed in paraformaldehyde. EBR was performed with 6 Mev electrons in a field of 3 x 5 cm using a linear accelerator. The dose was specified to depth of 15 mm. Histomorphometry was performed to compare external elastic lamina (EEL) area (mm2), lumen area (mm2) and neo intimal area (mm2) of the injured segments. ANOVA test was used to compare group means and unpaired t-test to compare low dose group (5-10 Gy) and high dose group (15-20 Gy). No statistically significant difference was found among each group in EEL and lumen area. Low dose EBR has no significant impact on neo intimal hyperplasia in rat carotid injury model. However, neo intimal area is significantly reduced in high dose group (p<0.01) indicating high dose EBR ({>=} 1500 Gy) markedly prevents neo intimal hyperplasia. (Author) 44 refs., 1 tab., 8 figs.
International Nuclear Information System (INIS)
Larson, H.A.; Dean, E.M.; Koenig, J.F.; Gale, J.G.; Lehto, W.K.
1984-01-01
The DSNP Simulation Language facilitates whole reactor plant simulation and design. Verification includes DSNP dynamic modeling of Experimental Breeder Reactor No. 2 (EBR-II) plant experiments as well as comparisons with verified simulation programs. Great flexibility is allowed in expanding the DSNP language and accommodate other computer languages. The component modules of DSNP, contained in libraries, are continually updated with new, improved, and verified modules. The modules are used to simulate the dynamic response of LMFBR reactor systems to upset and transient conditions, with special emphasis on investigations of inherent shutdown mechanisms
Energy Technology Data Exchange (ETDEWEB)
Sondhaus, C. A.; Wallace, R. W.; Lyman, J. T.; Kase, K. W.; Steward, P. G. [University of California Lawrence Radiation Laboratory Berkeley (United States)
1964-03-15
Mortality at 6 , 12, and 30 d was studied in male Swiss-Webster white mice exposed to 730-MeV protons, 250-kVp X-rays, and 100-kVp X-rays at different dose rates. In the proton irradiated mice, 6 - to 8 -d gastro-intestinal death predominated at both 100 and 1000 rad/min, and was enhanced at the higher dose rate. In the X-ray exposures, 12- to 14-d haematopoietic death predominated and showed a similar dose-rate effect. The RBE of protons relative to 250 kVp X-ray for 30-d LD{sub 50} was found to be 0.8 ; the RBE for 6-d LD{sub 50} was found to be 1.2 at the same dose rate of 100 rad/min. It is suggested that the difference in injury mode may be due to differences in tissue dose distribution. The higher but variable proton RBE for 6 -d gut death appears to exhibit the dose-rate effect associated with low-LET exposure. Practical consequences of the dose distribution and dose-rate factois are discussed. (author) [French] Ils auteurs ont etudie la mortalite apres 6 , 10 et 30 j chez des souris blanches males Swiss Webster exposees a des protons de 730 MeV, a des rayons X de 250 kV-crete et a des rayons X de 100 kV-crete, avec des debits de dose differents. Chez les souris exposees aux protons, on a observe une predominance de la mortalite apres 6 a 8 j due au syndrome gastro-intestinal, a 100 et 1000 rad/min; la mortalite etait plus elevee a 1000 rad/min. Chez les souris exposees aux rayons X , on a observe une predominance de la mortalite apres 12 a 14 j due au syndrome hematopoletique, avec effet similaire du debit de dose. L'EBR des protons par rapport aux rayons X de 250 kV-crete pour la DL{sup 30}{sub 50} etait de 0,8 et l'EBR pour la DL{sup 6}{sub 50} etait de 1,2 pour un meme debit de dose de 100 rad/min. La difference dans les types de lesions peut etre due a des differences de distribution de la dose dans les tissus. L'EBR des protons, plus elevee mais variable, pour la mortalite apres six jours causee par des lesions de l'appareil digestif semble reveler le
Transient behaviour and inherent safety research of LMFBR power plants
International Nuclear Information System (INIS)
Zhu Jizhou; Wang Ping; Yu Baoan
1995-06-01
Fast Breeder Reactor will be the next generation reactor for nuclear electricity production, the development of FBR will give the profits of efficient utilization of nuclear resources. The fast reactor safety analysis is the foundation and key of FBR research work. Therefore, a block-oriented mathematical model for the primary system of LMFBRs was constructed, and the dynamic simulating results which have been carried out on micro-computer are presented for various transients, i.e. TOP, LOFS, LOHS. The results agree well with the corresponding results of the code NATDEMO and experiment results of EBR-II. Based on previous analysis, various methods are discussed to confirm the inherent safety of LMFBR
Validation and application of a physics database for fast reactor fuel cycle analysis
International Nuclear Information System (INIS)
McKnight, R.D.; Stillman, J.A.; Toppel, B.J.; Khalil, H.S.
1994-01-01
An effort has been made to automate the execution of fast reactor fuel cycle analysis, using EBR-II as a demonstration vehicle, and to validate the analysis results for application to the IFR closed fuel cycle demonstration at EBR-II and its fuel cycle facility. This effort has included: (1) the application of the standard ANL depletion codes to perform core-follow analyses for an extensive series of EBR-II runs, (2) incorporation of the EBR-II data into a physics database, (3) development and verification of software to update, maintain and verify the database files, (4) development and validation of fuel cycle models and methodology, (5) development and verification of software which utilizes this physics database to automate the application of the ANL depletion codes, methods and models to perform the core-follow analysis, and (6) validation studies of the ANL depletion codes and of their application in support of anticipated near-term operations in EBR-II and the Fuel Cycle Facility. Results of the validation tests indicate the physics database and associated analysis codes and procedures are adequate to predict required quantities in support of early phases of FCF operations
ANL calculational methodologies for determining spent nuclear fuel source term
International Nuclear Information System (INIS)
McKnight, R. D.
2000-01-01
Over the last decade Argonne National Laboratory has developed reactor depletion methods and models to determine radionuclide inventories of irradiated EBR-II fuels. Predicted masses based on these calculational methodologies have been validated using available data from destructive measurements--first from measurements of lead EBR-II experimental test assemblies and later using data obtained from processing irradiated EBR-II fuel assemblies in the Fuel Conditioning Facility. Details of these generic methodologies are described herein. Validation results demonstrate these methods meet the FCF operations and material control and accountancy requirements
Fast Reactor Knowledge Preservation Efforts. An Overview
International Nuclear Information System (INIS)
Grandy, Christopher
2013-01-01
• ARC-AFR Program is involved in a number of knowledge preservation activities; • Recovery of Information from EBR-II, FFTF, and TREAT is very important; • Recovery of Information from Office of Scientific and Technical Information (OSTI) and conversion to electronic format; • Organizing some data into electronic databases – EBR-II Plant Testing Data, FFTF Plant Testing Data, TREAT Test Data, SFR Fuels and Materials Irradiation Data, etc.; • Information is being used to support existing U.S. SFR programs along with international programs such as the IAEA CRP EBR-II Safety Benchmark
Energy Technology Data Exchange (ETDEWEB)
Huang, Y., E-mail: yina.huang@materials.ox.ac.uk [University of Wisconsin, Madison, WI 53706 (United States); Wiezorek, J.M.K. [University of Pittsburgh, Pittsburgh, PA 15260 (United States); Garner, F.A. [Radiation Effects Consulting, 2003 Howell Ave., Richland, WA 99354 (United States); Freyer, P.D. [Westinghouse Electric Company LLC, Pittsburgh, PA 15235 (United States); Okita, T. [University of Tokyo, Tokyo (Japan); Sagisaka, M.; Isobe, Y. [Nuclear Fuel Industries, Ltd., Osaka (Japan); Allen, T.R. [University of Wisconsin, Madison, WI 53706 (United States)
2015-10-15
While thin reactor structural components such as cladding and ducts do not experience significant gradients in dpa rate, gamma heating rate, temperature or stress, thick components can develop strong local variations in void swelling and irradiation creep in response to gradients in these variables. In this study we conducted microstructural investigations by transmission electron microscopy of two 52 mm thick 304-type stainless steel hex-blocks irradiated for 12 years in the EBR-II reactor with accumulated doses ranging from ∼0.4 to 33 dpa. Spatial variations in the populations of voids, precipitates, Frank loops and dislocation lines have been determined for 304 stainless steel sections exposed to different temperatures, different dpa levels and at different dpa rates, demonstrating the existence of spatial gradients in the resulting void swelling. The microstructural measurements compare very well with complementary density change measurements regarding void swelling gradients in the 304 stainless steel hex-block components. The TEM studies revealed that the original cold-worked-state microstructure of the unirradiated blocks was completely erased by irradiation, replaced by high densities of interstitial Frank loops, voids and carbide precipitates at both the lowest and highest doses. At large dose levels the amount of volumetric void swelling correlated directly with the gamma heating gradient-related temperature increase (e.g. for 28 dpa, ∼2% swelling at 418 °C and ∼2.9% swelling at 448 °C). Under approximately iso-thermal local conditions, volumetric void swelling was found to increase with dose level (e.g. ∼0.2% swelling at 0.4 dpa, ∼0.5% swelling at 4 dpa and ∼2% swelling at 28 dpa). Carbide precipitate formation levels were found to be relatively independent of both dpa level and temperature and induced a measurable densification. Void swelling was dominant at the higher dose levels and caused measurable decreases in density. Void
Huang, Y.; Wiezorek, J. M. K.; Garner, F. A.; Freyer, P. D.; Okita, T.; Sagisaka, M.; Isobe, Y.; Allen, T. R.
2015-10-01
While thin reactor structural components such as cladding and ducts do not experience significant gradients in dpa rate, gamma heating rate, temperature or stress, thick components can develop strong local variations in void swelling and irradiation creep in response to gradients in these variables. In this study we conducted microstructural investigations by transmission electron microscopy of two 52 mm thick 304-type stainless steel hex-blocks irradiated for 12 years in the EBR-II reactor with accumulated doses ranging from ∼0.4 to 33 dpa. Spatial variations in the populations of voids, precipitates, Frank loops and dislocation lines have been determined for 304 stainless steel sections exposed to different temperatures, different dpa levels and at different dpa rates, demonstrating the existence of spatial gradients in the resulting void swelling. The microstructural measurements compare very well with complementary density change measurements regarding void swelling gradients in the 304 stainless steel hex-block components. The TEM studies revealed that the original cold-worked-state microstructure of the unirradiated blocks was completely erased by irradiation, replaced by high densities of interstitial Frank loops, voids and carbide precipitates at both the lowest and highest doses. At large dose levels the amount of volumetric void swelling correlated directly with the gamma heating gradient-related temperature increase (e.g. for 28 dpa, ∼2% swelling at 418 °C and ∼2.9% swelling at 448 °C). Under approximately iso-thermal local conditions, volumetric void swelling was found to increase with dose level (e.g. ∼0.2% swelling at 0.4 dpa, ∼0.5% swelling at 4 dpa and ∼2% swelling at 28 dpa). Carbide precipitate formation levels were found to be relatively independent of both dpa level and temperature and induced a measurable densification. Void swelling was dominant at the higher dose levels and caused measurable decreases in density. Void swelling
Swelling and swelling resistance possibilities of austenitic stainless steels in fusion reactors
International Nuclear Information System (INIS)
Maziasz, P.J.
1983-01-01
Fusion reactor helium generation rates in stainless steels are intermediate to those found in EBR-II and HFIR, and swelling in fusion reactors may differ from the fission swelling behavior. Advanced titanium-modified austenitic stainless steels exhibit much better void swelling resistance than AISI 316 under EBR-II (up to approx. 120 dpa) and HFIR (up to approx. 44 dpa) irradiations. The stability of fine titanium carbide (MC) precipitates plays an important role in void swelling resistance for the cold-worked titanium-modified steels irradiated in EBR-II. Futhermore, increased helium generation in these steels can (a) suppress void conversion, (b) suppress radiation-induced solute segregation (RIS), and (c) stabilize fine MC particles, if sufficient bubble nucleation occurs early in the irradation. The combined effects of helium-enhanced MC stability and helium-suppressed RIS suggest better void swelling resistance in these steels for fusion service than under EBR-II irradiation
Training experience at Experimental Breeder Reactor II
International Nuclear Information System (INIS)
Driscoll, J.W.; McCormick, R.P.; McCreery, H.I.
1978-01-01
The EBR-II Training Group develops, maintains,and oversees training programs and activities associated with the EBR-II Project. The group originally spent all its time on EBR-II plant-operations training, but has gradually spread its work into other areas. These other areas of training now include mechanical maintenance, fuel manufacturing facility, instrumentation and control, fissile fuel handling, and emergency activities. This report describes each of the programs and gives a statistical breakdown of the time spent by the Training Group for each program. The major training programs for the EBR-II Project are presented by multimedia methods at a pace controlled by the student. The Training Group has much experience in the use of audio-visual techniques and equipment, including video-tapes, 35 mm slides, Super 8 and 16 mm film, models, and filmstrips. The effectiveness of these techniques is evaluated in this report
Directory of Open Access Journals (Sweden)
Parvaiz Ahmad
2016-11-01
Full Text Available The present experiment was designed to assess the effects of seed soaking with 24-epibrassinolide (EBR on the physiology of Brassica juncea L. seedlings grown under imidacloprid (IMI toxicity. Application of EBR increased the length of seedlings, dry weight, and pigment contents, polyphenols, total phenols and organic acids under IMI toxicity. The expression of genes coding key enzymes of pigment, phenols, polyphenols and organic acid biosynthetic pathways was also studied including CHLASE (chlorophyllase, PSY (phytoene synthase, CHS (chalcone synthase and PAL (phenylalanine ammonialyase, CS (citrate synthase, SUCLG1 (succinyl Co-A ligase,, SDH (succinate dehydrogenase, FH (fumarate hydratase, MS (malate synthase. Multiple linear regression analysis revealed that IMI application regressed negatively on seedling length, dry weight and total chlorophyll content. However, EBR seed treatment regressed positively on all of the parameters studied. Moreover, interaction between IMI and EBR showed positive regression for growth parameters, content of pigments, total polyphenol, total phenol and malate, and expression of PSY and PAL. Negative interactions were noticed for the contents of fumarate, succinate and citrate, and expression of CHS and all genes studied related to organic acid metabolism. In conclusion, EBR enhanced the growth and contents of all studied metabolites by regulating the gene expression of B. juncea seedlings under IMI stress.
International Nuclear Information System (INIS)
Lee, Hun; Lee, Kangsun; Ahn, Byungwook; Xu, Jing; Xu, Linfeng; Oh, Kwang W
2011-01-01
This paper proposes a new SU-8 fabrication process to simultaneously remove edge bead and tiny air bubbles by spraying out edge bead removal (EBR) fluid over the entire surface of photoresist. In particular, the edge bead and air bubbles can cause an air gap between a film mask and a photoresist surface during UV exposure. The diffraction effect of UV light by the air gap leads to inaccurate and non-uniform SU-8 patterns. In this study, we demonstrate a simple method using EBR treatment to simultaneously eliminate the edge bead at the edge of wafer and tiny air bubbles inside SU-8. The profiles of thickness variation of SU-8 films with/without the EBR treatment are measured. The results show that the proposed EBR treatment can successfully remove the edge bead and air bubbles over the entire SU-8 films. The average pattern uniformity of SU-8 is improved from 50.5% to 11.3% in the case of 200 µm thickness. This method is simple and inexpensive, compared to a standard EBR process, because it does not require specialized equipment and it can be applied regardless of substrate geometry (e.g. circular wafer and rectangular slide glass).
Radiographers' preconditions for evidence-based radiography
International Nuclear Information System (INIS)
Ahonen, Sanna-Mari; Liikanen, Eeva
2010-01-01
Evidence-based practice (EBP) is essential in today's health care, but its establishment requires several preconditions from individuals and organizations (e.g. knowledge, understanding, attitudes, abilities, self-confidence, support, and resources). Previous studies suggest that radiographers do generate and use evidence in their work, but evidence-based radiography (EBR) is not yet used routinely as established practice, especially in terms of research utilization. This paper aims to describe radiographers' preconditions for EBR, and their participation in research activities. Main focus is on research utilization. Using an electronic questionnaire developed for this study, a survey was conducted: data collected from Finnish radiographers and radiotherapists (N = 438) were analysed both statistically and qualitatively. The final response rate was 39%. The results suggest radiographers' preconditions for EBR to consist of knowledge of research, significance of research activities, research-orientated way of working, and support. In addition, adequate resourcing is essential. Reading scientific journals, participation in research activities, a higher degree of education, and senior post seem to be significant promoters of EBR and research utilization. The results support the notion that EBR, and especially research utilization, are not yet well-established in Finland, and radiographers' viewpoints concerning the role and significance of research evidence and research activities still seem to vary.
Method for the determination of technical specifications limiting temperature in EBR-II operation
International Nuclear Information System (INIS)
Chang, L.K.; Hill, D.J.; Ku, J.Y.
2004-01-01
The methodology and analysis procedure to qualify the Mark-V and Mark-VA fuels for the Experimental Breeder Reactor II are summarized in this paper. Fuel performance data and design safety criteria are essential for thermal-hydraulic analyses and safety evaluations. Normal and off-normal operation duty cycles and transient classifications are required for the safety assessment of the fuels. Design safety criteria for steady-state normal and transient off-normal operations were developed to ensure structural integrity of the fuel pin. The maximum allowable coolant outlet temperatures and powers of subassemblies for steady-state normal operation conditions were first determined in a row-by-row basis by a thermal-hydraulic and fuel damage analysis, in which a trial-and-error approach was used to predict the maximum subassembly coolant outlet temperatures and powers that satisfy the design safety criteria for steady-state normal operation conditions. The limiting steady-state temperature and power were then used as the initial subassembly thermal conditions for the off-normal transient analysis to assess the safety performance of the fuel pin for anticipated, unlikely and extremely unlikely events. If the design safety criteria for the off-normal events are not satisfied, then the initial steady-state subassembly temperatures and/or powers are reduced and an iterative procedure is employed until the design safety criteria for off-normal conditions are satisfied, and the initial subassembly outlet coolant temperature and power are the technical specification limits for reactor operation. (author)
International Nuclear Information System (INIS)
Rao, Shama; Shetty, Sukanya; Suchetha Kumari, N.; Madhu, L.N.
2014-01-01
Chitosan has been widely used for multiple applications because it is a non-toxic biocompatible, biodegradable, and adsorptive material. A previous study has shown that low-molecular-weight chitosan (LMWC) exerts a cytotoxic effect on oral cancer cells. Although a higher concentration of LMWC in comparison to cisplatin was needed in order to kill cancer cells, it was relatively less cytotoxic to non-cancer cells. Some of the well known anticancer drugs have the property of sensitizing the cell to radiation, which will be more applicable during combination therapy of cancer. The present study was undertaken to find the radiosensitizing effect of chitosan on Hela and Brain tumor (LN18) cells against electron beam radiation (EBR). Both the cancer cell lines, Hela and LN 18 were treated with different concentration of chitosan (50 and 100 μg/ml) pre and post exposure to 4 Gy EBR. The percentage of cell viability, percentage of apoptosis and ssDNA damage in the treated cells were assessed by MTT assay, DNA diffusion assay and comet assay respectively. The obtained results showed 62.13 1 5.08 and 65.24 1 2.45 percent Hela and LN 18 viable cells at 24 hour after the exposure to 4 Gy EBR. The percentage of viability was found to be decreased in cells exposed to EBR in the presence of chitosan. Supporting to this, percentage of apoptotic cells was found to be more in treated groups (28.13 1 4.34 and 25.13 1 3.76) when compared with control (23.19 1 1.07 and 20.79 1 4.86). Treatment of HeLa and LN18 before and after the exposure of EBR showed significantly (P<0.05) more frequency of micronucleus and % of DNA damage than the 4 Gy EBR control group. These results conclude the sensitizing effect of chitosan on cancer cell line against EBR exposure. (author)
International Nuclear Information System (INIS)
Van Tuyle, G.J.; Slovik, G.C.; Chan, B.C.; Kennett, R.J.; Cheng, H.S.; Kroeger, P.G.
1989-10-01
In support of the US Nuclear Regulatory Commission (NRC), Brookhaven National Laboratory (BNL) has performed independent analyses of two advanced Liquid Metal Reactor (LMR) concepts. The designs, sponsored by the US Department of Energy (DOE), the Power Reactor Inherently Safe Module (PRISM) [Berglund, 1987] and the Sodium Advanced Fast Reactor (SAFR) [Baumeister, 1987], were developed primarily by General Electric (GE) and Rockwell International (RI), respectively. Technical support was provided to DOE, RI, and GE, by the Argonne National Laboratory (ANL), particularly with respect to the characteristics of the metal fuels. There are several examples in both PRISM and SAFR where inherent or passive systems provide for a safe response to off-normal conditions. This is in contrast to the engineered safety systems utilized on current US Light Water Reactor (LWR) designs. One important design inherency in the LMRs is the ''inherent shutdown'', which refers to the tendency of the reactor to transition to a much lower power level whenever temperatures rise significantly. This type of behavior was demonstrated in a series of unscrammed tests at EBR-II [NED, 1986]. The second key design feature is the passive air cooling of the vessel to remove decay heat. These systems, designated RVACS in PRISM and RACS in SAFR, always operate and are believed to be able to prevent core damage in the event that no other means of heat removal is available. 27 refs., 78 figs., 3 tabs
International Nuclear Information System (INIS)
Smith, R.N.; Cissel, D.W.; Smith, R.R.
1977-01-01
As originally designed and operated, EBR-II successfully demonstrated the concept of a sodium-cooled fast breeder power plant with a closed fuel reprocessing cycle (mini-nuclear park). Subsequent operation has been as an irradiation facility, a role which will continue into the foreseeable future. Since the beginning of operation in 1961, operating experience of EBR-II has been very satisfactory. Most of the components and systems have performed well. In particular, the mechanical performance of heat-removal systems has been excellent. A review of the operating experience reveals that all the original design objectives have been successfully demonstrated. To date, no failures or incidents resulting in serious in-core or out-of-core consequences have occurred. No water-to-sodium leaks have been detected over the life of the plant. At the present time, the facility is operating very well and continuously except for short shutdowns required by maintenance, refueling, modification, and minor repair. A plant factor of 76.9% was achieved for the calendar year 1976
Application of advanced technology to LMR control
International Nuclear Information System (INIS)
Lindsay, R.W.
1989-01-01
Key issues must be resolved to preserve the nuclear option; including new considerations for safety, economics, waste, transportation, diversion, etc. The programs at the Experimental Breeder Reactor II (EBR-II) are now carefully focused to provide answers to the above concerns in connection with the Integral Fast Reactor program at Argonne. Safety features that are inherent in plant design, coupled with automating plant control to help achieve the above objectives are more than just an issue of installing controllers and exotic algorithms, they include the complete integration of plant design, control strategy, and information presentation. Current technology development, both at Argonne and elsewhere includes efforts relating to the use of Artificial Intelligence, sensor/signal validation in many forms, pattern recognition, optimal develop and/or adopt promising technologies, and integrate them into an operating power plant for proof of value. After they have proven useful at EBR-II, it is expected that they can be incorporated into advanced designs such as PRISM and/or included in backfit activities as well. 6 refs
Management of super-grade plutonium in spent nuclear fuel
International Nuclear Information System (INIS)
McFarlane, H. F.; Benedict, R. W.
2000-01-01
This paper examines the security and safeguards implications of potential management options for DOE's sodium-bonded blanket fuel from the EBR-II and the Fermi-1 fast reactors. The EBR-II fuel appears to be unsuitable for the packaging alternative because of DOE's current safeguards requirements for plutonium. Emerging DOE requirements, National Academy of Sciences recommendations, draft waste acceptance requirements for Yucca Mountain and IAEA requirements for similar fuel also emphasize the importance of safeguards in spent fuel management. Electrometallurgical treatment would be acceptable for both fuel types. Meeting the known requirements for safeguards and security could potentially add more than $200M in cost to the packaging option for the EBR-II fuel
Powering Up Mitichondrial Functions to Treat Mitochondrial Disease
2017-10-01
per group) measured by ELISA . E Phosphorylated (Tyr694) and total STAT5 in 10-day-old mouse livers determined by Western blot (n = 3–4 mice per group...protein content of individual mouse liver) were quantified by ELISA (n = 13 mice per group). G Expression of STAT5 target genes Igf1, Igfbp3, and Igfals...plasma (n = 9–10 mice per group) IGFBP3 concentrations in 13-day-old mice measured by ELISA . Data information: *P < 0.05, **P < 0.01, ****P < 0.0001
Elbasha, E; Greaves, W; Roth, D; Nwankwo, C
2017-04-01
Among patients with chronic kidney disease (CKD) in the United States, HCV infection causes significant morbidity and mortality and results in substantial healthcare costs. A once-daily oral regimen of elbasvir/grazoprevir (EBR/GZR) for 12 weeks was found to be a safe and efficacious treatment for HCV in patients with CKD. We evaluated the cost-effectiveness of EBR/GZR in treatment-naïve and treatment-experienced CKD patients compared with no treatment (NoTx) and pegylated interferon plus ribavirin (peg-IFN/RBV) using a computer-based model of the natural history of chronic HCV genotype 1 infection, CKD and liver disease. Data on baseline characteristics of the simulated patients were obtained from NHANES, 2000-2010. Model inputs were estimated from published studies. Cost of treatment with EBR/GZR and peg-INF/RBV were based on wholesale acquisition cost. All costs were from a third-party payer perspective and were expressed in 2015 U.S. dollars. We estimated lifetime incidence of liver-related complications, liver transplantation, kidney transplantation, end-stage live disease mortality and end-stage renal disease mortality; lifetime quality-adjusted life years (QALY); and incremental cost-utility ratios (ICUR). The model predicted that EBR/GZR will significantly reduce the incidence of liver-related complications and prolong life in patients with chronic HCV genotype 1 infection and CKD compared with NoTx or use of peg-IFN/RBV. EBR/GZR-based regimens resulted in higher average remaining QALYs and higher costs (11.5716, $191 242) compared with NoTx (8.9199, $156 236) or peg-INF/RBV (10.2857, $186 701). Peg-IFN/RBV is not cost-effective, and the ICUR of EBR/GZR compared with NoTx was $13 200/QALY. Treatment of a patient on haemodialysis with EBR/GZR resulted in a higher ICUR ($217 000/QALY). Assuming a threshold of $100 000 per QALY gained for cost-effectiveness, use of elbasvir/grazoprevir to treat an average patient with CKD can be considered cost
The Sodium Process Facility at Argonne National Laboratory-West
International Nuclear Information System (INIS)
Michelbacher, J.A.; Henslee, S.P.; McDermott, M.D.; Price, J.R.; Rosenberg, K.E.; Wells, P.B.
1998-01-01
Argonne National Laboratory-West (ANL-W) has approximately 680,000 liters of raw sodium stored in facilities on site. As mandated by the State of Idaho and the US Department of Energy (DOE), this sodium must be transformed into a stable condition for land disposal. To comply with this mandate, ANL-W designed and built the Sodium Process Facility (SPF) for the processing of this sodium into a dry, sodium carbonate powder. The major portion of the sodium stored at ANL-W is radioactively contaminated. The sodium will be processed in three separate and distinct campaigns: the 290,000 liters of Fermi-1 primary sodium, the 50,000 liters of the Experimental Breeder Reactor-II (EBR-II) secondary sodium, and the 330,000 liters of the EBR-II primary sodium. The Fermi-1 and the EBR-II secondary sodium contain only low-level of radiation, while the EBR-II primary sodium has radiation levels up to 0.5 mSv (50 mrem) per hour at 1 meter. The EBR-II primary sodium will be processed last, allowing the operating experience to be gained with the less radioactive sodium prior to reacting the most radioactive sodium. The sodium carbonate will be disposed of in 270 liter barrels, four to a pallet. These barrels are square in cross-section, allowing for maximum utilization of the space on a pallet, minimizing the required landfill space required for disposal
The Sodium Process Facility at Argonne National Laboratory-West
Energy Technology Data Exchange (ETDEWEB)
Michelbacher, J.A.; Henslee, S.P. McDermott, M.D.; Price, J.R.; Rosenberg, K.E.; Wells, P.B.
1998-07-01
Argonne National Laboratory-West (ANL-W) has approximately 680,000 liters of raw sodium stored in facilities on site. As mandated by the State of Idaho and the US Department of Energy (DOE), this sodium must be transformed into a stable condition for land disposal. To comply with this mandate, ANL-W designed and built the Sodium Process Facility (SPF) for the processing of this sodium into a dry, sodium carbonate powder. The major portion of the sodium stored at ANL-W is radioactively contaminated. The sodium will be processed in three separate and distinct campaigns: the 290,000 liters of Fermi-1 primary sodium, the 50,000 liters of the Experimental Breeder Reactor-II (EBR-II) secondary sodium, and the 330,000 liters of the EBR-II primary sodium. The Fermi-1 and the EBR-II secondary sodium contain only low-level of radiation, while the EBR-II primary sodium has radiation levels up to 0.5 mSv (50 mrem) per hour at 1 meter. The EBR-II primary sodium will be processed last, allowing the operating experience to be gained with the less radioactive sodium prior to reacting the most radioactive sodium. The sodium carbonate will be disposed of in 270 liter barrels, four to a pallet. These barrels are square in cross-section, allowing for maximum utilization of the space on a pallet, minimizing the required landfill space required for disposal.
Rekindled interest in pyrometallurgical processing
International Nuclear Information System (INIS)
Burris, L.
1986-01-01
The IFR with its integral, on-site fuel recycle revived a concept pioneered at EBR-II. The reactor concept has become very attractive due to the advances in metal fuel performance over the past 15 years and in the understanding of the safety of metal-fueled reactors. The proposed fuel cycle carries out Lawroski's call for development of a low-cost fuel cycle for fast reactors to help them become economically competitive. The IFR represents a new direction in breeder developments. The next two years will be devoted to establishing experimentally the chemical feasibility of the pyrometallurgical process. Once it becomes feasible, the EBR-II fuel cycle facility can be refurbished and the process using IFR-type fuel irradiated in EBR-II
Saccomanno, Maristella F; Donati, Fabrizio; Careri, Silvia; Bartoli, Matteo; Severini, Gabriele; Milano, Giuseppe
2016-05-01
To assess the efficacy of intra-articular hyaluronic acid (HA) injections and exercise-based rehabilitation (EBR) programme, administered as isolated or integrated for the treatment of knee osteoarthritis. One hundred sixty-five patients affected by moderate degrees of knee OA were randomly divided into three groups. Group 1 (HA) underwent three HA injections (one every 2 weeks); group 2 (EBR) underwent 20 treatment sessions in a month of an individualized programme; and group 3 (HA + EBR) received both treatments simultaneously. Primary outcome was the Italian version of the Western Ontario and McMaster Universities (WOMAC) Osteoarthritis Index; secondary outcome was the evaluation of active range of movement (AROM). All patients were evaluated before and 1, 3 and 6 months after treatment. Significance was set at p injections and individualized rehabilitation programmes administered in isolation or in combination are effective in improving knee function and pain relief. The combined treatment showed the greatest pain relief at 1-month follow-up compared to either in isolation. Compared to the previous studies, this is the first study, which proposed an EBR programme tailored to the compartment of the knee joint most involved in the degenerative process. I.
Application of advanced technology to LMR control
International Nuclear Information System (INIS)
Lindsay, R.W.
1989-01-01
This paper reports that key issues must be resolved to preserve the nuclear option; including new considerations for safety, economics, waste, transportation, diversion, etc. The programs at the Experimental Breeder Reactor II (EBR-II) are now carefully focused to provide answers to the above concerns in connection with the Integral Fast Reactor program at Argonne. Safety features that are inherent in plant design, coupled with automating plant control to help achieve the above objectives are more than just an issue of installing controllers and exotic algorithms, they include the complete integration of plant design, control strategy, and information presentation. Current technology development, both at Argonne and elsewhere includes efforts relating to the use of Artificial Intelligence, sensor/signal validation in many forms, pattern recognition, optimal control technologies, etc. The eBR-II effort is to identify needs, develop and/or adopt promising technologies, and integrate them into an operating power plant for proof of value. After they have proven useful at EBR-II, it is expected that they can be incorporated into advanced designs such as PRISM and/or included in backfit activities as well
A neurophysiological training evaluation metric for air traffic management.
Borghini, G; Aricò, P; Ferri, F; Graziani, I; Pozzi, S; Napoletano, L; Imbert, J P; Granger, G; Benhacene, R; Babiloni, F
2014-01-01
The aim of this work was to analyze the possibility to apply a neuroelectrical cognitive metrics for the evaluation of the training level of subjects during the learning of a task employed by Air Traffic Controllers (ATCos). In particular, the Electroencephalogram (EEG), the Electrocardiogram (ECG) and the Electrooculogram (EOG) signals were gathered from a group of students during the execution of an Air Traffic Management (ATM) task, proposed at three different levels of difficulty. The neuroelectrical results were compared with the subjective perception of the task difficulty obtained by the NASA-TLX questionnaires. From these analyses, we suggest that the integration of information derived from the power spectral density (PSD) of the EEG signals, the heart rate (HR) and the eye-blink rate (EBR) return important quantitative information about the training level of the subjects. In particular, by focusing the analysis on the direct and inverse correlation of the frontal PSD theta (4-7 (Hz)) and HR, and of the parietal PSD alpha (10-12 (Hz)) and EBR, respectively, with the degree of mental and emotive engagement, it is possible to obtain useful information about the training improvement across the training sessions.
Nogueira, Zeni Drubi; Boa-Sorte, Ney; Leite, Maria Efigênia de Queiroz; Kiya, Márcia Miyuki; Amorim, Tatiana; Fonseca, Silvana Fahel da
2015-01-01
To study breastfeeding history (BF) and the anthropometric status of children with Sickle Cell Disease (SCD). A cross-sectional study of 357 children with SS and SC hemoglobinopathies aged between 2 and 6 years old receiving regular follow-up at a Newborn Screening Reference Service (NSRS) between November 2007 and January 2009. The outcome was anthropometric status and the exposures were: BF pattern, type of hemoglobinopathy and child's age and sex. The average (SD) age was 3.7 (1.1) years, 52.9% were boys and 53.5% had SS hemoglobinopathy. The prevalence of exclusive breastfeeding (EBR) up to six months of age was 31.5%, the median EBR times (p25-p75) was 90.0 (24.0-180.0) days and the median weaning ages (p25-p75) was 360.0 (90.0-20.0) days respectively. Normal W/H children experienced EBR for an average duration almost four times longer than malnourished children (p=0.01), and were weaned later (p<0.05). Height deficit was found in 5.0% of children, while all the children with severe short stature had SS hemoglobinopathy and were over 4 years of age. EBR time and weaning age were greater than found in the literature, which is a possible effect of the multidisciplinary follow-up. Duration of EBR and later weaning were associated with improved anthropometric indicators. Copyright © 2014 Associação de Pediatria de São Paulo. Publicado por Elsevier Editora Ltda. All rights reserved.
Application of neural computing paradigms for signal validation
International Nuclear Information System (INIS)
Upadhyaya, B.R.; Eryurek, E.; Mathai, G.
1989-01-01
Signal validation and process monitoring problems often require the prediction of one or more process variables in a system. The feasibility of applying neural network paradigms to relate one variable with a set of other related variables is studied. The backpropagation network (BPN) is applied to develop models of signals from both a commercial power plant and the EBR-II. Modification of the BPN algorithm is studied with emphasis on the speed of network training and the accuracy of prediction. The prediction of process variables in a Westinghouse PWR is presented in this paper
Energy Technology Data Exchange (ETDEWEB)
Ronald Farris; David Gertman; Jacques Hugo
2014-03-01
This report presents the results of the Work Domain Analysis for the Experimental Breeder Reactor (EBR-II). This is part of the phase of the research designed to incorporate Cognitive Work Analysis in the development of a framework for the formalization of an Operational Concept (OpsCon) for Advanced Small Modular Reactors (AdvSMRs). For a new AdvSMR design, information obtained through Cognitive Work Analysis, combined with human performance criteria, can and should be used in during the operational phase of a plant to assess the crew performance aspects associated with identified AdvSMR operational concepts. The main objective of this phase was to develop an analytical and descriptive framework that will help systems and human factors engineers to understand the design and operational requirements of the emerging generation of small, advanced, multi-modular reactors. Using EBR-II as a predecessor to emerging sodium-cooled reactor designs required the application of a method suitable to the structured and systematic analysis of the plant to assist in identifying key features of the work associated with it and to clarify the operational and other constraints. The analysis included the identification and description of operating scenarios that were considered characteristic of this type of nuclear power plant. This is an invaluable aspect of Operational Concept development since it typically reveals aspects of future plant configurations that will have an impact on operations. These include, for example, the effect of core design, different coolants, reactor-to-power conversion unit ratios, modular plant layout, modular versus central control rooms, plant siting, and many more. Multi-modular plants in particular are expected to have a significant impact on overall OpsCon in general, and human performance in particular. To support unconventional modes of operation, the modern control room of a multi-module plant would typically require advanced HSIs that would
Shakirova, Farida; Allagulova, Chulpan; Maslennikova, Dilara; Fedorova, Kristina; Yuldashev, Ruslan; Lubyanova, Alsu; Bezrukova, Marina; Avalbaev, Azamat
2016-11-01
In this study, we performed a comparative analysis of the physiological and biochemical parameters of wheat cultivars with contrasting drought resistance, drought-resistant Omskaya 35 (O-35) and less drought-resistant Salavat Yulaev (SYu), during 7-day germination under drought stress simulated by 5% mannitol. In addition, we evaluated the effectiveness of pre-sowing seed treatment with 0.4 μM 24-epibrassinolide (EBR) used to increase the resistance of plants of both cultivars to drought stress. It was revealed that mannitol has caused significant changes in the hormonal balance of the plants of both cultivars, associated with abscisic acid (ABA) accumulation and decrease in the contents of indoleacetic acid (IAA) and cytokinins (CKs). It should be noted that more dramatic changes in the content of phytohormones were characteristic for seedlings of SYu cultivar, which was reflected in a stronger growth inhibition of these plants. Pretreatment with EBR mitigated the negative effect of drought on the hormonal status and growth of seedlings during their germination. Furthermore, we found that drought caused accumulation of dehydrin (DHN) proteins, especially of low molecular weight DHNs, whose abundance was 2.5 times greater in O-35 cultivar than in SYu plants. EBR-pretreated plants of both cultivars were characterized by the additional accumulation of DHNs, indicating their involvement in the development of the EBR-induced wheat drought resistance. The use of fluridone allowed us to demonstrate ABA-dependent and ABA-independent pathways of regulation of low molecular mass dehydrins accumulation by EBR in wheat plants of both cultivars under drought conditions. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Effects of meditation practice on spontaneous eyeblink rate.
Kruis, Ayla; Slagter, Heleen A; Bachhuber, David R W; Davidson, Richard J; Lutz, Antoine
2016-05-01
A rapidly growing body of research suggests that meditation can change brain and cognitive functioning. Yet little is known about the neurochemical mechanisms underlying meditation-related changes in cognition. Here, we investigated the effects of meditation on spontaneous eyeblink rates (sEBR), a noninvasive peripheral correlate of striatal dopamine activity. Previous studies have shown a relationship between sEBR and cognitive functions such as mind wandering, cognitive flexibility, and attention-functions that are also affected by meditation. We therefore expected that long-term meditation practice would alter eyeblink activity. To test this, we recorded baseline sEBR and intereyeblink intervals (IEBI) in long-term meditators (LTM) and meditation-naive participants (MNP). We found that LTM not only blinked less frequently, but also showed a different eyeblink pattern than MNP. This pattern had good to high degree of consistency over three time points. Moreover, we examined the effects of an 8-week course of mindfulness-based stress reduction on sEBR and IEBI, compared to an active control group and a waitlist control group. No effect of short-term meditation practice was found. Finally, we investigated whether different types of meditation differentially alter eyeblink activity by measuring sEBR and IEBI after a full day of two kinds of meditation practices in the LTM. No effect of meditation type was found. Taken together, these findings may suggest either that individual difference in dopaminergic neurotransmission is a self-selection factor for meditation practice, or that long-term, but not short-term meditation practice induces stable changes in baseline striatal dopaminergic functioning. © 2016 Society for Psychophysiological Research.
Directory of Open Access Journals (Sweden)
Pingfang Li
Full Text Available Brassinosteroids (BRs, a group of naturally occurring plant steroidal compounds, are essential for plant growth, development and stress tolerance. Recent studies showed that BRs could induce systemic tolerance to biotic and abiotic stresses; however, the molecular mechanisms by which BRs signals lead to responses in the whole plant are largely unknown. In this study, 24-epibrassinosteroid (EBR-induced systemic tolerance in Cucumis sativus L. cv. Jinyan No. 4 was analyzed through the assessment of symptoms of photooxidative stress by chlorophyll fluorescence imaging pulse amplitude modulation. Expression of defense/stress related genes were induced in both treated local leaves and untreated systemic leaves by local EBR application. With the suppressive subtractive hybridization (SSH library using cDNA from the phloem sap of EBR-treated plants as the tester and distilled water (DW-treated plants as the driver, 14 transcripts out of 260 clones were identified. Quantitative Real Time-Polymerase Chain Reaction (RT-qPCR validated the specific up-regulation of these transcripts. Of the differentially expressed transcripts with known functions, transcripts for the selected four cDNAs, which encode an auxin-responsive protein (IAA14, a putative ankyrin-repeat protein, an F-box protein (PP2, and a major latex, pathogenesis-related (MLP-like protein, were induced in local leaves, systemic leaves and roots after foliar application of EBR onto mature leaves. Our results demonstrated that EBR-induced systemic tolerance is accompanied with increased transcript of genes in the defense response in other organs. The potential role of phloem mRNAs as signaling components in mediating BR-regulated systemic resistance is discussed.
Ellis, Amy E; Simiola, Vanessa; Brown, Laura; Courtois, Christine; Cook, Joan M
2018-01-01
The purpose of this paper was to systematically review and synthesize the empirical literature on the effects of evidence-based therapy relationship (EBR) variables in the psychological treatment for adults who experienced trauma-related distress. Studies were identified using comprehensive searches of PsycINFO, Medline, Published International Literature on Traumatic Stress, and Cumulative Index to Nursing and Allied Health Literature databases. Included in the review were articles published between 1980 and 2015, in English that reported on the impact of EBRs on treatment outcome in clinical samples of adult trauma survivors. Nineteen unique studies met inclusion criteria. The bulk of the studies were on therapeutic alliance and the vast majority found that alliance was predictive of or associated with a reduction in various symptomotology. Methodological concerns included the use of small sample sizes, little information on EBRs beyond alliance as well as variability in its measurement, and non-randomized assignment to treatment conditions or the lack of a comparison group. More research is needed on the roles of client feedback, managing countertransference, and other therapist characteristics on treatment outcome with trauma survivors. Understanding the role of EBRs in the treatment of trauma survivors may assist researchers, clinicians, and psychotherapy educators to improve therapist training as well as client engagement and retention in treatment.
Advanced liquid metal reactor development at Argonne National Laboratory during the 1980s
International Nuclear Information System (INIS)
Wade, D.C.
1990-01-01
Argonne National Laboratory's (ANL'S) effort to pursue the exploitation of liquid metal cooled reactor (LMR) characteristics has given rise to the Integral Fast Reactor (IFR) concept, and has produced substantial technical advancement in concept implementation which includes demonstration of high burnup capability of metallic fuel, demonstration of injection casting fabrication, integral demonstration of passive safety response, and technical feasibility of pyroprocessing. The first half decade of the 90's will host demonstration of the IFR closed fuel cycle technology at the prototype scale. The EBR-II reactor will be fueled with ternary alloy fuel in HT-9 cladding and ducts, and pyroprocessing and injection casting refabrication of EBR-II fuel will be conducted using near-commercial sized equipment at the Fuel cycle Facility (FCF) which is co-located adjacent to EBR-II. Demonstration will start in 1992. The demonstration of passive safety response achievable with the IFR design concept, (already done in EBR-II in 1986) will be repeated in the mid 90's using the IFR prototype recycle fuel from the FCF. The demonstration of scrubbing of the reprocessing fission product waste stream, with recycle of the transuranics to the reactor for consumption, will also occur in the mid 90's. 30 refs
Correlation of creep and swelling with fuel pin performance
International Nuclear Information System (INIS)
Jackson, R.J.; Washburn, D.F.; Garner, F.A.; Gilbert, E.R.
1975-09-01
The HEDL PNL-11 experiment described was one in a series of fueled subassemblies irradiated in EBR-II to demonstrate the adequacy of the FFTF fuel pin design. The cladding material, dimensions, and fuel density are prototypic of FFTF. Because neutron flux in EBR-II is lower than in FFTF, the uranium enrichment is higher in these experimental fuel pins, irradiated in EBR-II, than the FFTF enrichment for comparable linear heat rates. Some pertinent oprating conditions for the center fuel pin in this experiment are listed. This 37-pin subassembly represents, at 110,000 MWd/MTM, the highest burnup yet attained by a prototypic FFTF subassembly. Similarly, this is the highest fluence presently attained by prototypic fuel pins. A cladding breach occurred in one fuel pin which is presently being examined. Results are presented and discussed
Energy Technology Data Exchange (ETDEWEB)
Vaughan, B. E.; Davis, A. K.; Cummins, J. T.; Alpen, E. L. [US Naval Radiological Defense Laboratory, San Francisco, CA (United States)
1964-05-15
V-crete respectivement. Les auteurs ont evalue, dans chaque cas, la dose profonde absorbee par les animaux dont le corps entier avait ete expose de deux cotes. Chez le rat, sept jours apres l'exposition, l'activite bioelectrique se trouve sensiblement reduite dans l'estomac, mais non pas au niveau inferieur de l'appareil gastro-intestinal. On peut donner a l'EBR une valeur de 2 a 3 pour la reduction tardive de l'activite bioelectrique de l'estomac; cet effet peut etre mis en evidence pour des doses de neutrons de 160 rad (premiere collision). Chez le chien, trois jours apres l'exposition, les taux de transport unidirectionnel plasma-paroi du vaisseau diminuent pour le sodium et pour lreau. Cette diminution se produit apres exposition a une dose de 1200 rad de rayons X (dose dans l'air) et apres exposition aux neutrons, soit a une dose de 300 rad, soit a une dose de 600 rad (premiere collision). Toutefois, pour 600 rad de rayons X (dans l'air), ces taux de transport n'accusent pas de diminution, et ont au contraire tendance a augmenter. On peut par deduction donner a l'EBR une valeur comprise entre 2 et 6 pour la reduction tardive des transports plasma-paroi du vaisseau. Contrairement a celui de l'estomac de la grenouille, le mecanisme electrogenique de l'estomac du rat presente, d'apres les etudes faites par les auteurs, une specificite pour l'ion sodium. Les potentiels mesures in vitro sont en bon accord avec ceux qui sont mesures in vivo, et ils ne sont affectes que par l'empoisonnement metabolique ou le remplacement du sodium. Contrairement a la determination des parametres bioelectriques, celle des courants est une mesure plus specifique; toutefois, si les conditions biologiques sont nettement differentes, son utilite est limitee. Les courants unidirectionnels plasma-paroi du vaisseau varient d'une maniere reguliere en fonction de l'irradiation, la permeabilite etant reduite pour les doses d'irradiation elevees. (author) [Spanish] Los autores han descrito anteriormente los metodos
ERBS fuel addendum: Pollution reduction technology program small jet aircraft engines, phase 3
Bruce, T. W.; Davis, F. G.; Kuhn, T. E.; Mongia, H. C.
1982-01-01
A Model TFE731-2 engine with a low emission, variable geometry combustion system was tested to compare the effects of operating the engine on Commercial Jet-A aviation turbine fuel and experimental referee broad specification (ERBS) fuels. Low power emission levels were essentially identical while the high power NOx emission indexes were approximately 15% lower with the EBRS fuel. The exhaust smoke number was approximately 50% higher with ERBS at the takeoff thrust setting; however, both values were still below the EPA limit of 40 for the Model TFE731 engine. Primary zone liner wall temperature ran an average of 25 K higher with ERBS fuel than with Jet-A. The possible adoption of broadened proprties fuels for gas turbine applications is suggested.
Reconstruction of pin burnup characteristics from nodal calculations in hexagonal geometry
International Nuclear Information System (INIS)
Yang, W.S.; Finck, P.J.; Khalil, H.S.
1990-01-01
A reconstruction method has been developed for recovering pin burnup characteristics from fuel cycle calculations performed in hexagonal-z geometry using the nodal diffusion option of the DIF3D/REBUS-3 code system. Intra-modal distributions of group fluxes, nuclide densities, power density, burnup, and fluence are efficiently computed using polynomial shapes constrained to satisfy nodal information. The accuracy of the method has been tested by performing several numerical benchmark calculations and by comparing predicted local burnups to values measured for experimental assemblies in EBR-11. The results indicate that the reconstruction methods are quite accurate, yielding maximum errors in power and nuclide densities that are less than 2% for driver assemblies and typically less than 5% for blanket assemblies. 14 refs., 2 figs., 5 tabs
Experimental Breeder Reactor I Preservation Plan
Energy Technology Data Exchange (ETDEWEB)
Julie Braun
2006-10-01
Experimental Breeder Reactor I (EBR I) is a National Historic Landmark located at the Idaho National Laboratory, a Department of Energy laboratory in southeastern Idaho. The facility is significant for its association and contributions to the development of nuclear reactor testing and development. This Plan includes a structural assessment of the interior and exterior of the EBR I Reactor Building from a preservation, rather than an engineering stand point and recommendations for maintenance to ensure its continued protection.
Efficacy and safety of elbasvir/grazoprevir and sofosbuvir/pegylated interferon/ribavirin
DEFF Research Database (Denmark)
Sperl, Jan; Horvath, Gabor; Halota, Waldemar
2016-01-01
daily (n=129) or sofosbuvir (400mg once daily) plus PR (n=128). Primary efficacy objective was sustained virologic response 12weeks after the end of therapy (SVR12, HCV RNA tier 1 safety event. RESULTS: The majority...... the lower bound of the 1-sided 1-sample exact test was greater than -10% and greater than zero, both non-inferiority and superiority of EBR/GZR vs. SOF/PR were established. The frequency of tier 1 safety events was lower among patients receiving EBR/GZR than SOF/PR (0.8% vs. 27.8%, between group difference...... pegylated interferon/ribavirin (SOF/PR) in patients with HCV infection. METHODS: This was a randomized, open-label, phase III trial. Two hundred fifty-seven patients with HCV genotype (GT)1 or 4 infection and baseline viral load >10,000IU/ml were randomized to receive 12weeks of EBR/GZR 50mg/100mg once...
Development of a physical 3D anthropomorphic breast phantom
Energy Technology Data Exchange (ETDEWEB)
Carton, Ann-Katherine; Bakic, Predrag; Ullberg, Christer; Derand, Helen; Maidment, Andrew D. A. [Department of Radiology, University of Pennsylvania, 1 Silverstein Building, 3400 Spruce Street, Philadelphia, Pennsylvania 19104-4206 (United States); XCounter AB, Svaerdvaegen 11, SE-182 33 Danderyd (Sweden); Department of Radiology, University of Pennsylvania, 1 Silverstein Building, 3400 Spruce Street, Philadelphia, Pennsylvania 19104-4206 (United States)
2011-02-15
Purpose: Develop a technique to fabricate a 3D anthropomorphic breast phantom with known ground truth for image quality assessment of 2D and 3D breast x-ray imaging systems. Methods: The phantom design is based on an existing computer model that can generate breast voxel phantoms of varying composition, size, and shape. The physical phantom is produced in two steps. First, the portion of the voxel phantom consisting of the glandular tissue, skin, and Cooper's ligaments is separated into sections. These sections are then fabricated by high-resolution rapid prototyping using a single material with 50% glandular equivalence. The remaining adipose compartments are then filled using an epoxy-based resin (EBR) with 100% adipose equivalence. The phantom sections are stacked to form the physical anthropomorphic phantom. Results: The authors fabricated a prototype phantom corresponding to a 450 ml breast with 45% dense tissue, deformed to a 5 cm compressed thickness. Both the rapid prototype (RP) and EBR phantom materials are radiographically uniform. The coefficient of variation (CoV) of the relative attenuation between RP and EBR phantom samples was <1% and the CoV of the signal intensity within RP and EBR phantom samples was <1.5% on average. Digital mammography and reconstructed digital breast tomosynthesis images of the authors' phantom were reviewed by two radiologists; they reported that the images are similar in appearance to clinical images, noting there are still artifacts from air bubbles in the EBR. Conclusions: The authors have developed a technique to produce 3D anthropomorphic breast phantoms with known ground truth, yielding highly realistic x-ray images. Such phantoms may serve both qualitative and quantitative performance assessments for 2D and 3D breast x-ray imaging systems.
International Nuclear Information System (INIS)
Suchetha Kumari, N.; Madhu, L.N.
2012-01-01
Protection of biological systems against radiation damage is of paramount importance during accidental and unavoidable exposure to radiation. Several physico-chemical and biological factors collectively contribute to the damage caused by radiation and are, therefore, targets for developing radioprotectors. Chemicals capable of scavenging free radicals, relieving oxidative stress, promoting antioxidant activity and modulating immune response have been some of the radioprotectors extensively investigated with limited success. It has long been known that some of the most effective radioprotective agents are those which contain sulphydryl groups. The present study reports an evaluation of radical scavenging property and radioprotective property of sulphydryl group containing triazole derivative. The lethal dose of Electron beam radiation (EBR) was studied by survival assay. The dose reduction factor (DRF) of 4-amino-5-mercapto-3-methyl-1,2,4-triazole (TR1) was calculated by taking the ratio between LD 50 of EBR with and without TR1 treatment. Radical scavenging property of TR1 was assessed by DPPH radical scavenging assay. The clastogenic effects of EBR were recorded by Micronucleus test in bone marrow cells and DNA fragmentation assay in hepatic cells of mice. The survival assay results showed that 10Gy was the LD 50 of EBR. The calculated DRF for TR1 was found to be 1.2. DPPH radical scavenging assay showed a positive result when it compared with the standard glutathione. Treatment of mice with 100 mg of TR1 for 15 days before irradiation significantly (P<0.05) reduced the frequency of micronucleus formation in bone marrow cells and also reduced the DNA fragmentation in hepatic cells. The result obtained in the present study concludes that TR1 has a protective effect against the EBR-induced mortality and clastogenicity. (author)
IFR fuel cycle--pyroprocess development
International Nuclear Information System (INIS)
Laidler, J.J.; Miller, W.E.; Johnson, T.R.; Ackerman, J.P.; Battles, J.E.
1992-01-01
The Integral Fast Reactor (IFR) fuel cycle is based on the use of a metallic fuel alloy, with nominal composition U-2OPu-lOZr. In its present state of development, this fuel system offers excellent high-burnup capabilities. Test fuel has been carried to burnups in excess of 20 atom % in EBR-II irradiations, and to peak burnups over 15 atom % in FFTF. The metallic fuel possesses physical characteristics, in particular very high thermal conductivity, that facilitate a high degree of passive inherent safety in the IFR design. The fuel has been shown to provide very large margins to failure in overpower transient events. Rapid overpower transient tests carried out in the TREAT reactor have shown the capability to withstand up to 400% overpower conditions before failing. An operational transient test conducted in EBR-II at a power ramp rate of 0.1% per second reached its termination point of 130% of normal power without any fuel failures. The IFR metallic fuel also exhibits superior compatibility with the liquid sodium coolant. Equally as important as the performance advantages offered by the use of metallic fuel is the fact that this fuel system permits the use of an innovative reprocessing method, known as ''pyroprocessing,'' featuring fused-salt electrorefining of the spent fuel. Development of the IFR pyroprocess has been underway at the Argonne National Laboratory for over five years, and great progress has been made toward establishing a commercially-viable process. Pyroprocessing offers a simple, compact means for closure of the fuel cycle, with anticipated significant savings in fuel cycle costs
GAMSOR: Gamma Source Preparation and DIF3D Flux Solution
Energy Technology Data Exchange (ETDEWEB)
Smith, M. A. [TerraPower, Bellevue, WA (United States); Lee, C. H. [TerraPower, Bellevue, WA (United States); Hill, R. N. [TerraPower, Bellevue, WA (United States)
2017-06-28
Nuclear reactors that rely upon the fission reaction have two modes of thermal energy deposition in the reactor system: neutron absorption and gamma absorption. The gamma rays are typically generated by neutron capture reactions or during the fission process which means the primary driver of energy production is of course the neutron interaction. In conventional reactor physics methods, the gamma heating component is ignored such that the gamma absorption is forced to occur at the gamma emission site. For experimental reactor systems like EBR-II and FFTF, the placement of structural pins and assemblies internal to the core leads to problems with power heating predictions because there is no fission power source internal to the assembly to dictate a spatial distribution of the power. As part of the EBR-II support work in the 1980s, the GAMSOR code was developed to assist analysts in calculating the gamma heating. The GAMSOR code is a modified version of DIF3D and actually functions within a sequence of DIF3D calculations. The gamma flux in a conventional fission reactor system does not perturb the neutron flux and thus the gamma flux calculation can be cast as a fixed source problem given a solution to the steady state neutron flux equation. This leads to a sequence of DIF3D calculations, called the GAMSOR sequence, which involves solving the neutron flux, then the gamma flux, and then combining the results to do a summary edit. In this manuscript, we go over the GAMSOR code and detail how it is put together and functions. We also discuss how to setup the GAMSOR sequence and input for each DIF3D calculation in the GAMSOR sequence.
Publications | Page 694 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Memoria del taller : la perspectiva de género en el trabajo de investigación del ... Agua y Saneamiento de Honduras : su dinámica y organización : reflexiones del ... las localidades en estudio : informe de trabajo de campo (restricted access) ...
Directory of Open Access Journals (Sweden)
Vukašinović Ivana Ž.
2014-01-01
Full Text Available The study of spatial distribution of activity concentration of 238U, 226Ra, 210Pb, 232Th, 40K, and 137Cs radionuclides in the surface soil samples (n = 42 collected in the vicinity of four coal-fired power plants in Serbia is presented. Radioactivity measurements in soils performed by gamma-ray spectrometry showed values [Bqkg-1] in the range: 15-117 for 238U, 21-115 for 226Ra, 33-65 for 210Pb, 20-69 for 232Th, 324-736 for 40K, and 2-59 for 137Cs. Surface soil radio-activity that could have resulted from deposition of radionuclides from airborne discharges or resuspension of ash from disposal sites showed no enhanced levels. It was found that variation of soil textural properties, pH values, and carbonate content influenced activity levels of natural radionuclides while radiocesium activities were associated with soil organic matter content. Modification of some soil properties was observed in the immediate vicinity (<1 km of power plants where the soil was more alkaline with coarser particles (0.2-0.05 mm and carbonates accumulated. Calculated average values of the absorbed gamma dose rate and annual external effective dose originating from the terrestrial radionuclides were 69.4 nGy/h and 0.085 mSv, respectively. [Projekat Ministarstva nauke Republike Srbije, br. 4007: Studying climate change and its influence on the environment: impacts, adaptation and mitigation
Electrometallurgical treatment of aluminum-matrix fuels
International Nuclear Information System (INIS)
Willit, J.L.; Gay, E.C.; Miller, W.E.; McPheeters, C.C.; Laidler, J.J.
1996-01-01
The electrometallurgical treatment process described in this paper builds on our experience in treating spent fuel from the Experimental Breeder Reactor (EBR-II). The work is also to some degree, a spin-off from applying electrometallurgical treatment to spent fuel from the Hanford single pass reactors (SPRs) and fuel and flush salt from the Molten Salt Reactor Experiment (MSRE) in treating EBR-II fuel, we recover the actinides from a uranium-zirconium fuel by electrorefining the uranium out of the chopped fuel. With SPR fuel, uranium is electrorefined out of the aluminum cladding. Both of these processes are conducted in a LiCl-KCl molten-salt electrolyte. In the case of the MSRE, which used a fluoride salt-based fuel, uranium in this salt is recovered through a series of electrochemical reductions. Recovering high-purity uranium from an aluminum-matrix fuel is more challenging than treating SPR or EBR-II fuel because the aluminum- matrix fuel is typically -90% (volume basis) aluminum
Directory of Open Access Journals (Sweden)
Mikael A Kowal
Full Text Available Chronic cannabis use has been shown to block long-term depression of GABA-glutamate synapses in the striatum, which is likely to reduce the extent to which endogenous cannabinoids modulate GABA- and glutamate-related neuronal activity. The current study aimed at investigating the effect of this process on striatal dopamine levels by studying the spontaneous eye blink rate (EBR, a clinical marker of dopamine level in the striatum. 25 adult regular cannabis users and 25 non-user controls matched for age, gender, race, and IQ were compared. Results show a significant reduction in EBR in chronic users as compared to non-users, suggesting an indirect detrimental effect of chronic cannabis use on striatal dopaminergic functioning. Additionally, EBR correlated negatively with years of cannabis exposure, monthly peak cannabis consumption, and lifetime cannabis consumption, pointing to a relationship between the degree of impairment of striatal dopaminergic transmission and cannabis consumption history.
International Nuclear Information System (INIS)
Meshkati, N.; Buller, B.J.; Azadeh, M.A.
1995-01-01
The goal of this research is threefold: (1) use of the Skill-, Rule-, and Knowledge-based levels of cognitive control -- the SRK framework -- to develop an integrated information processing conceptual framework (for integration of workstation, job, and team design); (2) to evaluate the user interface component of this framework -- the Ecological display; and (3) to analyze the effect of operators' individual information processing behavior and decision styles on handling plant disturbances plus their performance on, and preference for, Traditional and Ecological user interfaces. A series of studies were conducted. In Part I, a computer simulation model and a mathematical model were developed. In Part II, an experiment was designed and conducted at the EBR-II plant of the Argonne National Laboratory-West in Idaho Falls, Idaho. It is concluded that: the integrated SRK-based information processing model for control room operations is superior to the conventional rule-based model; operators' individual decision styles and the combination of their styles play a significant role in effective handling of nuclear power plant disturbances; use of the Ecological interface results in significantly more accurate event diagnosis and recall of various plant parameters, faster response to plant transients, and higher ratings of subject preference; and operators' decision styles affect on both their performance and preference for the Ecological interface
Energy Technology Data Exchange (ETDEWEB)
Meshkati, N.; Buller, B.J.; Azadeh, M.A. [Univ. of Southern California, Los Angeles, CA (United States)
1995-04-01
The goal of this research is threefold: (1) use of the Skill-, Rule-, and Knowledge-based levels of cognitive control -- the SRK framework -- to develop an integrated information processing conceptual framework (for integration of workstation, job, and team design); (2) to evaluate the user interface component of this framework -- the Ecological display; and (3) to analyze the effect of operators` individual information processing behavior and decision styles on handling plant disturbances plus their performance on, and preference for, Traditional and Ecological user interfaces. A series of studies were conducted. In Part I, a computer simulation model and a mathematical model were developed. In Part II, an experiment was designed and conducted at the EBR-II plant of the Argonne National Laboratory-West in Idaho Falls, Idaho. It is concluded that: the integrated SRK-based information processing model for control room operations is superior to the conventional rule-based model; operators` individual decision styles and the combination of their styles play a significant role in effective handling of nuclear power plant disturbances; use of the Ecological interface results in significantly more accurate event diagnosis and recall of various plant parameters, faster response to plant transients, and higher ratings of subject preference; and operators` decision styles affect on both their performance and preference for the Ecological interface.
Modeling of constituent redistribution in U-Pu-Zr metallic fuel
Energy Technology Data Exchange (ETDEWEB)
Kim, Yeon Soo [Argonne National Laboratory, Nuclear Engineering, RERTR, 9700 South Cass Avenue, Argonne, IL 60439 (United States)]. E-mail: yskim@anl.gov; Hayes, S.L. [Idaho National Laboratory, P.O. Box 1625, Idaho Falls, ID 83415-6188 (United States); Hofman, G.L. [Argonne National Laboratory, Nuclear Engineering, RERTR, 9700 South Cass Avenue, Argonne, IL 60439 (United States); Yacout, A.M. [Argonne National Laboratory, Nuclear Engineering, RERTR, 9700 South Cass Avenue, Argonne, IL 60439 (United States)
2006-12-01
A computer model was developed to analyze constituent redistribution in U-Pu-Zr metallic nuclear fuels. Diffusion and thermochemical properties were parametrically determined to fit the postirradiation data from a fuel test performed in the Experimental Breeder Reactor II (EBR-II). The computer model was used to estimate redistribution profiles of fuels proposed for the conceptual designs of small modular fast reactors. The model results showed that the level of redistribution of the fuel constituents of the designs was similar to the measured data from EBR-II.
Space reactor/organic Rankine conversion - A near-term state-of-the-art solution
Niggemann, R. E.; Lacey, D.
The use of demonstrated reactor technology with organic Rankine cycle (ORC) power conversion can provide a low cost, minimal risk approach to reactor-powered electrical generation systems in the near term. Several reactor technologies, including zirconium hydride, EBR-II and LMFBR, have demonstrated long life and suitability for space application at the operating temperature required by an efficient ORC engine. While this approach would not replace the high temperature space reactor systems presently under development, it could be available in a nearer time frame at a low and predictable cost, allowing some missions requiring high power levels to be flown prior to the availability of advanced systems with lower specific mass. Although this system has relatively high efficiency, the heat rejection temperature is low, requiring a large radiator on the order of 3.4 sq m/kWe. Therefore, a deployable heat pipe radiator configuration will be required.
International Nuclear Information System (INIS)
Beakes, J.H.; Ehman, J.R.; Jones, H.M.; Kinne, B.V.T.; Price, C.M.; Shores, S.P.; Welch, J.K.
1981-09-01
Prototype Large Breeder Reactor (PLBR) designs were reviewed by personnel with extensive power plant operations experience. Fourteen normal and off-normal events, such as startup, shutdown, refueling, reactor scram and loss of feedwater, were evaluated using an operational evaluation methodology which is designed to facilitate talk-through sessions on operational events. Human factors engineers participated in the review and assisted in developing and refining the review methodologies. Operating experience at breeder reactor facilities such as Experimental Breeder Reactor-II (EBR-II), Enrico Fermi Atomic Power Plant - Unit 1, and the Fast Flux Test Facility (FFTF) was gathered, analyzed, and used to determine whether lessons learned from operational experience had been incorporated into the PLBR designs. This eighteen month effort resulted in approximately one hundred specific recommendations for improving the operability of PLBR designs
Evidence-based radiology: why and how?
International Nuclear Information System (INIS)
Sardanelli, Francesco; Di Leo, Giovanni; Hunink, Myriam G.; Gilbert, Fiona J.; Krestin, Gabriel P.
2010-01-01
To provide an overview of evidence-based medicine (EBM) in relation to radiology and to define a policy for adoption of this principle in the European radiological community. Starting from Sackett's definition of EBM we illustrate the top-down and bottom-up approaches to EBM as well as EBM's limitations. Delayed diffusion and peculiar features of evidence-based radiology (EBR) are defined with emphasis on the need to shift from the demonstration of the increasing ability to see more and better, to the demonstration of a significant change in treatment planning or, at best, of a significant gain in patient outcome. The ''as low as reasonably achievable'' (ALARA) principle is thought as a dimension of EBR while EBR is proposed as part of the core curriculum of radiology residency. Moreover, we describe the process of health technology assessment in radiology with reference to the six-level scale of hierarchy of studies on diagnostic tests, the main sources of bias in studies on diagnostic performance, and levels of evidence and degrees of recommendations according to the Centre for Evidence-Based Medicine (Oxford, UK) as well as the approach proposed by the GRADE working group. Problems and opportunities offered by evidence-based guidelines in radiology are considered. Finally, we suggest nine points to be actioned by the ESR in order to promote EBR. Radiology will benefit greatly from the improvement in practice that will result from adopting this more rigorous approach to all aspects of our work. (orig.)
Actinide consumption: Nuclear resource conservation without breeding
Energy Technology Data Exchange (ETDEWEB)
Hannum, W.H.; Battles, J.E.; Johnson, T.R.; McPheeters, C.C.
1991-01-01
A new approach to the nuclear power issue based on a metallic fast reactor fuel and pyrometallurgical processing of spent fuel is showing great potential and is approaching a critical demonstration phase. If successful, this approach will complement and validate the LWR reactor systems and the attendant infrastructure (including repository development) and will alleviate the dominant concerns over the acceptability of nuclear power. The Integral Fast Reactor (IFR) concept is a metal-fueled, sodium-cooled pool-type fast reactor supported by a pyrometallurgical reprocessing system. The concept of a sodium cooled fast reactor is broadly demonstrated by the EBR-II and FFTF in the US; DFR and PFR in the UK; Phenix and SuperPhenix in France; BOR-60, BN-350, BN-600 in the USSR; and JOYO in Japan. The metallic fuel is an evolution from early EBR-II fuels. This fuel, a ternary U-Pu-Zr alloy, has been demonstrated to be highly reliable and fault tolerant even at very high burnup (160-180,000 MWd/MT). The fuel, coupled with the pool type reactor configuration, has been shown to have outstanding safety characteristics: even with all active safety systems disabled, such a reactor can survive a loss of coolant flow, a loss of heat sink, or other major accidents. Design studies based on a small modular approach show not only its impressive safety characteristics, but are projected to be economically competitive. The program to explore the feasibility of actinide recovery from spent LWR fuel is in its initial phase, but it is expected that technical feasibility could be demonstrated by about 1995; DOE has not yet committed funds to achieve this objective. 27 refs.
Actinide consumption: Nuclear resource conservation without breeding
International Nuclear Information System (INIS)
Hannum, W.H.; Battles, J.E.; Johnson, T.R.; McPheeters, C.C.
1991-01-01
A new approach to the nuclear power issue based on a metallic fast reactor fuel and pyrometallurgical processing of spent fuel is showing great potential and is approaching a critical demonstration phase. If successful, this approach will complement and validate the LWR reactor systems and the attendant infrastructure (including repository development) and will alleviate the dominant concerns over the acceptability of nuclear power. The Integral Fast Reactor (IFR) concept is a metal-fueled, sodium-cooled pool-type fast reactor supported by a pyrometallurgical reprocessing system. The concept of a sodium cooled fast reactor is broadly demonstrated by the EBR-II and FFTF in the US; DFR and PFR in the UK; Phenix and SuperPhenix in France; BOR-60, BN-350, BN-600 in the USSR; and JOYO in Japan. The metallic fuel is an evolution from early EBR-II fuels. This fuel, a ternary U-Pu-Zr alloy, has been demonstrated to be highly reliable and fault tolerant even at very high burnup (160-180,000 MWd/MT). The fuel, coupled with the pool type reactor configuration, has been shown to have outstanding safety characteristics: even with all active safety systems disabled, such a reactor can survive a loss of coolant flow, a loss of heat sink, or other major accidents. Design studies based on a small modular approach show not only its impressive safety characteristics, but are projected to be economically competitive. The program to explore the feasibility of actinide recovery from spent LWR fuel is in its initial phase, but it is expected that technical feasibility could be demonstrated by about 1995; DOE has not yet committed funds to achieve this objective. 27 refs
Status of gamma-ray heating characterization in LMFBR
International Nuclear Information System (INIS)
Gold, R.
1975-11-01
Efforts to define gamma-ray heating in Liquid Metal Fast Breeder Reactor (LMFBR) environments have been surveyed. Emphasis is placed on both current practice for the Experimental Breeder Reactor-II (EBR-II) and future needs of the Fast Flux Test Facility (FFTF). Experimental and theoretical work are included in this preliminary survey for both high and low power environments. Current ''state-of-the-art'' accuracies and limitations are assessed. On this basis, it is concluded that a broad and sustained effort be initiated to meet requested FFTF goal accuracies. To this end, recommendations are advanced for improving the current status of gamma heating characterization and temperature measurements in LMFBR
INL Cultural Resource Monitoring Report for FY 2015
Energy Technology Data Exchange (ETDEWEB)
Pace, Brenda Ringe [Idaho National Lab. (INL), Idaho Falls, ID (United States); Olson, Christina Liegh [Idaho National Lab. (INL), Idaho Falls, ID (United States); Gilbert, Hollie Kae [Idaho National Lab. (INL), Idaho Falls, ID (United States); Holmer, Marie Pilkington [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2015-10-01
This report describes the cultural resource monitoring activities of the Idaho National Laboratory’s (INL) Cultural Resource Management (CRM) Office during fiscal year (FY) 2015. Throughout the year, 67 total monitoring visits were completed, with several especially sensitive resources visited on more than one occasion. Overall, FY 2015 monitoring included surveillance of the following 49 individual cultural resource localities: three locations with human remains, one of which is also a cave; nine additional caves; twenty prehistoric archaeological sites; five historic archaeological sites; two historic trails; Experimental Breeder Reactor I (EBR-I), a National Historic Landmark; Aircraft Nuclear Propulsion (ANP) objects located at EBR-I; and eight Arco Naval Proving Ground (NPG) property types. Several INL work processes and projects were also monitored to confirm compliance with original INL CRM recommendations and assess the effects of ongoing work. On two occasions, ground disturbing activities within the boundaries of the Power Burst Facility/Critical Infrastructure Test Range Complex (PBF/CITRC) were observed by INL CRM staff prepared to respond to any additional finds of Native American human remains. Finally, the current location housing INL Archives and Special Collections was evaluated once. Most of the cultural resources monitored in FY 2015 exhibited no adverse impacts, resulting in Type 1 impact assessments. However, Type 2 impacts were noted 13 times. In one case, a portion of a historic trail was graded without prior review or coordination with the INL CRM Office, resulting in impacts to the surface of the trail and one archaeological site. Evidence of unauthorized artifact collection/ looting was also documented at three archaeological sites located along INL powerlines. Federal agents concluded a FY 2012 investigation by filing civil charges and levying fine under the Archaeological Resource Protection Act against one INL employee for this kind
International Nuclear Information System (INIS)
1997-01-01
The article 27 of Marco's legal Regulatory for the National Electric System it prohibits the use of Nuclear Energy in the territory of the Oriental Republic of the Uruguay and it could not to carry out contracts of electric power supply with nuclear generators neither with foreign generators whose plants contaminate the national territory [es
Proposed fuel cycle for the Integral Fast Reactor
International Nuclear Information System (INIS)
Burris, L.; Walters, L.C.
1985-01-01
One of the key features of ANL's Integral Fast Reactor (IFR) concept is a close-coupled fuel cycle. The proposed fuel cycle is similar to that demonstrated over the first five to six years of operation of EBR-II, when a fuel cycle facility adjacent to EBR-II was operated to reprocess and refabricate rapidly fuel discharged from the EBR-II. Locating the IFR and its fuel cycle facility on the same site makes the IFR a self-contained system. Because the reactor fuel and the uranium blanket are metals, pyrometallurgical processes (shortned to ''pyroprocesses'') have been chosen. The objectives of the IFR processes for the reactor fuel and blanket materials are to (1) recover fissionable materials in high yield; (2) remove fission products adequately from the reactor fuel, e.g., a decontamination factor of 10 to 100; and (3) upgrade the concentration of plutonium in uranium sufficiently to replenish the fissile-material content of the reactor fuel. After the fuel has been reconstituted, new fuel elements will be fabricated for recycle to the reactor
A state of the art on metallic fuel technology development
International Nuclear Information System (INIS)
Hwang, Woan; Kang, Hee Young; Nam, Cheol; Kim, Jong Oh
1997-01-01
Since worldwide interest turned toward ceramic fuels before the full potential of metallic fuel could be achieved in the late 1960's, the development of metallic fuels continued throughout the 1970's at ANL's experimental breeder reactor II (EBR-II) because EBR-II continued to be fueled with the metallic uranium-fissium alloy, U-5Fs. During this decade the performance limitations of metallic fuel were satisfactorily resolved resolved at EBR-II. The concept of the IFR developed at ANL since 1984. The technical feasibility had been demonstrated and the technology database had been established to support its practicality. One key features of the IFR is that the fuel is metallic, which brings pronounced benefits over oxide in improved inherent safety and lower processing costs. At the outset of the 1980's, it appeared that metallic fuels are recognized as a professed viable option with regard to safety, integral fuel cycle, waste minimization and deployment economics. This paper reviews the key advances in the last score and summarizes the state-of the art on metallic fuel technology development. (author). 29 refs., 1 tab
Experimental and design experience with passive safety features of liquid metal reactors
International Nuclear Information System (INIS)
Lucoff, D.M.; Waltar, A.E.; Sackett, J.I.; Salvatores, M.; Aizawa, K.
1992-10-01
Liquid metal cooled reactors (LMRs) have already been demonstrated to be robust machines. Many reactor designers now believe that it is possible to include in this technology sufficient passive safety that LMRs would be able to survive loss of flow, loss of heat sink, and transient overpower events, even if the plant protective system fails completely and do so without damage to the core. Early whole-core testing in Rapsodie, EBR-II. and FFTF indicate such designs may be possible. The operational safety testing program in EBR-II is demonstrating benign response of the reactor to a full range of controls failures. But additional testing is needed if transient core structural response under major accident conditions is to be properly understood. The proposed international Phase IIB passive safety tests in FFTF, being designed with a particular emphasis on providing, data to understand core bowing extremes, and further tests planned in EBR-11 with processed IFR fuel should provide a substantial and unique database for validating the computer codes being used to simulate postulated accident conditions
International Nuclear Information System (INIS)
Chavez, C.; Edwards, R.M.; Goldberg, J.H.
1993-01-01
New CRT-based information displays which enhance the human machine interface are playing a very important role and are being increasingly used in control rooms since they present a higher degree of flexibility compared to conventional hardwired instrumentation. To prototype a new console configuration and information display system at the Experimental Breeder Reactor II (EBR-II), an iterative process of console simulation and evaluation involving operations personnel is being pursued. Entire panels including selector switches and information displays are simulated and driven by plant dynamical simulations with realistic responses that reproduce the actual cognitive and physical environment. Careful analysis and formal evaluation of operator interaction while using the simulated console will be conducted to determine underlying principles for effective control console design for this particular group of operation personnel. Additional iterations of design, simulation, and evaluation will then be conducted as necessary
Quod fidei plenitudine fines semper Spaniae floruerunt… Egica and the Jews
Directory of Open Access Journals (Sweden)
Chernina, Liubov
2009-06-01
Full Text Available The article deals with the last stage of the anti-Jewish policies of the Visigoth kings. It analyses the reasons for the thrust of power plays moving from the stimulation of conversion to the enforcing and realization of royal policies, especially in the economic sphere, 693-694. It argues a connection between the king’s decision to enslave all Jews and his permanent fear of conspiracies.El artículo describe la última etapa en el desarrollo de la política antijudía de los reyes visigodos. Se han sido analizado las razones del tránsito en 693-694 por parte del poder real de una política de estimulación de conversiones de judíos a una toma de decisiones, sobre todo en la esfera económica. Se plantea un enlace entre la decisión del rey acerca de la esclavización de todos los judíos y sus temores permanentes de conspiraciones.
Coignard-Biehler, H; Rapp, C; Chapplain, J M; Hoen, B; Che, D; Berthelot, P; Cazenave-Roblot, F; Rabaud, C; Brouqui, P; Leport, C
2018-03-01
In 2012, the French Infectious Diseases Society (French acronym SPILF) initiated the "Coordination of epidemic and biological risk" (SPILF-COREB - Emergences [SCE]) group to support the readiness and response of healthcare workers (HCWs) to new alerts. To present the SCE group, its functioning, and the main support it provided for frontline HCWs. A multidisciplinary group of heads of infectious disease departments from reference hospitals was created to build a network of clinical expertise for care, training, and research in the field of epidemic and biological risk (EBR). The network developed a set of standardized operational procedures (SOPs) to guide interventions to manage EBR-suspect patients. A working group created the SOP aimed at frontline HCWs taking care of patients. Priority was given to the development of a generic procedure, which was then adapted according to the current alert. Five key steps were identified and hierarchized: detecting, protecting, caring for, alerting, and referring the EBR patient. The interaction between clinicians and those responsible for the protection of the community was crucial. The SOPs validated by the SPILF and its affiliates were disseminated to a wide range of key stakeholders through various media including workshops and the SPILF's website. SPILF can easily adapt and timely mobilize the EBR expertise in case of an alert. The present work suggests that sharing and discussing this experience, initiated at the European level, can generate a new collective expertise and needs to be further developed and strengthened. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
The present status of the fast breeder reactor industrialization in western Europe
International Nuclear Information System (INIS)
Dievoet, J.P. van
1987-01-01
The development of the liquid metal fast breeder reactor in Europe started in the mid-fifties, after the successful operation of EBR-1 at ARCO, Idaho, in 1951. A more and more integrated development among the countries of the European Community culminated in 1986 with the beginning to power of the 1200 MWe SUPERPHENIX plant at Creys-Malville, France. The road is now open towards the full industrialization of the liquid metal fast breeder reactor at the moment, in 2005, when the first European thermal neutron power reactor station will have to be decommissioned and replaced. The European programme aims at providing the utilities at that time with a clear choice between thermal neutron reactors and fast breeder reactors, both economical but very different in their use of the limited natural resource that uranium is. (author)
Herpetofauna Surveys, Northern California - 2010 [ds694
California Natural Resource Agency — We recorded all incidental herpetofauna encountered during visual encounter and dipnet surveys in northern California. Surveys took place from April 2, 2010 to...
Performance of fast reactor mixed-oxide fuels pins during extended overpower transients
International Nuclear Information System (INIS)
Tsai, H.; Neimark, L.A.; Asaga, T.; Shikakura, S.
1991-02-01
The Operational Reliability Testing (ORT) program, a collaborative effort between the US Department of Energy and the Power Reactor and Nuclear Fuel Development Corp. (PNC) of Japan, was initiated in 1982 to investigate the behavior of mixed-oxide fuel pin under various slow-ramp transient and duty-cycle conditions. In the first phase of the program, a series of four extended overpower transient tests, with severity sufficient to challenge the pin cladding integrity, was conducted. The objectives of the designated TOPI-1A through -1D tests were to establish the cladding breaching threshold and mechanisms, and investigate the thermal and mechanical effects of the transient on pin behavior. The tests were conducted in EBR-2, a normally steady-state reactor. The modes of transient operation in EBR-2 were described in a previous paper. Two ramp rates, 0.1%/s and 10%/s, were selected to provide a comparison of ramp-rate effects on fuel behavior. The test pins chosen for the series covered a range of design and pre-test irradiation parameters. In the first test (1A), all pins maintained their cladding integrity during the 0.1%/s ramp to 60% peak overpower. Fuel pins with aggressive designs, i.e., high fuel- smear density and/or thin cladding, were, therefore, included in the follow-up 1B and 1C tests to enhance the likelihood of achieving cladding breaching. In the meantime, a higher pin overpower capability, to greater than 100%, was established by increasing the reactor power limit from 62.5 to 75 MWt. In this paper, the significant results of the 1B and 1C tests are presented. 4 refs., 5 figs., 1 tab
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-03-01
With an objective to propose large-size system development scenarios assuming installations in deserts, the following investigations have been carried out: (1) collection of data on societies, economy, and energies in China and other countries where the large systems are assumed to be installed, (2) in order to reduce the costs, comparison was given on power generation cost by using a fixed tracking frame, a single axial tracking frame, and a biaxial tracking frame, (3) in order to evaluate the life cycle, discussions were given on the required energy inputs for system equipment, transmission and transformer equipment, and the installation construction to estimate the energy payback time (EPT) and CO2 emission unit requirement, and (4) discussions on development scenarios. In Item (1), while China expects on natural gas and atomic energy as the supply source, 80% of the energy would be supplied from coal in 2010. The development of new energies in India would further be delayed than in China. In item (2), the trially calculated power generation costs in Mongol by using the fixed frame, single axial tracking frame, and biaxial tracking frame were 8.72, 8.23 and 6.94 yen per watt. In Item (3) The EPT was two years or less in a 100-MW system, and the CO2 emission unit requirements in the silicon systems were 10 to 19 kg-C/kWh. (NEDO)
Integrating the fuel cycle at IFR [Integral Fast Reactor
International Nuclear Information System (INIS)
Till, C.E.; Chang, Y.I.
1992-01-01
During the past few years Argonne National Laboratory has been developing the Integral Fast Reactor (IFR), an advanced liquid metal reactor. Much of the IFR technology stems from Argonne National Laboratory's experience with the Experimental Breeder Reactors, EBR 1 and 2. The unique aspect of EBR 2 is its success with high-burnup metallic fuel. Irradiation tests of the new U-Pu-Zr fuel for the IFR have now reached a burnup level of 20%. The results to date have demonstrated excellent performance characteristics of the metallic fuel in both steady-state and off-normal operating conditions. EBR 2 is now fully loaded with the IFR fuel alloys and fuel performance data are being generated. In turn, metallic fuel becomes the key factor in achieving a high degree of passive safety in the IFR. These characteristics were demonstrated dramatically by two landmark tests conducted at EBR 2 in 1986: loss of flow without scram; and loss of heat sink without scram. They demonstrated that the combination of high heat conductivity of metallic fuel and thermal inertia of the large sodium pool can shut the reactor down during potentially severe accidents without depending on human intervention or the operation of active engineered components. The IFR metallic fuel is also the key factor in compact pyroprocessing. Pyroprocessing uses high temperatures, molten salt and metal solvents to process metal fuels. The result is suitable for fabrication into new fuel elements. Feasibility studies are to be conducted into the recycling of actinides from light water reactor spent fuel in the IFR using the pyroprocessing approach to extract the actinides (author)
A state of the art on metallic fuel technology development
Energy Technology Data Exchange (ETDEWEB)
Hwang, Woan; Kang, Hee Young; Nam, Cheol; Kim, Jong Oh [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)
1997-12-31
Since worldwide interest turned toward ceramic fuels before the full potential of metallic fuel could be achieved in the late 1960`s, the development of metallic fuels continued throughout the 1970`s at ANL`s experimental breeder reactor II (EBR-II) because EBR-II continued to be fueled with the metallic uranium-fissium alloy, U-5Fs. During this decade the performance limitations of metallic fuel were satisfactorily resolved resolved at EBR-II. The concept of the IFR developed at ANL since 1984. The technical feasibility had been demonstrated and the technology database had been established to support its practicality. One key features of the IFR is that the fuel is metallic, which brings pronounced benefits over oxide in improved inherent safety and lower processing costs. At the outset of the 1980`s, it appeared that metallic fuels are recognized as a professed viable option with regard to safety, integral fuel cycle, waste minimization and deployment economics. This paper reviews the key advances in the last score and summarizes the state-of the art on metallic fuel technology development. (author). 29 refs., 1 tab.
Energy Technology Data Exchange (ETDEWEB)
Magoulas, V. E. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2017-07-28
Savannah River National Laboratory (SRNL) was requested to evaluate the potential to receive and process the Idaho National Laboratory (INL) uranium (U) recovered from the Experimental Breeder Reactor II (EBR-II) driver fuel through the Savannah River Site’s (SRS) H-Canyon as a way to disposition the material. INL recovers the uranium from the sodium bonded metallic fuel irradiated in the EBR-II reactor using an electrorefining process. There were two compositions of EBR-II driver fuel. The early generation fuel was U-5Fs, which consisted of 95% U metal alloyed with 5% noble metal elements “fissium” (2.5% molybdenum, 2.0% ruthenium, 0.3% rhodium, 0.1% palladium, and 0.1% zirconium), while the later generation was U-10Zr which was 90% U metal alloyed with 10% zirconium. A potential concern during the H-Canyon nitric acid dissolution process of the U metal containing zirconium (Zr) is the explosive behavior that has been reported for alloys of these materials. For this reason, this evaluation was focused on the ability to process the lower Zr content materials, the U-5Fs material.
SYSTEMATIC ANALYSIS OF PERSPECTIVE TRENDS IN ECOLOGICAL AND BIOLOGICAL STUDIES OF THE CASPIAN SEA
Directory of Open Access Journals (Sweden)
G. M. Abdurakhmanov
2016-01-01
Full Text Available RETRACTED ARTICLEAim. The main purpose of the ecological and biological research (EBR of the Caspian Sea is the information and technical support of decision-making to ensure the environmental management in the region taking into account the increase of anthropogenic impact and change in climatic conditions.Methods. As a basis, we have adopted the method of theoretical and mathematical generalization of a number of scientific papers and systematic analysis of the proposed solutions.Results. Analysis and mathematical processing of published literature sources has convincingly demonstrated the need for international cooperation to optimize the ecological and biological research. It has also confirmed the usefulness of the ecological and biological studies of the Caspian Sea in different directions, and the distribution of effort (cost between them requires coordinated management.Conclusion. It is shown that the data obtained by EBI have both rapid and long-term value. In the future, it is rational to develop suitable approaches to unified structuring of the EBR data, including their spatial and timing. An important task is to create a single interstate information space on the results of EBR using information and communication technologies.
GAMSOR: Gamma Source Preparation and DIF3D Flux Solution
Energy Technology Data Exchange (ETDEWEB)
Smith, M. A. [Argonne National Lab. (ANL), Argonne, IL (United States); Lee, C. H. [Argonne National Lab. (ANL), Argonne, IL (United States); Hill, R. N. [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-12-15
Nuclear reactors that rely upon the fission reaction have two modes of thermal energy deposition in the reactor system: neutron absorption and gamma absorption. The gamma rays are typically generated by neutron absorption reactions or during the fission process which means the primary driver of energy production is of course the neutron interaction. In conventional reactor physics methods, the gamma heating component is ignored such that the gamma absorption is forced to occur at the gamma emission site. For experimental reactor systems like EBR-II and FFTF, the placement of structural pins and assemblies internal to the core leads to problems with power heating predictions because there is no fission power source internal to the assembly to dictate a spatial distribution of the power. As part of the EBR-II support work in the 1980s, the GAMSOR code was developed to assist analysts in calculating the gamma heating. The GAMSOR code is a modified version of DIF3D and actually functions within a sequence of DIF3D calculations. The gamma flux in a conventional fission reactor system does not perturb the neutron flux and thus the gamma flux calculation can be cast as a fixed source problem given a solution to the steady state neutron flux equation. This leads to a sequence of DIF3D calculations, called the GAMSOR sequence, which involves solving the neutron flux, then the gamma flux, then combining the results to do a summary edit. In this manuscript, we go over the GAMSOR code and detail how it is put together and functions. We also discuss how to setup the GAMSOR sequence and input for each DIF3D calculation in the GAMSOR sequence. With the GAMSOR capability, users can take any valid steady state DIF3D calculation and compute the power distribution due to neutron and gamma heating. The MC2-3 code is the preferable companion code to use for generating neutron and gamma cross section data, but the GAMSOR code can accept cross section data from other sources. To further
Irradiation performance of metallic fuels
International Nuclear Information System (INIS)
Pahl, R.G.; Lahm, C.E.; Porter, D.L.; Batte, G.L.; Hofman, G.L.
1989-01-01
Argonne National Laboratory has been working for the past five years to develop and demonstrate the Integral Fast Reactor (IFR) concept. The concept involves a closed system for fast-reactor power generation and on-site fuel reprocessing, both designed specifically around the use of metallic fuel. The Experimental Breeder Reactor-II (EBR-II) has used metallic fuel for all of its 25-year life. In 1985, tests were begun to examine the irradiation performance of advanced-design metallic fuel systems based on U-Zr or U-Pu-Zr fuels. These tests have demonstrated the viable performance of these fuel systems to high burnup. The initial testing program will be described in this paper. 2 figs
Behavior of metallic fuel in treat transient overpower tests
International Nuclear Information System (INIS)
Bauer, T.H.; Wright, A.E.; Robinson, W.R.; Klickman, A.E.
1988-01-01
Results and analyses are reported for TREAT in-pile transient overpower tests of margin to cladding failure and pre-failure axial expansion of metallic fuel. In all cases the power rise was exponential on an 8 s period until either incipient or actual cladding failure was achieved. Test fuel included EBR-II driver fuel and ternary alloy, the reference fuel of the Intergral Fast Reactor concept. Test pin burnup spanned the widest range available. The nature of the observed cladding failure and resultant fuel dispersals is described. Simple models are presented which describe observed cladding failures and pre-failure axial expansions yet are general enough to apply to all metal fuel types
History of fast reactor development in U.S.A.-I
International Nuclear Information System (INIS)
Ninokata, Hisashi; Sasao, Nobuyki
2007-01-01
History and present state of fast reactor was reviewed in series. As a history of fast reactor development in U.S.A. - I, this third lecture presented the dawn of the fast reactor development in the USA. The first fast reactor was the Clementine reactor with plutonium fuels and mercury coolant. The LAMPRE-1 reactor was the first sodium cooled and molten plutonium reactor. Experimental breeder reactor (EBR-1) was the first reactor to produce electricity and four kinds of fuels were loaded. Zero-power reactors were constructed to conduct reactor physics experiments on fast reactors. Today there are renewed interests in fast reactors due to their ability to fission actinides and reduce radioactive wastes. (T. Tanaka)
Overview of gamma-ray energy deposition and spectra in fast reactor environments
International Nuclear Information System (INIS)
Gold, R.
1977-01-01
Efforts to define gamma-ray heating in Breeder Reactor (BR) environments are reviewed. This critique is restricted to programmatic activities in the United States, as best exemplified by current practice for the Experimental Breeder Reactor II (EBR-II). Future needs are also addressed in terms of requirements for the Fast Flux Test Facility (FFTF). Experimental efforts and theoretical analyses are surveyed for both high and low power environments. Special emphasis is placed on experimental techniques for calorimetry, temperature measurement, dosimetry and spectrometry. The relation between neutron and gamma-ray calculations is stressed with particular attention given to contrasting analytical techniques and basic nuclear data requirements. Wherever possible comparisons between theory and experiment are cited
Drive reinforcement neural networks for reactor control. Final report
International Nuclear Information System (INIS)
Williams, J.G.; Jouse, W.C.
1995-01-01
In view of the loss of the third year funding, the scope of the project goals has been revised. The revision in project scope no longer allows for the detailed modeling of the EBR-11 start-up task that was originally envisaged. The authors are continuing, however, to model the control of the rapid power ascent of the University of Arizona TRIGA reactor using a model-based controller and using a drive reinforcement neural network. These will be combined during the concluding period of the project into a hierarchical control architecture. In addition, the modeling of a PWR feedwater heater has continued, and an autonomous fault-tolerant software architecture for its control has been proposed
Calculation of displacement and helium production at the LAMPF irradiation facility
International Nuclear Information System (INIS)
Wechsler, M.S.; Davidson, D.R.; Sommer, W.F.; Greenwood, L.R.
1985-01-01
Differential and total displacement and helium-production rates are calculated for copper irradiated by spallation neutrons and 760-MeV protons at LAMPF. The calculations are performed using the SPECTOR and VNMTC computer codes, the latter being specially designed for spallation radiation-damage calculations. For comparison, similar SPECTER calculations are also described for irradiation of copper in the experimental breeder reactor (EBR-II) at the Argonne National Laboratory-West in Idaho, and in the rotating target neutron source (RTNS-II) at Lawrence Livermore Laboratory. The neutron energy spectra for LAMPF, EBR-II, and RTNS-II and the displacement and helium-production cross sections are shown
International Nuclear Information System (INIS)
Burris, L.; Steindler, M.; Miller, W.
1984-01-01
The pool-type Integral Fast Reactor (IFR) concept developed by Argonne National Laboratory includes on-site recycle of discharged core and blanket fuel materials. The process and fabrication steps will be demonstrated in the EBR-II Fuel Cycle Facility with IFR fuel irradiated in EBR-II and the Fast Flux Test Facility. The proposed process consists of two major steps: a halide slagging step and an electrorefining step. The fuel is maintained in the metallic form to yield directly a metal product sufficiently decontaminated to allow recycle to the reactor as new fuel. The process is further described and available information to support its feasibility is presented
International Nuclear Information System (INIS)
Burris, L.; Steindler, M.; Miller, W.
1984-01-01
The Integral Fast Reactor (IFR) concept developed by Argonne National Laboratory includes on-site recycle of discharged core and blanket fuel materials. The process and fabrication steps will be demonstrated in the EBR-II Fuel Cycle Facility with IFR fuel irradiated in EBR-II and the Fast Flux Test Facility. The proposed process consists of two major steps -- a halide slagging step and an electrorefining step. The fuel is maintained in the metallic form to yield directly a metal product sufficiently decontaminated to allow recycle to the reactor as new fuel. The process is further described and available information to support its feasibility is presented
Final report for the H3 transient overpower failure threshold experiment
International Nuclear Information System (INIS)
Wright, A.E.; Rothman, A.B.; Stahl, D.; Agrawal, A.K.; Deitrich, L.W.; Chen, S.S.
1975-06-01
Test H3 was the first transient overpower failure-threshold experiment in TREAT to use irradiated fuel and to employ a TREAT transient shaped to produce sample-temperature distributions typical of steady state prior to the overpower excursion. A seven-pin assembly was tested within the Mark-II TREAT sodium loop. The experiment was performed successfully with satisfactory TREAT power transient and loop performance, and demonstrated the capability of intermediate-power EBR-II-irradiated fuel at low burnup (no central void) to withstand a mild overpower transient that terminated with fuel temperatures just short of the solidus without cladding strain. Calculated values of outlet coolant temperature and amount of molten fuel generally agree well with the test data. Posttest thermalhydraulic and mechanical analyses of the fuel pins are reported. Results of detailed nondestructive and destructive examinations of the preirradiated central pin and a fresh peripheral pin are presented. (U.S.)
Investigations of fuel cladding chemical interaction in irradiated LMFBR type oxide fuel pins
International Nuclear Information System (INIS)
Roake, W.E.; Adamson, M.G.; Hilbert, R.F.; Langer, S.
1977-01-01
Understanding and controlling the chemical attack of fuel pin cladding by fuel and fission products are major objectives of the U.S. LMFBR Mixed Oxide Irradiation Testing Program. Fuel-cladding chemical interaction (FCCI) has been recognized as an important factor in the ability to achieve goal peak burnups of 8% (80.MWd/kg) in FFTF and in excess of 10% (100.MWd/kg) in the LMFBR demonstration reactors while maintaining coolant bulk outlet temperatures up to ∼60 deg. C (1100 deg. F). In this paper we review pertinent parts of the irradiation program and describe recent observation of FCCI in the fuel pins of this program. One goal of the FCCI investigations is to obtain a sufficiently quantitative understanding of FCCI such that correlations can be developed relating loss of effective cladding thickness to irradiation and fuel pin fabrication parameters. Wastage correlations being developed using different approaches are discussed. Much of the early data on FCCI obtained in the U.S. Mixed Oxide Fuel Program came from capsule tests irradiated in both fast and thermal flux facilities. The fast flux irradiated encapsulated fuel pins continue to provide valuable data and insight into FCCI. Currently, however, bare pins with prototypic fuels and cladding irradiated in the fast flux Experimental Breeder Reactor-II (EBR-II) as multiple pin assemblies under prototypic powers, temperatures and thermal gradients are providing growing quantities of data on FCCI characteristics and cladding thickness losses from FCCI. A few special encapsulated fuel pin tests are being conducted in the General Electric Test Reactor (GETR) and EBR-II, but these are aimed at providing specific information under irradiation conditions not achievable in the fast flux bare pin assemblies or because EBR-II Operation or Safety requirements dictate that the pins be encapsulated. The discussion in this paper is limited to fast flux irradiation test results from encapsulated pins and multiple pin
Investigations of fuel cladding chemical interaction in irradiated LMFBR type oxide fuel pins
Energy Technology Data Exchange (ETDEWEB)
Roake, W E [Westinghouse-Hanford Co., Richland, WA (United States); Adamson, M G [General Electric Company, Vallecitos Nuclear Center, Pleasanton, CA (United States); Hilbert, R F; Langer, S
1977-04-01
Understanding and controlling the chemical attack of fuel pin cladding by fuel and fission products are major objectives of the U.S. LMFBR Mixed Oxide Irradiation Testing Program. Fuel-cladding chemical interaction (FCCI) has been recognized as an important factor in the ability to achieve goal peak burnups of 8% (80.MWd/kg) in FFTF and in excess of 10% (100.MWd/kg) in the LMFBR demonstration reactors while maintaining coolant bulk outlet temperatures up to {approx}60 deg. C (1100 deg. F). In this paper we review pertinent parts of the irradiation program and describe recent observation of FCCI in the fuel pins of this program. One goal of the FCCI investigations is to obtain a sufficiently quantitative understanding of FCCI such that correlations can be developed relating loss of effective cladding thickness to irradiation and fuel pin fabrication parameters. Wastage correlations being developed using different approaches are discussed. Much of the early data on FCCI obtained in the U.S. Mixed Oxide Fuel Program came from capsule tests irradiated in both fast and thermal flux facilities. The fast flux irradiated encapsulated fuel pins continue to provide valuable data and insight into FCCI. Currently, however, bare pins with prototypic fuels and cladding irradiated in the fast flux Experimental Breeder Reactor-II (EBR-II) as multiple pin assemblies under prototypic powers, temperatures and thermal gradients are providing growing quantities of data on FCCI characteristics and cladding thickness losses from FCCI. A few special encapsulated fuel pin tests are being conducted in the General Electric Test Reactor (GETR) and EBR-II, but these are aimed at providing specific information under irradiation conditions not achievable in the fast flux bare pin assemblies or because EBR-II Operation or Safety requirements dictate that the pins be encapsulated. The discussion in this paper is limited to fast flux irradiation test results from encapsulated pins and multiple pin
International Nuclear Information System (INIS)
Perusquia, R.; Montes, J.L.; Hernandez, J.L.; Ortiz, J.J.; Hernandez, H.; Castillo, A.
2007-01-01
The Federal Commission of Electricity carries out works at the moment related with the one increase from the power to original 120% of the nominal one in the rectors of water in boil (BWR) of the Laguna Verde Central (CLV). In the National Institute of Nuclear Research (ININ) are carried out studies of the impact on the design of the fuel recharge derived of this increase. As option in the ININ the feasibility of continuing using the same type of fuel assemble that one has come using recently in the CLV, the type GE12 is analyzed. To achieve it was diminished the LPPF of the power cells from 1.43 to 1.24. It was verified, with the recently acquired CMS codes system that the use of fuel assemble GE12 type with cells of low peak of local power and low gadolinia concentration (ININ4) they are suitable for cycles of 18 months at 120% of the original nominal power in the reactors of the CLV. It was decreased the recharge from 148 to 140 when using the ININ4 fuel assemble instead of one conventionally designed. This brings itself appreciable economic savings. However, the above mentioned brought itself an increase of the dispersion in the burnt of definitive fuel discharges. All this when it had already been fulfilled the goals and requirements imposed in the design of the balance cycle. It was necessary to establish a principle with base to the one which it was developed a method that allowed to reduce in efficient form the dispersion of the burnt of discharge and at the same time to already have a low impact in the operational parameters reached. The method was applied in the cycle of balance of 18 months to 120% of the original nominal power using the fuel assemble of low peak of local power being achieved the following results; it was decreased the dispersion of the burnt of definitive discharge from 5.4% to 2.2%, the maximum burnt of discharge was diminished from 50.694 GWD/M to 47.443 GWD/TM, it was increased the minimum burnt of discharge from 41.369 GWD/TM to 42
New practical method for evaluation of a conventional flat plate continuous pistachio dryer
Energy Technology Data Exchange (ETDEWEB)
Kouchakzadeh, Ahmad [Agri Machinery Engineering, Ilam University, Ilam (Iran, Islamic Republic of); Tavakoli, Teymur [Agri Machinery Engineering, Tarbyat Modares University, Tehran (Iran, Islamic Republic of)
2011-07-15
Highlights: {yields} Evaluation of a conventional flat plate continuous pistachio dryer with a new feasible method. {yields} Using thermophysical properties of air and matter. {yields} This manner could be utilized in similar dryer for other agricultural products. {yields} Method shows the heat loss and power separately. -- Abstract: Testing a dryer is necessary to evaluate its absolute and comparative performance with other dryers. A conventional flat plate continuous pistachio dryer was tested by a new practical method of mass and energy equilibrium. Results showed that the average power consumption and heat loss in three tests are 62.13 and 18.99 kW, respectively. The ratio of heat loss on power consumption showed that the efficiency of practical pistachios flat plate dryer is about 69.4%.
New practical method for evaluation of a conventional flat plate continuous pistachio dryer
International Nuclear Information System (INIS)
Kouchakzadeh, Ahmad; Tavakoli, Teymur
2011-01-01
Highlights: → Evaluation of a conventional flat plate continuous pistachio dryer with a new feasible method. → Using thermophysical properties of air and matter. → This manner could be utilized in similar dryer for other agricultural products. → Method shows the heat loss and power separately. -- Abstract: Testing a dryer is necessary to evaluate its absolute and comparative performance with other dryers. A conventional flat plate continuous pistachio dryer was tested by a new practical method of mass and energy equilibrium. Results showed that the average power consumption and heat loss in three tests are 62.13 and 18.99 kW, respectively. The ratio of heat loss on power consumption showed that the efficiency of practical pistachios flat plate dryer is about 69.4%.
Energy Technology Data Exchange (ETDEWEB)
Grigor' ev, Ju. G.; Darenskaja, N. G.; Domshlak, M. M.; Lebedinskij, A. V.; Nefedov, Ju. G.; Ryzhov, N. I.
1964-03-15
sindrome hemorragico provocado en el perro por la irradiacion protonica es mas pronunciado. La hemorragia se presenta al cabo de un tiempo mas breve y es mas abundante. Verificaron asimismo que la EBR de los protones es diferente segun se trate de animales pequeflos (ratas o ratones) o de animales grandes (perros). La diferencia es apreciable, ya que los valores respectivos son 0,7 para los primeros y 1,0 o 1,15 para los segundos. En la memoria se examinan las posibles causas de estas diferencias. (author) [Russian] Harakteristiki biologicheskogo dejstvija protonov vysokih jenergij (120, 210 i 510Mjev) izuchalis' v jeksperimentah na myshah, krysah i sobakah. Bylo pokazano, chto narjadu s nekotorym shodstvom ili identichnost'ju radiacionnogo porazhenija pri dejstvii rentgenovskih luchej i protonov imelsja rjad razlichij. Pri protonnom obluchenii sobak byl bolee otchetlivo vyrazhen gemorrogicheskij sindrom. Krovoizlijanija pojavljalis' u zhivotnyh ran'she i byli b olee obil'nymi. Obnaruzhena raznica v urovnjah OBJe protonov dlja melkih (krysy, myshi) i krupnyh zhivotnyh (sobaki). Jeta raznica javljaetsja dovol'no znachitel'noj i ravnjaetsja so otvetstvenno 0,7 i 1,0 - 1,15. V doklade privodjatsja nekotorye soobrazhenija otnositel'no prichiny jetih razlichij. (author)
EBR-II in-vessel natural circulation experiments on hot and cold pool stratification
International Nuclear Information System (INIS)
Ragland, W.A.; Feldman, E.E.
1990-01-01
The Experimental Breeder Reactor II is located in a cylindrical pool of liquid sodium which is part of the cold-leg of the primary flow circuit. A vertical string of 32 thermocouples spans the 8 m tank height, at each of two diametrically opposed locations in the primary tank. Local temperatures were measured with these 64 thermocouples during dynamic tests. The instantaneous spacial temperature distribution obtained from a string of thermocouples can be viewed on a personal computer. The animation which results from displaying successive spacial distributions provide a very effective way to quickly obtain physical insights. The design of the two strings of thermocouples, the software used to create the animation, measured data from three different types of tests--two unprotected reactor transients, and one with the reactor at decay power levels and the reactor cover lifted, are discussed. 5 refs., 3 figs
Idaho National Laboratory Cultural Resource Monitoring Report for Fiscal Year 2016
Energy Technology Data Exchange (ETDEWEB)
Gilbert, Hollie Kae [Idaho National Lab. (INL), Idaho Falls, ID (United States); Holmer, Marie Pilkington [Idaho National Lab. (INL), Idaho Falls, ID (United States); Olson, Christina Liegh [Idaho National Lab. (INL), Idaho Falls, ID (United States); Pace, Brenda Ringe [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2016-11-01
This report describes the cultural resource monitoring activities of the Idaho National Laboratory’s (INL) Cultural Resource Management (CRM) Office during fiscal year (FY) 2016. Overall monitoring included surveillance of the following 23 individual cultural resource localities: two locations with human remains, one of which is also a cave; seven additional caves; six prehistoric archaeological sites; four historic archaeological sites; one historic trail; Experimental Breeder Reactor I (EBR-I), a National Historic Landmark; Aircraft Nuclear Propulsion (ANP) objects located at EBR-I; and one Arco Naval Proving Ground (NPG) property, CF-633 and related objects and structures. Several INL work processes and projects were also monitored to confirm compliance with original INL CRM recommendations and assess the effects of ongoing work. On one occasion, ground disturbing activities within the boundaries of the Critical Infrastructure Test Range Complex (CITRC) were observed by INL CRM staff prepared to respond to any additional finds of Native American human remains. Additionally, the CRM office was notified during two Trespass Investigations conducted by INL Security. Most of the cultural resources monitored in FY 2016 exhibited no adverse impacts, resulting in Type 1 impact assessments. However, Type 2 impacts were noted five times. Three previously reported Type 2 impacts were once again documented at the EBR-I National Historic Landmark, including spalling and deterioration of bricks due to inadequate drainage, minimal maintenance, and rodent infestation. The ANP engines and locomotive on display at the EBR-I Visitors Center also exhibited impacts related to long term exposure. Finally, most of the Arco NPG properties monitored at Central Facilities Area exhibited problems with lack of timely and appropriate maintenance as well as inadequate drainage. No new Type 3 or Type 4 impacts that adversely affected significant cultural resources and threatened National
Idaho National Laboratory Cultural Resource Monitoring Report for Fiscal Year 2016
International Nuclear Information System (INIS)
Gilbert, Hollie Kae; Holmer, Marie Pilkington; Olson, Christina Liegh; Pace, Brenda Ringe
2016-01-01
This report describes the cultural resource monitoring activities of the Idaho National Laboratory's (INL) Cultural Resource Management (CRM) Office during fiscal year (FY) 2016. Overall monitoring included surveillance of the following 23 individual cultural resource localities: two locations with human remains, one of which is also a cave; seven additional caves; six prehistoric archaeological sites; four historic archaeological sites; one historic trail; Experimental Breeder Reactor I (EBR-I), a National Historic Landmark; Aircraft Nuclear Propulsion (ANP) objects located at EBR-I; and one Arco Naval Proving Ground (NPG) property, CF-633 and related objects and structures. Several INL work processes and projects were also monitored to confirm compliance with original INL CRM recommendations and assess the effects of ongoing work. On one occasion, ground disturbing activities within the boundaries of the Critical Infrastructure Test Range Complex (CITRC) were observed by INL CRM staff prepared to respond to any additional finds of Native American human remains. Additionally, the CRM office was notified during two Trespass Investigations conducted by INL Security. Most of the cultural resources monitored in FY 2016 exhibited no adverse impacts, resulting in Type 1 impact assessments. However, Type 2 impacts were noted five times. Three previously reported Type 2 impacts were once again documented at the EBR-I National Historic Landmark, including spalling and deterioration of bricks due to inadequate drainage, minimal maintenance, and rodent infestation. The ANP engines and locomotive on display at the EBR-I Visitors Center also exhibited impacts related to long term exposure. Finally, most of the Arco NPG properties monitored at Central Facilities Area exhibited problems with lack of timely and appropriate maintenance as well as inadequate drainage. No new Type 3 or Type 4 impacts that adversely affected significant cultural resources and threatened National
International Nuclear Information System (INIS)
Till, C.E.
1987-01-01
On April 3rd, 1986, two dramatic demonstrations of the inherent capability of sodium-cooled fast reactors to survive unprotected loss of cooling accidents were carried out on the experimental sodium-cooled power reactor, EBR-II, on the Idaho site of Argonne National Laboratory. Transients potentially of the most serious kind, one an unprotected loss of flow, the other an unprotected loss of heat sink, both initiated from full power. In both cases the reactor quietly shut itself down, without damage of any kind. These tests were a part of the on-going development program at Argonne to develop an advanced reactor with significant new inherent safety characteristics. Called the Integral Fast Reactor, or IFR, the basic thrust is to develop everything that is needed for a complete nuclear power system - reactor, closed fuel cycle, and waste processing - as a single optimized entity, and, for simplicity in concept, as an integral part of a single plant. The particular selection of reactor materials emphasizes inherent safety characteristics and also makes possible a simplified closed fuel cycle and waste process improvements
International Nuclear Information System (INIS)
Chiapella, M.
2007-01-01
The questions that were formulated in the request for this report are: 1. What does 'local level' mean? 2. Who are the local stakeholders? 3. Which prerequisites are needed to involve the local level? 4. Who begins the consultation? 5. Who assures the participation and security of the local level? Some of these questions will be approached through the comparative study of two cases (carried out in the context of COWAM-Spain in the work group on Local Democracy and Systems of Social Participation) regarding the siting of a combined cycle natural gas power plant. In one case it was not possible to consolidate the project, whereas siting and licensing were achieved in the other. The two cases are: the Enron project in Mora la Nova (municipality of the district of the Riverside d'Ebre. county of Tarragona) and the project of Natural Gas in the municipality of Vandellos Hospitalet (in the district of the Baix Camp, bordering on the other district, and also in Tarragona). Each case was studied in detail from a broad sociological perspective, as well as from a psycho-sociological perspective, to analyse the different aspects, strategy and process observed, in order to identify the factors that contributed to success or failure. (author)
Status of LMR fuel development in the United States of America
International Nuclear Information System (INIS)
Leggett, R.D.; Walters, L.C.
1993-01-01
Three fuel systems oxide, metal, and carbide are shown to be reliable to high burnup and a fourth system, nitride, is shown to have promise for LMR applications. The excellent steady state performance of the oxide and metal driver fuels for FFTF and EBR-II, respectively, supported by the experience base on tens of thousands of test pins is provided. Achieving 300 MWd/kg in the oxide fuel system through the use of low swelling cladding and duct materials and the Integral Fast Reactor (IFR) concept that utilizes metallic fuel are described. Arguments for economic viability are presented. Responses to operational transients and severe over-power events are shown to have large safety margins and run-beyond-cladding-breach (RBCB), is shown to be non-threatening to LMR reactor system. Results from a joint U.S.-Swiss carbide test that operated successfully at high power and burnup in FFTF are also presented. (orig.)
International Nuclear Information System (INIS)
Strain, R.V.; Johnson, C.E.
1978-05-01
Postirradiation examinations were performed on five fuel pins from the Gas-Cooled Fast-Breeder Reactor F-1 experiment irradiated in EBR-II to a peak burnup of approximately 5.5 at. %. These encapsulated fuel pins were irradiated at peak-power linear ratings from approximately 13 to 15 kW/ft and peak cladding inside diameter temperatures from approximately 625 to 760 0 C. The maximum diametral change that occurred during irradiation was 0.2% ΔD/D 0 . The maximum fuel-cladding chemical interaction depth was 2.6 mils in fuel pin G-1 and 1 mil or less in the other three pins examined destructively. Significant migration of the volatile fission products occurred axially to the fuel-blanket interfaces. Teh postirradiation examination data indicate that fuel melted at the inner surface of the annular fuel pellets in the two highest power rating fuel pins, but little axial movement of fuel occurred
Energy Technology Data Exchange (ETDEWEB)
Strain, R V; Johnson, C E
1978-05-01
Postirradiation examinations were performed on five fuel pins from the Gas-Cooled Fast-Breeder Reactor F-1 experiment irradiated in EBR-II to a peak burnup of approximately 5.5 at. %. These encapsulated fuel pins were irradiated at peak-power linear ratings from approximately 13 to 15 kW/ft and peak cladding inside diameter temperatures from approximately 625 to 760/sup 0/C. The maximum diametral change that occurred during irradiation was 0.2% ..delta..D/D/sub 0/. The maximum fuel-cladding chemical interaction depth was 2.6 mils in fuel pin G-1 and 1 mil or less in the other three pins examined destructively. Significant migration of the volatile fission products occurred axially to the fuel-blanket interfaces. Teh postirradiation examination data indicate that fuel melted at the inner surface of the annular fuel pellets in the two highest power rating fuel pins, but little axial movement of fuel occurred.
Posttest examination results of recent treat tests on metal fuel
International Nuclear Information System (INIS)
Holland, J.W.; Wright, A.E.; Bauer, T.H.; Goldman, A.J.; Klickman, A.E.; Sevy, R.H.
1986-01-01
A series of in-reactor transient tests is underway to study the characteristics of metal-alloy fuel during transient-overpower-without-scam conditions. The initial tests focused on determining the margin to cladding breach and the axial fuel motions that would mitigate the power excursion. The tests were conducted in flowing-sodium loops with uranium - 5% fissium EBR-II Mark-II driver fuel elements in the TREAT facility. Posttest examination of the tests evaluated fuel elongation in intact pins and postfailure fuel motion. Microscopic examination of the intact pins studied the nature and extent of fuel/cladding interaction, fuel melt fraction and mass distribution, and distribution of porosity. Eutectic penetration and failure of the cladding were also examined in the failed pins
Automated reasoning in man-machine control systems
International Nuclear Information System (INIS)
Stratton, R.C.; Lusk, E.L.
1983-01-01
This paper describes a project being undertaken at Argonne National Laboratory to demonstrate the usefulness of automated reasoning techniques in the implementation of a man-machine control system being designed at the EBR-II nuclear power plant. It is shown how automated reasoning influences the choice of optimal roles for both man and machine in the system control process, both for normal and off-normal operation. In addition, the requirements imposed by such a system for a rigorously formal specification of operating states, subsystem states, and transition procedures have a useful impact on the analysis phase. The definitions and rules are discussed for a prototype system which is physically simple yet illustrates some of the complexities inherent in real systems
Psychology of democracy and democratization: Experience from Central and Eastern Europe
Czech Academy of Sciences Publication Activity Database
Klicperová-Baker, Martina
2012-01-01
Roč. 47, Supplement (2012), s. 694-694 ISSN 0020-7594. [International Congress of Psychology /30./. 22.07.2012-27.07.2012, Cape Town] Institutional support: RVO:68081740 Keywords : political psychology * democratization * Central and Eastern Europe Subject RIV: AN - Psychology
Advanced fast reactor fuels program. Second annual progress report, July 1, 1975--September 30, 1976
International Nuclear Information System (INIS)
Baker, R.D.
1978-12-01
Results of steady-state (EBR-II) irradiation testing, off-normal irradiation design and testing, fuel-cladding compatibility, and chemical stability of uranium--plutonium carbide and nitride fuels are presented
40 CFR 63.694 - Testing methods and procedures.
2010-07-01
... section. (i) For a potential leak interface other than a seal around a shaft that passes through a cover... organic concentration value determined in paragraph (k)(8) is less than 500 ppmv. (ii) For a seal around a shaft that passes through a cover opening, the potential leak interface is determined to operate with no...
Lifescience Database Archive (English)
Full Text Available KLLTEKHIALNVKEDGLDWLADQGYDPIYGARPLKRVIQKXRIKSNGKTNT *r*n*rsxxcynxlrinqkxn*klqvnkik Translated Amino Acid seq...ANXPDNTPSATAREEVMGVVRSRFPPEFLNRIDDMILFNRLXRKDMDKI VEIQLXDLRKLLTEKHIALNVKEDGLDWLADQGYDPIYGARPLKRVIQKXRIKSNGKTNT *r*n*rsxxc
Lifescience Database Archive (English)
Full Text Available 1 Artificial sequences cloning vector DNA pDXA-3H. 216 8e-54 2 X85122 |X85122.1 Artificial sequences cloni...216 8e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 8e-54 2 X85123 |X85123.1 Artificial sequences cloni...Cloning vector pDXA-FLAG, complete sequence. 216 8e-54 2 X85120 |X85120.1 Artificial sequences cloning vecto...steine proteinase 1. 1217 0.0 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 8e-54 2 X85119 |X85119....ng vector DNA pDXA-HY. 216 8e-54 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG.
Stability of lithium niobate on irradiation at elevated temperature
International Nuclear Information System (INIS)
Primak, W.; Gavin, A.P.; Anderson, T.T.; Monahan, E.
1977-01-01
In contrast to results obtained for neutron irradiation in a thermal reactor near room temperature, lithium niobate plates irradiated in the Experimental Breeder Reactor II (EBR-II) did not become metamict. This is attributed to the elevated temperature of the EBR-II. Ion bombardment experiments indicate that to avoid disordering of lithium niobate on irradiation, its temperature should be maintained above 673 K. Evidence for ionic conductivity was found at 873 K, indicating that it would be inadvisable to permit the temperature to rise that high, particularly with voltage across the plate. In reactor application as a microphone transducer, it is tentatively recommended that the lithium niobate be maintained in the middle of this temperature range for a major portion of reactor operating time
Actinide behavior in the integral fast reactor
International Nuclear Information System (INIS)
Courtney, J.C.
1993-05-01
Goal of this project is to determine the consumption of Np-237, Pu-240, Am-241, and Am-243 in the Integral Fast Reactor (IFR) fuel cycle. These four actinides set the long term waste management criteria for spent nuclear fuel; if it can be demonstrated that they can be efficiently consumed in the IFR, then requirements for nuclear waste repositories can be much less demanding. Irradiations in the Experimental Breeder Reactor II (EBR-II) at Argonne National Laboratory's site near Idaho Falls, Idaho, will be conducted to determine fission and transmutation rates for the four nuclides. The experimental effort involves target package design, fabrication, quality assurance, and irradiation. Post irradiation analyses are required to determine the fission rates and neutron spectra in the EBR-II core
A PRA case study of extended long term decay heat removal for shutdown risk assessment
International Nuclear Information System (INIS)
Roglans, J.; Ragland, W.A.; Hill, D.J.
1992-01-01
A Probabilistic Risk Assessment (PRA) of the Experimental Breeder Reactor II (EBR-II), a Department of Energy (DOE) Category A research reactor, has recently been completed at Argonne National Laboratory (ANL). The results of this PRA have shown that the decay heat removal system for EBR-II is extremely robust and reliable. In addition, the methodology used demonstrates how the actions of other systems not normally used for actions of other systems not normally used for decay heat removal can be used to expand the mission time of the decay heat removal system and further increase its reliability. The methodology may also be extended to account for the impact of non-safety systems in enhancing the reliability of other dedicated safety systems
Aportacions a la flora de les comarques transibèriques, II
Directory of Open Access Journals (Sweden)
Rovira, Ana M.
1988-01-01
Full Text Available Not availabe
[fr] On expose quelques nouveautés taxonomiques et chorologiques pour la Flore des comarques catalanes du Sud de l'Ebre. On décrit deux nouveaux taxa: Brassica repanda (Willd. DC. subsp. dertosensis Molero & Rovira et Helianthemum pilosum (L. Pers. var. pseudoasperum Molero & Rovira. On propose aussi une nouvelle combinaison nomenclaturelle: Reseda lutea L. subsp. vivantii (P. Montserrat A. Rovira. Dans l’aspecte chorologique, Euphorbia lagascae Sprengel est indiquée pour la première fois en Catalogne: la plupart des autres espèces sont des nouveautés pour les comarques catalanes du Sud de l'Ebre.
[ca] Presentem un recull de novetats corològiques i taxonòmiques per a les comarques catalanes situades alsud de l'Ebre. Es descriuen dos tàxons nous: Brassica repanda (Willd. DC. subsp. dertosensis Molero & Rovira i Helianthemum pilosum (L. Pers. var. pseudoasperum Molero & Rovira. S'estableix una nova combinació nomenclatural: Reseda lutea L. subsp. vivantii (P. Montserrat A. Rovira. En l'aspecte corològic. Euphorbia lagascae Sprengel representa una novetat per a Catalunya. La majoria de les altres citacions representen novetats pel conjunt d'aquestes comarques catalanes meridio-occidentals.
Irradiation creep experiments on fusion reactor candidate structural materials
International Nuclear Information System (INIS)
Hausen, H.; Cundy, M.R.; Schuele, W.
1991-01-01
Irradiation creep rates were determined for annealed and cold-worked AMCR- and 316-type steel alloys in the high flux reactor at Petten, for various irradiation temperatures, stresses and for neutron doses up to 4 dpa. Primary creep elongations were found in all annealed materials. A negative creep elongation was found in cold-worked materials for stresses equal to or below about 100 MPa. An increase of the negative creep elongation is found for decreasing irradiation temperatures and decreasing applied stresses. The stress exponent of the irradiation creep rate in annealed and cold-worked AMCR alloys is n = 1.85 and n = 1.1, respectively. The creep rates of cold-worked AMCR alloys are almost temperature independent over the range investigated (573-693 K). The results obtained in the HFR at Petten are compared with those obtained in ORR and EBR II. The smallest creep rates are found for cold-worked materials of AMCR- and US-PCA-type at Petten which are about a factor two smaller than the creep rates obtained of US-316 at Petten or for US-PCA at ORR or for 316L at EBR II. The scatter band factor for US-PCA, 316L, US-316 irradiated in ORR and EBR II is about 1.5 after a temperature and damage rate normalization
Mosalaei, A; Mohammadianpanah, M; Omidvari, S; Ahmadloo, N
2006-01-01
This retrospective analysis aims to report results of patients with cancer of uterine cervix treated with external-beam radiotherapy (EBR) and high-dose rate (HDR) brachytherapy, using manual treatment planning. From 1975 to 1995, 237 patients with FIGO stages IIB-IVA and mean age of 54.31 years were treated. EBR dose to the whole pelvis was 50 Gy in 25 fractions. Brachytherapy with HDR after-loading cobalt source (Cathetron) was performed following EBR completion with a dose of 30 Gy in three weekly fractions of 10 Gy to point A. Survival, local control, and genitourinary and gastrointestinal complications were assessed. In a median follow-up of 60.2 months, the 10-year overall and disease-free survival rate was 62.4%. Local recurrence was seen in 12.2% of patients. Distant metastases to the lymph nodes, peritoneum, lung, liver, and bone occurred in 25.3% of patients. Less than 6% of patients experienced severe genitourinary and/or gastrointestinal toxicity that were relieved by surgical intervention. No treatment-related mortality was seen. This series suggests that 50 Gy to the whole pelvis together with three fractions of 10 Gy to point A with HDR brachytherapy is an effective fractionation schedule in the treatment of locally advanced cancer of cervix. To decrease the complications, newer devices and treatment planning may be beneficial.
Corrosion assessment of dry fuel storage containers
Energy Technology Data Exchange (ETDEWEB)
Graves, C.E.
1994-09-01
The structural stability as a function of expected corrosion degradation of 75 dry fuel storage containers located in the 200 Area Low-Level Waste Burial Grounds was evaluated. These containers include 22 concrete burial containers, 13 55-gal (208-l) drums, and 40 Experimental Breeder Reactor II (EBR-II) transport/storage casks. All containers are buried beneath at least 48 in. of soil and a heavy plastic tarp with the exception of 35 of the EBR-II casks which are exposed to atmosphere. A literature review revealed that little general corrosion is expected and pitting corrosion of the carbon steel used as the exterior shell for all containers (with the exception of the concrete containers) will occur at a maximum rate of 3.5 mil/yr. Penetration from pitting of the exterior shell of the 208-l drums and EBR-II casks is calculated to occur after 18 and 71 years of burial, respectively. The internal construction beneath the shell would be expected to preclude containment breach, however, for the drums and casks. The estimates for structural failure of the external shells, large-scale shell deterioration due to corrosion, are considerably longer, 39 and 150 years respectively for the drums and casks. The concrete burial containers are expected to withstand a service life of 50 years.
International Nuclear Information System (INIS)
Abdul Jalil Abd Hamid; Shafii Khamis; Rehir Dahalan
2011-01-01
Paper batch records have been used for decades to record procedures, the types and quantities of each material used, and the status of each step in the manufacturing process for both pharmaceuticals and medical devices. Although paper batch records are well established in its implementation, the system is laborious to maintain and prone to human error, particularly as manufacturing operations become increasingly complicated. Many pharmaceutical manufacturers are currently evaluating the feasibility of Electronic Batch Record (EBR) system. An integrated EBR system has been developed by Medical Technology Division of Nuclear Malaysia to monitor process and equipment used in the manufacture of pharmaceuticals and medical devices. The system architecture consists of an iPAN7 data processing system operating under Microsoft Windows Embedded CE 6.0 R2. The system serves as a common data bank and an input/output device for the iPAN7 processors. Full traceability from component material to finished product is maintained. Properly implemented, EBR eliminate paperwork, speed up information distribution, and provide useful tools for improving quality and efficiency. This paper discusses the general system requirements and specifications along with the hardware and software required to implement those requirements and specifications. Also discussed are problems which were encountered after initial development and plans for future development, and a plan for extending and commercializing this technology. (author)
Flexural Strengthening of RC Slabs with Prestressed CFRP Strips Using Different Anchorage Systems
Directory of Open Access Journals (Sweden)
José Sena-Cruz
2015-10-01
Full Text Available Externally Bonded Reinforcement (EBR technique has been widely used for flexural strengthening of concrete structures by using carbon fiber-reinforced polymers (CFRP. EBR technique offers several structural advantages when the CFRP material is prestressed. This paper presents an experimental and numerical study on reinforced (RC slabs strengthened in flexure with prestressed CFRP strips as a structural strengthening system. The strips are applied as an externally bonded reinforcement (EBR and anchored with either a mechanical or a gradient anchorage. The former foresees metallic anchorage plates fixed to the concrete substrate, while the latter is based on an accelerated epoxy resin curing followed by a segment-wise prestress force decrease at the strip ends. Both anchorage systems, in combination with different CFRP strip geometries, were subjected to static loading tests. It could be demonstrated that the composite strip’s performance is better exploited when prestressing is used, with slightly higher overall load carrying capacities for mechanical anchorages than for the gradient anchorage. The performed investigations by means of a cross-section analysis supported the experimental observation that in case a mechanical anchorage is used, progressive strip debonding changes the fully bonded configuration to an unbonded end-anchored system. The inclusion of defined debonding criteria for both the anchorage zones and free length between the anchorage regions allowed to precisely capture the ultimate loading forces.
Fuel-sodium reaction product formation in breached mixed-oxide fuel
International Nuclear Information System (INIS)
Bottcher, J.H.; Lambert, J.D.B.; Strain, R.V.; Ukai, S.; Shibahara, S.
1988-01-01
The run-beyond-cladding-breach (RBCB) operation of mixed-oxide LMR fuel pins has been studied for six years in the Experimental Breeder Reactor-II (EBR-II) as part of a joint program between the US Department of Energy and the Power Reactor and Nuclear Fuel Development Corporation of Japan. The formation of fuel-sodium reaction product (FSRP), Na 3 MO 4 , where M = U/sub 1-y/Pu/sub y/, in the outer fuel regions is the major phenomenon governing RBCB behavior. It increases fuel volume, decreases fuel stoichiometry, modifies fission-product distributions, and alters thermal performance of a pin. This paper describes the morphology of Na 3 MO 4 observed in 5.84-mm diameter pins covering a variety of conditions and RBCB times up to 150 EFPD's. 8 refs., 1 fig
A prehistory of nuclear energy development
International Nuclear Information System (INIS)
Yoshikawa, Hideo
2007-01-01
Evolutionary progress of the LWR plants in the last half-century was reviewed in series. As a prehistory of nuclear energy development, this first lecture presented (1) discovery of nuclear energy and development of the atomic bomb and (2) development of the reactor system using nuclear energy for making electricity and for naval propulsion. The first nuclear reactor to produce electricity was the small Experimental Breeder Reactor (EBR-1) in Idaho, in the USA, which started up in December 1951. The Pressurized Water Reactor (PWR) for naval use was developed under Hyman Rickover in the USA. The Mark I prototype naval reactor started up in March 1953 in Idaho, and the first nuclear-powered submarine, NS Nautilus, with the Mark II reactor was put into service in January 1955. (T. Tanaka)
Clark, Dan
2014-01-01
Understanding your company's data has never been easier than with Microsoft's new Power BI package for Excel 2013. Consisting of four powerful tools-Power Pivot, Power View, Power Query and Power Maps-Power BI makes self-service business intelligence a reality for a wide range of users, bridging the traditional gap between Excel users, business analysts and IT experts and making it easier for everyone to work together to build the data models that can give you game-changing insights into your business. Beginning Power BI with Excel 2013 guides you step by step through the process of analyzin
Progress in Electron Beam Mastering of 100 Gbit/inch2 Density Disc
Takeda, Minoru; Furuki, Motohiro; Yamamoto, Masanobu; Shinoda, Masataka; Saito, Kimihiro; Aki, Yuichi; Kawase, Hiroshi; Koizumi, Mitsuru; Miyokawa, Toshiaki; Mutou, Masao; Handa, Nobuo
2004-07-01
We developed an electron beam recorder (EBR) capable of recording master discs under atmospheric conditions using a novel differential pumping head. Using the EBR and optimized fabrication process for Si-etched discs with reactive ion etching (RIE), a bottom signal jitter of 9.6% was obtained from a 36 Gbit/inch2 density disc, readout using a near-field optical pickup with an effective numerical aperture (NA) of 1.85 and a wavelength of 405 nm. We also obtained the eye patterns from a 70 Gbit/inch2 density disc readout using an optical pickup with a 2.05 NA and the same wavelength, and showed almost the same modulation ratio as the simulation value. Moreover, the capability of producing pit patterns corresponding to a 104 Gbit/inch2 density is demonstrated.
Current status of the Run-Beyond-Cladding Breach (RBCB) tests for the Integral Fast Reactor (IFR)
International Nuclear Information System (INIS)
Batte, G.L.; Pahl, R.G.; Hofman, G.L.
1993-01-01
This paper describes the results from the Integral Fast Reactor (IFR) metallic fuel Run-Beyond-Cladding-Breach (RBCB) experiments conducted in the Experimental Breeder Reactor II (EBR-II). Included in the report are scoping test results and the data collected from the prototypical tests as well as the exam results and discussion from a naturally occurring breach of one of the lead IFR fuel tests. All results showed a characteristic delayed neutron and fission gas release pattern that readily allows for identification and evaluation of cladding breach events. Also, cladding breaches are very small and do not propagate during extensive post breach operation. Loss of fuel from breached cladding was found to be insignificant. The paper will conclude with a brief description of future RBCB experiments planned for irradiation in EBR-II
International Nuclear Information System (INIS)
Bekal, Mahesh; Suchetha Kumari
2016-01-01
The whole brain irradiation causes injury to the nervous system at various levels. Omega-3 Poly Unsaturated Fatty Acids are very much essential for the growth and development of nervous system. Dietary supplementation of these nutrients will promote the development of injured neuronal cells. Therefore, this study was undertaken to establish the role of Omega-3 Poly Unsaturated Fatty Acids on Memory, Learning ability and anxiety levels in the irradiated mice. The effect of Electron Beam Radiation (EBR) on memory and learning ability was investigated in male Swiss albino mice. The study groups were subjected to a sub-lethal dose of 8 and 6 Gy of EBR and also the Fish oil and Flax seed extract (300 mg/kg body weight) were given orally to the irradiated mice
Actinide behavior in the integral fast reactor. Progress report, May 1, 1992--April 30, 1993
Energy Technology Data Exchange (ETDEWEB)
Courtney, J.C.
1993-05-01
Goal of this project is to determine the consumption of Np-237, Pu-240, Am-241, and Am-243 in the Integral Fast Reactor (IFR) fuel cycle. These four actinides set the long term waste management criteria for spent nuclear fuel; if it can be demonstrated that they can be efficiently consumed in the IFR, then requirements for nuclear waste repositories can be much less demanding. Irradiations in the Experimental Breeder Reactor II (EBR-II) at Argonne National Laboratory`s site near Idaho Falls, Idaho, will be conducted to determine fission and transmutation rates for the four nuclides. The experimental effort involves target package design, fabrication, quality assurance, and irradiation. Post irradiation analyses are required to determine the fission rates and neutron spectra in the EBR-II core.
Pinellas Plant Environmental Baseline Report
Energy Technology Data Exchange (ETDEWEB)
1997-06-01
The Pinellas Plant has been part of the Department of Energy`s (DOE) nuclear weapons complex since the plant opened in 1957. In March 1995, the DOE sold the Pinellas Plant to the Pinellas County Industry Council (PCIC). DOE has leased back a large portion of the plant site to facilitate transition to alternate use and safe shutdown. The current mission is to achieve a safe transition of the facility from defense production and prepare the site for alternative uses as a community resource for economic development. Toward that effort, the Pinellas Plant Environmental Baseline Report (EBR) discusses the current and past environmental conditions of the plant site. Information for the EBR is obtained from plant records. Historical process and chemical usage information for each area is reviewed during area characterizations.
Overview of the fast reactors fuels program. [LMFBR
Energy Technology Data Exchange (ETDEWEB)
Evans, E.A.; Cox, C.M.; Hayward, B.R.; Rice, L.H.; Yoshikawa, H.H.
1980-04-01
Each nation involved in LMFBR development has its unique energy strategies which consider energy growth projections, uranium resources, capital costs, and plant operational requirements. Common to all of these strategies is a history of fast reactor experience which dates back to the days of the Manhatten Project and includes the CLEMENTINE Reactor, which generated a few watts, LAMPRE, EBR-I, EBR-II, FERMI, SEFOR, FFTF, BR-1, -2, -5, -10, BOR-60, BN-350, BN-600, JOYO, RAPSODIE, Phenix, KNK-II, DFR, and PFR. Fast reactors under design or construction include PEC, CRBR, SuperPhenix, SNR-300, MONJU, and Madras (India). The parallel fuels and materials evolution has fully supported this reactor development. It has involved cermets, molten plutonium alloy, plutonium oxide, uranium metal or alloy, uranium oxide, and mixed uranium-plutonium oxides and carbides.
Overview of the fast reactors fuels program
International Nuclear Information System (INIS)
Evans, E.A.; Cox, C.M.; Hayward, B.R.; Rice, L.H.; Yoshikawa, H.H.
1980-04-01
Each nation involved in LMFBR development has its unique energy strategies which consider energy growth projections, uranium resources, capital costs, and plant operational requirements. Common to all of these strategies is a history of fast reactor experience which dates back to the days of the Manhatten Project and includes the CLEMENTINE Reactor, which generated a few watts, LAMPRE, EBR-I, EBR-II, FERMI, SEFOR, FFTF, BR-1, -2, -5, -10, BOR-60, BN-350, BN-600, JOYO, RAPSODIE, Phenix, KNK-II, DFR, and PFR. Fast reactors under design or construction include PEC, CRBR, SuperPhenix, SNR-300, MONJU, and Madras (India). The parallel fuels and materials evolution has fully supported this reactor development. It has involved cermets, molten plutonium alloy, plutonium oxide, uranium metal or alloy, uranium oxide, and mixed uranium-plutonium oxides and carbides
Performance of HT9 clad metallic fuel at high temperature
International Nuclear Information System (INIS)
Pahl, R.G.; Lahm, C.E.; Hayes, S.L.
1992-01-01
Steady-state testing of HT9 clad metallic fuel at high temperatures was initiated in EBR-II in November of 1987. At that time U-10 wt. % Zr fuel clad with the low-swelling ferritic/martensitic alloy HT9 was being considered as driver fuel options for both EBR-II and FFTF. The objective of the X447 test described here was to determine the lifetime of HT9 cladding when operated with metallic fuel at beginning of life inside wall temperatures approaching ∼660 degree C. Though stress-temperature design limits for HT9 preclude its use for high burnup applications under these conditions due to excessive thermal creep, the X447 test was carried out to obtain data on high temperature breach phenomena involving metallic fuel since little data existed in that area
Wind Power - A Power Source Enabled by Power Electronics
DEFF Research Database (Denmark)
Blaabjerg, Frede; Chen, Zhe
2004-01-01
. The deregulation of energy has lowered the investment in bigger power plants, which means the need for new electrical power sources may be very high in the near future. Two major technologies will play important roles to solve the future problems. One is to change the electrical power production sources from......The global electrical energy consumption is still rising and there is a steady demand to increase the power capacity. The production, distribution and the use of the energy should be as technological efficient as possible and incentives to save energy at the end-user should be set up...... the conventional, fossil (and short term) based energy sources to renewable energy sources. The other is to use high efficient power electronics in power systems, power production and end-user application. This paper discuss the most emerging renewable energy source, wind energy, which by means of power...
International Nuclear Information System (INIS)
Till, C.E.
1987-01-01
On April 3rd, 1986, two demonstrations of the inherent capability of sodium-cooled fast reactors to survive unprotected loss of cooling accidents were carried out on the experimental sodium-cooled power reactor, EBR-II, on the Idaho site of Argonne National Laboratory. Transients potentially of the most serious kind, one an unprotected loss of flow, the other an unprotected loss of heat sink, both initiated from full power. In both cases the reactor quietly shut itself down, without damage of any kind. These tests were a part of the on-going development program at Argonne to develop an advanced reactor with significant new inherent safety characteristics. Called the integral fast reactor, or IFR, the basic thrust is to develop everything that is needed for a complete nuclear power system - reactor, closed fuel cycle, and waste processing - as a single optimized entity, and, for simplicity in concept, as an integral part of a single plant. The particular selection of reactor materials emphasizes inherent safety characteristics also makes possible a simplified close fuel cycle and waste process improvements. The paper describes the IFR concept, the inherent safety, tests, and status of IFR development today
1991-07-31
ADDRESS: 35 South Service Road Plainview NY 11803 MARKETING: Clint Brown TECHNICAL: PHONE: (516) 694 6700 FAX: (516) 694 6771I I I I I VMEbus VENDOR...DISTRIBUTOR ADDRESS: 17032 Murphy Avenue I Irvine CA 92714 I MARKETING: John Sutherland TECHNICAL: Tim Elsmore PHONE: (714) 261 0606 FAX: (714) 261 0894 I I
Power program and nuclear power
International Nuclear Information System (INIS)
Chernilin, Yu.F.
1990-01-01
Main points of the USSR power program and the role of nuclear power in fuel and power complex of the country are considered. Data on dynamics of economic indices of electric power generation at nuclear power plants during 1980-1988 and forecasts till 2000 are presented. It is shown that real cost of 1 kW/h of electric power is equal to 1.3-1.8 cop., and total reduced cost is equal to 1.8-2.4 cop
Introduction to electrical power and power electronics
Patel, Mukund R
2012-01-01
Power Generation, Distribution, and Utilization AC Power Fundamentals Common Aspects of Power Equipments AC Generator AC and DC Motors Transformer Power Cable Power Distribution Fault Current Analysis System ProtectionEconomic Use of PowerElectrochemical BatteryPower Electronics and Motor Drives Power Electronics Devices DC-DC Converters AC-DC-AC Converters Variable-Frequency Drives Quality of Power Power Converter CoolingAppendixIndex
Argonne Fuel Cycle Facility ventilation system -- modeling and results
International Nuclear Information System (INIS)
Mohr, D.; Feldman, E.E.; Danielson, W.F.
1995-01-01
This paper describes an integrated study of the Argonne-West Fuel Cycle Facility (FCF) interconnected ventilation systems during various operations. Analyses and test results include first a nominal condition reflecting balanced pressures and flows followed by several infrequent and off-normal scenarios. This effort is the first study of the FCF ventilation systems as an integrated network wherein the hydraulic effects of all major air systems have been analyzed and tested. The FCF building consists of many interconnected regions in which nuclear fuel is handled, transported and reprocessed. The ventilation systems comprise a large number of ducts, fans, dampers, and filters which together must provide clean, properly conditioned air to the worker occupied spaces of the facility while preventing the spread of airborne radioactive materials to clean am-as or the atmosphere. This objective is achieved by keeping the FCF building at a partial vacuum in which the contaminated areas are kept at lower pressures than the other worker occupied spaces. The ventilation systems of FCF and the EBR-II reactor are analyzed as an integrated totality, as demonstrated. We then developed the network model shown in Fig. 2 for the TORAC code. The scope of this study was to assess the measured results from the acceptance/flow balancing testing and to predict the effects of power failures, hatch and door openings, single-failure faulted conditions, EBR-II isolation, and other infrequent operations. The studies show that the FCF ventilation systems am very controllable and remain stable following off-normal events. In addition, the FCF ventilation system complex is essentially immune to reverse flows and spread of contamination to clean areas during normal and off-normal operation
Use of liquid metals in nuclear and thermonuclear engineering, and in other innovative technologies
Rachkov, V. I.; Arnol'dov, M. N.; Efanov, A. D.; Kalyakin, S. G.; Kozlov, F. A.; Loginov, N. I.; Orlov, Yu. I.; Sorokin, A. P.
2014-05-01
By now, a good deal of experience has been gained with using liquid metals as coolants in nuclear power installations; extensive knowledge has been gained about the physical, thermophysical, and physicochemical properties of these coolants; and the scientific principles and a set of methods and means for handling liquid metals as coolants for nuclear power installations have been elaborated. Prototype and commercialgrade sodium-cooled NPP power units have been developed, including the BOR-60, BN-350, and BN-600 power units (the Soviet Union); the Rapsodie, Phenix, and Superphenix power units (France), the EBR-II power unit (the United States); and the PFR power unit (the United Kingdom). In Russia, dedicated nuclear power installations have been constructed, including those with a lead-bismuth coolant for nuclear submarines and with sodium-potassium alloy for spacecraft (the Buk and Topol installations), which have no analogs around the world. Liquid metals (primarily lithium and its alloy with lead) hold promise for use in thermonuclear power engineering, where they can serve not only as a coolant, but also as tritium-producing medium. In this article, the physicochemical properties of liquid metal coolants, as well as practical experience gained from using them in nuclear and thermonuclear power engineering and in innovative technologies are considered, and the lines of further research works are formulated. New results obtained from investigations carried out on the Pb-Bi and Pb for the SVBR and BREST fast-neutron reactors (referred to henceforth as fast reactors) and for controlled accelerator systems are described.
Directory of Open Access Journals (Sweden)
Francesco Chiappelli
2005-01-01
Full Text Available The terms ‘mucositis’ and ‘stomatitis’ are often used interchangeably. Mucositis, however, pertains to pharyngeal-esophago-gastrointestinal inflammation that manifests as red, burn-like sores or ulcerations throughout the mouth. Stomatitis is an inflammation of the oral tissues proper, which can present with or without sores, and is made worse by poor dental hygiene. Mucositis is observed in a variety of immunosuppressed patients, but is most often consequential to cancer therapy. It appears as early as the third day of intervention, and is usually established by Day 7 of treatment. Mucositis increases mortality and morbidity and contributes to rising health care costs. The precise immune components involved in the etiology of mucositis are unclear, but evidence-based research (EBR data has shown that applications of granulocyte–macrophage-colony stimulating factor prevent the onset or the exacerbation of oropharyngeal mucositis. The molecular implications of this observation are discussed from the perspective of future developments of complementary and alternative treatments for this condition. It must be emphasized that this article is meant to be neither a review on mucositis and the various treatments for it, nor a discussion paper on its underlying molecular immunology. It is a statement of the implications of EBR for CAM-based interventions for mucositis. It explores and discusses the specific domain of molecular immunology in the context of mucositis and its direct implications for EBR research in CAM-based treatments for mucositis.
Power theories for improved power quality
Pasko, Marian
2012-01-01
Power quality describes a set of parameters of electric power and the load’s ability to function properly under specific conditions. It is estimated that problems relating to power quality costs the European industry hundreds of billions of Euros annually. In contrast, financing for the prevention of these problems amount to fragments of these costs. Power Theories for Improved Power Quality addresses this imbalance by presenting and assessing a range of methods and problems related to improving the quality of electric power supply. Focusing particularly on active compensators and the DSP based control algorithms, Power Theories for Improved Power Quality introduces the fundamental problems of electrical power. This introduction is followed by chapters which discuss: •‘Power theories’ including their historical development and application to practical problems, •operational principles of active compensator’s DSP control based algorithms using examples and results from laboratory research, and •t...
International Nuclear Information System (INIS)
Berkan, R.C.
1990-06-01
After several successful applications to aerospace industry, the modern control theory methods have recently attracted many control engineers from other engineering disciplines. For advanced nuclear reactors, the modern control theory may provide major advantages in safety, availability, and economic aspects. This report is intended to illustrate the feasibility of applying the linear quadratic Gaussian (LQG) compensator in nuclear reactor applications. The LQG design is compared with the existing classical control schemes. Both approaches are tested using the Experimental Breeder Reactor 2 (EBR-2) as the system. The experiments are performed using a mathematical model of the EBR-2 plant. Despite the fact that the controller and plant models do not include all known physical constraints, the results are encouraging. This preliminary study provides an informative, introductory picture for future considerations of using modern control theory methods in nuclear industry. 10 refs., 25 figs
NEUTRON-INDUCED SWELLING OF Fe-Cr BINARY ALLOYS IN FFTF AT ∼400 DEGREES C
International Nuclear Information System (INIS)
Garner, Francis A.; Greenwood, Lawrence R.; Okita, Taira; Sekimura, Naoto; Wolfer, W. G.
2002-01-01
The purpose of this effort is to determine the influence of dpa rate, He/dpa ratio and composition on the void swelling of simple binary Fe-Cr alloys. Contrary to the behavior of swelling of model fcc Fe-Cr-Ni alloys irradiated in the same FFTF-MOTA experiment, model bcc Fe-Cr alloys do not exhibit a dependence of swelling on dpa rate at approximately 400 degrees C. This is surprising in that an apparent flux-sensitivity was observed in an earlier comparative irradiation of Fe-Cr binaries conducted in EBR-II and FFTF. The difference in behavior is ascribed to the higher helium generation rates of Fe-Cr alloys in EBR-II compared to that of FFTF, and also the fact that lower dpa rates in FFTF are accompanied by progressively lower helium generation rates.
Modifications to HFEF/S for IFR fuel cycle demonstration
International Nuclear Information System (INIS)
Lineberry, M.J.; Phipps, R.D.; Forrester, R.J.; Carnes, M.D.; Rigg, R.H.
1988-01-01
Modifications have begun to the Hot Fuel Examination Facility-South (HFEF/S) in order to demonstrate the technology of the integral fast reactor (IFR) fuel cycle. This paper describes the status of the modifications to the facility and briefly reviews the status of the development of the process equipment. The HFEF/S was the demonstration facility for the early Experimental Breeder Reactor II (EBR-II) melt refining/injection-casting fuel cycle. Then called the Fuel Cycle Facility, ∼400 EBR-II fuel assemblies were recycled in the two hot cells of the facility during the 1964-69 period. Since then it has been utilized as a fuels examination facility. The objective of the IFR fuel cycle program is to upgrade HFEF/S to current standards, install new process equipment, and demonstrate the commercial feasibility of the IFR pyroprocess fuel cycle
Surgical performance of a 405-nm diode laser in treatment of soft tissue
International Nuclear Information System (INIS)
Kato, J; Akashi, G; Moriya, K; Hirai, Y; Hatayama, H; Inoue, A; Miyazaki, H
2008-01-01
The study was conducted to evaluate the surgical performance of a 405-nm diode laser ex vivo. The experiments were carried out using tuna tissue, which was irradiated with a 405-nm diode laser at output powers of 400 mW (694 W/cm 2 ) to 1 W (1735 W/cm 2 ) on a motorized stage moving at a rate of 1 mm/sec. As a control, a 920-nm diode laser was used with the same irradiation conditions. After irradiation, the thickness of ablation and coagulation was measured by stereoscopic microscopy and evaluated statistically. Ablation and coagulation zones were obtained with 405-nm laser irradiation, but not with irradiation at 920 nm. Ablation depth increased significantly with output power and a thick coagulation zone was observed with 405-nm irradiation. The 405-nm diode laser performed well for incising and coagulating soft tissue at a low power density
Wind power - a power source now enabled by power electronics
DEFF Research Database (Denmark)
Blaabjerg, Frede; Iov, Florin
2007-01-01
energy at the end-user should be set up. Deregulation of energy has lowered the investment in larger power plants, which means the need for new electrical power sources may be increased in the near future. Two major technologies will play important roles to solve the future problems. One is to change......The global electrical energy consumption is still rising and there is a steady demand to increase the power capacity. It is expected that it has to be doubled within 20 years. The production, distribution and use of the energy should be as technological efficient as possible and incentives to save...... the electrical power production sources from the conventional, fossil (and short term) based energy sources to renewable energy resources. Another is to use high efficient power electronics in power generation, power transmission/distribution and end-user application. This paper discuss the most emerging...
International Nuclear Information System (INIS)
Brinkman, C.R.; Liu, K.C.; Grossbeck, M.L.
1978-01-01
Cyclic lives obtained from strain-controlled fatigue tests at 593 0 C of specimens irradiated in the experimental breeder reactor II (EBR-II) to a fluence of 1 to 2.63*10 26 neutrons (n)/m 2 (E>0.1 MeV) were compared with predictions based on the method of strain-range partitioning. It was demonstrated that, when appropriate tensile and creep-rupture ductilities were employed, reasonably good estimates of the influence of hold periods and irradiation damage on the fully reversed fatigue life of Type 316 stainless steel could be made. After applicability of this method was demonstrated, ductility values for 20 percent cold-worked Type 316 stainless steel specimens irradiated in a mixed-spectrum fission reactor were used to estimate fusion reactor first-wall lifetime. The ductility values used were from irradiations that simulate the environment of the first wall of a fusion reactor. Neutron wall loadings ranging from 2 to 5 MW/m 2 were used. 27 refs
Comparison between Different Power Sources for Emergency Power Supply at Nuclear Power Plants
International Nuclear Information System (INIS)
Lenasson, Magnus
2015-01-01
Currently the Swedish nuclear power plants are using diesel generator sets and to some extent gas turbines as their emergency AC power sources and batteries as their emergency DC power sources. In the laws governing Swedish nuclear activity, no specific power sources are prescribed. On the other hand, diversification of safety functions should be considered, as well as simplicity and reliability in the safety systems. So far the choices of emergency power sources have been similar between different power plants, and therefore this project investigated a number of alternative power sources and if they are suitable for use as emergency power on nuclear power plants. The goals of the project were to: - Define the parameters that are essential for rending a power source suitable for use at a nuclear power plant. - Present the characteristics of a number of power sources regarding the defined parameters. - Compile the suitability of the different power sources. - Make implementation suggestions for the less conventional of the investigated power sources. (unconventional in the investigated application) 10 different power sources in total have been investigated and to various degrees deemed suitable Out of the 10 power sources, diesel generators, batteries and to some extent gas turbines are seen as conventional technology at the nuclear power plants. In relation to them the other power sources have been assessed regarding diversification gains, foremost with regards to external events. The power sources with the largest diversification gains are: Internal steam turbine, Hydro power, Thermoelectric generators. The work should first and foremost put focus on the fact that under the right circumstances there are power sources that can complement conventional power sources and yield substantial diversification gains. This paper is a shortened version of the report 'Comparison between different power sources for emergency power supply at nuclear power plants'. The
Estados Unidos: militarização em curso no Afeganistão
Directory of Open Access Journals (Sweden)
Virgílio Caixeta Arraes
2009-11-01
Full Text Available O artigo aborda a política externa dos
Estados Unidos com vistas ao Afeganistão. Trata da
prioridade do auxilio militar em detrimento do civil e
/>as conseqüências negativas disso.
The sodium process facility at Argonne National Laboratory - West
International Nuclear Information System (INIS)
Michelbacher, J.A.; Henslee, S.P.; McDermott, M.D.; Price, J.R.; Rosenberg, K.E.; Wells, P.B.
1997-01-01
Argonne National Laboratory - West (ANL-W) has approximately 680,000 liters (180,000 gallons) of raw sodium stored in facilities on site. As mandated by the State of Idaho and the United States Department of Energy (DOE), this sodium must be transformed into a stable condition for land disposal. To comply with this mandate, ANL-W designed and built the Sodium Process Facility (SPF) for the processing of this sodium into a dry, sodium carbonate powder. The major portion of the sodium stored at ANL-W is radioactively contaminated. The SPF was designed to react elemental sodium to sodium carbonate through two-stages involving caustic process and carbonate process steps. The sodium is first reacted to sodium hydroxide in the caustic process step. The caustic process step involves the injection of sodium into a nickel reaction vessel filled with a 50 wt% solution of sodium hydroxide. Water is also injected, controlling the boiling point of the solution. In the carbonate process, the sodium hydroxide is reacted with carbon dioxide to form sodium carbonate. This dry powder, similar in consistency to baking soda, is a waste form acceptable for burial in the State of Idaho as a non-hazardous, radioactive waste. The caustic process was originally designed and built in the 1980s for reacting the 290,000 liters (77,000 gallons) of primary sodium from the Fermi-1 Reactor to sodium hydroxide. The hydroxide was slated to be used to neutralize acid products from the PUREX process at the Hanford site. However, changes in the DOE mission precluded the need for hydroxide and the caustic process was never operated. With the shutdown of the Experimental Breeder Reactor-II (EBR-II), the necessity for a facility to react sodium was identified. In order to comply with Resource Conservation and Recovery Act (RCRA) requirements, the sodium had to be converted into a waste form acceptable for disposal in a Sub-Title D low-level radioactive waste disposal facility. Sodium hydroxide is a RCRA
Pattern-recognition software detecting the onset of failures in complex systems
International Nuclear Information System (INIS)
Mott, J.; King, R.
1987-01-01
A very general mathematical framework for embodying learned data from a complex system and combining it with a current observation to estimate the true current state of the system has been implemented using nearly universal pattern-recognition algorithms and applied to surveillance of the EBR-II power plant. In this application the methodology can provide signal validation and replacement of faulty signals on a near-real-time basis for hundreds of plant parameters. The mathematical framework, the pattern-recognition algorithms, examples of the learning and estimating process, and plant operating decisions made using this methodology are discussed. The entire methodology has been reduced to a set of FORTRAN subroutines which are small, fast, robust and executable on a personal computer with a serial link to the system's data acquisition computer, or on the data acquisition computer itself
Niamtu , J
2001-08-01
Carousel slide presentations have been used for academic and clinical presentations since the late 1950s. However, advances in computer technology have caused a paradigm shift, and digital presentations are quickly becoming standard for clinical presentations. The advantages of digital presentations include cost savings; portability; easy updating capability; Internet access; multimedia functions, such as animation, pictures, video, and sound; and customization to augment audience interest and attention. Microsoft PowerPoint has emerged as the most popular digital presentation software and is currently used by many practitioners with and without significant computer expertise. The user-friendly platform of PowerPoint enables even the novice presenter to incorporate digital presentations into his or her profession. PowerPoint offers many advanced options that, with a minimal investment of time, can be used to create more interactive and professional presentations for lectures, patient education, and marketing. Examples of advanced PowerPoint applications are presented in a stepwise manner to unveil the full power of PowerPoint. By incorporating these techniques, medical practitioners can easily personalize, customize, and enhance their PowerPoint presentations. Complications, pitfalls, and caveats are discussed to detour and prevent misadventures in digital presentations. Relevant Web sites are listed to further update, customize, and communicate PowerPoint techniques.
Directory of Open Access Journals (Sweden)
Yu-Pei Huang
2018-01-01
Full Text Available This paper proposes a modified maximum power point tracking (MPPT algorithm for photovoltaic systems under rapidly changing partial shading conditions (PSCs. The proposed algorithm integrates a genetic algorithm (GA and the firefly algorithm (FA and further improves its calculation process via a differential evolution (DE algorithm. The conventional GA is not advisable for MPPT because of its complicated calculations and low accuracy under PSCs. In this study, we simplified the GA calculations with the integration of the DE mutation process and FA attractive process. Results from both the simulation and evaluation verify that the proposed algorithm provides rapid response time and high accuracy due to the simplified processing. For instance, evaluation results demonstrate that when compared to the conventional GA, the execution time and tracking accuracy of the proposed algorithm can be, respectively, improved around 69.4% and 4.16%. In addition, in comparison to FA, the tracking speed and tracking accuracy of the proposed algorithm can be improved around 42.9% and 1.85%, respectively. Consequently, the major improvement of the proposed method when evaluated against the conventional GA and FA is tracking speed. Moreover, this research provides a framework to integrate multiple nature-inspired algorithms for MPPT. Furthermore, the proposed method is adaptable to different types of solar panels and different system formats with specifically designed equations, the advantages of which are rapid tracking speed with high accuracy under PSCs.
Water Power Research | Water Power | NREL
Water Power Research Water Power Research NREL conducts water power research; develops design tools ; and evaluates, validates, and supports the demonstration of innovative water power technologies. Photo of a buoy designed around the oscillating water column principle wherein the turbine captures the
Power control device of an atomic power plant
International Nuclear Information System (INIS)
Ootsuka, Shiro; Ito, Takero.
1980-01-01
Purpose: To improve the power controllability of an atomic power plant by improving the controllability, response and stability of the recirculation flow rate. Constitution: The power control device comprises a power detector of the reactor, which detects and operates the reactor power from the thermal power, neutron flux or the process quantity controlling the same, and a deviation detector which seeks deviation between the power signal of the power detector and the power set value of the reactor or power station. By use of the power control device constituted in this manner, the core flow rate is regulated by the power signal of the deviation detector thereby to control the power. (Aizawa, K.)
DC power supplies power management and surge protection for power electronic systems
Kularatna, Nihal
2011-01-01
Modern electronic systems, particularly portable consumer electronic systems and processor based systems, are power hungry, compact, and feature packed. This book presents the most essential summaries of the theory behind DC-DC converter topologies of both linear and switching types. The text discusses power supply characteristics and design specifications based on new developments in power management techniques and modern semiconductors entering into the portable electronics market. The author also addresses off-the-line power supplies, digital control of power supply, power supply protection
Power generation by nuclear power plants
International Nuclear Information System (INIS)
Bacher, P.
2004-01-01
Nuclear power plays an important role in the world, European (33%) and French (75%) power generation. This article aims at presenting in a synthetic way the main reactor types with their respective advantages with respect to the objectives foreseen (power generation, resources valorization, waste management). It makes a fast review of 50 years of nuclear development, thanks to which the nuclear industry has become one of the safest and less environmentally harmful industry which allows to produce low cost electricity: 1 - simplified description of a nuclear power generation plant: nuclear reactor, heat transfer system, power generation system, interface with the power distribution grid; 2 - first historical developments of nuclear power; 3 - industrial development and experience feedback (1965-1995): water reactors (PWR, BWR, Candu), RBMK, fast neutron reactors, high temperature demonstration reactors, costs of industrial reactors; 4 - service life of nuclear power plants and replacement: technical, regulatory and economical lifetime, problems linked with the replacement; 5 - conclusion. (J.S.)
AVALIAÇÃO DE INICIADORES E PROTOCOLO PARA O DIAGNÓSTICO DA PANCITOPENIA TROPICAL CANINA POR PCR
Directory of Open Access Journals (Sweden)
Daniel C. L. Linhares
2006-10-01
Full Text Available Este trabalho foi desenvolvido com o objetivo de padronizar um protocolo para a reação em cadeia da polimerase (PCR e selecionar oligonucleotídeos iniciadores para a detecção específica de Ehrlichia canis, em uma única etapa de reação. Inicialmente foram obtidas seqüências depositadas no Genbank, referentes ao gene que codifica o 16S rRNA das espécies E. canis (número de acesso = AF162860, E. ewingii (U96436, E. platys (AF1567844, E. chaffeensis, (U86665, E. phagocytophila genogrupo (U02521, E. bovis (AF294789 e E. risticii (M21290, as quais foram submetidas ao alinhamento genético para a construção dos iniciadores. Do alinhamento foi selecionado, a partir de uma região semiconservada, um iniciador específico para E. canis, designado EBR1 (5’-cctctggctataggaaattg- 3’ e, de uma região conservada, um iniciador genérico EBR5 (5’-ggagtgcttaacgcgttag- 3’. Paralelamente foram obtidas amostras de sangue de dez cães que apresentavam infecção aguda por E. canis, confirmado pela presença de mórulas intracitoplasmáticas, características da riquétsia, em células mononucleares sangüíneas. O DNA genômico extraído dessas amostras foi utilizado para a avaliação da reação de PCR, empregando-se um protocolo adaptado de outros autores e o par de oligos EBR1/EBR5, selecionado neste trabalho. A reação de PCR apresentou resultados positivos para os 10 isolados de E. canis, amplificando o fragmento esperado de 765 pares de bases do gene 16S rRNA. Resultados negativos verificados nas reações de PCR para amostras de DNA genômico de Babesia canis, Hepatozoon canis, Haemobartonella sp., Trypanosoma evansi e do hospedeiro (Canis familiaris livre de infecção indicaram a segurança do método quanto à especificidade para a discriminação de E. canis. PALAVRAS-CHAVE: Cães, Ehrlichia canis, erliquiose canina, hemoparasitose, reação em cadeia da polimerase
Autonomous power networks based power system
International Nuclear Information System (INIS)
Jokic, A.; Van den Bosch, P.P.J.
2006-01-01
This paper presented the concept of autonomous networks to cope with this increased complexity in power systems while enhancing market-based operation. The operation of future power systems will be more challenging and demanding than present systems because of increased uncertainties, less inertia in the system, replacement of centralized coordinating activities by decentralized parties and the reliance on dynamic markets for both power balancing and system reliability. An autonomous network includes the aggregation of networked producers and consumers in a relatively small area with respect to the overall system. The operation of an autonomous network is coordinated and controlled with one central unit acting as an interface between internal producers/consumers and the rest of the power system. In this study, the power balance problem and system reliability through provision of ancillary services was formulated as an optimization problem for the overall autonomous networks based power system. This paper described the simulation of an optimal autonomous network dispatching in day ahead markets, based on predicted spot prices for real power, and two ancillary services. It was concluded that large changes occur in a power systems structure and operation, most of them adding to the uncertainty and complexity of the system. The introduced concept of an autonomous power network-based power system was shown to be a realistic and consistent approach to formulate and operate a market-based dispatch of both power and ancillary services. 9 refs., 4 figs
An Enhanced Islanding Microgrid Reactive Power, Imbalance Power, and Harmonic Power Sharing Scheme
DEFF Research Database (Denmark)
He, Jinwei; Lin, Yun Wei; Blaabjerg, Frede
2015-01-01
To address inaccurate power sharing problems in autonomous islanding microgrids, an enhanced droop control method through online virtual impedance adjustment is proposed. First, a term associated with DG reactive power, imbalance power, or harmonic power is added to the conventional real power...
The EBR-II spent fuel treatment program
International Nuclear Information System (INIS)
Lineberry, M.J.; McFarlane, H.F.
1995-01-01
Argonne National Laboratory has refurbished and equipped an existing hot cell facility for demonstrating a high-temperature electrometallurgical process for treating spent nuclear fuel from the Experimental Breeder Reactor-11. Two waste forms will be produced and qualified for geologic disposal of the fission and activation products. Relatively pure uranium will be separated for storage. Following additional development, transuranium elements will be blended into one of the high-level waste streams. The spent fuel treatment program will help assess the viability of electrometallurgical technology as a spent fuel management option
EBR-II Reactor Physics Benchmark Evaluation Report
Energy Technology Data Exchange (ETDEWEB)
Pope, Chad L. [Idaho State Univ., Pocatello, ID (United States); Lum, Edward S [Idaho State Univ., Pocatello, ID (United States); Stewart, Ryan [Idaho State Univ., Pocatello, ID (United States); Byambadorj, Bilguun [Idaho State Univ., Pocatello, ID (United States); Beaulieu, Quinton [Idaho State Univ., Pocatello, ID (United States)
2017-12-28
This report provides a reactor physics benchmark evaluation with associated uncertainty quantification for the critical configuration of the April 1986 Experimental Breeder Reactor II Run 138B core configuration.
Electric power system / emergency power supply
International Nuclear Information System (INIS)
Dorn, P.G.
1980-01-01
One factor of reliability of reactor safety systems is the integrity of the power supply. The purpose of this paper is a review and a discussion of the safety objectives required for the planning, licensing, manufacture and erection of electrical power systems and components. The safety aspects and the technical background of the systems for - the electric auxiliary power supply system and - the emergency power supply system are outlined. These requirements result specially from the safety standards which are the framework for the studies of safety analysis. The overall and specific requirements for the electrical power supply of the safety systems are demonstrated on a 1300 MW standard nuclear power station with a pressurized water reactor. (orig.)
Wind power in modern power systems
DEFF Research Database (Denmark)
Chen, Zhe
2013-01-01
In recent years, wind power is experiencing a rapid growth, and large-scale wind turbines/wind farms have been developed and connected to power systems. However, the traditional power system generation units are centralized located synchronous generators with different characteristics compared...... with wind turbines. This paper presents an overview of the issues about integrating large-scale wind power plants into modern power systems. Firstly, grid codes are introduced. Then, the main technical problems and challenges are presented. Finally, some possible technical solutions are discussed....
Stockholm Power Tech. Power systems
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-11-01
The proceedings from this symposium is presented in six volumes: Invited speakers` sessions; Power systems; Power electronics; High-voltage technology; Electrical machines and drives; and Information and control systems. This report covers the power systems volume. Separate abstracts have been prepared for 141 of the 145 papers in this volume
Stockholm Power Tech. Power systems
International Nuclear Information System (INIS)
1995-01-01
The proceedings from this symposium is presented in six volumes: Invited speakers' sessions; Power systems; Power electronics; High-voltage technology; Electrical machines and drives; and Information and control systems. This report covers the power systems volume. Separate abstracts have been prepared for 141 of the 145 papers in this volume
Roadmap for disposal of Electrorefiner Salt as Transuranic Waste.
Energy Technology Data Exchange (ETDEWEB)
Rechard, Robert P. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Trone, Janis R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Kalinina, Elena Arkadievna [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Wang, Yifeng [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hadgu, Teklu [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Sanchez, Lawrence C. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-12-01
The experimental breeder reactor (EBR-II) used fuel with a layer of sodium surrounding the uranium-zirconium fuel to improve heat transfer. Disposing of EBR-II fuel in a geologic repository without treatment is not prudent because of the potentially energetic reaction of the sodium with water. In 2000, the US Department of Energy (DOE) decided to treat the sodium-bonded fuel with an electrorefiner (ER), which produces metallic uranium product, a metallic waste, mostly from the cladding, and the salt waste in the ER, which contains most of the actinides and fission products. Two waste forms were proposed for disposal in a mined repository; the metallic waste, which was to be cast into ingots, and the ER salt waste, which was to be further treated to produce a ceramic waste form. However, alternative disposal pathways for metallic and salt waste streams may reduce the complexity. For example, performance assessments show that geologic repositories can easily accommodate the ER salt waste without treating it to form a ceramic waste form. Because EBR-II was used for atomic energy defense activities, the treated waste likely meets the definition of transuranic waste. Hence, disposal at the Waste Isolation Pilot Plant (WIPP) in southern New Mexico, may be feasible. This report reviews the direct disposal pathway for ER salt waste and describes eleven tasks necessary for implementing disposal at WIPP, provided space is available, DOE decides to use this alternative disposal pathway in an updated environmental impact statement, and the State of New Mexico grants permission.
Can cyclist safety be improved with intelligent transport systems?
Silla, Anne; Leden, Lars; Rämä, Pirkko; Scholliers, Johan; Van Noort, Martijn; Bell, Daniel
2017-08-01
In recent years, Intelligent Transport Systems (ITS) have assisted in the decrease of road traffic fatalities, particularly amongst passenger car occupants. Vulnerable Road Users (VRUs) such as pedestrians, cyclists, moped riders and motorcyclists, however, have not been that much in focus when developing ITS. Therefore, there is a clear need for ITS which specifically address VRUs as an integrated element of the traffic system. This paper presents the results of a quantitative safety impact assessment of five systems that were estimated to have high potential to improve the safety of cyclists, namely: Blind Spot Detection (BSD), Bicycle to Vehicle communication (B2V), Intersection safety (INS), Pedestrian and Cyclist Detection System+Emergency Braking (PCDS+EBR) and VRU Beacon System (VBS). An ex-ante assessment method proposed by Kulmala (2010) targeted to assess the effects of ITS for cars was applied and further developed in this study to assess the safety impacts of ITS specifically designed for VRUs. The main results of the assessment showed that all investigated systems affect cyclist safety in a positive way by preventing fatalities and injuries. The estimates considering 2012 accident data and full penetration showed that the highest effects could be obtained by the implementation of PCDS+EBR and B2V, whereas VBS had the lowest effect. The estimated yearly reduction in cyclist fatalities in the EU-28 varied between 77 and 286 per system. A forecast for 2030, taking into accounts the estimated accident trends and penetration rates, showed the highest effects for PCDS+EBR and BSD. Copyright © 2016 Elsevier Ltd. All rights reserved.
The impact of binaural beats on creativity
Directory of Open Access Journals (Sweden)
Susan A. Reedijk
2013-11-01
Full Text Available Human creativity relies on a multitude of cognitive processes, some of which are influenced by the neurotransmitter dopamine. This suggests that creativity could be enhanced by interventions that either modulate the production or transmission of dopamine directly, or affect dopamine-driven processes. In the current study we hypothesized that creativity can be influenced by means of binaural beats, an auditory illusion that is considered a form of cognitive entrainment that operates through stimulating neuronal phase locking. We aimed to investigate whether binaural beats affect creative performance at all, whether they affect divergent thinking, convergent thinking, or both, and whether possible effects may be mediated by the individual striatal dopamine level. Binaural beats were presented at alpha and gamma frequency. Participants completed a divergent and a convergent thinking task to assess two important functions of creativity, and filled out the Positive And Negative Affect Scale – mood State questionnaire (PANAS-S and affect grid to measure current mood. Dopamine levels in the striatum were estimated using spontaneous eye blink rates (EBRs. Results showed that binaural beats, regardless of the presented frequency, can affect divergent but not convergent thinking. Individuals with low EBRs mostly benefitted from alpha binaural beat stimulation, while individuals with high EBR were unaffected or even impaired by both alpha and gamma binaural beats. This suggests that binaural beats, and possibly other forms of cognitive entrainment, are not suited for a one-size-fits-all approach, and that individual cognitive-control systems need to be taken into account when studying cognitive enhancement methods.
The impact of binaural beats on creativity.
Reedijk, Susan A; Bolders, Anne; Hommel, Bernhard
2013-01-01
Human creativity relies on a multitude of cognitive processes, some of which are influenced by the neurotransmitter dopamine. This suggests that creativity could be enhanced by interventions that either modulate the production or transmission of dopamine directly, or affect dopamine-driven processes. In the current study we hypothesized that creativity can be influenced by means of binaural beats, an auditory illusion that is considered a form of cognitive entrainment that operates through stimulating neuronal phase locking. We aimed to investigate whether binaural beats affect creative performance at all, whether they affect divergent thinking, convergent thinking, or both, and whether possible effects may be mediated by the individual striatal dopamine level. Binaural beats were presented at alpha and gamma frequency. Participants completed a divergent and a convergent thinking task to assess two important functions of creativity, and filled out the Positive And Negative Affect Scale-mood State questionnaire (PANAS-S) and an affect grid to measure current mood. Dopamine levels in the striatum were estimated using spontaneous eye blink rates (EBRs). Results showed that binaural beats, regardless of the presented frequency, can affect divergent but not convergent thinking. Individuals with low EBRs mostly benefitted from alpha binaural beat stimulation, while individuals with high EBRs were unaffected or even impaired by both alpha and gamma binaural beats. This suggests that binaural beats, and possibly other forms of cognitive entrainment, are not suited for a one-size-fits-all approach, and that individual cognitive-control systems need to be taken into account when studying cognitive enhancement methods.
Thermoelectric power generator for variable thermal power source
Bell, Lon E; Crane, Douglas Todd
2015-04-14
Traditional power generation systems using thermoelectric power generators are designed to operate most efficiently for a single operating condition. The present invention provides a power generation system in which the characteristics of the thermoelectrics, the flow of the thermal power, and the operational characteristics of the power generator are monitored and controlled such that higher operation efficiencies and/or higher output powers can be maintained with variably thermal power input. Such a system is particularly beneficial in variable thermal power source systems, such as recovering power from the waste heat generated in the exhaust of combustion engines.
Emergency power systems at nuclear power plants
International Nuclear Information System (INIS)
1982-01-01
This Guide applies to nuclear power plants for which the total power supply comprises normal power supply (which is electric) and emergency power supply (which may be electric or a combination of electric and non-electric). In its present form the Guide provides general guidance for all types of emergency power systems (EPS) - electric and non-electric, and specific guidance (see Appendix A) on the design principles and the features of the emergency electric power system (EEPS). Future editions will include a second appendix giving specific guidance on non-electric power systems. Section 3 of this Safety Guide covers information on considerations that should be taken into account relative to the electric grid, the transmission lines, the on-site electrical supply system, and other alternative power sources, in order to provide high overall reliability of the power supply to the EPS. Since the nuclear power plant operator does not usually control off-site facilities, the discussion of methods of improving off-site reliability does not include requirements for facilities not under the operator's control. Sections 4 to 11 of this Guide provide information, recommendations and requirements that would apply to any emergency power system, be it electric or non-electric
Tracking Real-Time Changes in Working Memory Updating and Gating with the Event-Based Eye-Blink Rate
Rac-Lubashevsky, R.; Slagter, H.A.; Kessler, Y.
2017-01-01
Effective working memory (WM) functioning depends on the gating process that regulates the balance between maintenance and updating of WM. The present study used the event-based eye-blink rate (ebEBR), which presumably reflects phasic striatal dopamine activity, to examine how the cognitive
CSIR Research Space (South Africa)
Majozi, Nobuhle P
2017-07-01
Full Text Available available energy (net radiation (Rn) less soil heat (G)), and the energy balance ratio (EBR). Partitioning of the surface energy during the wet and dry seasons was also investigated, as well as how it is affected by atmospheric vapour pressure deficit (VPD...
International Nuclear Information System (INIS)
Satheesh Kumar Bhandary, B.; Sharmila, K.P.; Suchetha Kumari, N.; Vadisha Bhat, S.; Sherly, Sharmila; Sanjeev, Ganesh
2013-01-01
Radiation therapy has been used in cancer treatment for many decades; Although effective in killing tumor cells, ROS produced in radiotherapy threaten the integrity and survival of surrounding normal cells. ROS are scavenged by radioprotectors before they can interact with biochemical molecules, thus reducing harmful effects of radiation. The pomegranate, Punica granatum L., an ancient, mystical, and highly distinctive fruit, is the predominant member of the Punicaceae family. It is used in several systems of medicine for a variety of ailments. The objective of the present study was to investigate the protective effects of ethanolic extracts of pomegranate whole fruit (EPWF) and seeds (EPS) and Synthetic Ellagic acid (EA) against Electron Beam Radiation (EBR) induced DNA damage and biochemical alterations in Swiss Albino mice. The extracts and synthetic compound were assessed for its radical scavenging property by DPPH radical scavenging and Ferric Reducing Antioxidant Power assays. The animals were treated with 200 mg/kg body wt. of pomegranate extracts and Ellagic acid for 15 days before exposure to 6 Gy of EBR. Radiation induced DNA damage was assessed by comet assay in the peripheral blood lymphocytes of mice. The biochemical estimations were carried out in the serum and RBC lysate of the animals. The plant extracts and synthetic compound exhibited good radical scavenging and reducing properties.The pretreated animals before irradiation caused a reduction in the comet length, olive tail moment, % DNA in tail when compared to irradiated group. The biochemical parameters such as lipid peroxidation was significantly depleted in the treated groups when compared to irradiated group followed by significant elevation in reduced glutathione. Our findings indicate the ameliorating effects of pomegranate extracts and synthetic ellagic acid on radiation induced DNA damage and biochemical changes in mice may be due to its free radical scavenging and increased antioxidant
Power Burst Facility: power oscillation problem
International Nuclear Information System (INIS)
Lussie, W.G.; Wadkins, R.P.; Wells, R.A.
1975-01-01
In late 1973 PBF achieved a power level of 15 MW. During this period of operation fluctuations in reactor power were observed. Many possible causes of these fluctuations were considered and a number of nuclear and non-nuclear tests were conducted. Initial instrumentation installed in the core showed coolant outlet temperature variations of 10 0 F for several fuel cannisters and approximately 10 percent power variations at 15 MW. Power spectral density analysis showed a predominant frequency of 0.05 to 0.06 HZ. The testing program to determine the cause of the power oscillations is described
PowerFactory applications for power system analysis
Gonzalez-Longatt, Francisco
2014-01-01
This book presents a comprehensive set of guidelines and applications of DIgSILENT PowerFactory, an advanced power system simulation software package, for different types of power systems studies. Written by specialists in the field, it combines expertise and years of experience in the use of DIgSILENT PowerFactory with a deep understanding of power systems analysis. These complementary approaches therefore provide a fresh perspective on how to model, simulate and analyse power systems. It presents methodological approaches for modelling of system components, including both classical and non-
Cost of nuclear power generation judged by power rate
International Nuclear Information System (INIS)
Hirai, Takaharu
1981-01-01
According to estimation guidance, power rates in general are the proper cost plus the specific compensation and adjustment addition. However, the current system of power rates is of power-source development promotion type involving its tax. The structure of power rate determination must be restudied now especially in connection of nuclear power generation. The cost of nuclear power generation as viewed from power rate is discussed as follows: the fear of military application of power plants, rising plant construction costs, the loophole in fuel cost calculation, unreasonable unit power cost, depreciation and repair cost, business compensation, undue business compensation in nuclear power, the costs of nuclear waste management, doubt concerning nuclear power cost, personnel, pumping-up and power transmission costs in nuclear power, energy balance analysis, nuclear power viewed in entropy, the suppression of power consumption. (J.P.N.)
DEFF Research Database (Denmark)
He, Jinwei; Li, Yun Wei; Blaabjerg, Frede
2013-01-01
To address inaccurate power sharing problems in autonomous islanding microgrids, an enhanced droop control method through adaptive virtual impedance adjustment is proposed. First, a term associated with DG reactive power, imbalance power or harmonic power is added to the conventional real power...
Smart Power Supply for Battery-Powered Systems
Krasowski, Michael J.; Greer, Lawrence; Prokop, Norman F.; Flatico, Joseph M.
2010-01-01
A power supply for battery-powered systems has been designed with an embedded controller that is capable of monitoring and maintaining batteries, charging hardware, while maintaining output power. The power supply is primarily designed for rovers and other remote science and engineering vehicles, but it can be used in any battery alone, or battery and charging source applications. The supply can function autonomously, or can be connected to a host processor through a serial communications link. It can be programmed a priori or on the fly to return current and voltage readings to a host. It has two output power busses: a constant 24-V direct current nominal bus, and a programmable bus for output from approximately 24 up to approximately 50 V. The programmable bus voltage level, and its output power limit, can be changed on the fly as well. The power supply also offers options to reduce the programmable bus to 24 V when the set power limit is reached, limiting output power in the case of a system fault detected in the system. The smart power supply is based on an embedded 8051-type single-chip microcontroller. This choice was made in that a credible progression to flight (radiation hard, high reliability) can be assumed as many 8051 processors or gate arrays capable of accepting 8051-type core presently exist and will continue to do so for some time. To solve the problem of centralized control, this innovation moves an embedded microcontroller to the power supply and assigns it the task of overseeing the operation and charging of the power supply assets. This embedded processor is connected to the application central processor via a serial data link such that the central processor can request updates of various parameters within the supply, such as battery current, bus voltage, remaining power in battery estimations, etc. This supply has a direct connection to the battery bus for common (quiescent) power application. Because components from multiple vendors may have
Compensating active power imbalances in power system with large-scale wind power penetration
DEFF Research Database (Denmark)
Basit, Abdul; Hansen, Anca Daniela; Altin, Müfit
2016-01-01
Large-scale wind power penetration can affectthe supply continuity in the power system. This is a matterof high priority to investigate, as more regulating reservesand specified control strategies for generation control arerequired in the future power system with even more highwind power penetrat...
Military power requirements and backup power considerations
International Nuclear Information System (INIS)
Botts, T.E.
1986-01-01
All US Air Force (USAF) facilities have certain critical power requirements that must be met in order to carry out their mission successfully. Internal USAF studies have shown that the mission can degrade precipitously as the available power decreases below the mission critical level. Now, more than ever before, the military and private industry are finding that certain functions, such as automated data processing and automated process control, respond catastrophically to power reductions. Furthermore, increased reliance on electrical power means, in the case of the Air Force, that critical power requirements are anticipated to increase by half over the next 15 yr. For these reasons and others, the USAF is investigating several means of improving the availability of electric power under adverse conditions above that which can be provided by an off-base supplier. Among the approaches to this problem being pursued at this time are a program to improve all sorts of generator sets on a service-wide basis and the Multimegawatt Terrestrial Power (MTP) Program, which is pursuing the design and testing of a small dedicated nuclear power source to provide critical mission power. The purpose of this paper is to provide some insight into some of the issues associated with USAF power programs
Cerda-Flores, R M; Barton, S A; Marty-Gonzalez, L F; Rivas, F; Chakraborty, R
1999-07-01
A method for estimating the general rate of nonpaternity in a population was validated using phenotype data on seven blood groups (A1A2BO, MNSs, Rh, Duffy, Lutheran, Kidd, and P) on 396 mother, child, and legal father trios from Nuevo León, Mexico. In all, 32 legal fathers were excluded as the possible father based on genetic exclusions at one or more loci (combined average exclusion probability of 0.694 for specific mother-child phenotype pairs). The maximum likelihood estimate of the general nonpaternity rate in the population was 0.118 +/- 0.020. The nonpaternity rates in Nuevo León were also seen to be inversely related with the socioeconomic status of the families, i.e., the highest in the low and the lowest in the high socioeconomic class. We further argue that with the moderately low (69.4%) power of exclusion for these seven blood group systems, the traditional critical values of paternity index (PI > or = 19) were not good indicators of true paternity, since a considerable fraction (307/364) of nonexcluded legal fathers had a paternity index below 19 based on the seven markers. Implications of these results in the context of genetic-epidemiological studies as well as for detection of true fathers for child-support adjudications are discussed, implying the need to employ a battery of genetic markers (possibly DNA-based tests) that yield a higher power of exclusion. We conclude that even though DNA markers are more informative, the probabilistic approach developed here would still be needed to estimate the true rate of nonpaternity in a population or to evaluate the precision of detecting true fathers.
DEFF Research Database (Denmark)
Basit, Abdul; Hansen, Anca Daniela; Sørensen, Poul Ejnar
2017-01-01
Highly wind power integrated power system requires continuous active power regulation to tackle the power imbalances resulting from the wind power forecast errors. The active power balance is maintained in real-time with the automatic generation control and also from the control room, where...... power system model. The power system model takes the hour-ahead regulating power plan from power balancing model and the generation and power exchange capacities for the year 2020 into account. The real-time impact of power balancing in a highly wind power integrated power system is assessed...
Hybrid wind power balance control strategy using thermal power, hydro power and flow batteries
Gelažanskas, Linas; Baranauskas, Audrius; Gamage, Kelum A.A.; Ažubalis, Mindaugas
2016-01-01
The increased number of renewable power plants pose threat to power system balance. Their intermittent nature makes it very difficult to predict power output, thus either additional reserve power plants or new storage and control technologies are required. Traditional spinning reserve cannot fully compensate sudden changes in renewable energy power generation. Using new storage technologies such as flow batteries, it is feasible to balance the variations in power and voltage within very short...
Power manager and method for managing power
Burchard, A.T.; Kersten, G.; Molnos, A.M.; Milutinovic, A.; Goossens, K.G.W.; Steffens, E.F.M.
2009-01-01
A power manager (106) and method for managing the power supplied to an electronic device is provided. Furthermore, a system wherein the power supplied to an electronic device is managed is provided. The power manager (106) is operative to monitor a hardware monitor (104) during a monitoring time
Wireless powering for low-power distributed sensors
Directory of Open Access Journals (Sweden)
Popović Zoya B.
2006-01-01
Full Text Available In this paper, an overview of the field of wireless powering is presented with an emphasis on low-power applications. Several rectenna elements and arrays are discussed in more detail: (1 a 10-GHz array for powering sensors in aircraft wings; (2 a single antenna in the 2.4-GHz ISM band for low-power assisted-living sensors; and (3 a broadband array for power harvesting in the 2-18GHz frequency range.
Impacts of Wind Power on Power System Stability
Vittal, E.; Keane, A.; Slootweg, J.G.; Kling, W.L.; Ackermann, T.
2012-01-01
This chapter examines how wind power will impact the stability of power systems. It focuses on the three aspects of power system stability: voltage stability, rotor angle stability and frequency stability. It completes a detailed analysis as to how wind power in power systems will impact the
Belmonte-Reche, Efres; Martínez-García, Marta; Guédin, Aurore; Zuffo, Michela; Arévalo-Ruiz, Matilde; Doria, Filippo; Campos-Salinas, Jenny; Maynadier, Marjorie; López-Rubio, José Juan; Freccero, Mauro; Mergny, Jean-Louis; Pérez-Victoria, José María; Morales, Juan Carlos
2018-02-08
G-quadruplexes (G4) are DNA secondary structures that take part in the regulation of gene expression. Putative G4 forming sequences (PQS) have been reported in mammals, yeast, bacteria, and viruses. Here, we present PQS searches on the genomes of T. brucei, L. major, and P. falciparum. We found telomeric sequences and new PQS motifs. Biophysical experiments showed that EBR1, a 29 nucleotide long highly repeated PQS in T. brucei, forms a stable G4 structure. G4 ligands based on carbohydrate conjugated naphthalene diimides (carb-NDIs) that bind G4's including hTel could bind EBR1 with selectivity versus dsDNA. These ligands showed important antiparasitic activity. IC 50 values were in the nanomolar range against T. brucei with high selectivity against MRC-5 human cells. Confocal microscopy confirmed these ligands localize in the nucleus and kinetoplast of T. brucei suggesting they can reach their potential G4 targets. Cytotoxicity and zebrafish toxicity studies revealed sugar conjugation reduces intrinsic toxicity of NDIs.
Feasibility of calibration of liquid sodium flowmeters by neutron activation techniques
International Nuclear Information System (INIS)
Kehler, P.
1976-07-01
Velocities of fluids in pipes can be measured by injecting radioactive tracers into the fluid and recording the activity downstream of the injection point. One convenient method of injecting radioactive tracers is by neutron activation of the fluid itself. The present report describes a FORTRAN program that can be used for the prediction of the counting rates of fluid flow tests performed with a pulsed neutron source and a scintillation detector. The program models the flow profile and the mixing of the fluid, the attenuation of neutrons and gamma rays in the fluid, and the geometric arrangement of the source and the detector. Using this program, an experiment for the measurement of the secondary sodium flow of the EBR-II was optimized. A pulsed D,T neutron source and a 5 in. x 5 in. NaI detector will be used in the EBR-II test. Under optimized conditions, the expected accuracy of the flow measurement is about 2 percent
Thermal Expansion Property of U-Zr Alloys and U-Zr-Ce Alloys as a Surrogate Metallic Fuel for SFR
International Nuclear Information System (INIS)
Kim, Sun Ki; Lee, Jong Tak; Oh, Seok Jin; Ko, Young Mo; Kim, Ki Hwan; Woo, Youn Myung; Lee, Chan Bock
2010-01-01
Metal fuels was selected for fueling many of the first reactors in the US, including the Experimental Breeder Reactor-I (EBR-I) and the Experimental Breeder Reactor-II (EBR-II) in Idaho, the FERMI-I reactor, and the Dounreay Fast Reactor (DFR) in the UK. Metallic U.Pu.Zr alloys were the reference fuel for the US Integral Fast Reactor (IFR) program. An extensive database on the performance of advanced metal fuels was generated as a result of the operation of these reactors and the IFR program. In this study, the U-Zr binary alloys and U-Zr-Ce ternary alloys as surrogate metallic fuel were fabricated in lower pressure Ar environment by gravity casting. The melt temperature was approximately 1,500 .deg. C. Thermal expansion of the fuel during normal operation is related with fuel performance in a reactor. Therefore, it is necessary to investigate the thermal expansion of the fuel in order to warrant a good prediction the fuel performance
International Nuclear Information System (INIS)
Dunn, F.E.
1994-01-01
As part of a program to obtain realistic, as opposed to excessively conservative, analysis of reactor transients, a multiple pin treatment for the analysis of intra-subassembly thermal hydraulics has been included in the SASSYS-1 liquid metal reactor systems analysis code. This new treatment has made possible a whole new level of verification for the code. The code can now predict the steady-state and transient responses of individual thermocouples within instrumented subassemlies in a reactor, rather than just predicting average temperatures for a subassembly. Very good agreement has been achieved between code predictions and the experimental measurements of steady-state and transient temperatures and flow rates in the Shutdown Heat Removal Tests in the EBR-II Reactor. Detailed multiple pin calculations for blanket subassemblies in the EBR-II reactor demonstrate that the actual steady-state and transient peak temperatures in these subassemblies are significantly lower than those that would be calculated by simpler models
Nuclear power/water pumping-up composite power plant
International Nuclear Information System (INIS)
Okamura, Kiyoshi.
1995-01-01
In a nuclear power/water pumping-up composite power plant, a reversible pump for pumping-up power generation connected to a steam turbine is connected to an upper water reservoir and a lower water reservoir. A pumping-up steam turbine for driving the turbine power generator, a hydraulic pump for driving water power generator by water flowing from the upper water reservoir and a steam turbine for driving the pumping-up pump by steams from a nuclear reactor are disposed. When power demand is small during night, the steam turbine is rotated by steams of the reactor, to pump up the water in the lower water reservoir to the upper water reservoir by the reversible pump. Upon peak of power demand during day time, power is generated by the steams of the reactor, as well as the reversible pump is rotated by the flowing water from the upper water reservoir to conduct hydraulic power generation. Alternatively, hydraulic power generation is conducted by flowing water from the upper reservoir. Since the number of energy conversion steps in the combination of nuclear power generation and pumping-up power generation is reduced, energy loss is reduced and utilization efficiency can be improved. (N.H.)
Comprehensive Power Losses Model for Electronic Power Transformer
DEFF Research Database (Denmark)
Yue, Quanyou; Li, Canbing; Cao, Yijia
2018-01-01
and considering the impact of the non-unity power factor and the three-phase unbalanced current, the overall power losses in the distribution network when using the EPT to replace the conventional transformer is analyzed, and the conditions in which the application of the EPT can cause less power losses...... reduced power losses in the distribution network require a comprehensive consideration when comparing the power losses of theEPT and conventional transformer. In this paper, a comprehensive power losses analysis model for the EPT in distribution networks is proposed. By analyzing the EPT self-losses......The electronic power transformer (EPT) has highe rpower losses than the conventional transformer. However, the EPT can correct the power factor, compensate the unbalanced current and reduce the line power losses in the distribution network.Therefore, the higher losses of the EPT and the consequent...
Comprehensive Power Losses Model for Electronic Power Transformer
DEFF Research Database (Denmark)
Yue, Quanyou; Li, Canbing; Cao, Yijia
2018-01-01
The electronic power transformer (EPT) has highe rpower losses than the conventional transformer. However, the EPT can correct the power factor, compensate the unbalanced current and reduce the line power losses in the distribution network.Therefore, the higher losses of the EPT and the consequent...... reduced power losses in the distribution network require a comprehensive consideration when comparing the power losses of theEPT and conventional transformer. In this paper, a comprehensive power losses analysis model for the EPT in distribution networks is proposed. By analyzing the EPT self......-losses and considering the impact of the non-unity power factor and the three-phase unbalanced current, the overall power losses in the distribution network when using the EPT to replace the conventional transformer is analyzed, and the conditions in which the application of the EPT can cause less power losses...
Selectivity of power system protections at power swings in power system
Directory of Open Access Journals (Sweden)
Jan Machowski
2012-12-01
Full Text Available The paper discusses out-of-step protection systems such as: generator pole slip protections, out of step tripping protections, distance protections of step-up transformer, distance protections of transmission lines and transformers, power swing blocking, and special out-of-step protection. It is shown that all these protections make up a protection system, to which a setting concept uniform for the entire power system has to be applied. If a power system is inappropriately equipped with these protections, or their settings are inappropriate, they may operate unselectively, thus contributing to the development of power system blackouts. In the paper the concepts for a real power system are given for the two stages: target stage fully compliant with selectivity criteria, and transitional stage between the current and target stages.
Power Ramp Limitation capabilities of Large PV Power Plants with Active Power Reserves
DEFF Research Database (Denmark)
Bogdan, Craciun; Kerekes, Tamas; Sera, Dezso
2017-01-01
Power Ramp Limitation (PRL) is likely to become a requirement for large scale photovoltaic power plants (LPVPPs) in order to allow the increase of PV penetration levels. Especially in islands with reduced inertia capability, this problem is more stringent: high power ramp can be caused by either...... fast irradiance changes or other participant generators for example wind power, or loads. In order to compensate for the power mismatch, LPVPPs must use Active Power Reserve (APR), by either curtailment or auxiliary storage. The paper proposes a PRL control structure for dynamic APR sizing...... and deployment. The selected test case is the power system of Puerto Rico (PREPA), modeled using the modified IEEE 12 bus benchmark system, with different levels of PV penetration. It is shown that LPVPP with PRL can effectively reduce the ramping rate of the participating generators. Considering that the large...
Directory of Open Access Journals (Sweden)
Abdul Basit
2014-10-01
Full Text Available Transmission system operators have an increased interest in the active participation of wind power plants (WPP in the power balance control of power systems with large wind power penetration. The emphasis in this study is on the integration of WPPs into the automatic generation control (AGC of the power system. The present paper proposes a coordinated control strategy for the AGC between combined heat and power plants (CHPs and WPPs to enhance the security and the reliability of a power system operation in the case of a large wind power penetration. The proposed strategy, described and exemplified for the future Danish power system, takes the hour-ahead regulating power plan for generation and power exchange with neighbouring power systems into account. The performance of the proposed strategy for coordinated secondary control is assessed and discussed by means of simulations for different possible future scenarios, when wind power production in the power system is high and conventional production from CHPs is at a minimum level. The investigation results of the proposed control strategy have shown that the WPPs can actively help the AGC, and reduce the real-time power imbalance in the power system, by down regulating their production when CHPs are unable to provide the required response.
DEFF Research Database (Denmark)
Basit, Abdul; Hansen, Anca Daniela; Altin, Müfit
2014-01-01
Transmission system operators have an increased interest in the active participation of wind power plants (WPP) in the power balance control of power systems with large wind power penetration. The emphasis in this study is on the integration of WPPs into the automatic generation control (AGC......) of the power system. The present paper proposes a coordinated control strategy for the AGC between combined heat and power plants (CHPs) and WPPs to enhance the security and the reliability of a power system operation in the case of a large wind power penetration. The proposed strategy, described...... and exemplified for the future Danish power system, takes the hour-ahead regulating power plan for generation and power exchange with neighbouring power systems into account. The performance of the proposed strategy for coordinated secondary control is assessed and discussed by means of simulations for different...
A Review of Power Electronics for Wind Power
Institute of Scientific and Technical Information of China (English)
Zhe CHEN
2011-01-01
The paper reviews the power electronic applications for wind energy systems.Main wind turbine systems with different generators and power electronic converters are described.The electrical topologies of wind farms with power electronic conversion are discussed.Power electronic applications for improving the performance of wind turbines and wind farms in power systems have been illustrated.
DEFF Research Database (Denmark)
Elmholdt, Claus Westergård; Fogsgaard, Morten
2016-01-01
and creativity suggests that when managers give people the opportunity to gain power and explicate that there is reason to be more creative, people will show a boost in creative behaviour. Moreover, this process works best in unstable power hierarchies, which implies that power is treated as a negotiable....... It is thus a central point that power is not necessarily something that breaks down and represses. On the contrary, an explicit focus on the dynamics of power in relation to creativity can be productive for the organisation. Our main focus is to elaborate the implications of this for practice and theory...
Dynamic influences of wind power on the power system
Energy Technology Data Exchange (ETDEWEB)
Rosas, Pedro
2003-03-01
The thesis first presents the basics influences of wind power on the power system stability and quality by pointing out the main power quality issues of wind power in a small-scale case and following, the expected large-scale problems are introduced. Secondly, a dynamic wind turbine model that supports power quality assessment of wind turbines is presented. Thirdly, an aggregate wind farm model that support power quality and stability analysis from large wind farms is presented. The aggregate wind farm model includes the smoothing of the relative power fluctuation from a wind farm compared to a single wind turbine. Finally, applications of the aggregate wind farm model to the power systems are presented. The power quality and stability characteristics influenced by large-scale wind power are illustrated with three cases. In this thesis, special emphasis has been given to appropriate models to represent the wind acting on wind farms. The wind speed model to a single wind turbine includes turbulence and tower shadow effects from the wind and the rotational sampling turbulence due to the rotation of the blades. In a park scale, the wind speed model to the wind farm includes the spatial coherence between different wind turbines. Here the wind speed model is applied to a constant rotational speed wind turbine/farm, but the model is suitable to variable speed wind turbine/farm as well. The cases presented here illustrate the influences of the wind power on the power system quality and stability. The flicker and frequency deviations are the main power quality parameters presented. The power system stability concentrates on the voltage stability and on the power system oscillations. From the cases studied, voltage and the frequency variations were smaller than expected from the large-scale wind power integration due to the low spatial correlation of the wind speed. The voltage quality analysed in a Brazilian power system and in the Nordel power system from connecting large
AC Power Local Network with Multiple Power Routers
Directory of Open Access Journals (Sweden)
Ryo Takahashi
2013-12-01
Full Text Available Controlling power flow and achieving appropriate matching between power sources and loads according to the quality of energy is expected to be one of the approaches to reduce wasted energy consumption. A power router, proposed recently, has the capability of realizing circuit switching in a power distribution network. This study focuses on the feasibility of an AC power routing network system composed of multiple power routers. To evaluate the feasibility, we experimentally confirm the circuit switching operation of the parallel and series configurations of the power routers, so that the network system can be designed by the combination of parallel and series configurations.
Similarities and differences between conventional power and nuclear power
International Nuclear Information System (INIS)
Wang Yingrong
2011-01-01
As the implementation of the national guideline of 'proactively promoting nuclear power development', especially after China decided in 2006 to introduce Westinghouse's AP1000 technology, some of the power groups specialized in conventional power generation, have been participating in the preliminary work and construction of nuclear power projects in certain degrees. Meanwhile, such traditional nuclear power corporations as China National Nuclear Corporation (CNNC) and China Guangdong Nuclear Power Corporation (CGNPC) have also employed some employees with conventional power generation experience. How can these employees who have long been engaged in conventional power generation successfully adapt to the new work pattern, ideology, knowledge, thinking mode and proficiency of nuclear power, so that they can fit in with the work requirements of nuclear power and become qualified as soon as possible? By analyzing the technological, managerial and cultural features of nuclear power, as well as some issues to be kept in mind when engaged in nuclear power, this paper intends to make some contribution to the nuclear power development in the specific period. (author)
Balancing modern Power System with large scale of wind power
DEFF Research Database (Denmark)
Basit, Abdul; Altin, Müfit; Hansen, Anca Daniela
2014-01-01
Power system operators must ensure robust, secure and reliable power system operation even with a large scale integration of wind power. Electricity generated from the intermittent wind in large propor-tion may impact on the control of power system balance and thus deviations in the power system...... frequency in small or islanded power systems or tie line power flows in interconnected power systems. Therefore, the large scale integration of wind power into the power system strongly concerns the secure and stable grid operation. To ensure the stable power system operation, the evolving power system has...... to be analysed with improved analytical tools and techniques. This paper proposes techniques for the active power balance control in future power systems with the large scale wind power integration, where power balancing model provides the hour-ahead dispatch plan with reduced planning horizon and the real time...
Eccles, William
2008-01-01
Pragmatic Power is focused on just three aspects of the AC electrical power system that supplies and moves the vast majority of electrical energy nearly everywhere in the world: three-phase power systems, transformers, and induction motors. The reader needs to have had an introduction to electrical circuits and AC power, although the text begins with a review of the basics of AC power. Balanced three-phase systems are studied by developing their single-phase equivalents. The study includes a look at how the cost of ""power"" is affected by reactive power and power factor. Transformers are cons
Power System Operation with Large Scale Wind Power Integration
DEFF Research Database (Denmark)
Suwannarat, A.; Bak-Jensen, B.; Chen, Z.
2007-01-01
to the uncertain nature of wind power. In this paper, proposed models of generations and control system are presented which analyze the deviation of power exchange at the western Danish-German border, taking into account the fluctuating nature of wind power. The performance of the secondary control of the thermal......The Danish power system starts to face problems of integrating thousands megawatts of wind power, which produce in a stochastic behavior due to natural wind fluctuations. With wind power capacities increasing, the Danish Transmission System Operator (TSO) is faced with new challenges related...... power plants and the spinning reserves control from the Combined Heat and Power (CHP) units to achieve active power balance with the increased wind power penetration is presented....
Evidence for a new geomagnetic jerk in 2014
DEFF Research Database (Denmark)
Torta, J. Miquel; Pavón-Carrasco, Francisco Javier; Marsal, Santiago
2015-01-01
The production of quasi-definitive data at Ebre observatory has enabled us to detect a new geomagnetic jerk in early 2014. This has been confirmed by analyzing data at several observatories in the European-African and Western Pacific-Australian sectors in the classical fashion of looking for the ...
Wahl's conjecture for a minuscule G/P
Indian Academy of Sciences (India)
08. References. [1] Bourbaki N, Éléments de mathématique. Fasc. XXXIV. Groupes et alg`ebres de Lie. Chapitre IV: Groupes de Coxeter et syst`emes de Tits. Chapitre V: Groupes engendrés par des réflexions. Chapitre VI: syst`emes de racines, ...
Fire protection program evaluation of Argonne National Laboratory, West for the Department of Energy
International Nuclear Information System (INIS)
1984-01-01
A fire protection engineering survey was conducted of the Argonne National Laboratory, West Facility, near Idaho Falls, Idaho. This facility includes EBR-II, TREAT, ZPPR, and HFEF. The facility meets the improved risk criteria as set forth in DOE Order 5480.1, Chapter VII. Some recommendations are given
Breached-pin testing in the US
International Nuclear Information System (INIS)
Mahagin, D.E.; Lambert, J.D.B.
1981-04-01
Experience gained at EBR-II by the late 1970's from a significant number of failures in experimental fuel-pin irradiations forms the basis of a program directed towards the characterization of breached pins. The questions to be answered and the issues raised by further testing are discussed
Microstructure characterizaton of advanced oxide fuel
International Nuclear Information System (INIS)
Rasmussen, D.E.; Gerber, E.W.; McCord, R.B.
1977-01-01
Preirradiation porosity, grain size, and microcomposition characteristics are presented for selected advanced oxide (PuO 2 -UO 2 ) LMFBR developmental fuels fabricated for irradiation testing in EBR-II. Quantitative microscopy, electron microprobe analysis, and a recently developed quantitative autoradiographic technique are utilized to relate microstructure characteristics to fabrication parameters
Investigating power control in autonomous power systems with increasing wind power penetration
Energy Technology Data Exchange (ETDEWEB)
Margaris, Ioannis D. [National Technical Univ. of Athens (Greece). Electric Energy Systems Lab.; Hansen, Anca D.; Sorensen, Poul [Risoe National Laboratory, Roskilde (Denmark). Wind Energy Dept.; Hatziargyriou, Nikos D. [National Technical Univ. of Athens (Greece). Electric Energy Systems Lab.; Public Power Corporation S.A., Athens (Greece)
2009-07-01
Increasing levels of wind penetration in autonomous power systems has set intensively high standards with respect to wind turbine technology during the last years. Special features of non-interconnected power systems make security issues rather critical, as the operation of large wind farms like conventional power plants is becoming a necessity. This paper includes the study case of Rhodos island, in Greece, where rapidly increasing wind penetration has started to impose serious security issues for the immediate future. The scenarios studied here correspond to reference year of study 2012 and include wind farms with three different wind turbine technologies - namely Doubly Fed Induction Generator (DFIG), Permanent Magnet Synchronous Generator (PMSG) and Active Stall Induction Generator (ASIG) based wind turbines. Aggregated models of the wind farms are being used and results for different load cases are being analyzed and discussed. The ability of wind farms to assist in some of the power system control services traditionally carried out by conventional synchronous generation is being investigated and discussed. The power grid of the island, including speed governors and automatic voltage regulators, is simulated in the dedicated power system simulation program Power Factory from DIgSILENT. (orig.)
Williams, Melissa J; Gruenfeld, Deborah H; Guillory, Lucia E
2017-02-01
Previous theorists have characterized sexually aggressive behavior as an expression of power, yet evidence that power causes sexual aggression is mixed. We hypothesize that power can indeed create opportunities for sexual aggression-but that it is those who chronically experience low power who will choose to exploit such opportunities. Here, low-power men placed in a high-power role showed the most hostility in response to a denied opportunity with an attractive woman (Studies 1 and 2). Chronically low-power men and women given acute power were the most likely to say they would inappropriately pursue an unrequited workplace attraction (Studies 3 and 4). Finally, having power over an attractive woman increased harassment behavior among men with chronic low, but not high, power (Study 5). People who see themselves as chronically denied power appear to have a stronger desire to feel powerful and are more likely to use sexual aggression toward that end. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Power system stabilizer control for wind power to enhance power system stability
Domínguez García, José Luís; Gomis Bellmunt, Oriol; Bianchi, Fernando Daniel; Sumper, Andreas
2011-01-01
The paper presents a small signal stability analysis for power systems with wind farm interaction. Power systems have damping oscillation modes that can be excited by disturbance or fault in the grid. The power converters of the wind farms can be used to reduce these oscillations and make the system more stable. These ideas are explored to design a power system stabilized (PSS) for a network with conventional generators and a wind farm in order to increase the damping of the oscillation...
Wind farm - A power source in future power systems
DEFF Research Database (Denmark)
Chen, Zhe; Blaabjerg, Frede
2009-01-01
wind turbines and wind farms, and then introduces the wind power development and wind farms. An optimization platform for designing electrical systems of offshore wind farms is briefed. The major issues related to the grid connection requirements and the operation of wind turbines/farms in power......The paper describes modern wind power systems, introduces the issues of large penetration of wind power into power systems, and discusses the possible methods of making wind turbines/farms act as a power source, like conventional power plants in power systems. Firstly, the paper describes modern...... systems are illustrated....
Low Power Design with High-Level Power Estimation and Power-Aware Synthesis
Ahuja, Sumit; Shukla, Sandeep Kumar
2012-01-01
Low-power ASIC/FPGA based designs are important due to the need for extended battery life, reduced form factor, and lower packaging and cooling costs for electronic devices. These products require fast turnaround time because of the increasing demand for handheld electronic devices such as cell-phones, PDAs and high performance machines for data centers. To achieve short time to market, design flows must facilitate a much shortened time-to-product requirement. High-level modeling, architectural exploration and direct synthesis of design from high level description enable this design process. This book presents novel research techniques, algorithms,methodologies and experimental results for high level power estimation and power aware high-level synthesis. Readers will learn to apply such techniques to enable design flows resulting in shorter time to market and successful low power ASIC/FPGA design. Integrates power estimation and reduction for high level synthesis, with low-power, high-level design; Shows spec...
A Review of Power Electronics for Wind Power
DEFF Research Database (Denmark)
Chen, Zhe
2011-01-01
The paper reviews the power electronic applications for wind energy systems. Main wind turbine systems with different generators and power electronic converters are described. The electrical topologies of wind farms with power electronic conversion are discussed. Power electronic applications...
Power generation costs. Coal - nuclear power
International Nuclear Information System (INIS)
1979-01-01
This supplement volume contains 17 separate chapters investigating the parameters which determine power generation costs on the basis of coal and nuclear power and a comparison of these. A detailed calculation model is given. The complex nature of this type of cost comparison is shown by a review of selected parameter constellation for coal-fired and nuclear power plants. The most favourable method of power generation can only be determined if all parameters are viewed together. One quite important parameter is the load factor, or rather the hours of operation. (UA) 891 UA/UA 892 AMO [de
DEFF Research Database (Denmark)
Iov, Florin; Ciobotaru, Mihai; Blaabjerg, Frede
2008-01-01
is to change the electrical power production sources from the conventional, fossil (and short term) based energy sources to renewable energy resources. The other is to use high efficient power electronics in power generation, power transmission/distribution and end-user application. This paper discuss the most...... emerging renewable energy sources, wind energy, which by means of power electronics are changing from being a minor energy source to be acting as an important power source in the energy system. Power electronics is the enabling technology and the presentation will cover the development in wind turbine...... technology from kW to MW, discuss which power electronic solutions are most feasible and used today....
Distractor inhibition predicts individual differences in recovery from the attentional blink.
Directory of Open Access Journals (Sweden)
Heleen A Slagter
Full Text Available BACKGROUND: The attentional blink (AB refers to an impairment in detecting the second of two target stimuli presented in close succession in a rapid stream of distractors. Recent studies indicate that the AB results, in part, from distractor suppression mechanisms, that may be mediated by striatal dopamine. Yet, it is currently unclear how distractor suppression ability may contribute to the AB. Here, we examined whether distractor suppression ability is predictive of an individual's AB depth and/or recovery. In addition, we investigated the relationship between individual spontaneous eye blink rate (sEBR, a marker of striatal dopaminergic functioning, and AB performance. METHODOLOGY/PRINCIPAL FINDINGS: Subjects were presented with rapid streams of letters containing white distractors, a red T1 and a green T2. T2 was presented either at Lag2, Lag4 or Lag10, and preceded by a distractor that shared the same identity as T2 (T2 primed or not (T2 not primed. Replicating previous work [1], we found that slow AB recovery (poor T2 performance in Lag4 vs. Lag10 was associated with a failure to inhibit distractors, as indexed by greater positive priming. However, no relationship was observed between a subject's ability to suppress distractors and AB depth (Lag10 vs. Lag2. Moreover, no relationship between sEBR and AB performance was observed. RESULTS/SIGNIFICANCE: These results indicate that a failure to inhibit distracting information impairs AB recovery, possibly by interfering with target encoding in working memory - but does not affect AB magnitude. The absence of a relationship between individual sEBR and AB performance may be explained by task specifics.
Nuclear and thermal power plant power ramping capability
International Nuclear Information System (INIS)
Golovach, E.A.
1983-01-01
The possibilities of step power increase by NPP and TPP units under emergency conditions of power grids operation are considered. The data analysis has shown that power units ramping capability with WWER-440, WWER-1000 and RBMK-1000 reactors is higher than that of 300 MW power units on fossil fuel, at the initial time interval (0-30 s). These NPP power units satisfy as to ramping capability the energy system requirements. Higher NPP power units ramping capability is explained by the fact that relative pressure before turbine valves is decreased less than in straight-through boilers while the steam volumes time constant of steam separator-superheaters is less than that of intermediate superheatings. Higher power unit ramping capability with WWER-440 and RBMK-1000 reactors as compared with the WWER-1000 reactor is pointed out as well as the increase of WWER-1000 power unit capability using high-speed turbines