7 CFR 636.18 - Technical services provided by qualified personnel not affiliated with USDA.
2010-01-01
... HABITAT INCENTIVES PROGRAM § 636.18 Technical services provided by qualified personnel not affiliated with... affiliated with USDA. 636.18 Section 636.18 Agriculture Regulations of the Department of Agriculture... provided by qualified personnel not affiliated with USDA may include, but is not limited to: Conservation...
Heliopause Electrostatic Rapid Transit System (HERTS)
Wiegmann, Bruce M.
2015-01-01
A recent six month investigation focused on: "Determining the benefits of propelling a scientific spacecraft by an 'Electric Sail' propulsion system to the edge of our solar system (the Heliopause), a distance of 100 to 120 AU, in ten years or less" has recently been completed by the Advance Concepts Office at NASA's MSFC. The concept investigated has been named the Heliopause Electrostatic Rapid Transit System (HERTS) by the MSFC team. The HERTS is a revolutionary propellant-less propulsion concept that is ideal for deep space missions to the Outer Planets, Heliopause, and beyond. It is unique in that it uses momentum exchange from naturally occurring solar wind protons to propel a spacecraft within the heliosphere. The propulsion system consists of an array of electrically positively-biased wires that extend outward 20 km from a rotating (one revolution per hour) spacecraft. It was determined that the HERTS system can accelerate a spacecraft to velocities as much as two to three times that possible by any realistic extrapolation of current state-of-the-art propulsion technologies- including solar electric and solar sail propulsion systems. The data produced show that a scientific spacecraft could reach distances of 100AU in less than 10 years. Moreover, it can be reasonably expected that this system could be developed within a decade and provide meaningful Heliophysics Science and Outer Planetary Science returns in the 2025-2035 timeframe.
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHE636 (Link to dictyBase) - - - Contig-U11696-1 CHE636P (Link... to Original site) CHE636F 174 CHE636Z 123 CHE636P 277 - - Show CHE636 Library CH (Link to library) Clone ID CHE636 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dict...ne RP11-15H22, WORKING DRAFT SEQUENCE, 23 unordered pieces. 40 0.19 3 AC149612 |AC149612.1 Ictalurus punctat... %: cytoskeletal 4.0 %: mitochondrial >> prediction for CHE636 is nuc 5' end seq. ID CHE636F 5' end seq. >CH
Evaluation of hybrid electric road train (HERT) as an alternative ...
African Journals Online (AJOL)
EDSA has been one of the busiest roads in the Philippines and essential component of the spatial structure of the Metro Manila. The decent growth of the areas around the avenue adds a great volume of traffic which cause traffic congestion and at the same time pollution. HERT is a 40 meter long vehicle, powered by an ...
Sobecki, Sebastian
2004-01-01
1. III * Middle English: Excluding Chaucer -- Brown et al., 10.1093 ... In '"And to the herte she hireselven smot": The Loveris Maladye and the Legitimate Suicides of Chaucer's and Gower's Exemplary Lovers' (Mediaevalia ... nbsp;nbsp;nbsp;nbsp;nbsp;nbsp; nbsp; 2. Publications of the Medieval
Goto, Tomomi; Urabe, Daisuke; Masuda, Koji; Isobe, Yosuke; Arita, Makoto; Inoue, Masayuki
2015-08-07
A novel anti-inflammatory lipid mediator, (4Z,7Z,10Z,12E,14S,16Z,18E,20R)-14,20-dihydroxy-4,7,10,12,16,18-docosahexaenoic acid (1aa), and its three C14,C20 stereoisomers (1ab,ba,bb) were synthesized in a convergent fashion. The carbon backbone of the target compounds was assembled from seven simple fragments by employing two Sonogashira coupling and three SN2 alkynylation reactions. The thus constructed four internal alkynes were chemoselectively reduced to the corresponding (Z)-alkenes by applying a newly developed stepwise protocol: (i) hydrogenation of the three alkynes using Lindlar catalyst and (ii) formation of the dicobalt hexacarbonyl complex from the remaining alkyne and subsequent reductive decomplexation. The synthetic preparation of the stereochemically defined four isomers 1aa,ab,ba,bb permitted determination of the absolute structure of the isolated natural product to be 1aa. Biological testing of the four synthetic 14,20-dihydroxydocosahexaenoic acids disclosed similar anti-inflammatory activities of the non-natural isomers (1ab,ba,bb) and the natural form (1aa).
7 CFR 58.636 - Homogenization.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Homogenization. 58.636 Section 58.636 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... Procedures § 58.636 Homogenization. Homogenization of the pasteurized mix shall be accomplished to...
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Administration. 636.2 Section 636.2 Agriculture Regulations of the Department of Agriculture (Continued) NATURAL RESOURCES CONSERVATION SERVICE, DEPARTMENT OF AGRICULTURE LONG TERM CONTRACTING WILDLIFE HABITAT INCENTIVES PROGRAM § 636.2 Administration. (a) The...
32 CFR 636.1 - Responsibilities.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Responsibilities. 636.1 Section 636.1 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION (SPECIFIC INSTALLATIONS) Fort Stewart, Georgia § 636.1 Responsibilities. In addition to the...
32 CFR 636.9 - Registration requirement.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Registration requirement. 636.9 Section 636.9 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION (SPECIFIC INSTALLATIONS) Fort Stewart, Georgia § 636.9 Registration requirement. In...
32 CFR 636.8 - Registration policy.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Registration policy. 636.8 Section 636.8 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION (SPECIFIC INSTALLATIONS) Fort Stewart, Georgia § 636.8 Registration policy. In addition to th...
32 CFR 636.2 - Program objectives.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Program objectives. 636.2 Section 636.2 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION (SPECIFIC INSTALLATIONS) Fort Stewart, Georgia § 636.2 Program objectives. In addition to the...
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Right-of-way. 636.25 Section 636.25 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION (SPECIFIC INSTALLATIONS) Fort Stewart, Georgia § 636.25 Right-of...
44 CFR 63.6 - Reimbursable relocation costs.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reimbursable relocation costs. 63.6 Section 63.6 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT... OF SECTION 1306(c) OF THE NATIONAL FLOOD INSURANCE ACT OF 1968 General § 63.6 Reimbursable relocation...
20 CFR 636.9 - Opportunity for informal review.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Opportunity for informal review. 636.9 Section 636.9 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR COMPLAINTS, INVESTIGATIONS AND HEARINGS § 636.9 Opportunity for informal review. (a) Parties to a complaint under § 636.10 may choose to waive their rights to an...
7 CFR 1230.636 - Results of the referendum.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Results of the referendum. 1230.636 Section 1230.636 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... CONSUMER INFORMATION Procedures for the Conduct of Referendum Referendum § 1230.636 Results of the...
2018-03-18T16:42:18Z https://www.ajol.info/index.php/index/oai oai ...
African Journals Online (AJOL)
article/55645 2018-03-18T16:42:18Z ajrh:ART Gender dynamics and sexual norms among youth in Mali in the context of HIV/AIDS prevention Boileau, C Vissandjee, B Nguyen, V-K Rashed, S Sylla, M Zunzunegui, MV Gender roles, sexual ...
48 CFR 636.513 - Accident prevention.
2010-10-01
... CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Contract Clauses 636.513 Accident prevention. (a) In... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Accident prevention. 636... contracting activities shall insert DOSAR 652.236-70, Accident Prevention, in lieu of FAR clause 52.236-13...
32 CFR 636.34 - Restraint systems.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Restraint systems. 636.34 Section 636.34 National... Restraint systems. (a) Restraint systems (seat belts) will be worn by all operators and passengers of U.S. Government vehicles on or off the installations. (b) Restraint systems will be worn by all civilian personnel...
32 CFR 636.12 - Traffic accident investigation.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Traffic accident investigation. 636.12 Section... ENFORCEMENT AND CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION (SPECIFIC INSTALLATIONS) Fort Stewart, Georgia § 636.12 Traffic accident investigation. In addition to the requirements in § 634.28 of...
34 CFR 636.7 - What definitions apply?
2010-07-01
... cooperative arrangement for the purpose of carrying out common objectives. HEA means the Higher Education Act... 34 Education 3 2010-07-01 2010-07-01 false What definitions apply? 636.7 Section 636.7 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF POSTSECONDARY EDUCATION...
48 CFR 636.209 - Construction contracts with architect-engineer firms.
2010-10-01
... with architect-engineer firms. 636.209 Section 636.209 Federal Acquisition Regulations System DEPARTMENT OF STATE SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 636.209 Construction contracts with architect-engineer firms. The...
48 CFR 636.602 - Selection of firms for architect-engineer contracts.
2010-10-01
... architect-engineer contracts. 636.602 Section 636.602 Federal Acquisition Regulations System DEPARTMENT OF STATE SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Architect-Engineer Services 636.602 Selection of firms for architect-engineer contracts. ...
32 CFR 636.13 - Traffic accident investigation reports.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Traffic accident investigation reports. 636.13... Stewart, Georgia § 636.13 Traffic accident investigation reports. In addition to the requirements in § 634... record traffic accident investigations on DA Form 3946 (Military Police Traffic Accident Report) and DA...
23 CFR 636.409 - Can offerors revise their proposals during communications?
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Can offerors revise their proposals during communications? 636.409 Section 636.409 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS DESIGN-BUILD CONTRACTING Exchanges § 636.409 Can offerors revise their...
Tsuzuki, Tsuyoshi; Tokuyama, Yoshiko; Igarashi, Miki; Nakagawa, Kiyotaka; Ohsaki, Yusuke; Komai, Michio; Miyazawa, Teruo
2004-10-01
We previously showed that alpha-eleostearic acid (alpha-ESA; 9Z11E13E-18:3) is converted to conjugated linoleic acid (CLA; 9,11-18:2) in the liver and plasma of rats that were given diets including 1% alpha-ESA for 4 wk. In this study, we investigated this phenomenon in detail. First, the chemical structure of CLA produced by alpha-ESA administration was determined. After alpha-ESA was orally administered to rats, CLA in rat liver was isolated by HPLC. The positional and geometric isomerism was determined using GC-EI/MS and (13)C-NMR, respectively, and the CLA generated in rats after alpha-ESA feeding was confirmed to be 9Z11E-CLA. Next, the concentrations of alpha-ESA and CLA were determined 0, 3, 6, and 24 h after oral administration of alpha-ESA to rats. Moreover, we also investigated whether enteric bacteria are involved in the conversion of alpha-ESA to CLA using germ-free rats. alpha-ESA was orally administered to germ-free and normal rats and alpha-ESA and CLA were detected in the organs of both groups. In addition, to confirm that this reaction was enzyme-mediated, alpha-ESA was reacted with tissue homogenates (liver, kidney, and small intestine mucous) and coenzymes (NADH, NAD(+), NADPH, and NADP(+)), and the enzyme activities were estimated from the amount of CLA produced. CLA was detected when alpha-ESA was reacted with liver, kidney, and small intestine mucous homogenates and a coenzyme (NADPH). These results indicated that alpha-ESA is converted to 9Z11E-CLA in rats by a Delta13-saturation reaction carried out by an NADPH-dependent enzyme.
Recent results on W,Z production at √s = 1.8 TeV
International Nuclear Information System (INIS)
Ng, J.S.T.
1991-01-01
Some recent results on W,Z production from CDF are presented. The W,Z production differential cross section was measured as a function of transverse momentum, using data from antipp collisions at √s = 1.8 TeV. The results agree with a next-to-leading order QCD calculation over the range 0 t < 180 GeV/c available from this data sample. The charge asymmetry in the W lepton rapidity was also measured. Comparison with Standard Model prediction shows good agreement for most available parametrizations of parton distributions. (author) 5 refs., 2 figs
2010-07-01
... Administration DEPARTMENT OF JUSTICE (CONTINUED) FLOODPLAIN MANAGEMENT AND WETLAND PROTECTION PROCEDURES § 63.6..., habitat, hazards, etc.); social concerns (aesthetics, historical and cultural values, land use patterns... proposed action shall not be located in a floodplain or wetland unless the importance of the floodplain or...
Mosquito cell line C6/36 shows resistence to Cyt1Aa6
Czech Academy of Sciences Publication Activity Database
Zhang, L.; Huang, E.; Tang, B.; Guan, X.; Gelbič, Ivan
2012-01-01
Roč. 50, č. 4 (2012), s. 265-269 ISSN 0019-5189 R&D Projects: GA MŠk 2B08003 Grant - others:National Nature Science Foundation of China(CN) 31071745; Science Foundation of the Ministry of Education of China(CN) 20093515110010; Science Foundation of the Ministry of Education of China(CN) 20093515120010; Transformation Fund for Agricultural Science and Technology Achievements(CN) 2010GB2C400212; Fujian Colleges and Universities for the Development of the West Strait(CN) 0b08b005 Institutional research plan: CEZ:AV0Z50070508 Keywords : Bacillus thuringiensis * C6/36 cells * indirect immunofluorescence assay Subject RIV: ED - Physiology Impact factor: 1.195, year: 2012 http://nopr.niscair.res.in/bitstream/123456789/13748/1/IJEB%2050(4)%20265-269.pdf
Properties of jets in Z events from 1.8 TeV bar pp collisions
International Nuclear Information System (INIS)
Hauger, S.A.
1994-01-01
We have studied the properties of Z boson events produced in 1.8 TeV p bar p collisions using 19.3 pb -1 of integrated luminosity collected by the Collider Detector at Fermilab (CDF) during the 1992--1993 Tevatron run. We compare the characteristics of the hadronic jets associated with the Z to leading-order QCD calculations using the VECBOS Monte Carlo program. For a subsample of events, we identify B jets and compare their rates to those expected from events with generic QCD jets
US gas pipelines respond to FERC Order 636
International Nuclear Information System (INIS)
Anon.
1992-01-01
This paper reports that U.S. pipelines are continuing to examine the react to the Federal Energy Regulatory Commission's Order 636. Among the latest responses: Bill Vititoe, president and chief executive officer of ANR Pipeline Co., a subsidiary of Coastal Corp., Houston, the his company's recently proposed comprehensive service restructuring and rate settlement basically is consistent with Order 636. Paul M. Anderson, executive vice-president of Panhandle Eastern Corp., Houston, the Order 63 likely will increase reliance on long term gas sales contracts and shrink or eliminate spot market sales
636 ART-naive patients were enrolled; 361 completed 6 months of ...
Indian Academy of Sciences (India)
First page Back Continue Last page Graphics. 636 ART-naive patients were enrolled; 361 completed 6 months of follow-up (282 received supplements and 79 received standard care). 636 ART-naive patients were enrolled; 361 completed 6 months of follow-up (282 received supplements and 79 received standard care).
Improvement of dynamic absorber by means of weak stops
Czech Academy of Sciences Publication Activity Database
Půst, Ladislav
2003-01-01
Roč. 48, č. 48 (2003), s. 273-299 ISSN 0001-7043 R&D Projects: GA AV ČR IBS2076301 Institutional research plan: CEZ:AV0Z2076919 Keywords : damping of vibrations * 2DOF system * Hert's Impacts Subject RIV: BI - Acoustics
7 CFR 636.4 - Program requirements.
2010-01-01
... AGRICULTURE LONG TERM CONTRACTING WILDLIFE HABITAT INCENTIVES PROGRAM § 636.4 Program requirements. (a) To... members' tax identification numbers and percentage interest in the entity. Where applicable, American... individuals and payments made, by tax identification number or other unique identification number, during the...
Energy Technology Data Exchange (ETDEWEB)
Lin, Frank I. [National Cancer Institute, NIH, Cancer Imaging Program, Bethesda, MD (United States); National Cancer Institute, Molecular Imaging Program, Bethesda, MD (United States); Gonzalez, E.M.; Kurdziel, K.A.; Ton, A.; Turkbey, B.; Choyke, P.L.; Lindenberg, M.L. [National Cancer Institute, Molecular Imaging Program, Bethesda, MD (United States); Kummar, S.; Do, K.; Collins, J.M.; Doroshow, J.H. [National Cancer Institute, Division of Cancer Treatment and Diagnosis and Center for Cancer Research, Bethesda, MD (United States); Shih, J. [National Cancer Institute, NIH, Biometric Research Program, Bethesda, MD (United States); Adler, S. [Leidos Biomedical Research, Inc., Clinical Research Directorate/Clinical Monitoring Research Program, Frederick, MD (United States); Jacobs, P.M. [National Cancer Institute, NIH, Cancer Imaging Program, Bethesda, MD (United States); Bhattacharyya, S. [Leidos Biomedical Research, Frederick National Laboratory for Cancer Research, Frederick, MD (United States); Chen, A.P. [National Cancer Institute, Early Clinical Trials Development Program, DCTD, Bethesda, MD (United States)
2017-03-15
Z-endoxifen is the most potent of the metabolites of tamoxifen, and has the potential to be more effective than tamoxifen because it bypasses potential drug resistance mechanisms attributable to patient variability in the expression of the hepatic microsomal enzyme CYP2D6. {sup 18}F-FES is a positron emission tomography (PET) imaging agent which selectively binds to estrogen receptor alpha (ER-α) and has been used for non-invasive in vivo assessment of ER activity in tumors. This study utilizes {sup 18}F-FES PET imaging as a pharmacodynamic biomarker in patients with ER+ tumors treated with Z-endoxifen. Fifteen patients were recruited from a parent therapeutic trial of Z-endoxifen and underwent imaging with {sup 18}F-FES PET at baseline. Eight had positive lesions on the baseline scan and underwent follow-up imaging with {sup 18}F-FES 1-5 days post administration of Z-endoxifen. Statistically significant changes (p = 0.0078) in standard uptake value (SUV)-Max were observed between the baseline and follow-up scans as early as 1 day post drug administration. F-FES PET imaging could serve as a pharmacodynamic biomarker for patients treated with ER-directed therapy. (orig.)
C6/36 Aedes albopictus cells have a dysfunctional antiviral RNA interference response.
Directory of Open Access Journals (Sweden)
Doug E Brackney
2010-10-01
Full Text Available Mosquitoes rely on RNA interference (RNAi as their primary defense against viral infections. To this end, the combination of RNAi and invertebrate cell culture systems has become an invaluable tool in studying virus-vector interactions. Nevertheless, a recent study failed to detect an active RNAi response to West Nile virus (WNV infection in C6/36 (Aedes albopictus cells, a mosquito cell line frequently used to study arthropod-borne viruses (arboviruses. Therefore, we sought to determine if WNV actively evades the host's RNAi response or if C6/36 cells have a dysfunctional RNAi pathway. C6/36 and Drosophila melanogaster S2 cells were infected with WNV (Flaviviridae, Sindbis virus (SINV, Togaviridae and La Crosse virus (LACV, Bunyaviridae and total RNA recovered from cell lysates. Small RNA (sRNA libraries were constructed and subjected to high-throughput sequencing. In S2 cells, virus-derived small interfering RNAs (viRNAs from all three viruses were predominantly 21 nt in length, a hallmark of the RNAi pathway. However, in C6/36 cells, viRNAs were primarily 17 nt in length from WNV infected cells and 26-27 nt in length in SINV and LACV infected cells. Furthermore, the origin (positive or negative viral strand and distribution (position along viral genome of S2 cell generated viRNA populations was consistent with previously published studies, but the profile of sRNAs isolated from C6/36 cells was altered. In total, these results suggest that C6/36 cells lack a functional antiviral RNAi response. These findings are analogous to the type-I interferon deficiency described in Vero (African green monkey kidney cells and suggest that C6/36 cells may fail to accurately model mosquito-arbovirus interactions at the molecular level.
32 CFR 636.35 - Headphones and earphones.
2010-07-01
... CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION (SPECIFIC INSTALLATIONS) Fort Stewart, Georgia § 636.35 Headphones and earphones. The wearing of headphones or earphones is prohibited while driving a U.S. Government vehicle, POV, motorcycle, or other self-propelled two-wheel, three-wheel, or four...
Effect of N/Z in pre-scission neutron multiplicity for 16,18O+198Pt systems
International Nuclear Information System (INIS)
Sandal, R.; Behera, B.R.; Singh, V.; Kaur, M.; Kumar, A.; Singh, G.; Singh, K.P.; Sugathan, P.; Jhingan, A.; Golda, K.S.; Chatterjee, M.B.; Bhowmik, R.K.; Kalkal, S.; Siwal, D.; Goyel, S.; Mandal, S.; Prasad, E.; Sadhukhan, J.; Pal, S.; Mahta, K.; Saxena, A.
2014-01-01
This paper reports the summary of the experimental results of pre-scission neutron multiplicities from four compound nuclei, namely 210,212,214,216 Rn, and statistical model analysis of the corresponding data. The compound nuclei 210,212,214,216 Rn having N/Z values as 1.441, 1.465, 1.488, 1.511 respectively are populated through the 16,18 O+ 194,198 Pt reactions at excitation energies of 50, 61, 71.7 and 79 MeV. The measured neutron multiplicities are further analyzed with the statistical model of nuclear decay where fission hindrance due to nuclear dissipation is considered. The N/Z dependence of the dissipation strength at lowest excitation energy of the compound nuclei suggests shell closure effects. However, such effects are not observed at higher excitations where the variation of the dissipation strength with N/Z does not show any specific trend. The variation of N/Z in fission time scale is also shown. (authors)
24 CFR 982.636 - Homeownership option: Portability.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Homeownership option: Portability... Types Homeownership Option § 982.636 Homeownership option: Portability. (a) General. A family may... described in §§ 982.353 and 982.355 apply to the homeownership option and the administrative...
2018-03-20T18:48:07Z https://www.ajol.info/index.php/index/oai oai ...
African Journals Online (AJOL)
article/55754 2018-03-20T18:48:07Z ajrh:ART Poor parenting: Teenagers' views on adolescent pregnancies in Eastern Uganda Sekiwunga, R Whyte, SR Parental care, adolescent pregnancies, Uganda In Uganda teenage pregnancy is ...
Field Dependence of Elastic Constants in the Bilayer Manganite: (La1-z Prz )1.2Sr1.8Mn2O7 for z=0.6
International Nuclear Information System (INIS)
Nakanishi, Y.; Shimomura, K.; Matasukawa, M.; Yoshizawa, M.; Apost, M.; Suryanarayanan, R.; Revcolevischi, A.
2003-01-01
Elastic properties of the Pr-doped bilayer manganite: (La 1-z Pr z ) 1.2 Sr 1.8 Mn 2 O 7 for z=0.6 was investigated by means of the ultrasonic measurement. No remarkable anomaly was observed around the transition temperature in the temperature dependence of C 33 in zero field. A pronounced elastic anomaly, however, has been observed around the magnetic phase transition field Ht in the longitudinal elastic constants C 11 , indicating the phase can be induced in magnetic fields. The transition accompanies a large hysteresis, implying the ordered state to be so-called ''orbital-glass state''. The origin of observed elastic anomalies are discussed in terms of the coupling between elastic strains and magnetic moments of Mn ions, and a change of carrier numbers. (author)
Properties of inclusive W, Z events in bar pp collisions at 1.8 TeV
International Nuclear Information System (INIS)
Watts, T.
1990-01-01
A preliminary measurement of the properties of W and Z production along with accompanying jets has been made in anti pp collisions at 1.8 TeV using the CDF detector at Fermilab. Distributions of jet multiplicity, and boson E T , with and without selection on jet multiplicity, were obtained. Agreement was found with perturbative QCD predictions
42 CFR 431.636 - Coordination of Medicaid with the Children's Health Insurance Program (CHIP).
2010-10-01
... Insurance Program (CHIP). 431.636 Section 431.636 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES...'s Health Insurance Program (CHIP). (a) Statutory basis. This section implements— (1) Section 2102(b... coordination between a State child health program and other public health insurance programs. (b) Obligations...
2018-04-17T18:13:28Z https://www.ajol.info/index.php/index/oai oai ...
African Journals Online (AJOL)
-17T18:13:28Z ajpsy:ART Psychiatric symptoms and disorders in HIV infected mine workers in South Africa A retrospective descriptive study of acute first admissions Säll, L Salamon, E Allgulander, C Owe-Larsson, B AIDS; Dementia; Delirium; ...
2018-05-09T18:56:27Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
article/20961 2018-05-09T18:56:27Z bcse:ART CONSTITUENTS OFERYTHRINA SIGMOIDEA Ndom, Jean Claude; Department of Chemistry, Faculty of Science, University of Douala, P.O. Box 24157, Douala, Cameroon Kouam, ; Department of ...
32 CFR 636.26 - Pedestrian's rights and duties.
2010-07-01
... ENFORCEMENT AND CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION (SPECIFIC INSTALLATIONS) Fort Stewart, Georgia § 636.26 Pedestrian's rights and duties. (a) Pedestrians will obey all traffic control... signals are not in place or not in operation, the driver of a vehicle will yield the right of way, by...
2018-05-07T09:18:01Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
article/95678 2018-05-07T09:18:01Z ajb:ART Effects of extremely low frequency electromagnetic fields on growth, cytogenetic, protein content and antioxidant system of Zea mays L. Shabrangi, A Majd, A Sheidai, M Zea mays, cytogenetic, protein ...
2018-05-05T22:18:19Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
article/10639 2018-05-05T22:18:19Z jmbr:ART Adolescents and HIV/AIDS: an update of cases seen in Benin City, Nigeria Offor, E; Departments of Medical Microbiology, School of Medicine, University of Benin, Benin City Unuigbe, E; Departments ...
2018-05-09T18:54:11Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
article/92203 2018-05-09T18:54:11Z lwati:ART The Impact of Emotional Intelligence and Self-Efficacy on the Malleability of Job Performance and Job Involvement of Prison Personnel in Nigeria Mwantu, EN Agbo, PO Ngwama, JC Emotional ...
2018-02-18T07:38:13Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
article/51216 2018-02-18T07:38:13Z ai:ART Sport tourism: comparing participant profiles and impact of three one-day events in South Africa Kotze, N Visser, G Sport tourism has emerged as one of the fastest-growing spheres of the leisure travel ...
International Nuclear Information System (INIS)
1985-03-01
The second Sub-Committee on Zircaloy Analysis was organized in April 1978, under the Committee on Analytical Chemistry on Nuclear Fuels and Reactor Materials, JAERI, for the renewal of zirconium and zirconium base alloy certified reference materials (CRMs). The Sub-Committee carried out collaborative analysis among 13 participating laboratories for the certification of the CRMs, JAERI-Z11 to Z18, after development, improvement and evaluation of analytical methods during the period of May 1978 to June 1982. As the result of the collaborative analysis, the certified value was given for 18 elements (Sn, Fe, Ni, Cr, B, Cd, U, Cu, Co, Mn, Pb, Al, Ti, Si, Mo, W, Hf, C) in the CRMs. The first part of this report includes general discussion, the second part principles of certification, the third part development and verification of analytical methods, and the fourth part evaluation of analytical results on 17 elements. Preparation of Z11 to Z18, and certification for carbon in JAERI-Z17 and Z18 were reported separately in JAERI-M 83-241 and M 83-035, respectively. (author)
Transverse momentum distributions of W and Z bosons produced in p anti p collisions at √ S = 1.8 TeV
International Nuclear Information System (INIS)
Abbott, B.
1997-10-01
The transverse momentum distributions of W and Z bosons produced in p anti p collisions at √s = 1.8 TeV are measured with the D0 detector at Fermilab. The results are compared to QCD calculations which include soft gluon resummation. The transverse momentum distribution of the Z boson is consistent with the calculation of Ladinsky and Yuan, and is used to extract their non-perturbative parameter 92-
Detection of Plasmodium spp. in Human Feces
Czech Academy of Sciences Publication Activity Database
Jirků, Milan; Pomajbíková, K.; Petrželková, Klára Judita; Hůzová, Z.; Modrý, David; Lukeš, Julius
2012-01-01
Roč. 18, č. 4 (2012), s. 634-636 ISSN 1080-6040 R&D Projects: GA ČR GA206/09/0927 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z60930519 Keywords : great apes * faecal samples * PCR Subject RIV: GJ - Animal Vermins ; Diseases , Veterinary Medicine; GJ - Animal Vermins ; Diseases , Veterinary Medicine (UBO-W) Impact factor: 5.993, year: 2012
Wiegmann, Bruce M.
2017-01-01
The Heliopause Electrostatic Rapid Transit System (HERTS) was one of the seven total Phase II NASA Innovative Advanced Concepts (NIAC) that was down-selected in 2015 for continued funding and research. In Phase I our team learned that a spacecraft propelled by an Electric Sail (E-Sail) can travel great astronomical distances, such as to the Heliopause region of the solar system (approx. 100 to 120 AU) in approximately one quarter of the time (10 years) versus the time it took the Voyager spacecraft launched in 1977 (36 years). The completed work within the Phase II NIAC funded effort builds upon the work that was done in the Phase I NIAC and is focused on: 1) Testing of plasma interaction with a charged wire in a MSFC simulated solar environment vacuum test chamber. 2) Development of a Particle-in-Cell (PIC) models that are validated in the plasma testing and used to extrapolate to the E-Sail propulsion system design. 3) Conceptual design of a Technology Demonstration Mission (TDM) spacecraft developed to showcase E-Sail propulsion systems. 4) Down selection of both: a) Materials for a multi km length conductor and, b) Best configuration of the proposed conductor deployment subsystem. This paper will document the findings to date (June, 2017) of the above focused areas.
International Nuclear Information System (INIS)
Lacan, G.; Barrio, J.R.; Satyamurthy, N.; Yu, D.C.; Huang, S.C.; Phelps, M.E.
1994-01-01
Racemic β-fluoromethylene-m-tyrosine (FMMl) was developed as an aromatic amino acid decarboxylase (AAAD)- activated monoamine oxidase (MAO) suicide inhibitor. Direct [F-18] fluorination of pure enantiomers, R and S-(E)-β- fluoromethylene-m-tyrosine (E-FMMT) and the racemic geometric isomer R,S(Z)-β-fluoromethylene-m-tyrosine (Z-FMMT) with [F- 18] acetylhypofluorite, afforded 6- and 2[F-18] fluoro positional isomers as the major products. Regioselective radiofluorodestannylation of the respective 4-trimethylstannyl R,S- (E) - FMMT with [F-18]F 2 yielded the 4[F-18] fluoro derivative, thus allowing for the systematic evaluation of the regio- and stereo radiofluorinated AAAD probes. Macacca nemestrina monkeys were injected iv with purified radiofluorinated FMMT analogs and the distribution of activity in the central dopaminergic system was studied with positron emission tomography (PET). Radiofluorinated stereo and geometric FMMT derivatives showed significant differences in their in vivo striatal localization, with radioprobe localization decreasing in the order: 6F-S-(E)-FMMT >> 2F-S-(E)- FMMT >> 4F-R,S-(E)-FMMT. Neither radiofluorinated analogs of R-(E)- FMMT and R,S-(Z)-FMMT showed any significant striatal localization in vivo. (author)
23 CFR 636.302 - Are there any limitations on the selection and use of proposal evaluation factors?
2010-04-01
... Are there any limitations on the selection and use of proposal evaluation factors? (a) The selection... 23 Highways 1 2010-04-01 2010-04-01 false Are there any limitations on the selection and use of proposal evaluation factors? 636.302 Section 636.302 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF...
34 CFR 636.3 - What activities may the Secretary support?
2010-07-01
.... (2) Urban poverty and the alleviation of poverty. (3) Health care, including delivery and access. (4... POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION URBAN COMMUNITY SERVICE PROGRAM General § 636.3 What activities.... (5) Delivery of services. (6) Other activities to design and implement programs to assist urban...
International Nuclear Information System (INIS)
Chen Senxiong; Cheng Lingpeng; Zhang Qinfen; Lin Wei; Lu Xinying; Brannan, Jennifer; Zhou, Z.H.; Zhang Jingqiang
2004-01-01
We report the isolation, sequencing, biochemical, and structural characterization of a previously undescribed virus in a chronically infected Aedes albopictus C6/36 cell line. This virus is identified as a new densovirus under the Densovirinae subfamily of the Parvoviridae based on its biological and morphologic properties as well as sequence homologies, and is tentatively designated A. albopictus C6/36 cell densovirus (C6/36 DNV). Analysis of the 4094 nt of the C6/36 DNV genome revealed that the plus strand had three large open reading frames (ORFs): a left ORF, a right ORF, and a mid-ORF (within the left ORF), whose potential coding capacities are 91.0, 40.8, and 41.2 kDa, respectively. The left ORF likely encodes the nonstructural protein NS-1, which contains NTP-binding and helicase domains. The right ORF likely encodes structural proteins, VP1 and VP2. Our analyses revealed that C6/36 DNV has a similar genomic organization and shares very high homology in nucleotide sequence and amino acid sequences with Aedes aegypti densovirus (AaeDNV) and A. albopictus densovirus (AalDNV), members of the genus Brevidensovirus of the Densovirinae. Similar to other densoviruses, C6/36 DNV has a different genomic organization and no recognizable sequence homology with viruses in the Parvovirinae. The three-dimensional (3D) reconstruction of the C6/36 DNV at 15.6-A resolution by electron cryomicroscopy (cryoEM) revealed distinctive outer surface features not previously seen in other parvoviruses, indicating structural divergence of densoviruses, in addition to its genomic differences, while the inner surface of the C6/36 DNV capsid exhibits features that are conserved among parvoviruses
23 CFR 636.119 - How does this part apply to a project developed under a public-private partnership?
2010-04-01
... public-private partnership? 636.119 Section 636.119 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT... does this part apply to a project developed under a public-private partnership? (a) In order for a... Federal-aid procurement procedures will depend on the nature of the public-private agreement. (1) If the...
Miller, Jason R; Koren, Sergey; Dilley, Kari A; Puri, Vinita; Brown, David M; Harkins, Derek M; Thibaud-Nissen, Françoise; Rosen, Benjamin; Chen, Xiao-Guang; Tu, Zhijian; Sharakhov, Igor V; Sharakhova, Maria V; Sebra, Robert; Stockwell, Timothy B; Bergman, Nicholas H; Sutton, Granger G; Phillippy, Adam M; Piermarini, Peter M; Shabman, Reed S
2018-03-01
The 50-year-old Aedes albopictus C6/36 cell line is a resource for the detection, amplification, and analysis of mosquito-borne viruses including Zika, dengue, and chikungunya. The cell line is derived from an unknown number of larvae from an unspecified strain of Aedes albopictus mosquitoes. Toward improved utility of the cell line for research in virus transmission, we present an annotated assembly of the C6/36 genome. The C6/36 genome assembly has the largest contig N50 (3.3 Mbp) of any mosquito assembly, presents the sequences of both haplotypes for most of the diploid genome, reveals independent null mutations in both alleles of the Dicer locus, and indicates a male-specific genome. Gene annotation was computed with publicly available mosquito transcript sequences. Gene expression data from cell line RNA sequence identified enrichment of growth-related pathways and conspicuous deficiency in aquaporins and inward rectifier K+ channels. As a test of utility, RNA sequence data from Zika-infected cells were mapped to the C6/36 genome and transcriptome assemblies. Host subtraction reduced the data set by 89%, enabling faster characterization of nonhost reads. The C6/36 genome sequence and annotation should enable additional uses of the cell line to study arbovirus vector interactions and interventions aimed at restricting the spread of human disease.
Measurement of the Z-boson pT distribution in bar pp collisions at √s =1.8 TeV
International Nuclear Information System (INIS)
Abe, F.; Amidei, D.; Apollinari, G.; Atac, M.; Auchincloss, P.; Baden, A.R.; Bailey, M.; Bamberger, A.; Barnett, B.A.; Barbaro-Galtieri, A.; Barnes, V.E.; Baumann, T.; Bedeschi, F.; Behrends, S.; Belforte, S.; Bellettini, G.; Bellinger, J.; Bensinger, J.; Beretvas, A.; Berge, J.P.; Bertolucci, S.; Bhadra, S.; Binkley, M.; Blair, R.; Blocker, C.; Bolognesi, V.; Booth, A.W.; Boswell, C.; Brandenburg, G.; Brown, D.; Buckley-Geer, E.; Budd, H.S.; Byon, A.; Byrum, K.L.; Campagnari, C.; Campbell, M.; Carey, R.; Carithers, W.; Carlsmith, D.; Carroll, J.T.; Cashmore, R.; Cervelli, F.; Chadwick, K.; Chiarelli, G.; Chinowsky, W.; Cihangir, S.; Clark, A.G.; Connor, D.; Contreras, M.; Cooper, J.; Cordelli, M.; Cousins, R.; Crane, D.; Curatolo, M.; Day, C.; Dell'Agnello, S.; Dell'Orso, M.; Demortier, L.; Derwent, P.F.; Devlin, T.; DiBitonto, D.; Drucker, R.B.; Elias, J.E.; Ely, R.; Eno, S.; Errede, S.; Esposito, B.; Feldman, G.J.; Flaugher, B.; Foster, G.W.; Franklin, M.; Freeman, J.; Frisch, H.; Fukui, Y.; Funayama, Y.; Garfinkel, A.F.; Gauthier, A.; Geer, S.; Giannetti, P.; Giokaris, N.; Giromini, P.; Gladney, L.; Gold, M.; Goulianos, K.; Grassmann, H.; Grosso-Pilcher, C.; Haber, C.; Hahn, S.R.; Handler, R.; Hara, K.; Harris, R.M.; Hauser, J.; Hawk, C.; Hessing, T.; Hollebeek, R.; Holloway, L.; Hu, P.; Hubbard, B.; Huffman, B.T.; Hughes, R.; Hurst, P.; Huth, J.; Incagli, M.; Ino, T.; Iso, H.; Jensen, H.; Jessop, C.P.; Johnson, R.P.; Joshi, U.; Kadel, R.W.; Kamon, T.; Kanda, S.; Kardelis, D.A.; Karliner, I.; Kearns, E.; Keeble, L.; Kephart, R.; Kesten, P.; Keup, R.M.; Keutelian, H.; Kim, S.; Kirsch, L.; Kondo, K.; Konigsberg, J.; Kuhlmann, S.E.; Kuns, E.; Laasanen, A.T.; Lamoureux, J.I.; Leone, S.; Li, W.; Liss, T.M.; Lockyer, N.; Luchini, C.B.; Maas, P.; Mangano, M.; Marriner, J.P.; Markeloff, R.; Markosky, L.A.
1991-01-01
We have measured the Z-boson production differential cross section as a function of transverse momentum using Z→ee and Z→μμ decays in bar pp collision at √s =1.8 TeV with the Collider Detector at Fermilab. Comparison with standard-model predictions shows good agreement over the range 0 T <160 GeV/c available from this data sample
26 CFR 1.636-1 - Treatment of production payments as loans.
2010-04-01
... shall be treated as a purchase money mortgage loan on the mineral property burdened thereby. Such... as a purchase money mortgage loan. (3) The provisions of this paragraph may be illustrated by the... time of the creation of such production payment, in the absence of section 636(a). See section 83 and...
1981-01-01
4c sw- 0mr- w <L -- 0 I- 0. .1 I0 W ’- -o’ -3 w XLW 8 0 WW 4CFO .-. .- -4 >(lJ K 0 E-#F-0 c...2 -. 4-; In cnz KW cc 8 0 0 I f4 (z~ 0- 0- 0- -- .10 ’ 4c 0z J It’ 00 it w .C 0 W 040 ~ LL. i ao0000 11.4 Or. z ZOO 3- LCW J- zw a J Cz 4 WW L...a* o darDf Ma r, in ori~e s.Vsaa rsnre (’,. mi ,-te ~ b . C, ."s ...... .- - - - ln,V,,i:e, .’ ,. . "(’ hrm ,..,o lrda hind ’ ,++r!l, hert.
Prevalence and severity of dental caries among 18-year-old Lithuanian adolescents.
Žemaitienė, Miglė; Grigalauskienė, Rūta; Vasiliauskienė, Ingrida; Saldūnaitė, Kristina; Razmienė, Jaunė; Slabšinskienė, Eglė
2016-01-01
The aim of the study was to evaluate the prevalence and severity of dental caries among 18-year-old Lithuanian adolescents and to disclose possible differences in the prevalence and severity of dental caries related to gender, urbanization, and different county. A total of 1063 18-year-old adolescents attending school, 427 boys and 636 girls from 10 Lithuanian counties including urban and rural areas, were included in the cross-sectional study on dental caries. The method of multistage cluster sampling was used. The dental examination was performed according to the methodology of oral status evaluation recommendations by the World Health Organization (WHO). The prevalence of dental caries, DMFT score, Significant Caries Index, and dental care index were determined. The overall prevalence of dental caries among 18-year-old Lithuanian adolescents was 78.3%. The study population had a mean DMFT score of 2.93 [SD, 2.81]. Considering the gender, a higher DMFT score was observed among girls than boys (3.03 [SD, 2.88] versus 2.73 [SD, 2.71]) and in rural than urban areas (3.02 [SD, 2.98] versus 2.89 [SD, 2.73]). The Significant Caries Index and the dental care index among 18-year-old adolescents were 6.14 and 62.3%, respectively. This study showed a relatively high prevalence of dental caries. The existing differences of caries experience between the urban and the rural areas as well as between the counties could be influenced by the socioeconomic differences in the country. Copyright © 2016 The Lithuanian University of Health Sciences. Production and hosting by Elsevier Urban & Partner Sp. z o.o. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Rasool, Muhammad Nasir, E-mail: nasir4iub@gmail.com [Department of Physics, The Islamia University of Bahawalpur, Bahawalpur, 63100 (Pakistan); Hussain, Altaf, E-mail: altafiub@yahoo.com [Department of Physics, The Islamia University of Bahawalpur, Bahawalpur, 63100 (Pakistan); Javed, Athar [Department of Physics, University of the Punjab, Lahore, 54590 (Pakistan); Khan, Muhammad Azhar; Iqbal, F. [Department of Physics, The Islamia University of Bahawalpur, Bahawalpur, 63100 (Pakistan)
2016-11-01
The structural stability, electronic and magnetic behaviour of YCoVZ (Z = Si, Ge) and YCoTiZ (Z = Si, Ge) Heusler alloys have been studied by first principle approach. Generalized gradient approximation (GGA) based on density functional theory (DFT) has been applied to investigate the properties of quaternary Heusler alloys. The YCoVSi, YCoVGe, YCoTiSi and YCoTiGe Heusler alloys of Type-3 structure are found to be stable in spin-polarized/magnetic phase. The YCoVSi and YCoVGe alloys exhibit nearly spin gapless semiconductor (SGS) behaviour while YCoTiSi and YCoTiGe alloys show half-metallic ferromagnetic (HMF) behaviour. For YCoVSi, YCoVGe, YCoTiSi and YCoTiGe alloys, the calculated energy band gaps in spin down (↓) channel are 0.60, 0.54, 0.68 and 0.44 eV, respectively. The YCoVZ and YCoTiZ alloys are found to have integral value of total magnetic moment (M{sub T}), thus obeying the Slater-Pauling rule, M{sub T} = (N{sub v}–18)μ{sub B}. - Highlights: • Four Heusler alloys i.e. YCoVZ (Z = Si, Ge) and YCoTiZ (Z = Si, Ge) are studied. • Type-3 crystal structure of all four alloys is stable in magnetic phase. • The compressibility (S) follows the order: S{sub YCoVSi} > S{sub YCoTiSi} > S{sub YCoVGe} > S{sub YCoTiGe}. • Half metallic ferromagnetic behaviour is observed in all four alloys. • All four alloys obey the Slater-Pauling rule, M{sub T} = (N{sub v} – 18)μ{sub B}.
International Nuclear Information System (INIS)
Wong, Ching-yee Oliver; Gannon, James; Bong, Jeffrey; Wong, Christiana O; Saha, Gopal B
2007-01-01
To evaluate the use of unbiased computer-assisted lateralization of temporal lobe epilepsy (TLE) by z-score parametric PET imaging (ZPET). 38 patients with histologically proven unilateral TLE due to pure hippocampal sclerosis, referred for pre-surgical PET evaluation of intractable seizure over a 5-year period, were included. The F-18 FDG images were oriented along temporal long axis and then transformed into ZPET images on a voxel by voxel basis. Multiple regions of interests (21 in total) were placed on cortical, subcortical and cerebellar structures on twenty-eight out of 38 patients with totally seizure-free (class I) outcome. Paired t-tests with Bonferroni correction were used to determine the location of the most asymmetric regions as variables for subsequent discriminant analysis of the entire group of the patients. The computer program identified the anterior half of the temporal lobe (p < 0.0005) and thalami (p = 0.021) as the most asymmetric regions in TLE patients with Class I outcome. Discriminant analysis using z-scores from a total of 8 ROIs (in 4 pairs) on these structures correctly lateralized thirty-seven out of 38 (97%) patients (sensitivity = 94%; specificity = 100%). The only false localization came from a patient with equivocal z-scores on the temporal lobes and this patient turned out to have poor outcome. The computer-assisted lateralization of TLE using ZPET provides an accurate, fast and objective way of seizure evaluation
23 CFR 636.113 - Is the stipend amount eligible for Federal participation?
2010-04-01
... ENGINEERING AND TRAFFIC OPERATIONS DESIGN-BUILD CONTRACTING General § 636.113 Is the stipend amount eligible.... (b) Unless prohibited by State law, you may retain the right to use ideas from unsuccessful offerors... the stipend to qualifying offerors. The acceptance of any stipend must be optional on the part of the...
Energy Technology Data Exchange (ETDEWEB)
Kramer-Marek, Gabriela; Lee, Sang Bong; Capala, Jacek [National Institutes of Health, National Cancer Institute, Bethesda, MD (United States); Kiesewetter, Dale O.; Jagoda, Elaine [National Institutes of Health, National Institute of Biomedical Imaging and Bioengineering, Bethesda, MD (United States); Martiniova, Lucia [National Institutes of Health, National Institute of Child Health and Human Development, Bethesda, MD (United States)
2008-05-15
The expression of human epidermal growth factor receptor-2 (HER2) receptors in cancers is correlated with a poor prognosis. If assessed in vivo, it could be used for selection of appropriate therapy for individual patients and for monitoring of the tumor response to targeted therapies. We have radiolabeled a HER2-binding Affibody molecule with fluorine-18 for in vivo monitoring of the HER2 expression by positron emission tomography (PET). The HER2-binding Z{sub HER2:342}-Cys Affibody molecule was conjugated with N-2-(4-[{sup 18}F]fluorobenzamido)ethylmaleimide ([{sup 18}F]FBEM). The in vitro binding of the resulting radioconjugate was characterized by receptor saturation and competition assays. For in vivo studies, the radioconjugate was injected into the tail vein of mice bearing subcutaneous HER2-positive or HER2-negative tumors. Some of the mice were pre-treated with non-labeled Z{sub HER2:342}-Cys. The animals were sacrificed at different times post-injection, and the radioactivity in selected tissues was measured. PET images were obtained using an animal PET scanner. In vitro experiments indicated specific, high-affinity binding to HER2. PET imaging revealed a high accumulation of the radioactivity in the tumor as early as 20 min after injection, with a plateau being reached after 60 min. These results were confirmed by biodistribution studies demonstrating that, as early as 1 h post-injection, the tumor to blood concentration ratio was 7.5 and increased to 27 at 4 h. Pre-saturation of the receptors with unlabeled Z{sub HER2:342}-Cys lowered the accumulation of radioactivity in HER2-positive tumors to the levels observed in HER2-negative ones. Our results suggest that the [{sup 18}F]FBEM-Z{sub HER2:342} radioconjugate can be used to assess HER2 expression in vivo. (orig.)
International Nuclear Information System (INIS)
Chee, H.-Y.; AbuBakar, Sazaly
2004-01-01
Binding of dengue virus 2 (DENV-2) to C6/36 mosquito cells protein was investigated. A 48 kDa DENV-2-binding C6/36 cells protein (D2BP) was detected in a virus overlay protein-binding assay. The binding occurred only to the C6/36 cells cytosolic protein fraction and it was inhibited by free D2BP. D2BP was shown to bind to DENV-2 E in the far-Western-binding studies and using mass spectrometry (MS) and MS/MS, peptide masses of the D2BP that matched to β-tubulin and α-tubulin chains were identified. These findings suggest that DENV-2 through DENV-2 E binds directly to a 48 kDa tubulin or tubulin-like protein of C6/36 mosquito cells
Ti2FeZ (Z=Al, Ga, Ge) alloys: Structural, electronic, and magnetic properties
International Nuclear Information System (INIS)
Liping, Mao; Yongfan, Shi; Yu, Han
2014-01-01
Using the first-principle projector augmented wave potential within the generalized gradient approximation taking into account the on-site Coulomb repulsive, we investigate the structural, electronic and magnetic properties of Ti 2 FeZ (Z=Al, Ga, Ge) alloys with Hg 2 CuTi-type structure. These alloys are found to be half-metallic ferrimagnets. The total magnetic moments of the Heusler alloys Ti 2 FeZ follow the µ t =Z t −18 rule and agree with the Slater–Pauling curve quite well. The band gaps are mainly determined by the bonding and antibonding states created from the hybridizations of the d states between the Ti(A)–Ti(B) coupling and Fe atom. - Highlights: • Ti 2 FeZ (Z=Al, Ga, Ge) are found to be half-metallic ferrimagnets. • The band gaps are mainly determined by the hybridizations of the d states between the Ti(A)–Ti(B) coupling and Fe atom. • The s–p elements play an important role in the half-metallicity of these Heusler alloys
International Nuclear Information System (INIS)
Diaz, E.; O'Laughlin, J.T.; O'Leary, M.H.
1988-01-01
(Z)-3-Bromophosphoenolpyruvate inactivates phosphoenolpyruvate carboxylase from maize in the presence of HCO 3 - and either Mg 2+ or Mn 2+ . The inactivation rate follows saturation kinetics. Inactivation is slower in the presence of phospholactate or epoxymaleate, both of which are inhibitors of the enzyme, or dithiothreitol. Inactivation is completely prevented by the presence of lactate dehydrogenase and NADH, and 3-bromolactate is formed during this treatment. If the reaction is conducted by using HC 18 O 3 - , the inorganic phosphate produced contains 18 O. This and other evidence indicate that phosphoenolpyruvate carboxylase catalyzes conversion of bromophosphoenolpyruvate into bromopyruvate by way of the usual carboxyphosphate-enolate intermediate, and bromopyruvate is the species responsible for enzyme inactivation. (Z)-3-fluorophosphoenolpyruvate is transformed by the enzyme into a 6:1 mixture of 3-fluoropyruvate and 3-fluorooxalacetate, presumably by the same mechanism. The enzyme is not inactivated during this treatment
Mokhtar, Rana R; Holick, Michael F; Sempértegui, Fernando; Griffiths, Jeffrey K; Estrella, Bertha; Moore, Lynn L; Fox, Matthew P; Hamer, Davidson H
2017-11-22
There is limited knowledge on vitamin D status of children residing in the Andes and its association with undernutrition. We evaluated the vitamin D status of children residing in a low socio-economic status (SES) setting in the Ecuadorian Andes and assessed the association between vitamin D status, stunting and underweight. We hypothesized that children who were underweight would have lower serum 25-hydroxyvitamin D (25(OH)D) levels and lower 25(OH)D levels would be associated with a higher risk of stunting. We conducted a cross-sectional secondary analysis of a randomized controlled trial, the Vitamin A, Zinc and Pneumonia study. Children had serum 25(OH)D concentrations measured. A sensitivity analysis was undertaken to determine a vitamin D cut-off specific for our endpoints. Associations between serum 25(OH)D and underweight (defined as weight-for-age Z-score≤-1) and stunting (defined as height-for-age Z-score≤-2) were assessed using multivariate logistic regression. Children residing in five low-SES peri-urban neighbourhoods near Quito, Ecuador. Children (n 516) aged 6-36 months. Mean serum 25(OH)D concentration was 58·0 (sd 17·7) nmol/l. Sensitivity analysis revealed an undernutrition-specific 25(OH)D cut-off of DDD levels were more likely to be stunted (aOR=2·8; 95 % CI 1·6, 4·7). Low serum 25(OH)D levels were more common in underweight and stunted Ecuadorian children.
32 CFR 636.24 - Driving on right side of roadway; use of roadway.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Driving on right side of roadway; use of roadway... (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION (SPECIFIC INSTALLATIONS) Fort Stewart, Georgia § 636.24 Driving on right side of roadway; use of roadway. (a) All drivers...
34 CFR 636.5 - What are the matching contribution and planning consortium requirements?
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false What are the matching contribution and planning... PROGRAM General § 636.5 What are the matching contribution and planning consortium requirements? (a) The... agreed to by the members of a planning consortium. (Authority: 20 U.S.C. 1136b, 1136e) ...
Energy Technology Data Exchange (ETDEWEB)
Grudberg, Peter Matthew [California Univ., Berkeley, CA (United States)
1997-12-31
This thesis reports on the measurement of the W and Z boson inclusive production cross sections (σW and σZ) times electronic branching ratios (Br(W → ev) and Br(Z → ee)) in p$\\bar{p}$ collisions at √s = 1.8 TeV. The analysis is based on 12.8 pb-1 of data taken in the 1992-1993 run by the D0 detector at the Fermilab Tevatron collider; the cross sections were measured to be: σW ∙ Br(W → ev) = 2. 36 ± 0.02 ± 0.07 ± 0.13 nb and σZ ∙ Br(Z → ee) = 0.218 ± 0.008 ± 0.008 ± 0.012 nb. The first error is statistical, the second error represents the non- luminosity systematic error, and the third error shows the uncertainty in the luminosity determination. Future prospects for similar measurements based on larger samples of data are discussed.
Energy Technology Data Exchange (ETDEWEB)
Grudberg, Peter Matthew [Univ. of California, Berkeley, CA (United States)
1997-01-01
This thesis reports on the measurement of the W and Z boson inclusive production cross sections (σW and σZ) times electronic branching ratios (Br(W → ev) and Br(Z → ee)) in p$\\bar{p}$ collisions at √s = 1.8 TeV. The analysis is based on 12.8 pb-1 of data taken in the 1992--1993 run by the D0 detector at the Fermilab Tevatron collider; the cross sections were measured to be: σW ∙ Br(W → ev) = 2.36 ± 0.02 ± 0.07 ± 0.13 nb and σZ ∙ Br(Z → ee) = 0.218 ± 0.008 ± 0.008 ± 0.012 nb. The first error is statistical, the second error represents the non-luminosity systematic error, and the third error shows the uncertainty in the luminosity determination. Future prospects for similar measurements based on larger samples of data are discussed.
International Nuclear Information System (INIS)
Grudberg, P.M.
1997-01-01
This thesis reports on the measurement of the W and Z boson inclusive production cross sections (σ W and σ Z ) times electronic branching ratios (Br(W → eν) and Br(Z → ee)) in p anti p collisions at √s = 1.8 TeV. The analysis is based on 12.8 pb -1 of data taken in the 1992--1993 run by the D0 detector at the Fermilab Tevatron collider; the cross sections were measured to be: σ W · Br(W → eν) = 2.36 ± 0.02 ± 0.07 ± 0.13 nb and σ Z · Br(Z → ee) 0.218 ± 0.008 ± 0.008 ± 0.012 nb. The first error is statistical, the second error represents the non-luminosity systematic error, and the third error shows the uncertainty in the luminosity determination. Future prospects for similar measurements based on larger samples of data are discussed
International Nuclear Information System (INIS)
Grudberg, P.M.
1997-01-01
This thesis reports on the measurement of the W and Z boson inclusive production cross sections (σ W and σ Z ) times electronic branching ratios (Br(W → eν) and Br(Z → ee)) in p anti p collisions at √s = 1.8 TeV. The analysis is based on 12.8 pb -1 of data taken in the 1992-1993 run by the D0 detector at the Fermilab Tevatron collider; the cross sections were measured to be: σ W · Br(W → eν) = 2. 36 ± 0.02 ± 0.07 ± 0.13 nb and σ Z · Br(Z → ee) = 0.218 ± 0.008 ± 0.008 ± 0.012 nb. The first error is statistical, the second error represents the non- luminosity systematic error, and the third error shows the uncertainty in the luminosity determination. Future prospects for similar measurements based on larger samples of data are discussed
Corrosion mechanism of Z3 CN18.10 stainless steel in the presence of nitric acid condensates
International Nuclear Information System (INIS)
Balbaud, Fanny
1998-01-01
In installations handling concentrated boiling nitric acid, a severe intergranular corrosion can sometimes occur in condensation zones constituted of non-sensitized Z3 CN 18.10 stainless steel. Corrosion tests in reactors and in a specific loop, CIRCE, allowed to specify the conditions of occurrence of this type of corrosion and showed the similitude with the corrosion in non-renewed liquid nitric acid: the specific parameters linked to the condensate phase are the high ratio metallic surface area to volume of condensate and the low renewing rate which induce a concentration of oxidation products of the metal and of reduction products of nitric acid. The initiation of the intergranular corrosion is attributed to the increase in the reduction rate of nitric acid by an autocatalytic mechanism which was demonstrated by electrochemical measurements on platinum and on stainless steel. The reduction mechanism involves a charge transfer step where nitrous acid, the electro-active species, is reduced into nitrogen monoxide and a chemical regeneration reaction of nitrous acid. The thermodynamic study led to a representation of the chemical and electrochemical properties of nitric acid. This study allowed also to determine the Gibbs free energy of formation of nitrous acid in solution in concentrated nitric acid at 100 deg. C. The diagram, constructed in coordinates log(P O 2 ) / [-log(P HNO 3 )] or E eXperimental / [-log(P HNO 3 )], shows that the final reduction product of nitric acid depends on the concentration of nitric acid: at 100 deg. C, NO is obtained for concentrations lower than 8 mol.L -1 and NO 2 is obtained for higher concentrations. All these results allowed to propose a corrosion mechanism of Z3 CN 18.10 stainless steel in the presence of nitric acid condensates. [fr
Detailed spectral simulations in support of PBFA-Z dynamic hohlraum Z-pinch experiments
International Nuclear Information System (INIS)
MacFarlane, J.J.; Wang, P.; Derzon, M.S.; Haill, A.; Nash, T.J.; Peterson, D.L.
1997-01-01
In PBFA-Z dynamic hohlraum Z-pinch experiments, 16--18 MA of current is delivered to a load comprises of a tungsten wire array surrounding a low-density cylindrical CH foam. The magnetic field accelerates the W plasma radially inward at velocities ∼ 40--60 cm/micros. The W plasma impacts into the foam, generating a high T R radiation field which diffuses into the foam. The authors are investigating several types of spectral diagnostics which can be used to characterize the time-dependent conditions in the foam. In addition, they are examining the potential ramifications of axial jetting on the interpretation of axial x-ray diagnostics. In the analysis, results from 2-D radiation-magnetohydrodynamics simulations are post-processed using a hybrid spectral analysis code in which low-Z material is treated using a detailed collisional-radiative atomic model, while high-Z material is modeled using LTE UTA (unresolved transition array) opacities. They will present results from recent simulations and discuss ramifications for x-ray diagnostics
Chloroquine Inhibits Dengue Virus Type 2 Replication in Vero Cells but Not in C6/36 Cells
Directory of Open Access Journals (Sweden)
Kleber Juvenal Silva Farias
2013-01-01
Full Text Available Dengue viruses are the most important arthropod-borne viruses in terms of morbidity and mortality in the world. Since there is no dengue vaccine available for human use, we have set out to investigate the use of chloroquine as an antiviral drug against dengue. Chloroquine, an amine acidotropic drug known to affect intracellular exocytic pathways by increasing endosomal pH, was used in the in vitro treatment of Vero and C6/36 cells infected with dengue virus type 2 (DENV-2. Real-time RT-PCR and plaque assays were used to quantify the DENV-2 load in infected Vero and C6/36 cells after chloroquine treatment. Our results showed that a dose of 50 μg/ml of chloroquine was not toxic to the cells and induced a statistically significant inhibition of virus production in infected Vero cells when compared to untreated cells. In C6/36 cells, chloroquine does not induce a statistically significant difference in viral replication when compared to untreated cells, showing that this virus uses an unlikely pathway of penetration in these cells, and results were also confirmed by the plaque assay (PFU. These data suggest that the inhibition of virus infection induced by chloroquine is due to interference with acidic vesicles in mammalian cells.
Chloroquine inhibits dengue virus type 2 replication in Vero cells but not in C6/36 cells.
Farias, Kleber Juvenal Silva; Machado, Paula Renata Lima; da Fonseca, Benedito Antônio Lopes
2013-01-01
Dengue viruses are the most important arthropod-borne viruses in terms of morbidity and mortality in the world. Since there is no dengue vaccine available for human use, we have set out to investigate the use of chloroquine as an antiviral drug against dengue. Chloroquine, an amine acidotropic drug known to affect intracellular exocytic pathways by increasing endosomal pH, was used in the in vitro treatment of Vero and C6/36 cells infected with dengue virus type 2 (DENV-2). Real-time RT-PCR and plaque assays were used to quantify the DENV-2 load in infected Vero and C6/36 cells after chloroquine treatment. Our results showed that a dose of 50 μg/ml of chloroquine was not toxic to the cells and induced a statistically significant inhibition of virus production in infected Vero cells when compared to untreated cells. In C6/36 cells, chloroquine does not induce a statistically significant difference in viral replication when compared to untreated cells, showing that this virus uses an unlikely pathway of penetration in these cells, and results were also confirmed by the plaque assay (PFU). These data suggest that the inhibition of virus infection induced by chloroquine is due to interference with acidic vesicles in mammalian cells.
Bonaventura, N. R.; Webb, T. M. A.; Muzzin, A.; Noble, A.; Lidman, C.; Wilson, G.; Yee, H. K. C.; Geach, J.; Hezaveh, Y.; Shupe, D.; Surace, J.
2017-08-01
We present the results of a Spitzer/Herschel infrared photometric analysis of the largest (716) and the highest-redshift (z = 1.8) sample of brightest cluster galaxies (BCGs), those from the Spitzer Adaptation of the Red-Sequence Cluster Survey Given the tension that exists between model predictions and recent observations of BCGs at z energy distributions (SEDs) to a variety of model templates in the literature, we identify the major sources of their infrared energy output, in multiple redshift bins between 0 solar masses per year down to z = 0.5. This discovery challenges the accepted belief that BCGs should only passively evolve through a series of gas-poor, minor mergers since z ˜ 4, but agrees with an improved semi-analytic model of hierarchical structure formation that predicts star-forming BCGs throughout the epoch considered. We attribute the star formation inferred from the stacked infrared SEDs to both major and minor 'wet' (gas-rich) mergers, based on a lack of key signatures (to date) of cooling-flow-induced star formation, as well as a number of observational and simulation-based studies that support this scenario.
Energy Technology Data Exchange (ETDEWEB)
Yi, Wei-Min; Bai, Jin-Ming; Zhang, Ju-jia; Wang, Fang; Wang, Jian-Guo; Fan, Yu-Feng; Chang, Liang; Wang, Chuan-Jun; Lun, Bao-Li [Yunnan Observatories, Chinese Academy of Sciences, Kunming 650011 (China); Wang, Feige; Wu, Xue-Bing; Yang, Jinyi; Ho, Luis C.; Zuo, Wenwen; Yang, Qian; Ai, Yanli [Department of Astronomy, School of Physics, Peking University, Beijing 100871 (China); Fan, Xiaohui [Steward Observatory, University of Arizona, Tucson, AZ 85721-0065 (United States); Brandt, William N. [Department of Astronomy and Astrophysics, The Pennsylvania State University, 525 Davey Lab, University Park, PA 16802 (United States); Kim, Minjin [Korea Astronomy and Space Science Institute, Daejeon 305-348 (Korea, Republic of); Wang, Ran [Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100871 (China); and others
2014-11-10
Very few of the z > 5 quasars discovered to date have been radio-loud, with radio-to-optical flux ratios (radio-loudness parameters) higher than 10. Here we report the discovery of an optically luminous radio-loud quasar, SDSS J013127.34–032100.1 (J0131–0321 in short), at z = 5.18 ± 0.01 using the Lijiang 2.4 m and Magellan telescopes. J0131–0321 has a spectral energy distribution consistent with that of radio-loud quasars. With an i-band magnitude of 18.47 and a radio flux density of 33 mJy, its radio-loudness parameter is ∼100. The optical and near-infrared spectra taken by Magellan enable us to estimate its bolometric luminosity to be L {sub bol} ∼ 1.1 × 10{sup 48} erg s{sup –1}, approximately 4.5 times greater than that of the most distant quasar known to date. The black hole mass of J0131–0321 is estimated to be 2.7 × 10{sup 9} M {sub ☉}, with an uncertainty up to 0.4 dex. Detailed physical properties of this high-redshift, radio-loud, potentially super-Eddington quasar can be probed in the future with more dedicated and intensive follow-up observations using multi-wavelength facilities.
Order 636 has worrisome leftovers for small LDCs
International Nuclear Information System (INIS)
Anon.
1993-01-01
This paper is an interview with a representative of a local natural gas distribution company, giving his opinion of the economic effects of the Federal Energy Regulatory Commission's (FERC) Order 636. This regulation provides that all natural gas, pipelines, and local gas distribution companies (LDC's) contract and manage their own supply and demand sales and purchases. The goal of the legislation was to provide a stable natural gas market which would allow for long term contract sales of natural gas. This paper discusses the economic and business impacts this regulation will have on LDC's which use to spot market purchase the majority of their gas from lowest price suppliers. The end result of this regulation would reduce the available of easily accessible spot market gas and require LCD's to begin negotiating their own contracts
X-ray sources by Z-pinch for inertial confinement fusion
International Nuclear Information System (INIS)
Akiyama, Hidenori; Katsuki, Sunao; Lisitsyn, Igor
1999-01-01
Inertial confinement nuclear fusion driven by X-ray from Z-pinch plasmas has been developed. Recently, extremely high X-ray power (290 TW) and energy (1.8 MJ) were produced in fast Z-pinch implosions on the Z accelerator (Sandia National Laboratories). Wire arrays are used to produce the initial plasma. The X-ray from Z-pinch plasmas produced by pulsed power has great potential as a driver of inertial confinement nuclear fusion. (author)
Czech Academy of Sciences Publication Activity Database
Škarpová, Marie; Kapsa, Václav
2008-01-01
Roč. 45, 3-4 (2008) ISSN 0018-7003. [Aurora musas nutrit. Die Jesuiten und die Kultur Mitteleuropas im 16.-18. Jahrhundert. Bratislava, 26.09.2007-29.09.2007] Institutional research plan: CEZ:AV0Z90580513 Keywords : music * conferences * report Subject RIV: AL - Art, Architecture, Cultural Heritage
Progress on z-pinch inertial fusion energy
International Nuclear Information System (INIS)
Olson, C.; Rochau, G.; Matzen, M.K.
2005-01-01
The goal of z-pinch inertial fusion energy (IFE) is to extend the single-shot z-pinch inertial confinement fusion (ICF) results on Z to a repetitive-shot z-pinch power plant concept for the economical production of electricity. Z produces up to 1.8 MJ of x-rays at powers as high as 230 TW. Recent target experiments on Z have demonstrated capsule implosion convergence ratios of 14-21 with a double-pinch driven target, and DD neutron yields up to 8x10exp10 with a dynamic hohlraum target. For z-pinch IFE, a power plant concept is discussed that uses high-yield IFE targets (3 GJ) with a low rep-rate per chamber (0.1 Hz). The concept includes a repetitive driver at 0.1 Hz, a Recyclable Transmission Line (RTL) to connect the driver to the target, high-yield targets, and a thick-liquid wall chamber. Recent funding by a U.S. Congressional initiative for $4M for FY04 is supporting research on RTLs, repetitive pulsed power drivers, shock mitigation, full RTL cycle planned experiments, high-yield IFE targets, and z-pinch power plant technologies. Recent results of research in all of these areas are discussed, and a Road Map for Z-Pinch IFE is presented. (author)
U.S. independents face new age for gas under FERC order 636
International Nuclear Information System (INIS)
Gibbs, E.S.
1992-01-01
This paper reports that the U.S. Federal Energy Regulatory Commission's Order 636 opens the doors to a potential new age for independent producers and others in the gas industry. Rather than defining new winners and losers, it creates the same opportunity for every competitor: a significant new role in the marketing of natural gas. But it is not for the faint of heart, the uneducated, or those who have not identified their goals, strategies, and parameters within which they intend to compete
Davis, Deborah Winders; Finkel, Deborah; Turkheimer, Eric; Dickens, William
2015-11-01
The Infant Behavior Record (IBR) from the Bayley Scales of Infant Development has been used to study behavioral development since the 1960s. Matheny (1983) examined behavioral development at 6, 12, 18, and 24 months from the Louisville Twin Study (LTS). The extracted temperament scales included Task Orientation, Affect-Extraversion, and Activity. He concluded that monozygotic twins were more similar than same-sex dizygotic twins on these dimensions. Since this seminal work was published, a larger LTS sample and more advanced analytical methods are available. In the current analyses, Choleksy decomposition was applied to behavioral data (n = 1231) from twins 6-36 months. Different patterns of genetic continuity vs genetic innovations were identified for each IBR scale. Single common genetic and shared environmental factors explained cross-age twin similarity in the Activity scale. Multiple shared environmental factors and a single genetic factor coming on line at age 18 months contributed to Affect-Extraversion. A single shared environmental factor and multiple genetic factors explained cross-age twin similarity in Task Orientation.
Experimental studies of an Extrap Z-Pinch
International Nuclear Information System (INIS)
Drake, J.R.
1983-01-01
Experimental studies of the formation, equilibrium and stability of a linear Extrap Z-pinch are reported on. The Z-pinch discharge is generated between electrodes along the Z-axis of a linear octupole field produced by currents in four Z-directed rods. The combined discharge current and rod currents produce a magnetic field having a separatrix with four null X-points which define the corners of a square shaped region where the high beta plasma discharge is contained. Bounding the pinch discharge with a separatrix produces equilibria which are stable against global kink modes for the 50-μsec duration of the discharge which corresponds to about 100 Alfven transit times. The equilibria, with line densities of about 3 x 10 18 m - 1 , are consistent in magnitude and scaling with the Bennet relation. (Author)
How is Order 636 affecting the gas producing industry? -- Part 4
International Nuclear Information System (INIS)
Anon.
1994-01-01
This paper is an interview with a representative of the natural gas industry regarding the impacts of the new Order 636 recently approved by the Federal Energy Regulatory Commission. The regulations are related to natural gas production and regulated pipeline distribution. The goal is to help establish long-term contracts between users and producers with a stable transportation system allowing both competition and price controls. The interview discusses the economic aspects of this regulation, the effects on marketing and production, and the ability of the regulation to actually be a catalyst for long-term contract agreements
Measurement of the Z boson resonance parameters
International Nuclear Information System (INIS)
Feldman, G.J.
1989-11-01
Using the Mark II detector at the SLC, we measure the Z mass and width to be 91.17 ± 0.18 GeV/c 2 and 1.95 +0. 40 -0.30 GeV, respectively. From a fit in which the visible Z width is constrained to its Standard Model value, the number of neutrino species is determined to be 3.0 ± or <4.4 at the 95% confidence level. 13 refs., 20 figs., 4 tabs
International Nuclear Information System (INIS)
Ryutov, D.D.; Derzon, M.S.; Matzen, M.K.
1998-07-01
The spectacular progress made during the last few years in reaching high energy densities in fast implosions of annular current sheaths (fast Z pinches) opens new possibilities for a broad spectrum of experiments, from x-ray generation to controlled thermonuclear fusion and astrophysics. Presently Z pinches are the most intense laboratory X ray sources (1.8 MJ in 5 ns from a volume 2 mm in diameter and 2 cm tall). Powers in excess of 200 TW have been obtained. This warrants summarizes the present knowledge of physics that governs the behavior of radiating current-carrying plasma in fast Z-pinches. This survey covers essentially all aspects of the physics of fast Z pinches: initiation, instabilities of the early stage, magnetic Rayleigh-Taylor instability in the implosion phase, formation of a transient quasi-equilibrium near the stagnation point, and rebound. Considerable attention is paid to the analysis of hydrodynamic instabilities governing the implosion symmetry. Possible ways of mitigating these instabilities are discussed. Non-magnetohydrodynamic effects (anomalous resistivity, generation of particle beams, etc.) are summarized. Various applications of fast Z pinches are briefly described. Scaling laws governing development of more powerful Z pinches are presented. The survey contains 52 figures and nearly 300 references
Energy Technology Data Exchange (ETDEWEB)
RYUTOV,D.D.; DERZON,MARK S.; MATZEN,M. KEITH
1999-10-25
The spectacular progress made during the last few years in reaching high energy densities in fast implosions of annular current sheaths (fast Z pinches) opens new possibilities for a broad spectrum of experiments, from x-ray generation to controlled thermonuclear fusion and astrophysics. Presently Z pinches are the most intense laboratory X ray sources (1.8 MJ in 5 ns from a volume 2 mm in diameter and 2 cm tall). Powers in excess of 200 TW have been obtained. This warrants summarizing the present knowledge of physics that governs the behavior of radiating current-carrying plasma in fast Z pinches. This survey covers essentially all aspects of the physics of fast Z pinches: initiation, instabilities of the early stage, magnetic Rayleigh-Taylor instability in the implosion phase, formation of a transient quasi-equilibrium near the stagnation point, and rebound. Considerable attention is paid to the analysis of hydrodynamic instabilities governing the implosion symmetry. Possible ways of mitigating these instabilities are discussed. Non-magnetohydrodynamic effects (anomalous resistivity, generation of particle beams, etc.) are summarized. Various applications of fast Z pinches are briefly described. Scaling laws governing development of more powerful Z pinches are presented. The survey contains 36 figures and more than 300 references.
International Nuclear Information System (INIS)
Bagger, J.; Dimopoulos, S.; Masso, E.
1984-08-01
We present an O(18) theory which is pertubatively unifiable and which accounts for the absence of right-handed families in the low-energy world. The model gives rise to dramatic predictions for proton decay and for the Z 0 width
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Short selection processes... ARCHITECT-ENGINEER CONTRACTS Architect-Engineer Services 636.602-5 Short selection processes for contracts not to exceed the simplified acquisition threshold. The short selection process described in FAR 36...
2010-04-01
... Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES PAYMENTS TO AND ON BEHALF OF PARTICIPANTS IN THE INTERNATIONAL EDUCATIONAL AND CULTURAL EXCHANGE PROGRAM § 63.6 Assignment of United States... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Assignment of United States Government...
Directory of Open Access Journals (Sweden)
Luiz Tadeu Moraes Figueiredo
1990-03-01
Full Text Available Colônias de células de mosquito Aedes albopictus C6/36 foram infectadas com 23 arbovirus, sendo 19 destes existentes no Brasil, pertencentes às famílias Togaviridae, Flaviviridae, Bunyaviridae e Rhabdoviridae. A Replicação virai foi detectada por imunofluorescência indireta com todos os vírus estudados enquanto que o efeito citopático foi observado durante a infecção por alguns destes. No teste de imunofluorescência indireta utilizou-se fluidos ascíticos imunes de camundongos, específicos para os vírus estudados. A replicação virai caracterizada por grande produção de antígeno recomenda a utilização de células C6/36 na propagação e em tentativas de isolamento desses arbovirus. A técnica de imunofluorescência ofereceu importantes subsídios na classificação e identificação de vírus que replicam nestas células.C6/36 Aedes albopictus cells were infected w ith Brazilian arbovirus from the families Togaviridae, Flaviviridae, Bunyaviridae and Rhabdoviridae. Replication was obtained with all the studied viruses and cytopathic effect was observed with some. Viral antigen was assayed in C6/36 cell cultures for antigen was assayed in C6/36 cells by an indirect immunofluorescence test using specific mouse immune ascitic fluid. Antigen production was detected in C6/36 cells infected with all the studied viruses. The author recommends the inoculation of C6/36 cell cultures for isolation of virus from the four studied families. The immunofluorescence technique is an important tool for classification and identification of virus growing in C6/36 cells.
International Nuclear Information System (INIS)
Calvet, J.-N.; Le Bret, P.; Roulliay, R.
1975-01-01
A creep machine was modified enabling tests to be carried out at 550 deg C under 8hbar. The modulus of elasticity, yield strength, plastic deformation on loading, creep deformation and total plastic deformation were determined in an austenitic stainless steel of Z3CND 18-13 type. A relationship was established between the plastic deformation on loading and the creep deformation [fr
Gas-puff Z-pinch experiment on the LIMAY-I
International Nuclear Information System (INIS)
Takasugi, K.; Miyamoto, T.; Akiyama, H.; Shimomura, N.; Sato, M.; Tazima, T.
1989-01-01
A gas-puff z-pinch plasma has been produced on the pulsed power generator LIMAY-I at IPP Nagoya University. The stored energy of the generator is 13 kJ, and it generates 600 kV-70 ns-3 Ω power pulse. Ar or He gas is puffed from a hollow nozzle with 18 mm diameter, and a z-pinch plasma is produced by a discharge between 3 mm gap electrodes
How is Order 636 affecting the gas producing industry?
International Nuclear Information System (INIS)
Anon.
1993-01-01
This paper is an interview with an energy representative for a major gas-producing company regarding the impact of the Federal Energy Regulatory Commission (FERC) Order 636. This legislation was suppose to streamline the interstate transportation of natural gas unhindered by local distribution company (LCD) interference. Many times these LCD's owned a portion of the necessary pipeline route used to transport natural gas, and as a result, had a priority on purchasing pipeline gas whenever they needed. This could, in turn, result in a depletion of contract gas which was in-route to a specified contract market. Such interferences caused problems with the contract markets, but could boost the net profits to natural gas companies who had excess gas that could be sold in-route to other markets. This paper addresses both the pro's and cons' of this new regulation on both the pipeline and gas producing companies
Z' boson mixings with Z-γ and charge assignments
International Nuclear Information System (INIS)
Zhang Ying; Wang Qing
2009-01-01
Based on the general description for Z'-Z-γ mixing as derived from the electroweak chiral Lagrangian, we characterize and classify the various new physics models involving the Z' boson that have appeared in the literature into five classes: 1. Models with minimal Z'-Z mass mixing; 2. Models with minimal Z'-Z kinetic mixing; 3. Models with general Z'-Z mixing; 4. Models with Z'-γ kinetic and Z'-Z mixing; and 5. Models with Stueckelberg-type mixing. The corresponding mixing matrices are explicitly evaluated for each of these classes. We constrain and classify the Z' boson charges with respect to quark-leptons by anomaly cancellation conditions.
Yang, Jiajia; Lin, Yao; Jiang, Liming; Xi, Juemin; Wang, Xiaodan; Guan, Jiaoqiong; Chen, Junying; Pan, Yue; Luo, Jia; Ye, Chao; Sun, Qiangming
2018-05-02
To elucidate the differences in microRNAs during dengue virus infection between Vero cell-adapted strain (DENV-2-Vero) and its source, the clinical C6/36 isolated strain (DENV-2-C6/36), a comparison analysis was performed in Vero cells by high throughput sequencing. The results showed that the expression of 16 known and 3 novel miRNAs exhibited marked differences. 5 known miRNAs were up-regulated in DENV-2-C6/36 group, while 11 known microRNAs were down-regulated in DENV-2-Vero group. The GO enrichment and KEGG pathway analysis showed that there was a distinct difference in regulating viral replication between two strains. In DENV-2-Vero infection group, significantly enriched GO terms included virion attachment to host cells, viral structural protein/genome processing and packaging. Meanwhile, the regulation of cell death and apoptosis between two groups were different in the early stage of infection. KEGG enrichment analysis showed that DENV-2-C6/36 infection induced more intense regulation of immune-related pathways, including Fc gamma R-mediated phagocytosis, etc. DENV-2-Vero infection could partially alleviate the immune defense of Vero cells compared with DENV-2-C6/36. The results indicated that the distinct microRNA changes induced by two DENV-2 strains may be partly related to their infective abilities. Our data provide useful insights that help elucidate the host-pathogen interactions following DENV infection. Copyright © 2018 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Porter, L.E.; Bryan, S.R.
1980-01-01
Three independent sets of measurements of the stopping power of solid elemental targets for alpha particles were previously analyzed in terms of basic Bethe-Bloch theory with the low velocity projectile-z 3 correction term included. These data for Al, Si, Ni, Ge, Se, Y, Ag and Au have now been analyzed with the Bloch projectile-z 4 term and a revised projectile-z 3 term incorporated in the Bethe-Bloch formula, the projectile-z 3 revision having been effected by variation of the single free parameter of the projectile-z 3 effect formalism. The value of this parameter, fixed at 1.8 in previous studies, which counteracts inclusion of the projectile-z 4 term is 1.3 +- 0.1 for all target elements except Si. (orig.)
A Search for Z ^' in barpp Collsions at √s = 1.8 TeV
CDF Collaboration
1996-05-01
A search for a neutral heavy gauge boson, Z', was conducted in barpp collisions using 110pb-1 data obtained at the Collider Detector at Fermilab. We present preliminary 95% CL limits on the production of Z ' using its e+e- and μ+μ- decay modes. *We thank the Fermilab staff and the technical staffs of the participating institutions for their vital contributions. This work was supported by the U.S. Department of Energy and National Science Foundation; the Italian Istituto Nazionale di Fisica Nucleare; the Ministry of Education, Science and Culture of Japan; the Natural Sciences and Engineering Research Council of Canada; the National Science Council of the Republic of China; and the A. P. Sloan Foundation. Supported by U.S. DOE under grant DE-FG02-9140685
The TESIS Project: Revealing Massive Early-Type Galaxies at z > 1
Saracco, P.; Longhetti, M.; Severgnini, P.; Della Ceca, R.; Braito, V.; Bender, R.; Drory, N.; Feulner, G.; Hopp, U.; Mannucci, F.; Maraston, C.
How and when present-day massive early-type galaxies built up and what type of evolution has characterized their growth (star formation and/or merging) still remain open issues. The different competing scenarios of galaxy formation predict much different properties of early-type galaxies at z > 1. The "monolithic" collapse predicts that massive spheroids formed at high redshift (z > 2.5-3) and that their comoving density is constant at z 1, their comoving density decreases from z = 0 to z ~ 1.5 and they should experience their last burst of star formation at z 1 can be probed observationally once a well defined sample of massive early-types at z > 1 is available. We are constructing such a sample through a dedicated near-IR very low resolution (λ/Δλ≃50) spectroscopic survey (TNG EROs Spectroscopic Identification Survey, TESIS, [6]) of a complete sample of 30 bright (K < 18.5) Extremely Red Objects (EROs).
The galaxy major merger fraction to {z} 1
López-Sanjuan, C.; Balcells, M.; Pérez-González, P. G.; Barro, G.; García-Dabó, C. E.; Gallego, J.; Zamorano, J.
2009-07-01
Aims: The importance of disc-disc major mergers in galaxy evolution remains uncertain. We study the major merger fraction in a SPITZER/IRAC-selected catalogue in the GOODS-S field up to z 1 for luminosity- and mass-limited samples. Methods: We select disc-disc merger remnants on the basis of morphological asymmetries/distortions, and address three main sources of systematic errors: (i) we explicitly apply morphological K-corrections; (ii) we measure asymmetries in galaxies artificially redshifted to zd = 1.0 to deal with loss of morphological information with redshift; and (iii) we take into account the observational errors in z and A, which tend to overestimate the merger fraction, though use of maximum likelihood techniques. Results: We obtain morphological merger fractions (f_m^mph) below 0.06 up to z 1. Parameterizing the merger fraction evolution with redshift as f_m^mph(z) = f_m^mph(0) (1+z)^m, we find that m = 1.8 ± 0.5 for MB ≤ -20 galaxies, while m = 5.4 ± 0.4 for Mstar ≥ 1010 M⊙ galaxies. When we translate our merger fractions to merger rates (Re_m^mph), their evolution, parameterized as Re_m^mph(z) = Re_m^mph(0) (1+z)^n, is quite similar in both cases: n = 3.3 ± 0.8 for MB ≤ -20 galaxies, and n = 3.5 ± 0.4 for Mstar ≥ 1010 M⊙ galaxies. Conclusions: Our results imply that only 8% of today's Mstar ≥ 1010 M⊙ galaxies have undergone a disc-disc major merger since z 1. In addition, 21% of Mstar ≥ 1010 M⊙ galaxies at z 1 have undergone one of these mergers since z 1.5. This suggests that disc-disc major mergers are not the dominant process in the evolution of Mstar ≥ 1010 M⊙ galaxies since z 1, with only 0.2 disc-disc major mergers per galaxy, but may be an important process at z > 1, with ˜1 merger per galaxy at 1 < z < 3.
International Nuclear Information System (INIS)
Roach-Bellino, M.
1994-02-01
The Z + γ cross-section x branching ratio in the electron channel has been measured using the inclusive Z data sample from the CDF 1988--1989 collider run, for which the total integrated luminosity was 4.05 ± 0.28 pb -1 . Two Zγ candidates are observed from central photon events with ΔR/ γ > 0.7 and E t γ > 5.0 GeV. From these events the σ * BR(Z + γ) is measured and compared with SM predictions: σ * BR(Z + γ) e = 6.8 -5.7 +5.7 (stat + syst)pb σ * BR(Z + γ)SM = 4.7 -4.7 +0.7 (stat + syst)pb. From this ZZ γ cross section measurement limits on the Z γγ and couplings for three different choices of compositeness scale Λ Z are obtained. The experimental sensitivity to the h 30 Z,γ /h 10 Z,γ couplings is in the range of Λ Z ∼ 450--500 GeV and for the h 40 Zγ /h 20 Z,γ couplings Λ Z ∼ 300 GeV
Directory of Open Access Journals (Sweden)
V. R. Mamdapur
1997-01-01
Full Text Available A stereoselective synthesis of (6Z, 11Z-octadecadienoic acid (1 and (6Z, 11Z-eicosadienoic acid (2 from easily accessible pentane-1,5-diol (3 is described. Thus, compound 3 on pyranylation and oxidation gave the aldehyde 5 which was converted to the acid 7 by Wittig reaction with a suitable phosphorane. Its depyranylation and oxidation furnished the key aldehyde 9 which upon Wittig reaction with n-heptylidene and n-nonylidene phosphoranes, respectively followed by alkaline hydrolysis afforded the title acids.
Measurement of the partial widths of the Z into up- and down-type quarks
Abbiendi, G.; Akesson, P.F.; Alexander, G.; Allison, John; Amaral, P.; Anagnostou, G.; Anderson, K.J.; Arcelli, S.; Asai, S.; Axen, D.; Azuelos, G.; Bailey, I.; Barberio, E.; Barillari, T.; Barlow, R.J.; Batley, R.J.; Bechtle, P.; Behnke, T.; Bell, Kenneth Watson; Bell, P.J.; Bella, G.; Bellerive, A.; Benelli, G.; Bethke, S.; Biebel, O.; Boeriu, O.; Bock, P.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Buesser, K.; Burckhart, H.J.; Campana, S.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, D.G.; Ciocca, C.; Csilling, A.; Cuffiani, M.; Dado, S.; De Roeck, A.; De Wolf, E.A.; Desch, K.; Dienes, B.; Donkers, M.; Doucet, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Etzion, E.; Fabbri, F.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Gagnon, P.; Gary, John William; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Giunta, Marina; Goldberg, J.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Gupta, A.; Hajdu, C.; Hamann, M.; Hanson, G.G.; Harel, A.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hoffman, Kara Dion; Horvath, D.; Huntemeyer, P.; Igo-Kemenes, P.; Ishii, K.; Jeremie, H.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karlen, D.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Klein, K.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Komamiya, S.; Kramer, T.; Krieger, P.; von Krogh, J.; Kruger, K.; Kuhl, T.; Kupper, M.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Layter, J.G.; Lellouch, D.; Lettso, J.; Levinson, L.; Lillich, J.; Lloyd, S.L.; Loebinger, F.K.; Lu, J.; Ludwig, A.; Ludwig, J.; Mader, W.; Marcellini, S.; Martin, A.J.; Masetti, G.; Mashimo, T.; Mattig, Peter; McKenna, J.; McPherson, R.A.; Meijers, F.; Menges, W.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Moed, S.; Mohr, W.; Mori, T.; Mutter, A.; Nagai, K.; Nakamura, I.; Nanjo, H.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pahl, C.; Pasztor, G.; Pater, J.R.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Pooth, O.; Przybycien, M.; Quadt, A.; Rabbertz, K.; Rembser, C.; Renkel, P.; Roney, J.M.; Rosati, S.; Rozen, Y.; Runge, K.; Sachs, K.; Saeki, T.; Sarkisyan, E.K.G.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schieck, J.; Schoerner-Sadenius, Thomas; Schroder, Matthias; Schumacher, M.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Sherwood, P.; Skuja, A.; Smith, A.M.; Sobie, R.; Soldner-Rembold, S.; Spano, F.; Stahl, A.; Strom, David M.; Strohmer, R.; Tarem, S.; Tasevsky, M.; Teuscher, R.; Thomson, M.A.; Torrence, E.; Toya, D.; Tran, P.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Ujvari, B.; Vollmer, C.F.; Vannerem, P.; Vertesi, R.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Zer-Zion, D.; Zivkovic, Lidija
2004-01-01
Using the entire OPAL LEP1 on-peak Z hadronic decay sample, Z -> qbarq gamma decays were selected by tagging hadronic final states with isolated photon candidates in the electromagnetic calorimeter. Combining the measured rates of Z -> qbarq gamma decays with the total rate of hadronic Z decays permits the simultaneous determination of the widths of the Z into up- and down-type quarks. The values obtained, with total errors, were Gamma u = 300 ^{+19}_{-18} MeV and Gamma d = 381 ^{+12}_{-12} MeV. The results are in good agreement with the Standard Model expectation.
Energy Technology Data Exchange (ETDEWEB)
Roach-Bellino, Mary [Tufts Univ., Medford, MA (United States)
1994-02-01
The Z + γ cross-section x branching ratio in the electron channel has been measured using the inclusive Z data sample from the CDF 1988--1989 collider run, for which the total integrated luminosity was 4.05 ± 0.28 pb-1. Two Zγ candidates are observed from central photon events with ΔR/γ > 0.7 and Etγ > 5.0 GeV. From these events the σ * BR(Z + γ) is measured and compared with SM predictions: σ * BR(Z + γ)e = 6.8$+5.7\\atop{-5.7}$(stat + syst)pb σ * BR(Z + γ)SM = 4.7$+0.7\\atop{-4.7}$(stat + syst)pb. From this ZZγ cross section measurement limits on the Zγγ and couplings for three different choices of compositeness scale ΛZ are obtained. The experimental sensitivity to the h30Z,γ/h10Z,γ couplings is in the range of ΛZ ~ 450--500 GeV and for the h40Z,γ/h20Z,γ couplings ΛZ ~ 300 GeV.
Discovering Massive z > 1 Galaxy Clusters with Spitzer and SPTpol
Bleem, Lindsey; Brodwin, Mark; Ashby, Matthew; Stalder, Brian; Klein, Matthias; Gladders, Michael; Stanford, Spencer; Canning, Rebecca
2018-05-01
We propose to obtain Spitzer/IRAC imaging of 50 high-redshift galaxy cluster candidates derived from two new completed SZ cluster surveys by the South Pole Telescope. Clusters from the deep SPTpol 500-square-deg main survey will extend high-redshift SZ cluster science to lower masses (median M500 2x10^14Msun) while systems drawn from the wider 2500-sq-deg SPTpol Extended Cluster Survey are some of the rarest most massive high-z clusters in the observable universe. The proposed small 10 h program will enable (1) confirmation of these candidates as high-redshift clusters, (2) measurements of the cluster redshifts (sigma_z/(1+z) 0.03), and (3) estimates of the stellar masses of the brightest cluster members. These observations will yield exciting and timely targets for the James Webb Space Telescope--and, combined with lower-z systems--will both extend cluster tests of dark energy to z>1 as well as enable studies of galaxy evolution in the richest environments for a mass-limited cluster sample from 0<z<1.8.
Production of charmed mesons in Z decays
Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Pietrzyk, B.; Ariztizabal, F.; Comas, P.; Crespo, J. M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Ll.; Mattison, T.; Orteu, S.; Pacheco, A.; Padilla, C.; Pascual, A.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Marinelli, N.; Natali, S.; Nuzzo, S.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Hu, H.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Bonvicini, G.; Boudreau, J.; Casper, D.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Girone, M.; Hagelberg, R.; Harvey, J.; Hilgart, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Maggi, M.; Markou, C.; Martinez, M.; Mato, P.; Meinhard, H.; Minten, A.; Miquel, R.; Moser, H.-G.; Palazzi, P.; Pater, J. R.; Perlas, J. A.; Perrodo, P.; Pusztaszeri, J.-F.; Ranjard, F.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Tomalin, I. R.; Veenhof, R.; Wachsmuth, H.; Wasserbaech, S.; Wiedemann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Bardadin-Otwinowska, M.; Barres, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Saadi, F.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Johnson, S. D.; Møllerud, R.; Nilsson, B. S.; Kyriakis, A.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, B.; Fouque, G.; Passalacqua, L.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Focardi, E.; Moneta, L.; Parrini, G.; Corden, M.; Delfino, M.; Georgiopoulos, C.; Ikeda, M.; Jaffe, D. E.; Levinthal, D.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Pepe=Altarelli, M.; Salomone, S.; Colrain, P.; Ten Have, I.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Thorn, S.; Turnbull, R. M.; Brandl, B.; Braun, O.; Geweniger, C.; Graefe, G.; Hanke, P.; Hepp, V.; Karger, C.; Kluge, E. E.; Maumary, Y.; Putzer, A.; Rensch, B.; Stahl, A.; Tittel, K.; Wunsch, M.; Beuselinck, M.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Hassard, J. F.; Lieske, N. M.; Moutoussi, A.; Nash, J.; Patton, S.; Payne, D. G.; Phillips, M. J.; San Martin, G.; Sedgbeer, J. K.; Wright, A. G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Vogl, R.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttal, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Galla, A.; Greene, A. M.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Walther, S. M.; Wanke, R.; Wolf, B.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Calvet, D.; Carr, J.; Coyle, P.; Diaconu, C.; Drinkard, J.; Etienne, F.; Nicod, D.; Payre, P.; Roos, L.; Rousseau, D.; Schwemling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Halley, A. W.; Jakobs, K.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, G.; Richter, R.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, H.; Stiegler, U.; Denis, R. St.; Wolf, G.; Alemany, R.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Musolino, G.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Luisiani, A.; Mannelli, E. B.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Valassi, A.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Gao, Y.; Green, M. G.; Johnson, D. L.; March, P. V.; Medcalf, T.; Mir, Ll. M.; Quazi, I. S.; Strong, J. A.; Bertin, V.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Edwards, M.; Norton, P. R.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Babbage, W.; Booth, C. N.; Buttar, C.; Cartwright, S.; Combley, F.; Dawson, I.; Thompson, L. F.; Barberio, E.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Lutters, G.; Rivera, F.; Schäfer, U.; Smolik, L.; Bosisio, L.; Della Marina, R.; Giannini, G.; Bobbo, B.; Pitis, L.; Ragusa, F.; Bellantoni, L.; Chen, W.; Conway, J. S.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; Hayes, O. J.; Nachtman, J. M.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Scott, I.; Sharma, V.; Shi, Z. H.; Turk, J. D.; Walsh, A. M.; Weber, F. V.; Wu, Sau Lan; Wu, X.; Zheng, M.; Zobernig, G.
1994-03-01
The production of charmed mesonsmathop {D^0 }limits^{( - )} , D ± , and D *± is studied in a sample of 478,000 hadronic Z decays. The production rates are measured to be 10052_2005_Article_BF01559519_TeX2GIFE1.gif begin{gathered} {Γ (Z to D^{* ± } X)}/{Γ _{had }} = 0.187 ± 0.015(exp .) ± 0.013(BR), \\ {Γ (Z to D^ ± X)}/{Γ _{had }} = 0.251 ± 0.026(exp .) ± 0.025(BR), \\ {Γ (Z to mathop {D^0 }limits^{( - )} X)}/{Γ _{had }} = 0.518 ± 0.052(exp .) ± 0.035(BR), \\ where the errors from this analysis are separated from those coming from the D branching ratios (BR). The D *± momentum distribution is extracted separately forZ to cbar c andZ to bbar b events with the help of event shape variables. It is consistent with the prediction of the JETSET Monte Carlo program after adjustment of the charm fragmentation function. Constraining the shape of theZ to bbar b contribution, the average fraction of the beam energy taken by a D * meson produced in the fragmentation of a charm quark is extracted by a parametric fit to be c =0.495±0.011±0.007. Evidence for D **0 ( D 1(2420)0 and/or D {2/*}(2460)0) production is found in theD^{* ± } π ^ mp channel, accounting for a fraction (18±5±2)% of all D *± production. The relative production of vector and pseudoscalar mesons is dicussed, together with the possible effects of D ** production. The c-quark forward-backward Z-pole asymmetry is detrmined from that of high momentum D *± to be A {/FB 0,c }=(7.7±4.4)%.
Marek Zawadzki; Jacek Szechiński
2011-01-01
Cel: Porównanie wpływu zażywania opatentowanego, stabilizowanego CO2 oleju z nowozelandzkich małży zielonych Perna canaliculus(PCSO-524™) oraz oleju z ryb [zawierającego standaryzowanąmieszaninę kwasu eikozapentaenowego (eicosapentaenoicacid – EPA) – 18%, i kwasu dokozaheksaenowego (docosahexaenoicacid – DHA) – 12%] na łagodzenie bólu, zmiany w wyznacznikachjakości życia i bezpieczeństwo u pacjentów z chorobą zwyrodnieniowąstawów kolanowych i/lub biodrowych.Materiały i metody: U 50 pacjentów ...
Qin, Renyao; Duan, Zhaoling; He, Guo
2013-10-01
The large circumferential multipass dissimilar weld between 20MND5 steel and Z2CND18-12NS stainless steel welded with FM52 filler material was investigated in terms of the diluted composition, the grain boundary precipitation, and the ductility-dip cracking (DDC) susceptibility of the weld. The diluted composition of the weld is composed of 37 to 47 pct Ni, 21 to 24 pct Cr, and 28 to 40 pct Fe, which are inhomogeneous along the depth and over the width of the deep weld. The carbon content has a distribution in the region of the surface weld from a high level (~0.20 pct) in the zone near 20MND5 steel to a normal level (~0.03 pct) in the zone near Z2CND18-12NS stainless steel. The carbon distribution is corresponding to the grain boundary carbides. The minimum threshold strains for DDC occur in the temperature range of 1223 K to 1323 K (950 °C to 1050 °C), which are 0.5, 0.35, and 0.4 pct for the root weld, middle region, and the surface weld, respectively. The dissimilar weld has the largest susceptibility to the DDC compared to the filler metal 52 and the Inconel 690.
Measurement of the ratio σB(W→eν)/σB(Z0→e+e-) in bar pp collisions at √s =1.8 TeV
International Nuclear Information System (INIS)
Abe, F.; Albrow, M.; Amidei, D.; Anway-Wiese, C.; Apollinari, G.; Areti, H.; Auchincloss, P.; Azfar, F.; Azzi, P.; Bacchetta, N.; Badgett, W.; Bailey, M.W.; Bao, J.; de Barbaro, P.; Barbaro-Galtieri, A.; Barnes, V.E.; Barnett, B.A.; Bartalini, P.; Bauer, G.; Baumann, T.; Bedeschi, F.; Behrends, S.; Belforte, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Benlloch, J.; Benton, D.; Beretvas, A.; Berge, J.P.; Bertolucci, S.; Bhatti, A.; Biery, K.; Binkley, M.; Bird, F.; Bisello, D.; Blair, R.E.; Blocker, C.; Bodek, A.; Bolognesi, V.; Bortoletto, D.; Boswell, C.; Boulos, T.; Brandenburg, G.; Buckley-Geer, E.; Budd, H.S.; Burkett, K.; Busetto, G.; Byon-Wagner, A.; Bryum, K.L.; Campagnari, C.; Campbell, M.; Caner, A.; Carithers, W.; Carlsmith, D.; Castro, A.; Cen, Y.; Cervelli, F.; Chapman, J.; Chiarelli, G.; Chikamatsu, T.; Cihangir, S.; Clark, A.G.; Cobal, M.; Contreras, M.; Conway, J.; Cooper, J.; Cordelli, M.; Coupal, D.P.; Crane, D.; Cunningham, J.D.; Daniels, T.; DeJongh, F.; Delchamps, S.; Dell'Agnello, S.; Dell'Orso, M.; Demortier, L.; Denby, B.; Deninno, M.; Derwent, P.F.; Devlin, T.; Dickson, M.; Donati, S.; Drucker, R.B.; Dunn, A.; Einsweiler, K.; Elias, J.E.; Ely, R.; Engels, E. Jr.; Eno, S.; Errede, D.; Errede, S.; Etchegoyen, A.; Fan, Q.; Farhat, B.; Fiori, I.; Flaugher, B.; Foster, G.W.; Franklin, M.; Frautschi, M.; Freeman, J.; Friedman, J.; Frisch, H.; Fry, A.; Fuess, T.A.; Fukui, Y.; Funaki, S.; Gagliardi, G.; Gallinaro, M.; Garfinkel, A.F.; Geer, S.; Gerdes, D.W.; Giannetti, P.; Giokaris, N.; Giromini, P.; Gladney, L.; Glenzinski, D.; Gold, M.; Gonzalez, J.; Gordon, A.; Goshaw, A.T.; Goulianos, K.; Grassmann, H.; Grewal, A.; Grieco, G.; Groer, L.; Grosso-Pilcher, C.; Haber, C.; Hahn, S.R.; Hamilton, R.; Handler, R.; Hans, R.M.; Hara, K.; Harral, B.; Harris, R.M.; Hauger, S.A.; Hauser, J.; Hawk, C.; Heinrich, J.; Hennessy, D.; Hollebeek, R.; Holloway, L.; Hoelscher, A.; Hong, S.; Houk, G.; Hu, P.; Huffman, B.T.; Hughes, R.; Hurst, P.
1994-01-01
We present a measurement of the ratio σB(W→ev)/σB(Z 0 →e + e - ) in bar pp collisions at √s =1.8 TeV. The data represent an integrated luminosity of 21.7 pb -1 from the 1992--1993 run of the Collider Detector at Fermilab. We find σB(W→eV)/σB(Z 0 →e + e - )=10.90±0.32(stat)±0.29(sys t). From this value, we extract a value for the W width, Γ(W)=2.064±0.061(stat)±0.059(syst) GeV, and the branching ratio, Γ(W→eV)/Γ(W)=0.1094±0.0033(stat)±0.0031(syst), and we set a decay-mode-independent limit on the top quark mass m top >62 GeV/c 2 at the 95% C.L
International Nuclear Information System (INIS)
JOHNSON, L.E.
1999-01-01
This Calculation Note provides a conservative estimate of the grams of plutonium released from Building 2736-ZB of the Plutonium Finishing Plant as a result of a fire within Glovebox 636, without consideration of mitigation
Energy Technology Data Exchange (ETDEWEB)
Wang, Xiaotian [School of Material Sciences and Engineering, Hebei University of Technology, Tianjin 300130 (China); Institute for Superconducting & Electronic Materials (ISEM), University of Wollongong, Wollongong 2500 (Australia); Cheng, Zhenxiang, E-mail: cheng@uow.edu.au [Institute for Superconducting & Electronic Materials (ISEM), University of Wollongong, Wollongong 2500 (Australia); Guo, Ruikang [School of Material Sciences and Engineering, Hebei University of Technology, Tianjin 300130 (China); Wang, Jianli [Institute for Superconducting & Electronic Materials (ISEM), University of Wollongong, Wollongong 2500 (Australia); Rozale, Habib [Condensed Matter and Sustainable Development Laboratory, Physics Department, University of Sidi-Bel-Abbès, 22000 Sidi-Bel-Abbès (Algeria); Wang, Liying [Department of Physics, Tianjin University, Tianjin 300350 (China); Yu, Zheyin [Institute for Superconducting & Electronic Materials (ISEM), University of Wollongong, Wollongong 2500 (Australia); Liu, Guodong, E-mail: gdliu1978@126.com [School of Material Sciences and Engineering, Hebei University of Technology, Tianjin 300130 (China)
2017-06-01
Plane-wave pseudo-potential methods based on density functional theory are employed to investigate the electronic structures, and the magnetic and half-metallic properties of the newly designed quaternary Heusler compounds ZrRhHfZ (Z = Al, Ga, In) without 3d transition metal elements. The calculated results show that ZrRhHfZ (Z = Al, Ga, In) compounds are half-metallic, with 100% spin polarization around the Fermi level. The structural stability of these compounds has been tested from the aspects of their cohesion energy and formation. The spin-flip/half-metallic gaps of ZrRhHfZ (Z = Al, Ga, In) compounds are quite large, with values of 0.2548 eV, 0.3483 eV, and 0.2866 eV, respectively. These compounds show Slater-Pauling behavior, and the total spin magnetic moment per unit cell (M{sub t}) scales with the total number of valence electrons (Z{sub t}) following the rule: M{sub t} = Z{sub t} - 18. The magnetization of ZrRhHfZ (Z = Al, Ga, In) compounds mainly comes from the 4d electrons of the Zr atoms and the 5d electrons of the Hf atoms. Furthermore, the effects of uniform strain and tetragonal deformation on the half metallicity has been investigated in detail, which is important for practical application. Finally, we reveal that the half-metallicity can be maintained when the Coulomb interactions are considered. - Highlights: • New quaternary compounds without 3d transition metal elements have been designed. • The electronic structures and magnetism of the ZrRhHfZ compounds have been studied. • The effect of strain on the half-metallic behavior has been tested. • The effect of the Coulomb interactions on the half-metallicity has been investigated.
On finite larmor radius stabilization of Z-pinches
International Nuclear Information System (INIS)
Hellsten, T.
1982-12-01
Finite Larmor radius stabilization of Z-pinches is discussed. Stability criteria can be derived for a class of equilibria having constant mass and current density. The internal modes can be stabilized provided the line density not exceed a critical value of the order of 10 18 ions/m. (Author)
Test Excavations at Painted Rock Reservoir: Sites AZ Z:1:7, AZ Z:1:8, and AZ S:16:36.
1981-11-01
were dehydrated, trimmed to 12-mm squares, and 77 78 placed in catalyzed (0.05-percent benzoyl peroxide), deinhibited acrylic monomer (50-percent methyl ...refrigeration for 72 hours in partially polymerized ethyl- methyl methacrylate. The methacrylate was polymerized at 50 degrees C and 50 p.s.i. nitrogen...pollen types from fill of Feature 10, AZ Z:l:8 Pollen Type Percent Pinus spp. 0.5 Cheno-Am 92.0 Gramineae 2.0 Ambrosia spp. 0.5 Malvaceae 0.5 Zea spp. 2.0
Hu, Zenglei; Hu, Jiao; Hu, Shunlin; Song, Qingqing; Ding, Pingyun; Zhu, Jie; Liu, Xiaowen; Wang, Xiaoquan; Liu, Xiufan
2015-03-01
Some strains of Newcastle disease virus (NDV) genotype VIId cause more-severe tissue damage in lymphoid organs compared to other virulent strains. In this study, we aim to define the mechanism of this distinct pathological manifestation of genotype VII viruses. Pathology, virus replication, and the innate immune response in lymphoid tissues of chickens infected with two genotype VIId NDV strains (JS5/05 and JS3/05), genotype IX NDV F48E8 and genotype IV NDV Herts/33, were compared. Histopathologic examination showed that JS5/05 and JS3/05 produced more-severe lesions in the spleen and thymus, but these four virulent strains caused comparable mild lesions in the bursa. In addition, JS3/05 and JS5/05 replicated at significantly higher levels in the lymphatic organs than F48E8 and Herts/33. A microarray assay performed on the spleens of chickens infected with JS5/05 or Herts/33 revealed that JS5/05 elicited a more potent inflammatory response by increasing the number and expression levels of activated genes. Moreover, cytokine gene expression profiling showed that JS5/05 and JS3/05 induced a stronger cytokine response in lymphoid tissues compared to F48E8 and Herts/33. Taken together, our results indicate that the severe pathology in immune organs caused by genotype VIId NDV strains is associated with high levels of virus replication and an intense inflammatory response.
An audit of prescribing practices for benzodiazepines and Z-drugs.
LENUS (Irish Health Repository)
Cadogan, C
2015-03-01
Concerns persist over the use of benzodiazepines and Z-drugs in Ireland. A prospective prescription audit was conducted in 81 community pharmacies across Ireland over a four week period. The study sought to assess the level of prescription compliance with key components of benzodiazepine and Z-drug prescribing guidelines. 28% of audit booklets issued were returned, yielding data on 4,418 prescriptions. The findings suggest that little progress has been made in improving the prescribing of benzodiazepines and Z-drugs in Ireland in the decade since publication of the Benzodiazepine Committee\\'s report. Fewer than one fifth of prescriptions (18.8%) were fully compliant with the assessment criteria and the majority (53.7%) had multiple discrepancies. This study highlights the importance of monitoring and auditing benzodiazepine and Z-drug prescribing practices. Interventions involving patients, prescribers and pharmacists are required to improve the prescribing and use of these medications in Ireland.
International Nuclear Information System (INIS)
Zarling, D.A.; Calhoun, C.J.; Hardin, C.C.; Zarling, A.H.
1987-01-01
Specific immunochemical probes for Z-RNA were generated and characterized to search for possible Z-RNA-like double helices in cells. Z-RNA was detected in the cytoplasm of fixed protozoan cells by immunofluorescence microscopy using these anti-Z-RNA IgCs. In contrast, autoimmune or experimentally elicited anti-DNA antibodies, specifically reactive with B-DNA or Z-DNA, stained the nuclei. Pre-or nonimmune IgGs did not bind to the cells. RNase A or T1 digestion eliminated anti-Z-RNA IgG binding to cytoplasmic determinants; however, DNase I or mung bean nuclease had no effect. Doxorubicin and ethidium bromide prevented anti-Z-RNA antibody binding; however, actinomycin D, which does not bind double-stranded RNA, did not. Anti-Z-RNA immunofluorescence was specifically blocked in competition assays by synthetic Z-RNA but not Z-DNA, A-RNA, or single-stranded RNAs. Thus, some cytoplasmic sequences in fixed cells exist in the left-handed Z-RNA conformation
Maximilien Brice
2011-01-01
18th May 2011 - Chinese State Administration of Foreign Experts Affairs (SAFEA) Deputy Director-General M. LU (State Council of China) in the ATLAS visitors centre with Collaboration Deputy Spokesperson A. Lankford and Collaboration member Z. Ren.
International Nuclear Information System (INIS)
Ardill, R.W.B.; Moriarty, K.J.M.
1979-01-01
The Bessel function appears in a wide range of physical applications, and in particular where there is axial symmetry. The package contains complex function routines to calculate Jsub(n)(z), Ysub(n)(z), Hsub(n)sup((1))(z) and Hsub(n)sup((2))(z) for integer n and complex z. The method of solution is based on the ascending series representations and asymptotic forms of the Bessel functions Jsub(n)(z) and Ysub(n)(z) and asymptotic forms of the modified Bessel functions Isub(n)(z) and Ksub(n)(z). The program will return results for all values of mod(z) up to machine overflows in the Bessel functions. The size of the order should not be too large (say, mod(n) -11 . For the asymptotic region, the accuracy EPS may not always be achieved (since the asymptotic series may have to be truncated at their lower terms), in which case the output parameter ISET will indicate this and an estimation of the relative error is also produced. The functions Ysub(n)(z), Hsub(n)sup((1))(z) and Hsub(n)sup((2))(z) have a branch point at the origin, together with a cut along the negative real axis. (Auth.)
Tank 241-Z-361 process and characterization history
International Nuclear Information System (INIS)
Jones, S.A.
1998-01-01
An Unreviewed Safety Question (Wagoner, 1997) was declared based on lack of adequate authorization basis for Tank 241-Z-361 in the 200W Area at Hanford. This document is a summary of the history of Tank 241-Z-361 through December 1997. Documents reviewed include engineering files, laboratory notebooks from characterization efforts, waste facility process procedures, supporting documents and interviews of people's recollections of over twenty years ago. Records of transfers into the tank, past characterization efforts, and speculation were used to estimate the current condition of Tank 241-Z-361 and its contents. Information about the overall waste system as related to the settling tank was included to help in understanding the numbering system and process relationships. The Plutonium Finishing Plant was built in 1948 and began processing plutonium in mid-1949. The Incinerator (232-Z) operated from December 1961 until May 1973. The Plutonium Reclamation Facility (PRF, 236-Z) began operation in May 1964. The Waste Treatment Facility (242-Z) operated from August 1964 until August 1976. Waste from some processes went through transfer lines to 241-Z sump tanks. High salt and organic waste under normal operation were sent to Z-9 or Z-18 cribs. Water from the retention basin may have also passed through this tank. The transfer lines to 241-Z were numbered D-4 to D-6. The 241-Z sump tanks were numbered D-4 through D-8. The D-4, 5, and 8 drains went to the D-6 sump tank. When D-6 tank was full it was transferred to D-7 tank. Prior to transfer to cribs, the D-7 tank contents was sampled. If the plutonium content was analyzed to be more than 10 g per batch, the material was (generally) reprocessed. Below the discard limit, caustic was added and the material was sent to the cribs via the 241-Z-361 settling tank where solids settled out and the liquid overflowed by gravity to the cribs. Waste liquids that passed through the 241-Z-361 settling tank flowed from PFP to ground in
Search for long-lived parents of Z0 bosons in p bar p collisions at √ (s) =1.8thinspTeV
International Nuclear Information System (INIS)
Blair, R.E.; Byrum, K.L.; Kovacs, E.; Kuhlmann, S.E.; LeCompte, T.; Nodulman, L.; Breccia, L.; Brunetti, R.; Deninno, M.; Fiori, I.; Mazzanti, P.; Behrends, S.; Bensinger, J.; Blocker, C.; Kirsch, L.; Lamoureux, J.I.; Bonushkin, Y.; Hauser, J.; Lindgren, M.; Amadon, A.; Berryhill, J.; Contreras, M.; Culbertson, R.; Frisch, H.; Grosso-Pilcher, C.; Hohlmann, M.; Cronin-Hennessy, D.; Dittmann, J.R.; Goshaw, A.T.; Khazins, D.; Kowald, W.; Oh, S.H.; Albrow, M.G.; Atac, M.; Beretvas, A.; Berge, J.P.; Biery, K.; Binkley, M.; Buckley-Geer, E.; Byon-Wagner, A.; Chlebana, F.; Cihangir, S.; Cooper, J.; DeJongh, F.; Demina, R.; Derwent, P.F.; Elias, J.E.; Erdmann, W.; Flaugher, B.; Foster, G.W.; Freeman, J.; Geer, S.; Hahn, S.R.; Harris, R.M.; Incandela, J.; Jensen, H.; Joshi, U.; Kennedy, R.D.; Kephart, R.; Lammel, S.; Lewis, J.D.; Limon, P.; Lukens, P.; Maeshima, K.; Marriner, J.P.; Miao, T.; Mukherjee, A.; Nelson, C.; Newman-Holmes, C.; Patrick, J.; Klimenko, S.; Konigsberg, J.; Korytov, A.; Nomerotski, A.; Barone, M.; Bertolucci, S.; Cordelli, M.; DellAgnello, S.; Giromini, P.; Happacher, F.; Miscetti, S.; Parri, A.; Clark, A.G.; Couyoumtzelis, C.; Kambara, H.; Baumann, T.; Franklin, M.; Gordon, A.; Hamilton, R.; Huth, J.
1998-01-01
We search for new long-lived particles which decay to Z 0 bosons by looking for Z 0 →e + e - decays with displaced vertices. We find no evidence for parent particles of the Z 0 with long lifetimes in 90thinsppb -1 of data from the CDF experiment at Fermilab. We set a cross section limit as a function of the lifetime of the parent particle for both a generic Z 0 parent and a fourth-generation, charge - (1) /(3) quark that decays into Z 0 b. copyright 1998 The American Physical Society
The radio galaxy K-z relation to z ~ 4.5
Jarvis, Matt J.; Rawlings, Steve; Eales, Steve; Blundell, Katherine M.; Willott, Chris J.
2001-01-01
Using a new radio sample, 6C* designed to find radio galaxies at z > 4 along with the complete 3CRR and 6CE sample we extend the radio galaxy K-z relation to z~4.5. The 6C* K-z data significantly improve delineation of the K-z relation for radio galaxies at high redshift (z > 2). Accounting for non-stellar contamination, and for correlations between radio luminosity and estimates of stellar mass, we find little support for previous claims that the underlying scatter in the stellar luminosity ...
Directory of Open Access Journals (Sweden)
Mei Li
Full Text Available Streptomyces ahygroscopicus ZB01 can effectively oxidize 4″-OH of avermectin to form 4″-oxo-avermectin. CYP107Z13 is responsible for this site-specific oxidation in ZB01. In the present study, we explored the electron transfer pathway in oxidation of avermectin by CYP107Z13 in ZB01. A putative [3Fe-4S] ferredoxin gene fd68 and two possible NADH-dependent ferredoxin reductase genes fdr18 and fdr28 were cloned from the genomic DNA of ZB01. fd68 gene disruption mutants showed no catalytic activity in oxidation of avermectin to form 4″-oxo-avermectin. To clarify whether FdR18 and FdR28 participate in the electron transfer during avermectin oxidation by CYP107Z13, two whole-cell biocatalytic systems were designed in E. coli BL21 (DE3, with one co-expressing CYP107Z13, Fd68 and FdR18 and the other co-expressing CYP107Z13, Fd68 and FdR28. Both of the two biocatalytic systems were found to be able to mediate the oxidation of avermectin to form 4″-oxo-avermectin. Thus, we propose an electron transfer pathway NADH→FdR18/FdR28→Fd68→CYP107Z13 for oxidation of avermectin to form 4″-oxo-avermectin in ZB01.
Higgs decays to Z Z and Z γ in the standard model effective field theory: An NLO analysis
Dawson, S.; Giardino, P. P.
2018-05-01
We calculate the complete one-loop electroweak corrections to the inclusive H →Z Z and H →Z γ decays in the dimension-6 extension of the Standard Model Effective Field Theory (SMEFT). The corrections to H →Z Z are computed for on-shell Z bosons and are a precursor to the physical H →Z f f ¯ calculation. We present compact numerical formulas for our results and demonstrate that the logarithmic contributions that result from the renormalization group evolution of the SMEFT coefficients are larger than the finite next-to-leading-order contributions to the decay widths. As a byproduct of our calculation, we obtain the first complete result for the finite corrections to Gμ in the SMEFT.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI
Parameterization of general Z-γ-Z' mixing in an electroweak chiral theory
International Nuclear Information System (INIS)
Zhang Ying; Wang Qing
2012-01-01
A new general parameterization with eight mixing parameters among Z, γ and an extra neutral gauge boson Z ' is proposed and subjected to phenomenological analysis. We show that in addition to the conventional Weinberg angle θ W , there are seven other phenomenological parameters, G ' , ξ, η, θ 1 , θ r , r and l, for the most general Z-γ-Z ' mixings, in which parameter G ' arises due to the presence of an extra Stueckelbergtype mass coupling. Combined with the conventional Z-Z ' mass mixing angle 0', the remaining six parameters, ξ, η, θ l -θ ' , θ r - θ ' , r and l, are caused by general kinetic mixing. In all eight phenomenological parameters, θ W , G ' , ξ, η, θ 1 , θ r , r and l, we can determine the Z-Z ' mass mixing angle θ ' and the mass ratio M Z /M Z ' . The Z-γ-Z ' mixing that we discuss are based on the model-independent description of the extended electroweak chiral Lagrangian (EWCL) previously proposed by us. In addition, we show that there are eight corresponding independent theoretical coefficients in our EWCL, which are fully fixed by our eight phenomenological mixing parameters. We further find that the experimental measurability of these eight parameters does not rely on the extended neutral current for Z ' , but depends on the Z-Z ' mass ratio. (authors)
Cytological profile of antibacterial FtsZ inhibitors and synthetic peptide MciZ
Directory of Open Access Journals (Sweden)
Lidia Araujo-Bazan
2016-10-01
Full Text Available Cell division protein FtsZ is the organizer of the cytokinetic ring in almost all bacteria and a target for the discovery of new antibacterial agents that are needed to counter widespread antibiotic resistance. Bacterial cytological profiling, using quantitative microscopy, is a powerful approach for identifying the mechanism of action of antibacterial molecules affecting different cellular pathways. We have determined the cytological profile on Bacillus subtilis cells of a selection of small molecule inhibitors targeting FtsZ on different binding sites. FtsZ inhibitors lead to long undivided cells, impair the normal assembly of FtsZ into the midcell Z-rings, induce aberrant ring distributions, punctate FtsZ foci, membrane spots and also modify nucleoid length. Quantitative analysis of cell and nucleoid length combined, or the Z-ring distribution, allows categorizing FtsZ inhibitors and to distinguish them from antibiotics with other mechanisms of action, which should be useful for identifying new antibacterial FtsZ inhibitors. Biochemical assays of FtsZ polymerization and GTPase activity combined explain the cellular effects of the FtsZ polymer stabilizing agent PC190723 and its fragments. MciZ is a 40-aminoacid endogenous inhibitor of cell division normally expressed during sporulation in B. subtilis. Using FtsZ cytological profiling we have determined that exogenous synthetic MciZ is an effective inhibitor of B. subtilis cell division, Z-ring formation and localization. This finding supports our cell-based approach to screen for FtsZ inhibitors and opens new possibilities for peptide inhibitors of bacterial cell division.
International Nuclear Information System (INIS)
Slutz, Stephen A.; Olson, Craig L.; Rochau, Gary E.; Dezon, Mark S.; Peterson, P.F.; Degroot, J.S.; Jensen, N.; Miller, G.
2000-01-01
The Z machine at Sandia National Laboratories (SNL) is the most powerful multi-module synchronized pulsed-power accelerator in the world. Rapid development of z-pinch loads on Z has led to outstanding progress in the last few years, resulting in radiative powers of up to 280 TW in 4 ns and a total radiated x-ray energy of 1.8 MJ. The present goal is to demonstrate single-shot, high-yield fusion capsules. Pulsed power is a robust and inexpensive technology, which should be well suited for Inertial Fusion Energy, but a rep-rated capability is needed. Recent developments have led to a viable conceptual approach for a rep-rated z-pinch power plant for IFE. This concept exploits the advantages of going to high yield (a few GJ) at low rep-rate (approximately 0.1 Hz), and using a Recyclable Transmission Line (RTL) to provide the necessary standoff between the fusion target and the power plant chamber. In this approach, a portion of the transmission line near the capsule is replaced after each shot. The RTL should be constructed of materials that can easily be separated from the liquid coolant stream and refabricated for a subsequent shots. One possibility is that most of the RTL is formed by casting FLiBe, a salt composed of fluorine, lithium, and beryllium, which is an attractive choice for the reactor coolant, with chemically compatible lead or tin on the surface to provide conductivity. The authors estimate that fusion yields greater than 1 GJ will be required for efficient generation of electricity. Calculations indicate that the first wall will have an acceptable lifetime with these high yields if blast mitigation techniques are used. Furthermore, yields above 5 GJ may allow the use of a compact blanket direct conversion scheme
New properties of z-scaling: flavor independence and saturation at low z
International Nuclear Information System (INIS)
Zborovsky, I.; Tokarev, M.V.
2008-01-01
Experimental ISR, RHIC, and Tevatron data on inclusive cross sections of particles produced in high energy proton-(anti)proton collisions are analyzed in the framework of z-scaling. New features of the scaling function ψ(z) are established. These are flavor independence of ψ(z) including particles with heavy flavor content and saturation at low z. Flavor independence means that the shape of the scaling function ψ(z) is the same for different hadron species. Saturation corresponds to flattering of ψ(z) for low z < 0.1. Relations of model parameters used in data z-presentation with some thermodynamical quantities (entropy, specific heat, temperature) are discussed. It is shown that behavior of particle spectra at low z is controlled by a parameter c interpreted as specific heat of the created medium associated with production of the inclusive particle. The saturation regime of ψ(z) observed at low z is assumed to be preferable in searching for phase transitions of hadron matter and for study of nonperturbative QCD in high energy proton-(anti)proton collisions at U70, RHIC, Tevatron, and LHC
Jean-Claude Gadmer
2012-01-01
18 September 2012 - PD Dr. med. Andreas Trojan Researcher, University of Zürich and Mr Marc Forster Independant Swiss Movie Director Switzerland visiting the CMS underground area with Head of international Relations F. Pauss and CMS Collaboration Z. Szillasi.
Chloroquine Inhibits Dengue Virus Type 2 Replication in Vero Cells but Not in C6/36 Cells
Farias, Kleber Juvenal Silva; Machado, Paula Renata Lima; da Fonseca, Benedito Antônio Lopes
2013-01-01
Dengue viruses are the most important arthropod-borne viruses in terms of morbidity and mortality in the world. Since there is no dengue vaccine available for human use, we have set out to investigate the use of chloroquine as an antiviral drug against dengue. Chloroquine, an amine acidotropic drug known to affect intracellular exocytic pathways by increasing endosomal pH, was used in the in vitro treatment of Vero and C6/36 cells infected with dengue virus type 2 (DENV-2). Real-time RT-PCR a...
Generalizations of Z-supercontinuous functions and Dδ-supercontinuous functions
Directory of Open Access Journals (Sweden)
J.K. Kohli
2008-10-01
Full Text Available Two new classes of functions, called ‘almost z-supercontinuous functions’ and ’almost Dδ-supercontinuous functions’ are introduced. The class of almost z-supercontinuous functions properly includes the class of z-supercontinuous functions (Indian J. Pure Appl. Math. 33(7, (2002, 1097-1108 as well as the class of almost clopen maps due to Ekici (Acta. Math. Hungar. 107(3, (2005, 193-206 and is properly contained in the class of almost Dδ-supercontinuous functions which in turn constitutes a proper subclass of the class of almost strongly θ-continuous functions due to Noiri and Kang (Indian J. Pure Appl. Math. 15(1, (1984, 1-8 and which in its turn include all δ-continuous functions of Noiri (J. Korean Math. Soc. 16 (1980, 161-166. Characterizations and basic properties of almost z-supercontinuous functions and almost Dδ-supercontinuous functions are discussed and their place in the hierarchy of variants of continuity is elaborated. Moreover, properties of almost strongly θ-continuous functions are investigated and sufficient conditions for almost strongly θ-continuous functions to have u θ-closed (θ-closed graph are formulated.
SALT spectroscopic classification of Gaia18blo as AGN at z=2.09
Wyrzykowski, L.; Gromadzki, Sz.,; Kozlowski, M.; Buckley, D. A. H.; Ihanec, N.
2018-06-01
Gaia18blo (AT2018chv, 13:11:50.55 -37:30:49.43), was discovered by the Gaia Science Alerts programme on 2018-06-05 as a smooth 0.4 mag increase on a 18.9 mag blueish source at Galactic Plane latitude of about 25 deg (http://gsaweb.ast.cam.ac.uk/alerts/alert/Gaia18blo/) We observed the target with the Southern African Large Telescope (SALT) using the Robert Stobie Spectrograph (RSS) on 2018-06-08 with PG300 grating, slit size 1.5 arcsec.
X-ray fluorescence from the element with atomic number Z=120
International Nuclear Information System (INIS)
Fregeau, M.O.; Morjean, M.; Bonnet, E.; Chbihi, A.; Frankland, J.D.; Jacquet, D.; Rivet, M.F.; Tassan-Got, L.; Dechery, F.; Drouart, A.; Nalpas, L.; Ledoux, X.; Parlog, M.; Parlog, M.; Ciortea, C.; Dumitriu, D.; Fluerasu, D.; Gugiu, M.; Gramegna, F.; Kravchuk, V.L.; Marchi, T.; Marchi, T.; Fabris, D.; Corsi, A.; Barlini, S.
2012-01-01
An atomic clock based on x-ray fluorescence yields has been used to estimate the mean characteristic time for fusion followed by fission in reactions 238 U + 64 Ni at 6.6 MeV/A. Inner shell vacancies are created during the collisions in the electronic structure of the possibly formed Z = 120 compound nuclei. The filling of these vacancies accompanied by a x-ray emission with energies characteristic of Z = 120 can take place only if the atomic transitions occur before nuclear fission. Therefore, the x-ray yield characteristic of the united atom with 120 protons is strongly related to the fission time and to the vacancy lifetimes. K x rays from the element with Z = 120 have been unambiguously identified from a coupled analysis of the involved nuclear reaction mechanisms and of the measured photon spectra. A minimum mean fission time τ f = 2.5 * 10 -18 s has been deduced for Z = 120 from the measured x-ray multiplicity. (authors)
The synthesis of 18F-labelled amino acid O-(2-[18F]fluoroethyl)-L-tyrosine (FET) in NPI
Czech Academy of Sciences Publication Activity Database
Švecová, Helena; Procházka, Libor; Fedorova, S.; Kropáček, Martin; Melichar, František
2007-01-01
Roč. 2, č. 331 (2007), s. 34-34 ISSN 1619-7070 R&D Projects: GA MPO 2A-1TP1/055 Institutional research plan: CEZ:AV0Z10480505 Keywords : [18F]FET * PET * tumor imaging Subject RIV: FR - Pharmacology ; Medidal Chemistry
International Nuclear Information System (INIS)
Tetsu, Miyamoto
1999-01-01
The steady state and quasi-steady processes of infinite- and finite-width sheet z-pinches are studied. The relations corresponding to the Bennett relation and Pease-Braginskii current of cylindrical fiber z-pinches depend on a geometrical factor in the sheet z-pinches. The finite-width sheet z-pinch is approximated by a segment of infinite-width sheet z-pinch, if it is wide enough, and corresponds to a number of (width/thickness) times fiber z-pinch plasmas of the diameter that equals the sheet thickness. If the sheet current equals this number times the fiber current, the plasma created in the sheet z-pinches is as dense as in the fiber z-pinches. The total energy of plasma and magnetic field per unit mass is approximately equal in both pinches. Quasi-static transient processes are different in several aspects from the fiber z-pinch. No radiation collapse occurs in the sheet z-pinch. The stability is improved in the sheet z-pinches. The fusion criterions and the experimental arrangements to produce the sheet z-pinches are also discussed. (author)
Directory of Open Access Journals (Sweden)
Carla Aparecida Cielo
2013-01-01
Full Text Available OBJETIVO: correlacionar os tempos máximos de fonação (TMF e as relações entre os fricativos /s/ e /z/ (s/z e entre /e/ não vozeado e a vogal /e/ (ė/e de mulheres sem afecções laríngeas. MÉTODO: participaram 60 mulheres com média de 21,56 anos de idade. Coletaram-se os TMF/ė/, /e/, /s/ e /z/ e calcularam-se a relação s/z e a relação ė/e, com padrão de normalidade para as relações de 0,8 a 1,2; para os TMF/s/ e /z/, entre 15,57 e 34,17s; para o TMF/ė/, entre 16 a 18s; e para o TMF/e/, entre 14,04 e 26,96s. Testes de Lilliefords, Spearmann, Binomial e Mann-Whitney com nível de significância de 5%. RESULTADOS: correlação positiva entre TMF/s/ e TMF/ė/, TMF/z/ e TMF/e/, TMF/s/ e TMF/z/, e TMF/ė/ e TMF/e/. Não houve correlação entre as relações s/z e ė/e, nem diferenças entre a relação ė/e, enquanto a relação s/z foi significantemente normal. TMF/ė/ e TMF/e/ significantemente diminuídos; TMF/s/ e TMF/z/ significantemente normais. TMF/ė/ significantemente menor do que TMF/s/; TMF/e/ significantemente menor do que TMF/z/. CONCLUSÃO: os fonemas /s/ e /z/ isolados e sua relação ficaram dentro da normalidade e as relações s/z e ė/e não apresentaram correlação. Os TMF/ė/ e TMF/e/ mostraram-se diminuídos em relação à normalidade. O TMF/ė/ foi menor do que TMF/s/ e o TMF/e/ foi menor do que TMF/z/, possivelmente devido ao modo articulatório dos fricativos ter aumentado o tempo de emissão, independentemente do controle do nível glótico e respiratório.PURPOSE: correlate the maximum phonation time (MPT and the relations between the fricative /s/ and /z/ (s/z and between the vowels /ė/ and /e/ (ė/e of women without laryngeal disorders. METHOD: participants were 60 women with a mean of 21.56 years old. Were collected MPT/ė/, /e/, /s/ and /z/ and calculated the relations ė/e and s/z, with normal pattern for the relationship from 0.8 to 1.2; for MPT/s/ and MPT/z/, between 15.57 and 34.17s; for the
Czech Academy of Sciences Publication Activity Database
Šturma, Pavel
2010-01-01
Roč. 18, č. 6 (2010), s. 191-194 ISSN 1210-6410 Institutional research plan: CEZ:AV0Z70680506 Keywords : the Lisbon Treaty * the Charter of Fundamental Rights of the EU Subject RIV: AG - Legal Sciences
Osobnostné aspekty zvládania záťaže
Czech Academy of Sciences Publication Activity Database
Millová, Katarína; Blatný, Marek; Kohoutek, Tomáš
2008-01-01
Roč. 2, č. 1 (2008), s. 1-8 ISSN 1802-8853 Institutional research plan: CEZ:AV0Z7025918 Keywords : coping strategies * personality styles * personality Subject RIV: AN - Psychology http://e-psycholog.eu/pdf/millova-etal.pdf
Development of a Z-pinch-driven ICF hohlraum concept on Z
International Nuclear Information System (INIS)
Cuneo, M.E.; Porter, J.L. Jr.; Vesey, R.A.
1999-01-01
Recent development of high power z-pinches (> 150 MW) on the Z driver has permitted the study of high-temperature, radiation-driven hohlraums. Three complementary, Z-pinch source-hohlraum-ICF capsule configurations are being developed to harness the x-ray output of these Z-pinch's. These are the dynamic-hohlraum, static-wall hohlraum, and Z-pinch-driven hohlraum concepts. Each has different potential strengths and concerns. In this paper, the authors report on the first experiments with the Z-pinch-driven hohlraum (ZPDH) concept. A high-yield ICF capsule design for this concept appears feasible, when driven by z-pinches from a 60 MA-class driver. Initial experiments characterize the behavior of the spoke array on Z-pinch performance and x-ray transmission, and the uniformity of radiation flux incident on a foam capsule in the secondary, for a single-sided drive. Measurements of x-ray wall re-emission power and spectrum, radiation temperatures, spoke-plasma location, and drive uniformity will be presented and compared with 0-D energetics, 2-D Lasnex rad-hydro, and 3-D radiosity calculations of energy transport and drive uniformity
Development of a Z-pinch-driven ICF hohlraum concept on Z
Energy Technology Data Exchange (ETDEWEB)
Cuneo, M E; Porter, Jr, J L; Vesey, R A [and others
1999-07-01
Recent development of high power z-pinches (> 150 MW) on the Z driver has permitted the study of high-temperature, radiation-driven hohlraums. Three complementary, Z-pinch source-hohlraum-ICF capsule configurations are being developed to harness the x-ray output of these Z-pinch's. These are the dynamic-hohlraum, static-wall hohlraum, and Z-pinch-driven hohlraum concepts. Each has different potential strengths and concerns. In this paper, the authors report on the first experiments with the Z-pinch-driven hohlraum (ZPDH) concept. A high-yield ICF capsule design for this concept appears feasible, when driven by z-pinches from a 60 MA-class driver. Initial experiments characterize the behavior of the spoke array on Z-pinch performance and x-ray transmission, and the uniformity of radiation flux incident on a foam capsule in the secondary, for a single-sided drive. Measurements of x-ray wall re-emission power and spectrum, radiation temperatures, spoke-plasma location, and drive uniformity will be presented and compared with 0-D energetics, 2-D Lasnex rad-hydro, and 3-D radiosity calculations of energy transport and drive uniformity.
Schumacher, Maria A; Huang, Kuo-Hsiang; Zeng, Wenjie; Janakiraman, Anuradha
2017-03-03
Cell division in most bacteria is mediated by the tubulin-like FtsZ protein, which polymerizes in a GTP-dependent manner to form the cytokinetic Z ring. A diverse repertoire of FtsZ-binding proteins affects FtsZ localization and polymerization to ensure correct Z ring formation. Many of these proteins bind the C-terminal domain (CTD) of FtsZ, which serves as a hub for FtsZ regulation. FtsZ ring-associated proteins, ZapA-D (Zaps), are important FtsZ regulatory proteins that stabilize FtsZ assembly and enhance Z ring formation by increasing lateral assembly of FtsZ protofilaments, which then form the Z ring. There are no structures of a Zap protein bound to FtsZ; therefore, how these proteins affect FtsZ polymerization has been unclear. Recent data showed ZapD binds specifically to the FtsZ CTD. Thus, to obtain insight into the ZapD-CTD interaction and how it may mediate FtsZ protofilament assembly, we determined the Escherichia coli ZapD-FtsZ CTD structure to 2.67 Å resolution. The structure shows that the CTD docks within a hydrophobic cleft in the ZapD helical domain and adopts an unusual structure composed of two turns of helix separated by a proline kink. FtsZ CTD residue Phe-377 inserts into the ZapD pocket, anchoring the CTD in place and permitting hydrophobic contacts between FtsZ residues Ile-374, Pro-375, and Leu-378 with ZapD residues Leu-74, Trp-77, Leu-91, and Leu-174. The structural findings were supported by mutagenesis coupled with biochemical and in vivo studies. The combined data suggest that ZapD acts as a molecular cross-linking reagent between FtsZ protofilaments to enhance FtsZ assembly. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.
Photometric Selection of a Massive Galaxy Catalog with z ≥ 0.55
Núñez, Carolina; Spergel, David N.; Ho, Shirley
2017-02-01
We present the development of a photometrically selected massive galaxy catalog, targeting Luminous Red Galaxies (LRGs) and massive blue galaxies at redshifts of z≥slant 0.55. Massive galaxy candidates are selected using infrared/optical color-color cuts, with optical data from the Sloan Digital Sky Survey (SDSS) and infrared data from “unWISE” forced photometry derived from the Wide-field Infrared Survey Explorer (WISE). The selection method is based on previously developed techniques to select LRGs with z> 0.5, and is optimized using receiver operating characteristic curves. The catalog contains 16,191,145 objects, selected over the full SDSS DR10 footprint. The redshift distribution of the resulting catalog is estimated using spectroscopic redshifts from the DEEP2 Galaxy Redshift Survey and photometric redshifts from COSMOS. Restframe U - B colors from DEEP2 are used to estimate LRG selection efficiency. Using DEEP2, the resulting catalog has an average redshift of z = 0.65, with a standard deviation of σ =2.0, and an average restframe of U-B=1.0, with a standard deviation of σ =0.27. Using COSMOS, the resulting catalog has an average redshift of z = 0.60, with a standard deviation of σ =1.8. We estimate 34 % of the catalog to be blue galaxies with z≥slant 0.55. An estimated 9.6 % of selected objects are blue sources with redshift z0.55. Stellar contamination is estimated to be 1.8%.
PBFA Z: A 60-TW/5-MJ Z-pinch driver
International Nuclear Information System (INIS)
Spielman, R.B.; Deeney, C.; Chandler, G.A.; Douglas, M.R.; Fehl, D.L.; Matzen, M.K.; McDaniel, D.H.; Nash, T.J.; Porter, J.L.; Sanford, T.W.; Seamen, J.F.; Stygar, W.A.; Struve, K.W.; Breeze, S.P.; McGurn, J.S.; Torres, J.A.; Zagar, D.M.; Gilliland, T.L.; Jobe, D.O.; McKenney, J.L.; Mock, R.C.; Vargas, M.; Wagoner, T.; Peterson, D.L.
1997-01-01
PBFA Z, a new 60-TW/5-MJ electrical accelerator located at Sandia National Laboratories, is now the world's most powerful z-pinch driver. PBFA Z stores 11.4 MJ in its 36 Marx generators, couples 5 MJ into a 60-TW/105-ns FWHM pulse to the 120-mΩ water transmission lines, and delivers 3.0 MJ and 50 TW of electrical energy to the z-pinch load. Depending on load parameters, we attain peak load currents of 16-20 MA with a current rise time of ∼105ns with wire-array z-pinch loads. We have extended the x-ray performance of tungsten wire-array z pinches from earlier Saturn experiments. Using a 2-cm-radius, 2-cm-long tungsten wire array with 240, 7.5-μm diameter wires (4.1-mg mass), we achieved an x-ray power of 210 TW and an x-ray energy of 1.9 MJ. Preliminary spectral measurements suggest a mostly optically-thick, Planckian-like radiator below 1000 eV. Data indicate ∼100kJ of x rays radiated above 1000 eV. An intense z-pinch x-ray source with an overall coupling efficiency greater than 15% has been demonstrated. copyright 1997 American Institute of Physics
Computational modeling of z-pinch-driven hohlraum experiments on Z
International Nuclear Information System (INIS)
Vesey, R.A.; Porter, J.L. Jr.; Cuneo, M.E.
1999-01-01
The high-yield inertial confinement fusion concept based on a double-ended z-pinch driven hohlraum tolerates the degree of spatial inhomogeneity present in z-pinch plasma radiation sources by utilizing a relatively large hohlraum wall surface to provide spatial smoothing of the radiation delivered to the fusion capsule. The z-pinch radiation sources are separated from the capsule by radial spoke arrays. Key physics issues for this concept are the behavior of the spoke array (effect on the z-pinch performance, x-ray transmission) and the uniformity of the radiation flux incident on the surface of the capsule. Experiments are underway on the Z accelerator at Sandia National laboratories to gain understanding of these issues in a single-sided drive geometry. These experiments seek to measure the radiation coupling among the z-pinch, source hohlraum, and secondary hohlraum, as well as the uniformity of the radiation flux striking a foam witness ball diagnostic positioned in the secondary hohlraum. This paper will present the results of computational modeling of various aspects of these experiments
Internal conversion coefficients for atomic numbers Z less than or equal to 30
International Nuclear Information System (INIS)
Band, I.M.; Trzhaskovskaya, M.B.; Listengarten, M.A.
1976-01-01
Presented here are internal conversion coefficients (ICC) of gamma rays for 20 values of atomic number, Z, in the range 3 less than or equal to Z less than or equal to 30, including all Z greater than or equal to 14. The tables provide the previously missing data for light elements. Coefficients are given for 19 values of gamma-ray transition energies up to 6 MeV for the K-electron shell and 18 values up to 2 MeV for three L-subshells. The minimum enegy is 15 keV. The first five electric and magnetic nuclear transition multipolarities are covered. The calculations are relativistic, with screening and finite nuclear size effect taken into account
Vacuum oscillations around a large-Z ''nucleus''
International Nuclear Information System (INIS)
Kumano, S.; Iwazaki, A.
1989-01-01
We investigate a possible explanation of sharp e + peaks in heavy-ion collisions by analyzing QED with a large atomic number external source. We show that a highly polarized vacuum around a large Z ''nucleus'' has at least two neutral oscillation modes, whose energies are calculated to be 1.8 MeV and 1.5 MeV with an appropriate choice of the nuclear radius. They decay into a pair of e/sup +-/ through electromagnetic interactions. 8 refs., 1 fig
International Nuclear Information System (INIS)
Calva-Vazquez, G.; Razo-Angel, G.; Rodriguez-Fernandez, L.; Ruvalcaba-Sil, J.L.
2006-01-01
The concentration of elements with Z > 18 is measured in tree rings from forests at the surroundings of the Mexico Valley: El Chico National Park (ECP) and Desierto de los Leones National Park (DLP). The analysis was done by simultaneous PIXE-RBS using an external proton beam on tree rings of Pine and Sacred fir (species Pinus montezumae and Abies religiosa, respectively). This study provides information about the elemental concentration in trees of those parks during the years from 1965 to 2003. Typical elements such as K, Ca, Ti, V, Cr, Mn, Fe, Ni, Cu, Zn, Br, Sr and Pb were detected using PIXE technique while the wood matrix composition (mainly C and O) was determined by RBS. In general, elemental contents present large variations but concentrations oscillate around the mean value during this period of time. Nevertheless, the measurements showed some trends for Fe and Zn in the tree-rings elemental composition that may be correlated to recent volcanic activities in the region. The low Mn contents indicate soil acidification in DLP from 1968 and the forest decline in ECP during the last 15 years
A SUBSTANTIAL POPULATION OF MASSIVE QUIESCENT GALAXIES AT z ∼ 4 FROM ZFOURGE
Energy Technology Data Exchange (ETDEWEB)
Straatman, Caroline M. S.; Labbé, Ivo [Leiden Observatory, Leiden University, P.O. Box 9513, 2300 RA Leiden (Netherlands); Spitler, Lee R. [Department of Physics and Astronomy, Faculty of Sciences, Macquarie University, Sydney, NSW 2109 (Australia); Allen, Rebecca; Glazebrook, Karl; Kacprzak, Glenn G. [Centre for Astrophysics and Supercomputing, Swinburne University, Hawthorn, VIC 3122 (Australia); Altieri, Bruno [European Space Astronomy Centre (ESAC)/ESA, Villanueva de la Cañada, 28691, Madrid (Spain); Brammer, Gabriel B. [European Southern Observatory, Alonso de Córdova 3107, Casilla 19001, Vitacura, Santiago (Chile); Dickinson, Mark; Inami, Hanae [National Optical Astronomy Observatory, Tucson, AZ (United States); Van Dokkum, Pieter [Department of Astronomy, Yale University, New Haven, CT 06520 (United States); Kawinwanichakij, Lalit; Mehrtens, Nicola; Papovich, Casey [George P. and Cynthia W. Mitchell Institute for Fundamental Physics and Astronomy, Department of Physics and Astronomy, Texas A and M University, College Station, TX 77843 (United States); Kelson, Daniel D.; McCarthy, Patrick J.; Monson, Andy; Murphy, David; Persson, S. Eric; Quadri, Ryan, E-mail: straatman@strw.leidenuniv.nl [Carnegie Observatories, Pasadena, CA 91101 (United States); and others
2014-03-01
We report the likely identification of a substantial population of massive M ∼ 10{sup 11} M {sub ☉} galaxies at z ∼ 4 with suppressed star formation rates (SFRs), selected on rest-frame optical to near-IR colors from the FourStar Galaxy Evolution Survey (ZFOURGE). The observed spectral energy distributions show pronounced breaks, sampled by a set of near-IR medium-bandwidth filters, resulting in tightly constrained photometric redshifts. Fitting stellar population models suggests large Balmer/4000 Å breaks, relatively old stellar populations, large stellar masses, and low SFRs, with a median specific SFR of 2.9 ± 1.8 × 10{sup –11} yr{sup –1}. Ultradeep Herschel/PACS 100 μm, 160 μm and Spitzer/MIPS 24 μm data reveal no dust-obscured SFR activity for 15/19(79%) galaxies. Two far-IR detected galaxies are obscured QSOs. Stacking the far-IR undetected galaxies yields no detection, consistent with the spectral energy distribution fit, indicating independently that the average specific SFR is at least 10 × smaller than that of typical star-forming galaxies at z ∼ 4. Assuming all far-IR undetected galaxies are indeed quiescent, the volume density is 1.8 ± 0.7 × 10{sup –5} Mpc{sup –3} to a limit of log{sub 10} M/M {sub ☉} ≥ 10.6, which is 10 × and 80 × lower than at z = 2 and z = 0.1. They comprise a remarkably high fraction (∼35%) of z ∼ 4 massive galaxies, suggesting that suppression of star formation was efficient even at very high redshift. Given the average stellar age of 0.8 Gyr and stellar mass of 0.8 × 10{sup 11} M {sub ☉}, the galaxies likely started forming stars before z = 5, with SFRs well in excess of 100 M {sub ☉} yr{sup –1}, far exceeding that of similarly abundant UV-bright galaxies at z ≥ 4. This suggests that most of the star formation in the progenitors of quiescent z ∼ 4 galaxies was obscured by dust.
Hossain, Md Iqbal; Ahmed, Tahmeed; Arifeen, Shams El; Billah, Sk Masum; Faruque, Asg; Islam, M Munirul; Jackson, Alan A
2017-11-01
Background : In clinical settings, wasting in childhood has primarily been assessed with the use of a weight-for-height z score (WHZ), and in community settings, it has been assessed via the midupper arm circumference (MUAC) with a cutoff children were not identified when these cutoffs for MUAC were used. Objective: We determined the cutoffs for MUAC to detect wasting in Bangladeshi children aged 6-60 mo. Design: A secondary analysis was carried out on data from 27,767 children aged 6-59 mo. This analysis comprised 1 ) 9131 children across Bangladesh and 2 ) 18,636 children enrolled in a surveillance study in the Dhaka Hospital of icddr,b during 1996-2014. The area under the receiver operating curve was used to indicate the most appropriate choice for cutoffs that related MUAC with WHZ. Results: The mean ± SD age for the entire group was 21 ± 14 mo, WHZ was -1.18 ± 1.23, height-for-age z score was -1.63 ± 1.39, MUAC was 136 ± 14 mm, and 45% of subjects were girls. MUAC correlated with the WHZ ( r : 0.618, P < 0.001). Age-stratified analyses revealed that, for ages 6-24 mo, MUAC cutoffs were <120 mm for a WHZ <-3 and <125 mm for a WHZ <-2 with a sensitivity of 72.9% and 63.2%, respectively, and a specificity of 84.7% and 85.3%, respectively; for ages 25-36 mo, MUAC cutoffs were <125 mm for a WHZ <-3 and <135 mm for a WHZ <-2 with a sensitivity of 55.0% and 71.7%, respectively, and a specificity of 92.8% and 78.7% respectively; and for ages 37-60 mo, MUAC cutoffs were <135 mm for a WHZ <-3 and <140 mm for a WHZ <-2 with a sensitivity of 71.4% and 70.4%, respectively, and a specificity of 84.6% and 80.3%, respectively. Conclusion: The respective cutoffs for MUAC to better capture the vulnerability and risk of severe (WHZ <-3) and moderate (WHZ <-2) wasting would be <120 and <125 mm for ages 6-24 mo, <125 and <135 mm for ages 25-36 mo, and <135 and <140 mm for ages 37-60 mo. © 2017 American Society for Nutrition.
Effects of rhodomyrtone on Gram-positive bacterial tubulin homologue FtsZ
Directory of Open Access Journals (Sweden)
Dennapa Saeloh
2017-02-01
Full Text Available Rhodomyrtone, a natural antimicrobial compound, displays potent activity against many Gram-positive pathogenic bacteria, comparable to last-defence antibiotics including vancomycin and daptomycin. Our previous studies pointed towards effects of rhodomyrtone on the bacterial membrane and cell wall. In addition, a recent molecular docking study suggested that the compound could competitively bind to the main bacterial cell division protein FtsZ. In this study, we applied a computational approach (in silico, in vitro, and in vivo experiments to investigate molecular interactions of rhodomyrtone with FtsZ. Using molecular simulation, FtsZ conformational changes were observed in both (S- and (R-rhodomyrtone binding states, compared with the three natural states of FtsZ (ligand-free, GDP-, and GTP-binding states. Calculations of free binding energy showed a higher affinity of FtsZ to (S-rhodomyrtone (−35.92 ± 0.36 kcal mol−1 than the GDP substrate (−23.47 ± 0.25 kcal mol−1 while less affinity was observed in the case of (R-rhodomyrtone (−18.11 ± 0.11 kcal mol−1. In vitro experiments further revealed that rhodomyrtone reduced FtsZ polymerization by 36% and inhibited GTPase activity by up to 45%. However, the compound had no effect on FtsZ localization in Bacillus subtilis at inhibitory concentrations and cells also did not elongate after treatment. Higher concentrations of rhodomyrtone did affect localization of FtsZ and also affected localization of its membrane anchor proteins FtsA and SepF, showing that the compound did not specifically inhibit FtsZ but rather impaired multiple divisome proteins. Furthermore, a number of cells adopted a bean-like shape suggesting that rhodomyrtone possibly possesses further targets involved in cell envelope synthesis and/or maintenance.
Capak, P.; Mobasher, B.; Scoville, N. Z.; McCracken, H.; Ilbert, O.; Salvato, M.; Menéndez-Delmestre, K.; Aussel, H.; Carilli, C.; Civano, F.; Elvis, M.; Giavalisco, M.; Jullo, E.; Kartaltepe, J.; Leauthaud, A.; Koekemoer, A. M.; Kneib, J.-P.; LeFloch, E.; Sanders, D. B.; Schinnerer, E.; Shioya, Y.; Shopbell, P.; Tanaguchi, Y.; Thompson, D.; Willott, C. J.
2011-04-01
We present three bright z +-dropout candidates selected from deep near-infrared (NIR) imaging of the COSMOS 2 deg2 field. All three objects match the 0.8-8 μm colors of other published z > 7 candidates but are 3 mag brighter, facilitating further study. Deep spectroscopy of two of the candidates covering 0.64-1.02 μm with Keck-DEIMOS and all three covering 0.94-1.10 μm and 1.52-1.80 μm with Keck-NIRSPEC detects weak spectral features tentatively identified as Lyα at z = 6.95 and z = 7.69 in two of the objects. The third object is placed at z ~ 1.6 based on a 24 μm and weak optical detection. A comparison with the spectral energy distributions of known z 1 μm properties of all three objects can be matched to optically detected sources with photometric redshifts at z ~ 1.8, so the non-detection in the i + and z + bands is the primary factor which favors a z > 7 solution. If any of these objects are at z ~ 7, the bright end of the luminosity function is significantly higher at z > 7 than suggested by previous studies, but consistent within the statistical uncertainty and the dark matter halo distribution. If these objects are at low redshift, the Lyman break selection must be contaminated by a previously unknown population of low-redshift objects with very strong breaks in their broadband spectral energy distributions and blue NIR colors. The implications of this result on luminosity function evolution at high redshift are discussed. We show that the primary limitation of z > 7 galaxy searches with broad filters is the depth of the available optical data. Based on observations with the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration and made possible by the generous financial support of the W. M. Keck Foundation; the Spitzer Space Telescope, which is operated by the Jet Propulsion Laboratory, California
International Nuclear Information System (INIS)
Quintero, E.; Tovar, R.; Quintero, M.; Delgado, G.E.; Morocoima, M.; Caldera, D.; Ruiz, J.; Mora, A.E.; Briceno, M.; Fernandez, J.L.
2007-01-01
X-ray powder diffraction measurements and differential thermal analysis (DTA) were made on polycrystalline samples of the Cu 2 Cd 1-z Mn z GeSe 4 and Cu 2 Cd 1-z Fe z GeSe 4 alloy systems. The diffraction patterns were used to show the equilibrium conditions and to derive lattice parameter values. The effect of the annealing temperature and cooling rate to room temperature are discussed. For the Cu 2 Cd 1-z Fe z GeSe 4 system, only two single solid phase fields, the tetragonal stannite α and the wurtz-stannite δ structures were found to occur in the diagram. For the Cu 2 Cd 1-z Mn z GeSe 4 system, in addition to the tetragonal stannite α and the wurtz-stannite δ phases, MnSe was found to exist in the diagram. The DTA experiments showed that the cooling curves for both systems exhibited effects of undercooling
International Nuclear Information System (INIS)
Shlachter, J.S.; Hammel, J.E.; Scudder, D.W.
1985-01-01
Early researchers recogniZed the desirable features of the linear Z-pinch configuration as a magnetic fusion scheme. In particular, a Z-pinch reactor might not require auxiliary heating or external field coils, and could constitute an uncomplicated, high plasma β geometry. The simple Z pinch, however, exhibited gross MHD instabilities that disrupted the plasma, and the linear Z pinch was abandoned in favor of more stable configurations. Recent advances in pulsed-power technology and an appreciation of the dynamic behavior of an ohmically heated Z pinch have led to a reexamination of the Z pinch as a workable fusion concept
Comparative study of a low-Z cone-beam computed tomography system
International Nuclear Information System (INIS)
Roberts, D A; Hansen, V N; Poludniowski, G; Evans, P M; Thompson, M G; Niven, A; Seco, J
2011-01-01
Computed tomography images have been acquired using an experimental (low atomic number (Z) insert) megavoltage cone-beam imaging system. These images have been compared with standard megavoltage and kilovoltage imaging systems. The experimental system requires a simple modification to the 4 MeV electron beam from an Elekta Precise linac. Low-energy photons are produced in the standard medium-Z electron window and a low-Z carbon electron absorber located after the window. The carbon electron absorber produces photons as well as ensuring that all remaining electrons from the source are removed. A detector sensitive to diagnostic x-ray energies is also employed. Quantitative assessment of cone-beam computed tomography (CBCT) contrast shows that the low-Z imaging system is an order of magnitude or more superior to a standard 6 MV imaging system. CBCT data with the same contrast-to-noise ratio as a kilovoltage imaging system (0.15 cGy) can be obtained in doses of 11 and 244 cGy for the experimental and standard 6 MV systems, respectively. Whilst these doses are high for everyday imaging, qualitative images indicate that kilovoltage like images suitable for patient positioning can be acquired in radiation doses of 1-8 cGy with the experimental low-Z system.
International Nuclear Information System (INIS)
Sharma, Ajay; Mittal, Raj
2005-01-01
L sub-shell photo-ionization cross-sections, σ Li , for elements 18Z92 at energies .320-115.606 keV have been generated from an empirical relation fitted to Scofield's L sub-shell photo-ionization cross-section values. The excitation energy E for an element is constrained by the condition that only L and higher shell vacancies are produced in the elements. The closeness of generated and existing values of Scofield's L sub-shell data recommends the use of generated values in the fields of atomic and molecular physics and for trace elemental analysis. For this purpose computer software 'LSPICS' has been developed. On personal computer LSPICS generates L sub-shell photo-ionization cross-section values in barns just by entering the atomic number of element and excitation photon energy in keV
Huo, Yujia; Lu, Qiaonan; Zheng, Xiaowei; Ma, Yuanfang; Lu, Feng
2016-02-04
To explore effects of FtsZ mutants FtsZ(E75A), FtsZ(R78G) and FtsZ(D82A) on FtsZ self-assembly and interaction of FtsZ with MreB in Escherichia coli strains. METHODS) We constructed FtsZ and its mutant's plasmids by molecular clone and site-directed mutagenesis methods, and purified targeted proteins by affinity chromatography. QN6(ftsZ::yfp-cat), QN7(tsZ::yfp-cat), QN8(ftsZ(R78G)::yfp-cat) and QN9 (ftsZ(D82A):.:yfp-cat) strains were constructed by linear DNA homologous recombination. We observed cellular localization pattern of FtsZ and its mutants in E. coli by living cell imaging experiments, examined interaction of FtsZ/FtsZ*-FtsZ* and FtsZ/FtsZ*-MreB by Coimmunoprecipitation and bacteria two hybrid, and analyzed assembly characteristics of FtsZ mutants by Light scattering. RESULTS) The Yfp-labeled FtsZ(E75A), FtsZ(R78G) and FtsZ(D82A) mutant proteins failed to assemble into functional Z-ring structure and localize correctly in E. coli strains. Interaction of FtsZ with its mutants, or FtsZ*-FtsZ* and FtsZ*-MreB interaction were weakened or completely disappeared. In addition, in vitro experiments show that E75A, R78G and D82A mutations decreased the polymerization efficiency of FtsZ monomer. FtsZ E75, R78 and D82 are critical amino acids in the assembly, function of FtsZ protein and FtsZ-MreB interaction in E. coli strains.
Quantum-well exciton dipolar interaction: Polarization-dependence and Z-LT splitting
International Nuclear Information System (INIS)
Nguyen Ba An.
1996-12-01
We calculate the exciton dipolar interaction in a semiconductor quantum well. The explicit polarization-dependence, i.e, the dependence on both the exciton dipole moment μ-vector and its inplane wavevector k-vector is derived. The obtained results for the three modes (L, T and Z modes) of the long-range part of the dipolar interaction satisfy the polarization sum rule for any parameters. In the long wavelength limit there is a Z-LT splitting which decreases as the well width increases reflecting a crossover from strict 2D to quasi-2D. A rough crossover from quasi-2D to 3D is also described. (author). 18 refs, 4 figs
International Nuclear Information System (INIS)
Yu Huiming; Liu Yunfang; Hou Ming; Liu Jie; Li Xiaonan; Yu Jinming
2009-01-01
Purpose: The correlation of gross tumor sizes between combined 18 F-FDG PET/CT images and macroscopic surgical samples has not yet been studied in detail. In the present study, we compared CT, 18 F-FDG PET and combined 18 F-FDG PET/CT for the delineation of gross tumor volume (GTV) and validated the results through examination of the macroscopic surgical specimen. Methods: Fifty-two operable non-small cell lung cancer (NSCLC) patients had integrated 18 F-FDG PET/CT scans preoperatively and pathological examination post-operation. Four separate maximal tumor sizes at X (lateral direction), Y (ventro-dorsal direction) and Z (cranio-caudal direction) axis were measured on 18 F-FDG PET, CT, combined 18 F-FDG PET/CT and surgical specimen, respectively. Linear regression was calculated for each of the three imaging measurements versus pathological measurement. Results: No significant differences were observed among the tumor sizes measured by three images and pathological method. Compared with pathological measurement, CT size at X, Y, Z axis was larger, whereas combined 18 F-FDG PET/CT and 18 F-FDG PET size were smaller. Combined 18 F-FDG PET/CT size was more similar to the pathological size than that of 18 F-FDG PET or CT. Results of linear regressions showed that integrated 18 F-FDG PET/CT was the most accurate modality in measuring the size of cancer. Conclusions: 18 F-FDG PET/CT correlates more faithfully with pathological findings than 18 F-FDG PET or CT. Integrated 18 F-FDG PET/CT is an effective tool to define the target of GTV in radiotherapy.
THE SUBARU HIGH-z QUASAR SURVEY: DISCOVERY OF FAINT z ∼ 6 QUASARS
International Nuclear Information System (INIS)
Kashikawa, Nobunari; Furusawa, Hisanori; Niino, Yuu; Ishizaki, Yoshifumi; Onoue, Masafusa; Toshikawa, Jun; Ishikawa, Shogo; Willott, Chris J.; Im, Myungshin; Shimasaku, Kazuhiro; Ouchi, Masami; Hibon, Pascale
2015-01-01
We present the discovery of one or two extremely faint z ∼ 6 quasars in 6.5 deg 2 utilizing a unique capability of the wide-field imaging of the Subaru/Suprime-Cam. The quasar selection was made in (i'-z B ) and (z B -z R ) colors, where z B and z R are bandpasses with central wavelengths of 8842 Å and 9841 Å, respectively. The color selection can effectively isolate quasars at z ∼ 6 from M/L/T dwarfs without the J-band photometry down to z R < 24.0, which is 3.5 mag deeper than the Sloan Digital Sky Survey (SDSS). We have selected 17 promising quasar candidates. The follow-up spectroscopy for seven targets identified one apparent quasar at z = 6.156 with M 1450 = –23.10. We also identified one possible quasar at z = 6.041 with a faint continuum of M 1450 = –22.58 and a narrow Lyα emission with HWHM =427 km s –1 , which cannot be distinguished from Lyman α emitters. We derive the quasar luminosity function at z ∼ 6 by combining our faint quasar sample with the bright quasar samples by SDSS and CFHQS. Including our data points invokes a higher number density in the faintest bin of the quasar luminosity function than the previous estimate employed. This suggests a steeper faint-end slope than lower z, though it is yet uncertain based on a small number of spectroscopically identified faint quasars, and several quasar candidates still remain to be diagnosed. The steepening of the quasar luminosity function at the faint end does increase the expected emission rate of the ionizing photon; however, it only changes by a factor of approximately two to six. This was found to still be insufficient for the required photon budget of reionization at z ∼ 6
Indian Academy of Sciences (India)
Z L GAN. Articles written in Sadhana. Volume 43 Issue 4 April 2018 pp 59. Effect of scale size, orientation type and dispensing method on void formation in the CUF encapsulation of BGA · AIZAT ABAS FEI CHONG NG Z L GAN M H H ISHAK M Z ABDULLAH GEAN YUEN CHONG · More Details Abstract Fulltext PDF.
International Nuclear Information System (INIS)
Firestone, A.
1990-01-01
This paper presents results of studies of the Z Boson produced in e + e - annihilations in the DELPHI detector at the CERN LEP collider. Approximately 600 nb. -1 of useful data were collected in the first LEP running period in the last half of 1989. Results are presented on the mass and width of the Z Boson, on the partial widths of the Z decays into hadrons and into lepton pairs, on comparisons with the predictions of QCD, on the number of light neutrino generations, and on the searches for new particles. The authors find that M Z = 91.171 ± 0.030 (stat.) ± 0.030 (beam) GeV, Γ Z = 2.511 ± 0.065 GeV, Γ had. = 1741 ± 61 MeV, Γ lept. = 85.1 ± 2.9 MeV, Γ inv. = 515 ± 54 MeV, and N v = 2.97 ± 0.26 generations. The authors have set limits on the mass of the charged Higgs particle, and the authors find no evidence for new quarks, new heavy leptons, or any supersymmetric partners to the known particles. All the authors' results are consistent with the Standard Model of electroweak interactions plus QCD with exactly three generations of elementary fermions
Liu, Bo; The ATLAS collaboration
2018-01-01
These slides present the study of Z\\gamma production with high mass dijet system. The fiducial cross sections for the EWK and QCD productions of Z\\gamma+2j are measured with Z boson charged leptonic decay mode and found to be consistent with theoretical predictions. In addition, the aQGC is test in high photon pT region by using both Z boson charged and neutral lepton decay modes within EFT framework. No obvious excess is observed and the data are found to be consistent with predictions. Limit intervals for EFT dimension-8 operators are derived and presented.
PBFA Z: A 20-MA z-pinch driver for plasma radiation sources
International Nuclear Information System (INIS)
Spielman, R.B.; Breeze, S.F.; Deeney, C.
1996-01-01
Sandia National Laboratories is completing a major modification to the PBFA-II facility. PBFA Z will be a z-pinch driver capable of delivering up to 20 MA to a z-pinch load. It optimizes the electrical coupling to the implosion energy of z pinches at implosion velocities of ∼ 40 cm/μs. Design constraints resulted in an accelerator with a 0.12-Ω impedance, a 10.25-nH inductance, and a 120-ns pulse width. The design required new water transmission lines, insulator stack, and vacuum power feeds. Current is delivered to the z-pinch load through four, self-magnetically-insulated vacuum transmission lines and a double post-hole convolute. A variety of design codes are used to model the power flow. These predict a peak current of 20 MA to a z-pinch load having a 2-cm length, a 2-cm radius, and a 15--mg mass, coupling 1.5 MJ into kinetic energy. We present 2-D Rad-Hydro calculations showing MJ x-ray outputs from tungsten wire-array z pinches
International Nuclear Information System (INIS)
Robinett, R.W.; Rosner, J.L.
1982-01-01
Models based on SO(10) are presented in which a second Z (''Z 2 '') can have a mass as low as 230 GeV/c 2 without appreciably distorting the lower-energy picture. In such models the lightest Z(''Z 1 '') is very close to the predicted mass in the standard picture, 1 greater than or equal to M(Z 1 )/M(Z 0 ) greater than or equal to 0.98. The major constraint preventing M(Z 2 ) from being even lower comes from experiments on parity violation in heavy atoms. Other properties of Z 2 , and ways to discover it, are discussed
Tests of QCD in W and Z production at Tevatron
International Nuclear Information System (INIS)
Abachi, S.
1995-01-01
We present measurements of the production cross sections times leptonic branching fractions and the transverse momentum distributions of W and Z bosons in p bar p collisions at √s = 1.8 TeV using data collected with the DO detector at the Fermilab Tevatron p bar p collider. A preliminary measurement of the W charge asymmetry is also presented
Mass-Radius Relations of Z and Higgs-Like Bosons
Directory of Open Access Journals (Sweden)
Lehnert B.
2014-01-01
Full Text Available Relations between the rest mass and the effective radius are deduced for the Z boson and the experimentally discovered Higgs-like boson, in terms of a revised quantum electrodynamic (RQED theory. The latter forms an alternative to the Standard Model of elementary particles. This results in an effective radius of the order of 10 E-18 m for a rest mass of 125 GeV.
Czech Academy of Sciences Publication Activity Database
Kolínská, Jiřina; Zákostelecká, Marie; Lisá, Věra; Kozáková, Hana; Dvorak, B.
2008-01-01
Roč. 64, č. 4 (2008), s. 338-338 ISSN 1138-7548. [Meeting European Intestinal Transport Group /22./. 07.09.2008-10.09.2008, Pamplona] R&D Projects: GA MŠk(CZ) 1P05ME783 Grant - others:NIH(US) HD-47237 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * cytokine IL-18 * probiotic Subject RIV: CE - Biochemistry
International Nuclear Information System (INIS)
Leznov, A.N.; Smirnov, V.G.
1981-01-01
In the terms of the notions of the theory of infinite-dimensional algebras of finite growth of the second rank, we have derived solutions to the equations Ysub(z)sub(z) = exp(2Y) - exp(-2Y); Ysub(z)sub(z) = 2 exp(Y) - exp(-2Y) dependent on two arbitrary functions. (orig.)
Constraints on z~10 Galaxies from the Deepest Hubble Space Telescope NICMOS Fields
Bouwens, R. J.; Illingworth, G. D.; Thompson, R. I.; Franx, M.
2005-05-01
We use all available fields with deep NICMOS imaging to search for J110-dropouts (H160,AB1.8. Eleven such sources were found in all search fields using this criterion. Eight of these are clearly ruled out as credible z~10 sources, either as a result of detections (>2 σ) blueward of J110 or their colors redward of the break (H160-K~1.5) (redder than >~98% of lower redshift dropouts). The nature of the three remaining sources could not be determined from the data. This number appears consistent with the expected contamination from low-redshift interlopers. Analysis of the stacked images for the three candidates also suggests some contamination. Regardless of their true redshifts, the actual number of z~10 sources must be three or fewer. To assess the significance of these results, two lower redshift samples (a z~3.8 B-dropout and z~6 i-dropout sample) were projected to z~7-13 using a (1+z)-1 size scaling (for fixed luminosity). They were added to the image frames and the selection was repeated, giving 15.6 and 4.8 J110-dropouts, respectively. This suggests that to the limit of this probe (~0.3L*z=3), there has been evolution from z~3.8 and possibly from z~6. This is consistent with the strong evolution already noted at z~6 and z~7.5 relative to z~3-4. Even assuming that three sources from this probe are at z~10, the rest-frame continuum UV (~1500 Å) luminosity density at z~10 (integrated down to 0.3L*z=3) is just 0.19+0.13-0.09 times that at z~3.8 (or 0.19+0.15-0.10 times, including the small effect from cosmic variance). However, if none of our sources are at z~10, this ratio has a 1 σ upper limit of 0.07. Based on observations made with the NASA/ESA Hubble Space Telescope, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555.
Energy Technology Data Exchange (ETDEWEB)
Ryu, Jeong Ho; Won, Hyong Sik; Park, Youn-Gon; Kim, Sang Hyun; Song, Won Young; Suzuki, Hideo; Yoon, Chulsoo [Samsung Electro-Mechanics Co., LTD, Corporate R and D Institute, Suwon, Gyunggi-Do (Korea)
2009-06-15
Rare-earth-doped oxynitride or nitride compounds have been reported to be photoluminescent and may then serve as new phosphors because of their good thermal and chemical stabilities. In this work, Eu{sup 2+}-doped {beta}-SiAlON phosphor with a composition of Eu{sub x}Si{sub 6-z}Al{sub z}O{sub z}N{sub 8-z} (x=0.018,z=0.23) was prepared by gas-pressured solid state reaction. The crystallinity and particle morphology of the prepared phosphor were characterized. The Stokes shift and zero-phonon line were calculated mathematically and estimated from the spectral data. The temperature dependence of photoluminescence was measured from 25 to 250 C. The prepared Eu{sup 2+}-doped {beta}-SiAlON green phosphor showed superior thermal quenching property compared to silicate (SrBaSiO{sub 4}:Eu{sup 2+}) green phosphor. The white light-emitting diode (LED) back-lighting unit (BLU) using the prepared {beta}-SiAlON:Eu{sup 2+} green phosphor exhibited higher color gamut than a commercial silicate phosphor. (orig.)
Search for t Z' associated production induced by t c Z' couplings at the LHC
Hou, Wei-Shu; Kohda, Masaya; Modak, Tanmoy
2017-07-01
The P5' and RK anomalies, recently observed by the LHCb Collaboration in B →K(*) transitions, may indicate the existence of a new Z' boson, which may arise from gauged Lμ-Lτ symmetry. Flavor-changing neutral current Z' couplings, such as t c Z', can be induced by the presence of extra vector-like quarks. In this paper we study the LHC signatures of the induced right-handed t c Z' coupling that is inspired by, but not directly linked to, the B →K(*) anomalies. The specific processes studied are c g →t Z' and its conjugate process, each followed by Z'→μ+μ-. By constructing an effective theory for the t c Z' coupling, we first explore in a model-independent way the discovery potential of such a Z' at the 14 TeV LHC with 300 and 3000 fb-1 integrated luminosities. We then reinterpret the model-independent results within the gauged Lμ-Lτ model. In connection with t c Z', the model also implies the existence of a flavor-conserving c c Z' coupling, which can drive the c c ¯→Z'→μ+μ- process. Our study shows that existing LHC results for dimuon resonance searches already constrain the c c Z' coupling, and that the Z' can be discovered in either or both of the c g →t Z' and c c ¯→Z' processes. We further discuss the sensitivity to the left-handed t c Z' coupling and find that the coupling values favored by the B →K(*) anomalies lie slightly below the LHC discovery reach even with 3000 fb-1 .
Forward-Backward Charge Asymmetry of Electron Pairs Above the Z0 Pole at CDF
CDF Collaboration
1996-05-01
We present a measurement of the forward-backward charge asymmetry of the process pbar p arrow Z0 / γ+X, Z0 / γ arrow e+e- at Q2 > MZ2, using pbar p collisions at √s = 1.8 TeV. The results are from 110 pb-1 of data collected at the Collider Detector at Fermilab during the 1992-1993 and 1994-1995 runs of the Fermilab Tevatron. We measure the asymmetry in a region above the Z0 pole for which Mee > 105 GeV/c2 and in a region near the Z0 pole for which 75 GeV/c2 Fisica Nucleare; the Ministry of Education, Science and Culture of Japan; the Natural Sciences and Engineering Research Council of Canada; the National Science Council of the Republic of China; and the A. P. Sloan Foundation. Supported by U.S. NSF PHY-9406402.
International Nuclear Information System (INIS)
Cook, D.
1998-06-01
In the past thirty-six months, great progress has been made in x-ray production using high-current z-pinches. Today, the x-ray energy and power output of the Z accelerator (formerly PBFA-II) is the largest available in the laboratory. These z-pinch x-ray sources have the potential to drive high-yield ICF reactions at affordable cost if several challenging technical problems can be overcome. In this paper, the recent technical progress with Z-pinches will be described, and a technical strategy for achieving high-yield ICF with z-pinches will be presented
The achievements of the Z-machine; Les exploits de la Z-machine
Energy Technology Data Exchange (ETDEWEB)
Larousserie, D
2008-03-15
The ZR-machine that represents the latest generation of Z-pinch machines has recently begun preliminary testing before its full commissioning in Albuquerque (Usa). During its test the machine has well operated with electrical currents whose intensities of 26 million Ampere are already 2 times as high as the intensity of the operating current of the previous Z-machine. In 2006 the Z-machine reached temperatures of 2 billions Kelvin while 100 million Kelvin would be sufficient to ignite thermonuclear fusion. In fact the concept of Z-pinch machines was imagined in the fifties but the technological breakthrough that has allowed this recent success and the reborn of Z-machine, was the replacement of gas by an array of metal wires through which the electrical current flows and vaporizes it creating an imploding plasma. It is not well understood why Z-pinch machines generate far more radiation than theoretically expected. (A.C.)
18th informal meeting on reactor noise
International Nuclear Information System (INIS)
Dach, K.
1986-01-01
The proceedings contain the texts of 24 papers all of which fall under the INIS Subject Scope. The main purpose of the meeting of more than 90 scientists and specialists from 18 countries was for them to get acquainted with the current state and prospective development of noise diagnostics application in nuclear reactor operation. (Z.M.)
Predictions of the residue cross-sections for the elements Z=113 and Z=114
Bouriquet, Bertrand; Abe, Yasuhisa; Kosenko, Grigori
2003-01-01
An extremely good reproduction of experimental excitation function of the 1n reactions producing Z=110,Z=111 and Z=112 is obtained by the two-step model and the statistical decay code KEWPIE. Thus, an extension of the recipe permits us to predict reliable values of the residue cross-sections of the elements Z=113 and Z=114 which will be a useful guide for planning of experiments.
Tests of QCD in W and Z production at Tevatron
International Nuclear Information System (INIS)
Alitti, J.; Chevalier, L.; Ducros, Y.; Lebrat, J.F.; Mangeot, P.
1995-01-01
We present measurements of the production cross sections times leptonic branching fractions and the transverse momentum distributions of W and Z bosons in pp-bar collisions at √ s = 1.8 TeV using data collected with the DΦ detector at the Fermilab Tevatron pp-bar collider. A preliminary measurement of the W charge asymmetry is also presented. (authors). 27 refs., 9 figs., 3 tabs
Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; van Dalen, J A; De Asmundis, R; Déglon, P L; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, F; Fisher, P H; Fisher, W; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Hu, Y; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kräber, M H; Krämer, R W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma Wen Gan; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R A; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Shchegelskii, V; Schopper, Herwig Franz; Schotanus, D J; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, Ludwig; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R; Veszpremi, V; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, Q; Wang, X L; Wang, Z M; Weber, M; Wienemann, P; Wilkens, H; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M
2004-01-01
Events from the e+e- -> Zgamma process with hard initial state radiation collected with the L3 detector at centre-of-mass energies between 183 GeV and 209 GeV are used to measure the mass of the Z boson. Decays of the Z boson into hadrons or muon pairs are considered and the Z mass is determined to be 91.272 +- 0.032 (stat.) +- 0.033 (syst.) GeV, in agreement with the value measured at the Z resonance. Alternatively, assuming this measured value of the Z mass, the method determines the LEP beam energy, found to be 87 +- 34 (stat.) \\pm 34 (syst.) MeV lower than the nominal value.
Monitoring plan for borehole logging at 216-Z-1A Tile Field, 216-Z-9 Trench, and 216-Z-12 Crib
International Nuclear Information System (INIS)
Horton, D.G.
1998-04-01
This plan describes the fiscal year 1998 vadose monitoring of three inactive, liquid waste disposal facilities associated with the Plutonium Finishing Plant (Z-Plant): the 216-Z-1A Tile Field, the 216-Z-9 Trench, and the 216-Z-12 Crib. Monitoring will consist of spectral gamma ray logging of 21 boreholes. This plan describes the physical characteristics of the facilities, their operational histories, the subsurface geology and known contamination distribution at each facility. The plan then describes the specific monitoring to be done including the boreholes to be logged, the methods of data acquisition, data reduction, and data evaluation, and finally, the quality control, data management and data reporting for this effort. The three liquid waste disposal facilities at the Z Plant were chosen to be monitored because they were identified as containing some of the most significant sources of radioactive contamination in the Hanford vadose zone. Johnson's analysis was based on the relative hazard obtained by combining curie quantities disposed to the facilities with appropriate health risk standards. The basic question to be addressed by this logging activity addresses the configuration of subsurface contamination since it was last measured. Historical data from the 216-Z-1A Tile Field, the 216-Z-9 Trench, and the 216-Z-12 Crib form the baseline for comparisons to answer this question
Refinement in Z and Object-Z foundations and advanced applications
Derrick, John
2013-01-01
Refinement is one of the cornerstones of the formal approach to software engineering, and its use in various domains has led to research on new applications and generalisation. This book brings together this important research in one volume, with the addition of examples drawn from different application areas. It covers four main themes:Data refinement and its application to ZGeneralisations of refinement that change the interface and atomicity of operationsRefinement in Object-ZModelling state and behaviour by combining Object-Z with CSPRefinement in Z and Object-Z: Foundations and Advanced A
PBFA Z: A 20-MA Z-pinch driver for plasma radiation sources
International Nuclear Information System (INIS)
Spielman, R.B.; Breeze, S.F.; Deeney, C.
1996-01-01
Sandia National Laboratories is completing a major modification to the PBFA-II facility. PBFA Z will be capable of delivering up to 20 MA to a z-pinch load. It optimizes the electrical coupling to the implosion energy of z pinches at implosion velocities of ∼ 40 cm/μs. Design constraints resulted in an accelerator with a 0.12-Ω impedance, a 10.25-nH inductance, and a 120-ns pulse width. The design required new water transmission lines, insulator stack, and vacuum power feeds. Current is delivered to the z-pinch load through four self-magnetically-insulated vacuum transmission lines and a double post-hole convolute. A variety of design codes are used to model the power flow. These predict a peak current of 20 MA to a z-pinch load having a 2-cm length, a 2-cm radius, and a 15-mg mass, coupling 1.5 MJ into kinetic energy. Calculations are presented showing MJ x-ray outputs from tungsten wire-array z pinches. (author). 4 figs., 14 refs
PBFA Z: A 20-MA Z-pinch driver for plasma radiation sources
Energy Technology Data Exchange (ETDEWEB)
Spielman, R B; Breeze, S F; Deeney, C [Sandia Labs., Albuquerque, NM (United States); and others
1997-12-31
Sandia National Laboratories is completing a major modification to the PBFA-II facility. PBFA Z will be capable of delivering up to 20 MA to a z-pinch load. It optimizes the electrical coupling to the implosion energy of z pinches at implosion velocities of {approx} 40 cm/{mu}s. Design constraints resulted in an accelerator with a 0.12-{Omega} impedance, a 10.25-nH inductance, and a 120-ns pulse width. The design required new water transmission lines, insulator stack, and vacuum power feeds. Current is delivered to the z-pinch load through four self-magnetically-insulated vacuum transmission lines and a double post-hole convolute. A variety of design codes are used to model the power flow. These predict a peak current of 20 MA to a z-pinch load having a 2-cm length, a 2-cm radius, and a 15-mg mass, coupling 1.5 MJ into kinetic energy. Calculations are presented showing MJ x-ray outputs from tungsten wire-array z pinches. (author). 4 figs., 14 refs.
Asymptotic behavior of discrete holomorphic maps z^c, log(z) and discrete Painleve transcedents
Agafonov, S. I.
2005-01-01
It is shown that discrete analogs of z^c and log(z) have the same asymptotic behavior as their smooth counterparts. These discrete maps are described in terms of special solutions of discrete Painleve-II equations, asymptotics of these solutions providing the behaviour of discrete z^c and log(z) at infinity.
TRACING THE STAR-FORMATION-DENSITY RELATION TO z {approx} 2
Energy Technology Data Exchange (ETDEWEB)
Quadri, Ryan F.; Williams, Rik J. [Carnegie Observatories, Pasadena, CA 91101 (United States); Franx, Marijn; Hildebrandt, Hendrik, E-mail: quadri@obs.carnegiescience.edu [Leiden Observatory, Leiden University, NL-2300 RA Leiden (Netherlands)
2012-01-10
Recent work has shown that the star formation (SF) density relation-in which galaxies with low SF rates are preferentially found in dense environments-is still in place at z {approx} 1, but the situation becomes less clear at higher redshifts. We use mass-selected samples drawn from the UKIDSS Ultra-Deep Survey to show that galaxies with quenched SF tend to reside in dense environments out to at least z {approx} 1.8. Over most of this redshift range we are able to demonstrate that this SF-density relation holds even at fixed stellar mass. The environmental quenching of SF appears to operate with similar efficiency on all galaxies regardless of stellar mass. Nevertheless, the environment plays a greater role in the buildup of the red sequence at lower masses, whereas other quenching processes dominate at higher masses. In addition to a statistical analysis of environmental densities, we investigate a cluster at z = 1.6, and show that the central region has an elevated fraction of quiescent objects relative to the field. Although the uncertainties are large, the environmental quenching efficiency in this cluster is consistent with that of galaxy groups and clusters at z {approx} 0. In this work we rely on photometric redshifts and describe some of the pitfalls that large redshift errors can present.
Energy Technology Data Exchange (ETDEWEB)
Nurse, Emily L. [Univ. of Manchester (United Kingdom)
2005-01-01
A measurement of the inclusive Z/γ* → μ+ μ- cross section for Mμμ > 40 GeV at √s = 1.96 TeV is presented. The measurement is performed using a data sample corresponding to an integrated luminosity of 147.7 pb-1, collected with the D0 detector at the Tevatron, Fermilab, between September 2002 and October 2003. A total of 14352 di-muon events are selected and a final result of σ(Z/γ*) = 327.8 ± 3.4(stat.) ± 8.4(syst.) ± 21.3(lumi.) pb is obtained. Correcting the number of di-muon events by a factor of 0.885 ± 0.015 for the contribution from pure γ* exchange and Z/γ* interference, the inclusive Z → μ+ μ- cross section is found to be: σ(Z) = 290.1 ± 3.0(stat.) ± 7.4(syst.) ± 18.9(lumi.) pb. Finally, comparisons of W and Z boson pT distributions as measured with D0 during Run I of the Tevatron are compared to HERWIG and MC@NLO predictions. Relevant parameters in the simulations are tuned to obtain the best possible fit to the data. An excellent agreement is found for both HERWIG and MC@NLO.
Z2×Z2 generalizations of 𝒩 =2 super Schrödinger algebras and their representations
Aizawa, N.; Segar, J.
2017-11-01
We generalize the real and chiral N =2 super Schrödinger algebras to Z2×Z2-graded Lie superalgebras. This is done by D-module presentation, and as a consequence, the D-module presentations of Z2×Z2-graded superalgebras are identical to the ones of super Schrödinger algebras. We then generalize the calculus over the Grassmann number to Z2×Z2 setting. Using it and the standard technique of Lie theory, we obtain a vector field realization of Z2×Z2-graded superalgebras. A vector field realization of the Z2×Z2 generalization of N =1 super Schrödinger algebra is also presented.
Performance analyses of Z-source and quasi Z-source inverter for photovoltaic applications
Himabind, S.; Priya, T. Hari; Manjeera, Ch.
2018-04-01
This paper presents the comparative analysis of Z-source and Quasi Z-source converter for renewable energy applications. Due to the dependency of renewable energy sources on external weather conditions the output voltage, current changes accordingly which effects the performance of traditional voltage source and current source inverters connected across it. To overcome the drawbacks of VSI and CSI, Z-source and Quasi Z-source inverter (QZSI) are used, which can perform multiple tasks like ac-to-dc, dc-to-ac, ac-to-ac, dc-to-dc conversion. They can be used for both buck and boost operations, by utilizing the shoot-through zero state. The QZSI is derived from the ZSI topology, with a slight change in the impedance network and it overcomes the drawbacks of ZSI. The QZSI draws a constant current from the source when compared to ZSI. A comparative analysis is performed between Z-source and Quasi Z-source inverter, simulation is performed in MATLAB/Simulink environment.
Abrao, Emiliana Pereira; da Fonseca, Benedito Antônio Lopes
2016-02-01
Dengue is one of the most important diseases caused by arboviruses in the world. Yellow fever is another arthropod-borne disease of great importance to public health that is endemic to tropical regions of Africa and the Americas. Both yellow fever and dengue viruses are flaviviruses transmitted by Aedes aegypti mosquitoes, and then, it is reasonable to consider that in a given moment, mosquito cells could be coinfected by both viruses. Therefore, we decided to evaluate if sequential infections of dengue and yellow fever viruses (and vice-versa) in mosquito cells could affect the virus replication patterns. Using immunofluorescence and real-time PCR-based replication assays in Aedes albopictus C6/36 cells with single or sequential infections with both viruses, we demonstrated the occurrence of viral interference, also called superinfection exclusion, between these two viruses. Our results show that this interference pattern is particularly evident when cells were first infected with dengue virus and subsequently with yellow fever virus (YFV). Reduction in dengue virus replication, although to a lower extent, was also observed when C6/36 cells were initially infected with YFV followed by dengue virus infection. Although the importance that these findings have on nature is unknown, this study provides evidence, at the cellular level, of the occurrence of replication interference between dengue and yellow fever viruses and raises the question if superinfection exclusion could be a possible explanation, at least partially, for the reported lack of urban yellow fever occurrence in regions where a high level of dengue transmission occurs.
Czech Academy of Sciences Publication Activity Database
Řeháková, Klára; Zapomělová, Eliška; Prášil, Ondřej; Veselá, J.; Medová, Hana; Oren, A.
2009-01-01
Roč. 636, č. 1 (2009), s. 77-88 ISSN 0018-8158 R&D Projects: GA ČR GA206/06/0462; GA AV ČR KJB600960703; GA AV ČR 1QS600170504; GA AV ČR 1QS500200570 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z60170517; CEZ:AV0Z50200510 Keywords : phototrophic microbial community * salterns * species composition Subject RIV: EF - Botanics Impact factor: 1.754, year: 2009
Directory of Open Access Journals (Sweden)
Young Joo Jeon
Full Text Available OBJECTIVE: Recent non-invasive prenatal testing (NIPT technologies are based on next-generation sequencing (NGS. NGS allows rapid and effective clinical diagnoses to be determined with two common sequencing systems: Illumina and Ion Torrent platforms. The majority of NIPT technology is associated with Illumina platform. We investigated whether fetal trisomy 18 and 21 were sensitively and specifically detectable by semiconductor sequencer: Ion Proton. METHODS: From March 2012 to October 2013, we enrolled 155 pregnant women with fetuses who were diagnosed as high risk of fetal defects at Xiamen Maternal & Child Health Care Hospital (Xiamen, Fujian, China. Adapter-ligated DNA libraries were analyzed by the Ion Proton™ System (Life Technologies, Grand Island, NY, USA with an average 0.3× sequencing coverage per nucleotide. Average total raw reads per sample was 6.5 million and mean rate of uniquely mapped reads was 59.0%. The results of this study were derived from BWA mapping. Z-score was used for fetal trisomy 18 and 21 detection. RESULTS: Interactive dot diagrams showed the minimal z-score values to discriminate negative versus positive cases of fetal trisomy 18 and 21. For fetal trisomy 18, the minimal z-score value of 2.459 showed 100% positive predictive and negative predictive values. The minimal z-score of 2.566 was used to classify negative versus positive cases of fetal trisomy 21. CONCLUSION: These results provide the evidence that fetal trisomy 18 and 21 detection can be performed with semiconductor sequencer. Our data also suggest that a prospective study should be performed with a larger cohort of clinically diverse obstetrics patients.
Extraction of Z' coupling data from Z' → jj at the LHC and SSC
International Nuclear Information System (INIS)
Rizzo, T.G.
1993-06-01
A recent analysis has shown that it may be possible at the SSC to extract information about Z' couplings via the decay Z' → jj. This technique was found to be useful for some extended electroweak models provided the Z' is relatively light. In the present paper, the authors generalize this procedure to the LHC and to Z''s which are more massive than 1 TeV
Transformace průtoků v závislosti na geologii povodí
Czech Academy of Sciences Publication Activity Database
Jelínková, Hana
2008-01-01
Roč. 51, 5-6 (2008), s. 18-21 ISSN 0322-886X R&D Projects: GA AV ČR(CZ) KJB300600602; GA MŽP(CZ) SP/1A6/151/07 Institutional research plan: CEZ:AV0Z20600510 Keywords : rainfall- runoff modeling * geology Subject RIV: DA - Hydrology ; Limnology
International Nuclear Information System (INIS)
Imabayashi, Etsuko
2003-01-01
Interictal 18 F-FDG PET is beneficial to patients with epilepsy to define the epileptic foci before operation, especially to decide the laterality of temporal lobe epilepsy (TLE). However usefulness has not been clearly established in extra TLE. We retrospectively applied Z-score analysis to interictal preoperative 18 F-FDG PET images for detection of the epileptic foci in order to achieve better performance. Seventeen epileptic patients (women/men; 8/9, age; 11-55 yrs) underwent resection of epileptic foci with good outcome (Engel's stage of I or II) even after more than a year from operation. Presurgical 18 F-FDG PET images were spatially normalized using statistical parametric mapping 99 (SPM99) with an original Japanese template for 18 F-FDG and compared with normal database constructed from 31 healthy volunteers (women/men; 14/17, age; 19-59 yrs). A software program, easy Z-score imaging system (eZIS), for analysis of patient data was developed by calculating Z-score in each voxel and visualizing the score in a standardized stereotactic space; Z-score=(normal mean-patient's value)/a standard deviation of normal data. Detectability of epileptic foci for this computer-aided analysis was compared with visual inspection of original 18 F-FDG PET images by five radiologists without any clinical information. In all cases, there was significant reduction of glucose metabolism in the operated area. The sensitivities of the detection of epileptic foci obtained from visual inspection were 47-59%. In contrast to, computer analysis by eZIS showed 71% sensitivity when we defined the highest Z-score in the cerebrum to be the focus diagnosed by eZIS. Computer-aided diagnosis with eZIS for 18 F-FDG PET study is useful for detecting epileptic foci in extra TLE. (author)
ZipA binds to FtsZ with high affinity and enhances the stability of FtsZ protofilaments.
Directory of Open Access Journals (Sweden)
Anuradha Kuchibhatla
Full Text Available A bacterial membrane protein ZipA that tethers FtsZ to the membrane is known to promote FtsZ assembly. In this study, the binding of ZipA to FtsZ was monitored using fluorescence spectroscopy. ZipA was found to bind to FtsZ with high affinities at three different (6.0, 6.8 and 8.0 pHs, albeit the binding affinity decreased with increasing pH. Further, thick bundles of FtsZ protofilaments were observed in the presence of ZipA under the pH conditions used in this study indicating that ZipA can promote FtsZ assembly and stabilize FtsZ polymers under unfavorable conditions. Bis-ANS, a hydrophobic probe, decreased the interaction of FtsZ and ZipA indicating that the interaction between FtsZ and ZipA is hydrophobic in nature. ZipA prevented the dilution induced disassembly of FtsZ polymers suggesting that it stabilizes FtsZ protofilaments. Fluorescein isothiocyanate-labeled ZipA was found to be uniformly distributed along the length of the FtsZ protofilaments indicating that ZipA stabilizes FtsZ protofilaments by cross-linking them.
Directory of Open Access Journals (Sweden)
Adem POLAT
2012-09-01
Full Text Available This article is a consideration of matter-soul conflict which has a close relationship with the thought dimension established upon historical, sociological and cultural ground in the novel of Yalnızız of Peyami Safa, who has a crucial place in the Turkish Novel in the Republic period. The conflict in question and the paradoxes ingrained in society, emerges besides moral corruption. More importantly, Yalnızız is a novel which has the motivation to produce remedial solutions within aplan like Simeranya. In this respect, an utopian fiction, Simeranyaphenomenon’s effect on the character Samim, displays the intellectualground upon which matter-soul conflict built. These grounds do notonly include the ideal of the world the artist yearns for, but also theydisclose the factual values that will be conveyed as a message throughthe confrontation of matter-soul in the center of the novel. Inconsequence, even though it is beyond reality like Simeranya, inYalnızız novel, the crucial parameters for Turkish thought areconsidered on the agenda by Peyami Safa, as a solution suggestion tothe enduringly growing phenomena and which are carried towardstoday since our Westernization history.In other words, Simeranya is a sheltering territory from theanxiety that are felt due the social and actual realm. If it must be told inthe words of the KORA thematic system, Simeranya, is the place whichgathers dialectical affirmation of the conflicting values in thephenomenal realm of the ideal values. This work aims to scrutinize theintellectual grounds that are describable through the theme of mattersoulconfrontation in question. Bu makale Cumhuriyet devri Türk romanında önemli bir yere sahip olan Peyami Safa’nın Yalnızız romanında yer alan tarihsel, sosyolojik ve kültürel zemine bağlı olarak ortaya çıkmış olan düşünce boyutuyla yakından ilişki kuran madde-ruh çatışmasının roman üzerindeki bir değerlendirmesidir. Söz konusu
Results from the calibration of Z chambers with cosmic muons
International Nuclear Information System (INIS)
Alcaraz, J.; Cerrada, M.; Gonzalez, E.
1992-01-01
We describe a cosmic ray calibration procedure applied to L3 Z muon chambers. The experimental set up, and the method of data analysis used, are presented. We show the results obtained with different gas mixtures. The effect of variations in the values of some parameters, like the discriminator thresholds or the sense wire high voltages, on the chamber resolution and on the track reconstruction efficiency, is also reported. (author) 18 fig. 8 ref
Utilizing Z-track Air Lock Technique to Reduce Pain in Intramuscular Injections
Directory of Open Access Journals (Sweden)
Evelyn Hemme Tambunan
2015-04-01
Full Text Available Introduction: Injection is one of most painful and common medical interventions that more than 12 billion of it are administered annually throughout the world. Pain remains as one of the unresolved health problems. The objective of this research was to investigate the pain severity utilizing the z-track air lock technique during intra muscular injection procedure. Method:This study was conducted as an unblinded cinical trial, where 90 female subjects aged between 18-25 years old were randomly assigned to three groups of 30. Each group received z-track air lock (Group ZTAL, air lock (AL, and z-track (Group ZT techniques. Neurobion 5000 vitamin used as an injection substance.A Verbal Rating Scale (VRS on 0–3 was used to evaluate the severity of pain during procedure. Data were analized using the SPSS version 19. Groups’ age, Body Mass Index (BMI and pain severity were analyzed through descriptive and One Way ANOVA statistics. Results: Results showed that there were no signifi cant differences of pain severity both within and between groups (p > 0.05. Discussion: Both Z-track and air lock method are less pain compared to traditional method according to previous studies. Noncicepti stimulus inhibited nocicepti stimulus in z-track technique while locking effect inhibit leakeage of substance injection to subcutaneous layer of skin which contain of nerve fi bers. However All techniques are recommended to produce less pain therefore it can be considered as a standard procedure for intra muscular injection. Keywords: intramuscular injection, z-track air lock technique, pain
Pursuing supersymmetry in Z0 decays
International Nuclear Information System (INIS)
Ellis, J.; Zwirner, F.
1990-01-01
We use recent LEP and SLC data on Z 0 decays and anti pp collider limits on W ± , Z 0 and gluino production to constrain the parameters of the chargino-neutralino sector in the minimal supersymmetric extension of the standard model. We show that unsuccessful chargino and gluino scarches, the anti pp collider ratio R=σ W e /σ Z e , and measurements of the total Z 0 width, peak hadronic cross section and invisible Z 0 with provide important constraints. The most stringent present bounds on invisible Z 0 decays assume the standard model for hadronic final states, and are therefore not directly applicable to supersymmetric models, which may have additional visible Z 0 decay modes. Possible signatures for supersymmetry in future Z 0 measurements include excesses in the total Z 0 width or in the invisible Z 0 width, but the most promising signal would be an observable cross section for 'zen' events, in which all the visible Z 0 decay products are in one hemisphere. (orig.)
International Nuclear Information System (INIS)
del Aguila, F.; Moreno, J.M.; Quiros, M.
1989-01-01
Since new Z bosons (Z') are predicted by many approaches to particle physics beyond the standard model, the absence of a signal in lepton pairs at hadron colliders implies important, but very model-dependent, lower limits on Z' masses. We present an analytical procedure for converting an experimental limit on σ(Z')B(Z'→l + l - ) into mass limits in a large set of models. Explicit results are given for present CERN and future Fermilab collider data. We include renormalization effects so that consideration can be restricted to grand-unification models
Galaxies at z~7-8: z850-Dropouts in the Hubble Ultra Deep Field
Bouwens, R. J.; Thompson, R. I.; Illingworth, G. D.; Franx, M.; van Dokkum, P. G.; Fan, X.; Dickinson, M. E.; Eisenstein, D. J.; Rieke, M. J.
2004-12-01
We have detected likely z~7-8 galaxies in the 144''×144'' Near-Infrared Camera and Multi-Object Spectrometer (NICMOS) observations of the Hubble Ultra Deep Field. Objects are required to be >=3 σ detections in both NICMOS bands, J110 and H160. The selection criteria for this sample are (z850-J110)AB>0.8, (z850-J110)AB>0.66(J110-H160)AB+0.8, (J110-H160)ABdropout galaxies and are clustered within a 1 arcmin2 region. Because all five sources are near the limit of the NICMOS data, we have carefully evaluated their reality. Each of the candidates is visible in different splits of the data and a median stack. We analyzed several noise images and estimate the number of spurious sources to be 1+/-1. A search using an independent reduction of this same data set clearly revealed three of the five candidates and weakly detected a fourth candidate, suggesting that the contamination could be higher. For comparison with predictions from lower redshift samples, we take a conservative approach and adopt four z~7-8 galaxies as our sample. With the same detection criteria on simulated data sets, assuming no evolution from z~3.8, we predict 10 sources at z~7-8, or 14 if we use a more realistic (1+z)-1 size scaling. We estimate that the rest-frame continuum UV (~1800 Å) luminosity density at z~7.5 (integrated down to 0.3L*z=3) is just 0.20+0.12-0.08 times that found at z~3.8 (or 0.20+0.23-0.12 times this quantity including cosmic variance). Effectively this sets an upper limit on the luminosity density down to 0.3L*z=3 and is consistent with significant evolution at the bright end of the luminosity function from z~7.5 to 3.8. Even with the lower UV luminosity density at z~7.5, it appears that galaxies could still play an important role in reionization at these redshifts, although definitive measurements remain to be made. Based on observations made with the NASA/ESA Hubble Space Telescope, which is operated by the Association of Universities for Research in Astronomy, Inc., under
Energy Technology Data Exchange (ETDEWEB)
Yousuf, Saleem, E-mail: nengroosaleem17@gmail.com; Gupta, Dinesh C., E-mail: sosfizix@gmail.com
2017-05-01
Systematic investigation of impact of electronic structure and magnetism, on the thermoelectric properties of new Zr{sub 2}NiZ (Z = Al, Ga) Heusler alloys are determined using density functional theory calculations. Half-metallicity with ferromagnetic character is supported by their 100% spin polarizations at the Fermi level. Magnetic moment of ∼3 μ{sub B} is according to the Slater-Puling rule, enables their practical applications. Electron density plots are used to analyse the nature of bonding and chemical composition. Boltzmann's theory is conveniently employed to investigate the thermoelectric properties of these compounds. The analysis of the thermal transport properties specifies the Seebeck coefficient as 25.6 μV/K and 18.6 μV/K at room temperature for Zr{sub 2}NiAl and Zr{sub 2}NiGa, respectively. The half-metallic nature with efficient thermoelectric coefficients suggests the likelihood of these materials to have application in designing spintronic devices and imminent thermoelectric materials. - Highlights: • The compounds are half-metallic ferromagnets. • 100% spin-polarized compounds for spintronics. • Increasing Seebeck coefficient over a wide temperature range. • Zr{sub 2}NiAl is efficient thermoelectric material than Zr{sub 2}NiGa.
Search for γ-Z-Z' electroweak interference at e+e- collider LEP2
International Nuclear Information System (INIS)
Pankov, A.A.
2000-01-01
Indirect effects of Z' bosons at the e + e - collider LEP2 in e + e - → μ + μ - through the new integrated observables σ ± were studied. It is shown that these observables provide more definite information on Z' effects with respect to canonical observables, σ μμ and A FB . It is found that the deviations Δσ ± induced by Z' bosons have the specific energy dependence mostly defined by the Standard Model parameters. It allows to provide the unambiguous model-independent predictions for the deviations. In particular, there were found two energies, √s + ≅ 78 GeV and √s - = 113 GeV, where σ + and σ - vanish both in the Standard Model and in case of Z'. These energies are quite convenient to search for phenomenological consequences of alternative new physics sources beyond the Z' [ru
Excitation Potentials and Shell Corrections for the Elements Z2=20 to Z2=30
DEFF Research Database (Denmark)
Andersen, H.H.; Sørensen, H.; Vadja, P.
1969-01-01
Excitation potentials and shell corrections for the elements Z 2=20 to Z2=30 are evaluated from experimental stopping-power data for 5-12-MeV protons and deuterons. Use is made of Walske's K- and L-shell corrections and shell corrections calculated by Bonderup (1967) on the basis of the Thomas-Fe...... are found by means of Bonderup's shell corrections. Within the Z2 interval treated here, it is found that I/Z2 increases with increasing Z2, contrary to the general trend through the periodic system of elements......Excitation potentials and shell corrections for the elements Z 2=20 to Z2=30 are evaluated from experimental stopping-power data for 5-12-MeV protons and deuterons. Use is made of Walske's K- and L-shell corrections and shell corrections calculated by Bonderup (1967) on the basis of the Thomas...
Santhosh, K. P.; Priyanka, B.; Nithya, C.
2016-11-01
Within the Coulomb and proximity potential model for deformed nuclei (CPPMDN), the alpha decay properties of 34 isotopes of the superheavy nuclei with Z = 128 within the range 306 ≤ A ≤ 339 have been studied, considering both the parent and daughter nuclei to be deformed. The manuscript also deals with the decay properties of the isotopes of Z = 126 (within 288 ≤ A ≤ 339), Z = 124 (within 284 ≤ A ≤ 339) and Z = 122 (within 280 ≤ A ≤ 339). The alpha decay half lives thus evaluated have been compared with the values evaluated using other theoretical models and it was seen that, our theoretical alpha decay half lives match well with these values. Through the present study, we have underlined and have established the fact that, among the 192 isotopes considered in the present study, only those isotopes 321-324,328-335128, 318-320,323-327126, 305-308,315-322124 and 298-307,311-314122 can be synthesised and detected through alpha decay in laboratory. As the alpha decay half lives of these superheavy isotopes lie within the experimental limits, we hope these predictions, on the decay modes of these unknown nuclei, to pave the way for the future experiments. The proton separation energy calculations on 306-339128, 288-336126, 284-339124 and 280-339122 superheavy nuclei have also been done and the study revealed the probable proton emitters among these nuclei.
Potential energy function of CN-
Czech Academy of Sciences Publication Activity Database
Špirko, Vladimír; Polák, Rudolf
2008-01-01
Roč. 248, č. 1 (2008), s. 77-80 ISSN 0022-2852 R&D Projects: GA MŠk LC512; GA AV ČR IAA400550511; GA AV ČR IAA400400504 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z40400503 Keywords : potential energy curve * fundamental transition * spectroscopic constants Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.636, year: 2008
Czech Academy of Sciences Publication Activity Database
Syka, Josef
2002-01-01
Roč. 82, - (2002), s. 601-636 ISSN 0031-9333 R&D Projects: GA MZd NK6454 Institutional research plan: CEZ:AV0Z5039906 Keywords : auditory system Subject RIV: FH - Neurology Impact factor: 26.533, year: 2002
Nigerian Journal of Physics - Vol 18, No 2 (2006)
African Journals Online (AJOL)
Bouguer correction density determination from fractal analysis using data from part of the Nigerian Basement Complex · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. K M Lawal, C Z Akaolisa, 251-254. http://dx.doi.org/10.4314/njphy.v18i2.38111 ...
Predictions on the modes of decay of odd Z superheavy isotopes within the range 105 ≤ Z ≤ 135
Santhosh, K. P.; Nithya, C.
2018-05-01
The decay modes of 1051 odd Z superheavy nuclei within the range 105 ≤ Z ≤ 135, and their daughter nuclei are studied by comparing the alpha decay half-lives with the spontaneous fission half-lives. The alpha decay half-lives are calculated using the Coulomb and proximity potential model for deformed nuclei (CPPMDN) proposed by Santhosh et al. (2011) and the spontaneous fission half-lives are obtained with the shell-effect dependent formula of Santhosh et al. (Santhosh and Nithya, 2016). For a theoretical comparison, the alpha decay half-lives are also computed with the Coulomb and proximity potential model (CPPM), Viola-Seaborg-Sobiczewski semi-empirical relation (VSS), Universal curve of Poenaru et al. (UNIV), the analytical formula of Royer, and the Universal decay law of Qi et al. (UDL). The predicted decay modes and half-lives were compared with the available experimental results. The proton and neutron separation energies are calculated to identify those nuclei, which decay through proton and neutron emission. From the entire study of odd Z superheavy elements, it is seen that among 1051 nuclei, 233 nuclei exhibit proton emission and 18 nuclei exhibit neutron emission. 56 nuclei are stable against alpha decay with negative Q value for the decay. 92 nuclei show alpha decay followed by spontaneous fission and 9 nuclei show alpha decay followed by proton emission. 39 nuclei decay through full alpha chain and 595 nuclei decay through spontaneous fission. We hope that the study will be very useful for the future experimental investigations in this field.
International Nuclear Information System (INIS)
Yan'kov, V.V.
1991-01-01
The development of Z-pinches, including plasma foci, micropinches and dense Z-pinches are reviewed. A special attention is paid to the physics of sausage instability development. Theoretical questions are discussed in more detail that the experimental ones, recent works - to a fuller extent than the fundamental pioneer ones which are included in the textbooks. The Soviet works are given a greater coverage as compared to the foreign ones. An emphasis is made on the problem of controlled thermonuclear fusion
International Nuclear Information System (INIS)
Boor, M.G.; Hurford, J.M.; Landry, R.P.; Martinez, B.J.; Solem, A.M.; Whiteson, R.; Zardecki, A.
1998-01-01
Los Alamos National Laboratory has developed E/Z MAS, a new generation nuclear material accountability application based on the latest technology and designed for facilities required to track nuclear materials with a simple-to-use interface. E/Z MAS is based on years of experience spent developing nuclear material accounting systems. E/Z MAS uses a modern relational database with a web server and enables users on a classified local area network to interact with the database with web browsers. The E/Z MAS Demonstration poster session demonstrates the E/Z MAS functions required by an operational nuclear facility to track material as it enters and leaves a facility and to account for the material as it moves through a process. The generation of internal facility reports and external reports for the Russian Federal system will be demonstrated. Bar-code readers will be used to demonstrate the ability of EZ MAS to automate certain functions, such as physical inventories at facilities
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science. Z G Ghevariya. Articles written in Journal of Earth System Science. Volume 110 Issue 2 June 2001 pp 111-132. Geochemistry and magnetostratigraphy of Deccan flows at Anjar, Kutch · A D Shukla N Bhandari Sheela Kusumgar P N Shukla Z G Ghevariya K Gopalan V ...
Ono, Yoshiaki; Ouchi, Masami; Mobasher, Bahram; Dickinson, Mark; Penner, Kyle; Shimasaku, Kazuhiro; Weiner, Benjamin J.; Kartaltepe, Jeyhan S.; Nakajima, Kimihiko; Nayyeri, Hooshang; Stern, Daniel; Kashikawa, Nobunari; Spinrad, Hyron
2012-01-01
We present the results of our ultra-deep Keck/DEIMOS spectroscopy of z-dropout galaxies in the Subaru Deep Field and Great Observatories Origins Deep Survey's northern field. For 3 out of 11 objects, we detect an emission line at ~1 μm with a signal-to-noise ratio of ~10. The lines show asymmetric profiles with high weighted skewness values, consistent with being Lyα, yielding redshifts of z = 7.213, 6.965, and 6.844. Specifically, we confirm the z = 7.213 object in two independent DEIMOS runs with different spectroscopic configurations. The z = 6.965 object is a known Lyα emitter, IOK-1, for which our improved spectrum at a higher resolution yields a robust skewness measurement. The three z-dropouts have Lyα fluxes of 3 × 10-17 erg s-1 cm-2 and rest-frame equivalent widths EWLyα 0 = 33-43 Å. Based on the largest spectroscopic sample of 43 z-dropouts, which is the combination of our and previous data, we find that the fraction of Lyα-emitting galaxies (EWLyα 0 > 25 Å) is low at z ~ 7; 17% ± 10% and 24% ± 12% for bright (M UV ~= -21) and faint (M UV ~= -19.5) galaxies, respectively. The fractions of Lyα-emitting galaxies drop from z ~ 6 to 7 and the amplitude of the drop is larger for faint galaxies than for bright galaxies. These two pieces of evidence would indicate that the neutral hydrogen fraction of the intergalactic medium increases from z ~ 6 to 7 and that the reionization proceeds from high- to low-density environments, as suggested by an inside-out reionization model. Based on data obtained with the Subaru Telescope and the W. M. Keck Observatory. The Subaru Telescope is operated by the National Astronomical Observatory of Japan. The W. M. Keck Observatory is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration.
International Nuclear Information System (INIS)
Ono, Yoshiaki; Shimasaku, Kazuhiro; Nakajima, Kimihiko; Ouchi, Masami; Mobasher, Bahram; Nayyeri, Hooshang; Dickinson, Mark; Kartaltepe, Jeyhan S.; Penner, Kyle; Weiner, Benjamin J.; Stern, Daniel; Kashikawa, Nobunari; Spinrad, Hyron
2012-01-01
We present the results of our ultra-deep Keck/DEIMOS spectroscopy of z-dropout galaxies in the Subaru Deep Field and Great Observatories Origins Deep Survey's northern field. For 3 out of 11 objects, we detect an emission line at ∼1 μm with a signal-to-noise ratio of ∼10. The lines show asymmetric profiles with high weighted skewness values, consistent with being Lyα, yielding redshifts of z = 7.213, 6.965, and 6.844. Specifically, we confirm the z = 7.213 object in two independent DEIMOS runs with different spectroscopic configurations. The z = 6.965 object is a known Lyα emitter, IOK-1, for which our improved spectrum at a higher resolution yields a robust skewness measurement. The three z-dropouts have Lyα fluxes of 3 × 10 –17 erg s –1 cm –2 and rest-frame equivalent widths EW Lyα 0 = 33-43 Å. Based on the largest spectroscopic sample of 43 z-dropouts, which is the combination of our and previous data, we find that the fraction of Lyα-emitting galaxies (EW Lyα 0 > 25 Å) is low at z ∼ 7; 17% ± 10% and 24% ± 12% for bright (M UV ≅ –21) and faint (M UV ≅ –19.5) galaxies, respectively. The fractions of Lyα-emitting galaxies drop from z ∼ 6 to 7 and the amplitude of the drop is larger for faint galaxies than for bright galaxies. These two pieces of evidence would indicate that the neutral hydrogen fraction of the intergalactic medium increases from z ∼ 6 to 7 and that the reionization proceeds from high- to low-density environments, as suggested by an inside-out reionization model.
Energy Technology Data Exchange (ETDEWEB)
Ono, Yoshiaki; Shimasaku, Kazuhiro; Nakajima, Kimihiko, E-mail: ono@astron.s.u-tokyo.ac.jp [Department of Astronomy, Graduate School of Science, University of Tokyo, Tokyo 113-0033 (Japan); Ouchi, Masami [Institute for Cosmic Ray Research, University of Tokyo, Kashiwa 277-8582 (Japan); Mobasher, Bahram; Nayyeri, Hooshang [Department of Physics and Astronomy, University of California, Riverside, CA 92521 (United States); Dickinson, Mark; Kartaltepe, Jeyhan S. [National Optical Astronomical Observatories, Tucson, AZ 85719 (United States); Penner, Kyle [Department of Astronomy, University of Arizona, Tucson, AZ 85721 (United States); Weiner, Benjamin J. [Steward Observatory, University of Arizona, Tucson, AZ 85721 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Kashikawa, Nobunari [Optical and Infrared Astronomy Division, National Astronomical Observatory of Japan, Tokyo 181-8588 (Japan); Spinrad, Hyron [Department of Astronomy, University of California, Berkeley, CA 94720 (United States)
2012-01-10
We present the results of our ultra-deep Keck/DEIMOS spectroscopy of z-dropout galaxies in the Subaru Deep Field and Great Observatories Origins Deep Survey's northern field. For 3 out of 11 objects, we detect an emission line at {approx}1 {mu}m with a signal-to-noise ratio of {approx}10. The lines show asymmetric profiles with high weighted skewness values, consistent with being Ly{alpha}, yielding redshifts of z = 7.213, 6.965, and 6.844. Specifically, we confirm the z = 7.213 object in two independent DEIMOS runs with different spectroscopic configurations. The z = 6.965 object is a known Ly{alpha} emitter, IOK-1, for which our improved spectrum at a higher resolution yields a robust skewness measurement. The three z-dropouts have Ly{alpha} fluxes of 3 Multiplication-Sign 10{sup -17} erg s{sup -1} cm{sup -2} and rest-frame equivalent widths EW{sup Ly{alpha}}{sub 0} = 33-43 A. Based on the largest spectroscopic sample of 43 z-dropouts, which is the combination of our and previous data, we find that the fraction of Ly{alpha}-emitting galaxies (EW{sup Ly{alpha}}{sub 0} > 25 A) is low at z {approx} 7; 17% {+-} 10% and 24% {+-} 12% for bright (M{sub UV} {approx_equal} -21) and faint (M{sub UV} {approx_equal} -19.5) galaxies, respectively. The fractions of Ly{alpha}-emitting galaxies drop from z {approx} 6 to 7 and the amplitude of the drop is larger for faint galaxies than for bright galaxies. These two pieces of evidence would indicate that the neutral hydrogen fraction of the intergalactic medium increases from z {approx} 6 to 7 and that the reionization proceeds from high- to low-density environments, as suggested by an inside-out reionization model.
Discovery of a Very Bright Strongly Lensed Galaxy Candidate at z ≈ 7.6
Bradley, L. D.; Bouwens, R. J.; Ford, H. C.; Illingworth, G. D.; Jee, M. J.; Benítez, N.; Broadhurst, T. J.; Franx, M.; Frye, B. L.; Infante, L.; Motta, V.; Rosati, P.; White, R. L.; Zheng, W.
2008-05-01
Using Hubble Space Telescope (HST) and Spitzer IRAC imaging, we report the discovery of a very bright strongly lensed Lyman break galaxy (LBG) candidate at z ~ 7.6 in the field of the massive galaxy cluster Abell 1689 (z = 0.18). The galaxy candidate, which we refer to as A1689-zD1, shows a strong z850 - J110 break of at least 2.2 mag and is completely undetected (= 25). A1689-zD1 has an observed (lensed) magnitude of 24.7 AB (8 σ) in the NICMOS H160 band and is ~1.3 mag brighter than the brightest known z850-dropout galaxy. When corrected for the cluster magnification of ~9.3 at z ~ 7.6, the candidate has an intrinsic magnitude of H160 = 27.1 AB, or about an L* galaxy at z ~ 7.6. The source-plane deprojection shows that the star formation is occurring in compact knots of size lesssim300 pc. The best-fit stellar population synthesis models yield a median redshift of 7.6, stellar masses (1.6-3.9) × 109 M⊙, stellar ages 45-320 Myr, star formation rates lesssim7.6 M⊙ yr-1, and low reddening with AV 7.0 galaxy candidate found to date. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy under NASA contract NAS5-26555. Based on observations made with the Spitzer Space Telescope, which is operated by the Jet Propulsion Laboratory, California Institute of Technology under NASA contract 1407.
International Nuclear Information System (INIS)
Yan'kov, V.V.
1991-01-01
Although pinches, unlike tokamaks, have not occupied a central position in fusion research, their structural simplicity and the wealth of physical processes associated with plasma foci have maintained a steady interest. The development of Z-pinches, including plasma foci, micropinches, and dense Z-pinches, is reviewed. Attention is focused on theoretical as opposed to experimental questions, and on recent work rather than the basic results now found in textbooks. Finally, Soviet work is discussed more fully than work done abroad, and applications to controlled fusion are emphasized
The zeros of az2J″ν(z+bzJ′ν(z+cJν(z as functions of order
Directory of Open Access Journals (Sweden)
A. McD. Mercer
1992-01-01
Full Text Available If j″νk denotes the kth positive zero of the Bessel function J″ν(x, it has been shown recently by Lorch and Szego [2] that j″ν1 increases with ν in ν>0 and that (with k fixed in 2,3,… j″νk increases in 00. The present paper, by using a different kind of analysis, re-obtains these conclusions as a special case of a more general result concerning the positive zeros of the function az2J″ν(z+bzJ′ν(z+cJν(z. Here, the constants a, b and c are subject to certain mild restrictions.
Ghosh, S; Majumder, P B; Sen Mandi, S
2011-02-08
The Zingiber genus, which includes the herbs known as gingers, commonly used in cooking, is well known for its medicinal properties, as described in the Indian pharmacopoeia. Different members of this genus, although somewhat similar in morphology, differ widely in their pharmacological and therapeutic properties. The most important species of this genus, with maximal therapeutic properties, is Zingiber officinale (garden ginger), which is often adulterated with other less-potent Zingiber sp. There is an existing demand in the herbal drug industry for an authentication system for the Zingiber sp in order to facilitate their commercial use as genuine phytoceuticals. To this end, we used amplified fragment length polymorphism (AFLP) to produce DNA fingerprints for three Zingiber species. Sixteen collections (six of Z. officinale, five of Z. montanum, and five of Z. zerumbet) were used in the study. Seven selective primer pairs were found to be useful for all the accessions. A total of 837 fragments were produced by these primer pairs. Species-specific markers were identified for all three Zingiber species (91 for Z. officinale, 82 for Z. montanum, and 55 for Z. zerumbet). The dendogram analysis generated from AFLP patterns showed that Z. montanum and Z. zerumbet are phylogenetically closer to each other than to Z. officinale. The AFLP fingerprints of the Zingiber species could be used to authenticate Zingiber sp-derived drugs and to resolve adulteration-related problems faced by the commercial users of these herbs.
Detection of a new Z' in the Z' → W+W- mode at the SSC
International Nuclear Information System (INIS)
Deshpande, N.G.; Gunion, J.F.; Zwirner, F.
1987-07-01
If a new Z' exists with mass in the TeV region, the decay rate for the mode Z' → W + W - is expected to be of the same order as the ones for Z' → e + e - or Z' → μ + μ - . This mode can be detectable at the SSC via the secondary decays WW → (jet jet)(l nu), (l = e,μ). We compare the expected signal with the backgrounds coming from continuum WW production and W jet jet production in the standard model. Using for this decay selection criteria analogous to the ones proposed for the corresponding decay of a heavy Higgs, we conclude that the signal/background ratio should be considerably larger in the Z' case. This is primarily because, for masses in the TeV range, the Z' width is very much smaller than the Higgs width
$\\Upsilon$ production in Z Decays
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Boucham, A; Bourilkov, D; Bourquin, Maurice; Boutigny, D; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chen, M; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dorne, I; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gerald, J; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Leggett, C; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sassowsky, M; Sauvage, G; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Schneegans, M; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Soulimov, V; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhou, Y; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1997-01-01
We have searched for evidence of Upsilon production in 3.5 million hadronic Z decays collected by the L3 detector at LEP in 1991-1995. No signals are observed for the decay chain Z -> Upsilon X; Upsilon -> l+l- (l= e, mu), therefore upper limits at the 95% confidence level are set on the following Z branching fractions: BR (Z -> Upsilon(1S) X) Upsilon(2S) X) Upsilon(3S) X) < 9.4 x 10**-5.
Czech Academy of Sciences Publication Activity Database
Peterka, Miroslav; Peterková, Renata; Likovský, Zbyněk
2007-01-01
Roč. 115, č. 12 (2007), s. 1801-1806 ISSN 0091-6765 Institutional research plan: CEZ:AV0Z50390512 Keywords : Atomic power station * Birth seasonality * Ecologic catastrophe Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.636, year: 2007
Sensitizing effect of Z,Z-bilirubin IXα and its photoproducts on enzymes in model solutions
Plavskii, V. Yu.; Mostovnikov, V. A.; Tret'yakova, A. I.; Mostovnikova, G. R.
2008-05-01
In model systems, we have studied side effects which may be induced by light during phototherapy of hyperbilirubinemia (jaundice) in newborn infants, with the aim of reducing the Z,Z-bilirubin IXα (Z,Z-BR IXα) level. We have shown that the sensitizing effect of Z,Z-BR IXα, localized at strong binding sites of the human serum albumin (HSA) macromolecule, is primarily directed at the amino acid residues of the carrier protein and does not involve the molecules of the enzyme (lactate dehydrogenase (LDH)) present in the buffer solution. The detected photodynamic damage to LDH is due to sensitization by bilirubin photoisomers, characterized by lower HSA association constants and located (in contrast to native Z,Z-BR IXα) on the surface of the HSA protein globule. Based on study of the spectral characteristics of the photoproducts of Z,Z-BR IXα and comparison of their accumulation kinetics in solution and the enzyme photo-inactivation kinetics, we concluded that the determining role in sensitized damage to LDH is played by lumirubin. The photosensitization effect depends on the wavelength of the radiation used for photoconversion of bilirubin. When (at the beginning of exposure) we make sure that identical numbers of photons are absorbed by the pigment in the different spectral ranges, the side effect is minimal for radiation corresponding to the long-wavelength edge of the bilirubin absorption band. We have shown that for a bilirubin/HSA concentration ratio >2 (when some of the pigment molecules are sorbed on the surface of the protein globule), the bilirubin can act as a photosensitizing agent for the enzyme present in solution. We discuss methods for reducing unfavorable side effects of light on the body of newborn infants during phototherapy of hyperbilirubinemia.
Speakers at the Symposium on the discovery of Neutral Currents and of the W and Z
Maximilien Brice
2003-01-01
Prof. Lev Okun, Dr John Mulvey, Dr Antoine Léveque, in front of the SMA18 hall accompanied by Dr Vinod Chohan on the occasion of the Symposium on the discovery of Neutral currents and of the W and Z, September 2003
Lee, SangEun
2014-01-01
A measurement is presented of the Z boson production differential cross section as a function of Z transverse momentum. The sample of proton-proton collisions collected by the CMS experiment at the LHC at $\\sqrt{s}$ = 8 TeV corresponds to an integrated luminosity of $18.4~\\pm 0.5$~\\pbinv. The Z bosons are identified via their decay to do-lepton pairs. The measured cross sections are well described by theoretical predictions.
The effect of prenatal maternal cigarette smoking on children's BMI z-score with SGA as a mediator.
Salahuddin, Meliha; Pérez, Adriana; Ranjit, Nalini; Hoelscher, Deanna M; Kelder, Steven H
2018-02-21
The goal of this study was to assess the effect of prenatal maternal cigarette smoking on children's BMI z-score trajectories, and to evaluate whether small-for-gestational-age (SGA) acts as a potential mediator between prenatal maternal cigarette smoking and child's BMI z-score at 4 years of age. Group-based trajectory modeling (GBTM) methods were employed to describe and classify developmental BMI z-score trajectories (the outcome of interest) in children from 9 months to 4 years of age (n = 5221) in the Early Childhood Longitudinal Study, Birth Cohort (ECLS-B) study (2001-2005). Further analysis examined whether the identified BMI z-score trajectories varied with the exposure, prenatal maternal cigarette smoking. Mediation analyses were utilized to examine whether being SGA (binary measure) acted as a potential mediator in the relationship between prenatal maternal cigarette smoking and BMI z-score among 4-year-old children. Using GBTM, two BMI z-score trajectory groups were identified: normal BMI z-score (57.8%); and high BMI z-score (42.2%). Children of mothers who smoked cigarettes during pregnancy were 2.1 times (RR 95% CI: 1.1-4.0, P value = 0.023) more at risk of being in the high BMI z-score trajectory group. Prenatal cigarette smoking was positively related to SGA at birth, but SGA was inversely related to BMI z-score at 4 years. The direct effect (0.19, 95% CI: 0.18, 0.19; P value BMI z-score among 4-year-old children was stronger and in the opposite direction of the indirect effect (-0.04, 95% CI: -0.04, -0.04; P value BMI z-score group, as well with SGA. The effects of prenatal smoking on BMI z-score at 4 years appears to act through pathways other than SGA.
Deep absorption line studies of quiescent galaxies at z similar z ~ 2
DEFF Research Database (Denmark)
Toft, Sune; Gallazzi, Anna Rita; Zirm, Andrew Wasmuth
2012-01-01
the majority of its stars at z > 3 and currently has little or no ongoing star formation. We compile a sample of three other z similar to 2 quiescent galaxies with measured velocity dispersions, two of which are also post-starburst like. Their dynamical-mass-size relation is offset significantly less than...... the stellar-mass-size relation from the local early-type relations, which we attribute to a lower central dark matter fraction. Recent cosmological merger simulations agree qualitatively with the data, but cannot fully account for the evolution in the dark matter fraction. The z similar to 2 FP requires......We present dynamical and structural scaling relations of quiescent galaxies at z = 2, including the dynamical-mass-size relation and the first constraints on the fundamental plane (FP). The backbone of the analysis is a new, very deep Very Large Telescope/X-shooter spectrum of a massive, compact...
RELICS: A Candidate Galaxy Arc at z~10 and Other Brightly Lensed z>6 Galaxies
Salmon, Brett; Coe, Dan; Bradley, Larry; Bradac, Marusa; Huang, Kuang-Han; Oesch, Pascal; Brammer, Gabriel; Stark, Daniel P.; Sharon, Keren; Trenti, Michele; Avila, Roberto J.; Ogaz, Sara; Acebron, Ana; Andrade-Santos, Felipe; Carrasco, Daniela; Cerny, Catherine; Cibirka, Nathália; Dawson, William; Frye, Brenda; Hoag, Austin; Jones, Christine; Mainali, Ramesh; Ouchi, Masami; Paterno-Mahler, Rachel; Rodney, Steven; Umetsu, Keiichi; Zitrin, Adi; RELICS
2018-01-01
Massive foreground galaxy clusters magnify and distort the light of objects behind them, permitting a view into both the extremely distant and intrinsically faint galaxy populations. We present here some of the most brightly lensed z>6 galaxy candidates known from the Reionization Lensing Cluster Survey (RELICS) and the discovery of a particularly fortuitous z~10 galaxy candidate which has been arced by the effects of strong gravitational lensing. The z~10 candidate has a lensed H-band magnitude of 25.8 AB mag and a high lensing magnification (~4-7). The inferred upper limits on the stellar mass (log [M_star /M_Sun]=9.5) and star formation rate (log [SFR/(M_Sun/yr)]=1.5) indicate that this candidate is a typical star-forming galaxy on the z>6 SFR-M_star relation. We rule out the only low-z solution as unphysical based on the required stellar mass, dust attenuation, size, and [OIII] EW needed for a z~2 SED to match the data. Finally, we reconstruct the source-plane image and estimate the candidate's physical size at z~10, finding a half-light radius of r_e 9 candidates. While the James Webb Space Telescope will detect z>10 with ease, this rare candidate offers the potential for unprecedented spatial resolution less than 500 Myr after the Big Bang.
International Nuclear Information System (INIS)
Lafer, E.M.; Moeller, A.; Valle, R.P.C.; Nordheim, V.A.; Rich, A.; Stollar, B.D.; Massachusetts Inst. of Tech., Cambridge)
1983-01-01
To measure serological reactions under physiological ionic strength, we prepared a brominated (Bl) poly(dG-dC).poly(dG-dC), which forms a stable Z helix in solutions of low salt concentration. Mice and rabbits were immunized with this polymer complexed with the basic protein methylated bovine serum albumin (MBSA), and it was discovered that the Z-DNA helix is a strong immunogen. Various antibody populations were purified from the rabbit serum by quantitative immunoprecipitation. Spleen cells from the mice were used for the preparation of hybridoma cell lines secreting monoclonal antibodies. Anti-Z-DNA antibodies were also raised by immunizing animals with poly(dG-dm 5 C).poly(dG-dm 5 C) under conditions where it was reported to be in the left-handed Z conformation as well as unmodified poly(dG-dC).poly(dG-dC) that was in the right-handed B conformation: both were complexed with MBSA. Z-DNA reactive antibodies were found in both murine and human SLE. A Z-DNA-specific as well as a dDNA and Z-DNA cross-reactive antibody population were distinguished by affinity chromatography of the SLE sera. The specificities of the various anti-Z-DNA antibody populations were measured by direct-binding and competitive radioimmunoassays, using synthetic polymers of defined structure under various ionic strengths. These studies allow us to map the possible antigenic sites for these antibodies, which serve as a model for DNA-protein recognition. The findings also established the usefulness of the antibodies as biochemical probes for Z-DNA. 29 references, 6 figures, 1 table
The effect of both Z and Z'-mediated flavor-changing neutral currents on Bs → μ+ μ- decay
International Nuclear Information System (INIS)
Sahoo, S.; Maharana, L.; Behera, B.R.
2007-01-01
We study the effect of both Z and Z'-mediated flavor-changing neutral currents (FCNCs) on the B s → μ + μ - rare decay process. Mixing between ordinary and exotic left-handed quarks induces Z-mediated FCNC whereas mixing of right-handed ordinary and exotic quarks induces Z'-mediated FCNC. We find the branching ratio is enhanced from its standard model (SM) value due to the effect of both Z and Z'-mediated FCNCs. (author)
OCA/OCP Oracle database 11g all-in-one exam guide exams 1Z0-051, 1Z0-052, 1Z0-053
Watson, John
2010-01-01
A Fully Integrated Study System for OCA Exams 1Z0-051 and 1Z0-052, and OCP Exam 1Z0-053 Prepare for the Oracle Certified Associate Administration I and SQL Fundamentals I exams and the Oracle Certified Professional Administration II exam with help from this exclusive Oracle Press guide. In each chapter, you'll find challenging exercises, practice questions, and a two-minute drill to highlight what you've learned. This authoritative guide will help you pass the test and serve as your essential on-the-job reference. Get complete coverage of all objectives for exams 1Z0-051, 1Z0-052, and 1Z0-053, including: Instance management Networking and storage Security SQL Oracle Recovery Manager and Oracle Flashback Oracle Automatic Storage Management Resource manager Oracle Scheduler Automatic workload repository Performance tuning And more On the CD-ROM: Three full practice exams Detailed answers and explanations Score report performance assessment tool Complete electronic book Three bonus exams available with free onli...
Directory of Open Access Journals (Sweden)
Senait Aknaw Debebe
2016-02-01
Full Text Available Objective: This phase-I imaging study examined the imaging characteristic of 3’-deoxy-3’-(18F-fluorothymidine (18F-FLT positron emission tomography (PET in patients with pancreatic cancer and comparisons were made with (18F-fluorodeoxyglucose (18F-FDG. The ultimate aim was to develop a molecular imaging tool that could better define the biologic characteristics of pancreas cancer, and to identify the patients who could potentially benefit from surgical resection who were deemed inoperable by conventional means of staging. Methods: Six patients with newly diagnosed pancreatic cancer underwent a combined FLT and FDG computed tomography (CT PET/CT imaging protocol. The FLT PET/CT scan was performed within 1 week of FDG PET/CT imaging. Tumor uptake of a tracer was determined and compared using various techniques; statistical thresholding (z score=2.5, and fixed standardized uptake value (SUV thresholds of 1.4 and 2.5, and applying a threshold of 40% of maximum SUV (SUVmax and mean SUV (SUVmean. The correlation of functional tumor volumes (FTV between 18F-FDG and 18F-FLT was assessed using linear regression analysis. Results: It was found that there is a correlation in FTV due to metabolic and proliferation activity when using a threshold of SUV 2.5 for FDG and 1.4 for FLT (r=0.698, p=ns, but a better correlation was obtained when using SUV of 2.5 for both tracers (r=0.698, p=ns. The z score thresholding (z=2.5 method showed lower correlation between the FTVs (r=0.698, p=ns of FDG and FLT PET. Conclusion: Different tumor segmentation techniques yielded varying degrees of correlation in FTV between FLT and FDGPET images. FLT imaging may have a different meaning in determining tumor biology and prognosis.
Toponium-Z0 interference and phenomenology of an extra Z0 in e+e- collisions
International Nuclear Information System (INIS)
Franzini, P.J.
1987-01-01
A qualitative discussion of toponium-Z 0 interference is followed by a brief discussion of heavy quark potentials and the spectrum of toponium states which results. The results of the toponium spectra and the mixing formalism are then used to find the cross sections and asymmetries for toponium near the Z. The phenomenology of two-Higgs models and the bounds imposed on them by their effects on neutral B meson mixing are discussed, followed by the effects an extra Higgs doublet may have on toponium-Z 0 interference. The topic then turns to phenomenology of an extra Z 0 in electron-positron collisions. Models under consideration are reviewed, and the existing limits on such models are considered. What can be learned by electron-positron annihilation measurements at the Z peak without polarized beams is discussed, as well as further restrictions that can be made with polarized beams. The potential for experiments in the energy region above the Z is discussed. 57 refs
Study of the di-nuclear system $^{A}$Rb + $^{209}$Bi (Z$_{1}$ + Z$_{2}$ = 120)
The exact location of the next spherical shell closures beyond Z = 82, N = 126 is still an open question. According to model predictions shell closures are expected at Z = 114 or 120 or 126 and N = 184. Also experimental data cannot yet give a definite answer. Known nuclei with Z = 114 are too neutron‐deficient with respect to the N = 184 shell and nuclei with Z = 120 and beyond are still unknown. An option for studying reactions of super-heavy systems at Z = 120 and neutron numbers up to 184 becomes possible with the use of $^{209}$Bi targets and neutron‐rich beams. By studying quasi-fission and fusion‐fission reactions, which have significantly larger production cross‐sections than the evaporation residues, a possible influence of shell closures at Z = 120, N = 184 can be explored. Well suitable for such studies will be neutron‐rich rubidium beams at energies of about 5 MeV/u delivered by the HIE‐ISOLDE facility.
International Nuclear Information System (INIS)
Hinnov, E.; Suckewer, S.; Bol, K.; Hawryluk, R.; Hosea, J.; Meservey, E.
1977-11-01
Low-Z impurities concentrations (oxygen and carbon) have been measured in different discharges in PLT. The contribution to Z/sub eff/, influx rates and radiation losses by oxygen and carbon were obtained. An inverse correlation was found between the low-Z impurity density (and also the edge ion temperature) and the high-Z impurity (tungsten) density. A one-dimensional computer transport model has been used to calculate the spatial profiles of different oxygen and carbon ionization states. This model predicts that fully stripped oxygen and carbon ions should exist near the plasma periphery
International Nuclear Information System (INIS)
Corcella, G.
2014-01-01
I study the phenomenology of new heavy neutral gauge bosons Z', predicted by Grand Unification Theories-driven U(1)' gauge groups and by the sequential standard model. BSM (Beyond Standard Model) decays into supersymmetric final states are accounted for, besides the SM (Standard Model) modes usually investigated. I give an estimate of the number of supersymmetric events in Z' decays possibly expected at LHC, as well as of the product of the Z' cross section times the branching fraction into electron and muon pairs. (author)
Directory of Open Access Journals (Sweden)
Sumaira Z. Aasi
2010-01-01
Full Text Available A Z-plasty is a critical and reliable technique that is useful for scar revisions and correction of free margin distortion. A Z-plasty can help lengthen a contracted scar, change the direction of a scar so that it is better aligned with the relaxed skin tension lines, or interrupt and break a scar for better camouflage. This article will review the technique of a basic Z-plasty as well as provide case examples of its use in free margin distortion and scar revision.
Energy Technology Data Exchange (ETDEWEB)
Quintero, E. [Centro de Estudios de Semiconductores, Departamento de Fisica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101 (Venezuela); Tovar, R. [Centro de Estudios de Semiconductores, Departamento de Fisica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101 (Venezuela); Quintero, M. [Centro de Estudios de Semiconductores, Departamento de Fisica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101 (Venezuela)]. E-mail: mquinter@ula.ve; Delgado, G.E. [Laboratorio de Cristalografia, Departamento de Quimica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101 (Venezuela); Morocoima, M. [Centro de Estudios de Semiconductores, Departamento de Fisica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101 (Venezuela); Caldera, D. [Centro de Estudios de Semiconductores, Departamento de Fisica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101 (Venezuela); Ruiz, J. [Centro de Estudios de Semiconductores, Departamento de Fisica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101 (Venezuela); Mora, A.E. [Laboratorio de Analisis Quimico y Estructural de Materiales, Departamento de Fisica, Universidad de Los Andes, Merida 5101 (Venezuela); Briceno, M. [Laboratorio de Analisis Quimico y Estructural de Materiales, Departamento de Fisica, Universidad de Los Andes, Merida 5101 (Venezuela); Fernandez, J.L. [Laboratorio de Analisis Quimico y Estructural de Materiales, Departamento de Fisica, Universidad de Los Andes, Merida 5101 (Venezuela)
2007-04-25
X-ray powder diffraction measurements and differential thermal analysis (DTA) were made on polycrystalline samples of the Cu{sub 2}Cd{sub 1-z}Mn {sub z}GeSe{sub 4} and Cu{sub 2}Cd{sub 1-z}Fe {sub z}GeSe{sub 4} alloy systems. The diffraction patterns were used to show the equilibrium conditions and to derive lattice parameter values. The effect of the annealing temperature and cooling rate to room temperature are discussed. For the Cu{sub 2}Cd{sub 1-z}Fe {sub z}GeSe{sub 4} system, only two single solid phase fields, the tetragonal stannite {alpha} and the wurtz-stannite {delta} structures were found to occur in the diagram. For the Cu{sub 2}Cd{sub 1-z}Mn {sub z}GeSe{sub 4} system, in addition to the tetragonal stannite {alpha} and the wurtz-stannite {delta} phases, MnSe was found to exist in the diagram. The DTA experiments showed that the cooling curves for both systems exhibited effects of undercooling.
Effects of long-term salinity on the growth of the halophyte Spartina ...
African Journals Online (AJOL)
use
2011-12-07
Dec 7, 2011 ... randomized design in a glass-covered greenhouse with natural temperature and light. The interior of the greenhouse ceiling was draped with 30% shade ... Scientific, Great Amwell, Herts, UK) in the growth chamber. Statistical ...
DEFF Research Database (Denmark)
Bjørner, Nikolaj; Dung, Phan Anh; Fleckenstein, Lars
2015-01-01
vZ is a part of the SMT solver Z3. It allows users to pose and solve optimization problems modulo theories. Many SMT applications use models to provide satisfying assignments, and a growing number of these build on top of Z3 to get optimal assignments with respect to objective functions. vZ provi...
Czech Academy of Sciences Publication Activity Database
Ležalová-Piálková, Radka
2011-01-01
Roč. 152, č. 2 (2011), s. 291-295 ISSN 0021-8375 Institutional research plan: CEZ:AV0Z60930519 Keywords : Black-headed Gull * genetic mating system * extra-pair paternity * intraspecific brood parasitism Subject RIV: EG - Zoology Impact factor: 1.636, year: 2011
International Nuclear Information System (INIS)
Abe, F.; Amidei, D.; Apollinari, G.; Atac, M.; Auchincloss, P.; Baden, A.R.; Bacchetta, N.; Bailey, M.W.; Bamberger, A.; de Barbaro, P.; Barnett, B.A.; Barbaro-Galtieri, A.; Barnes, V.E.; Baumann, T.; Bedeschi, F.; Behrends, S.; Belforte, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Bensinger, J.; Beretvas, A.; Berge, J.P.; Bertolucci, S.; Bhadra, S.; Binkley, M.; Bisello, D.; Blair, R.; Blocker, C.; Bodek, A.; Bolognesi, V.; Booth, A.W.; Boswell, C.; Brandenburg, G.; Brown, D.; Buckley-Geer, E.; Budd, H.S.; Busetto, G.; Byon-Wagner, A.; Byrum, K.L.; Campagnari, C.; Campbell, M.; Caner, A.; Carey, R.; Carithers, W.; Carlsmith, D.; Carroll, J.T.; Cashmore, R.; Castro, A.; Cervelli, F.; Chadwick, K.; Chiarelli, G.; Chinowsky, W.; Cihangir, S.; Clark, A.G.; Cobal, M.; Connor, D.; Contreras, M.; Cooper, J.; Cordelli, M.; Crane, D.; Curatolo, M.; Day, C.; DeJongh, F.; Dell'Agnello, S.; Dell'Orso, M.; Demortier, L.; Denby, B.; Derwent, P.F.; Devlin, T.; DiBitonto, D.; Dickson, M.; Drucker, R.B.; Einsweiler, K.; Elias, J.E.; Ely, R.; Eno, S.; Errede, S.; Esposito, B.; Etchegoyen, A.; Flaugher, B.; Foster, G.W.; Franklin, M.; Freeman, J.; Frisch, H.; Fuess, T.; Fukui, Y.; Garfinkel, A.F.; Gauthier, A.; Geer, S.; Gerdes, D.W.; Giannetti, P.; Giokaris, N.; Giromini, P.; Gladney, L.; Gold, M.; Goulianos, K.; Grassmann, H.; Grieco, G.M.; Grosso-Pilcher, C.; Haber, C.; Hahn, S.R.; Handler, R.; Hara, K.; Harral, B.; Harris, R.M.; Hauser, J.; Hawk, C.; Hessing, T.; Hollebeek, R.; Holloway, L.; Hu, P.; Hubbard, B.; Huffman, B.T.; Hughes, R.; Hurst, P.; Huth, J.; Hylen, J.; Incagli, M.; Ino, T.; Iso, H.; Jensen, H.; Jessop, C.P.; Johnson, R.P.; Joshi, U.; Kadel, R.W.; Kamon, T.; Kanda, S.; Kardelis, D.A.; Karliner, I.; Kearns, E.; Keeble, L.; Kephart, R.; Kesten, P.; Keup, R.M.; Keutelian, H.; Kim, D.; Kim, S.; Kim, Y.K.; Kirsch, L.; Kondo, K.; Konigsberg, J.; Kovacs, E.; Kuhlmann, S.E.; Kuns, E.; Laasanen, A.T.; Lamoureux, J.I.; Leone, S.; Lewis, J.
1992-01-01
An analysis of proton-antiproton collisions at √s =1.8 TeV recorded with the Collider Detector at Fermilab (CDF) yields σ(p bar p→WX)B(W→μν)=2.21±0.22 nb and σ(p bar p→ZX)B(Z →μ + μ -) =0.226±0.032 nb. The ratio is R μ =σ WB (W→μν)/σ ZB (Z→μ + μ - )=9.8±1.2. Combining with previous CDF electron results gives σ WB (W→lν)=2.20±0.20 nb, σ ZB (Z→l + l-)=0.214±0.023 nb, and R l =10.0±0.8. We extract the ratios of the coupling constants g μ /g e and g τ /g μ . Using standard model assumptions we deduce the inverse branching ratio B -1 (W→lν), the width Γ(W), and a decay-mode-independent lower bound on the top quark mass of 45 GeV/c 2 (95% C.L.)
Directory of Open Access Journals (Sweden)
Esther Leushuis
2016-12-01
Full Text Available Background: Standardization of the semen analysis may improve reproducibility. We assessed variability between laboratories in semen analyses and evaluated whether a transformation using Z scores and regression statistics was able to reduce this variability. Materials and Methods: We performed a retrospective cohort study. We calculated between-laboratory coefficients of variation (CVB for sperm concentration and for morphology. Subsequently, we standardized the semen analysis results by calculating laboratory specific Z scores, and by using regression. We used analysis of variance for four semen parameters to assess systematic differences between laboratories before and after the transformations, both in the circulation samples and in the samples obtained in the prospective cohort study in the Netherlands between January 2002 and February 2004. Results: The mean CVB was 7% for sperm concentration (range 3 to 13% and 32% for sperm morphology (range 18 to 51%. The differences between the laboratories were statistically significant for all semen parameters (all P<0.001. Standardization using Z scores did not reduce the differences in semen analysis results between the laboratories (all P<0.001. Conclusion: There exists large between-laboratory variability for sperm morphology and small, but statistically significant, between-laboratory variation for sperm concentration. Standardization using Z scores does not eliminate between-laboratory variability.
Predictions of the residue cross-sections for the elements Z=113 and Z=114
Energy Technology Data Exchange (ETDEWEB)
Bouriquet, B.; Abe, Y. [Kyoto University, Yukawa Institute for Theoretical Physics, Kyoto (Japan); Kosenko, G. [University of Omsk, Department of Physics, Omsk (Russian Federation)
2004-10-01
A good reproduction of experimental excitation functions is obtained for the 1nreactions producing the elements with Z=108, 110, 111 and 112 by the combined usage of the two-step model for fusion and the statistical decay code KEWPIE. Furthermore, the model provides reliable predictions of productions of the elements with Z=113 and Z=114 which will be a useful guide for plannings of experiments. (orig.)
Predictions of the residue cross-sections for the elements Z = 113 and Z = 114
Bouriquet, B.; Abe, Y.; Kosenko, G.
2004-10-01
A good reproduction of experimental excitation functions is obtained for the 1 n reactions producing the elements with Z = 108, 110, 111 and 112 by the combined usage of the two-step model for fusion and the statistical decay code KEWPIE. Furthermore, the model provides reliable predictions of productions of the elements with Z = 113 and Z = 114 which will be a useful guide for plannings of experiments.
Predictions of the residue cross-sections for the elements Z=113 and Z=114
International Nuclear Information System (INIS)
Bouriquet, B.; Abe, Y.; Kosenko, G.
2004-01-01
A good reproduction of experimental excitation functions is obtained for the 1nreactions producing the elements with Z=108, 110, 111 and 112 by the combined usage of the two-step model for fusion and the statistical decay code KEWPIE. Furthermore, the model provides reliable predictions of productions of the elements with Z=113 and Z=114 which will be a useful guide for plannings of experiments. (orig.)
Modelling $Z\\to\\tau\\tau$ processes in ATLAS with $\\tau$-embedded $Z\\to\\mu\\mu$ data
Aad, Georges; Abdallah, Jalal; Abdinov, Ovsat; Aben, Rosemarie; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abreu, Ricardo; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Affolder, Tony; Agatonovic-Jovin, Tatjana; Agricola, Johannes; Aguilar-Saavedra, Juan Antonio; Ahlen, Steven; Ahmadov, Faig; Aielli, Giulio; Akerstedt, Henrik; Åkesson, Torsten Paul Ake; Akimov, Andrei; Alberghi, Gian Luigi; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alexa, Calin; Alexander, Gideon; Alexopoulos, Theodoros; Alhroob, Muhammad; Alimonti, Gianluca; Alio, Lion; Alison, John; Alkire, Steven Patrick; Allbrooke, Benedict; Allport, Phillip; Aloisio, Alberto; Alonso, Alejandro; Alonso, Francisco; Alpigiani, Cristiano; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Άlvarez Piqueras, Damián; Alviggi, Mariagrazia; Amadio, Brian Thomas; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Amidei, Dante; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anders, John Kenneth; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Angelidakis, Stylianos; Angelozzi, Ivan; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Arabidze, Giorgi; Arai, Yasuo; Araque, Juan Pedro; Arce, Ayana; Arduh, Francisco Anuar; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arnold, Hannah; Arratia, Miguel; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ashkenazi, Adi; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Axen, Bradley; Ayoub, Mohamad Kassem; Azuelos, Georges; Baak, Max; Baas, Alessandra; Baca, Matthew John; Bacci, Cesare; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bain, Travis; Baines, John; Baker, Oliver Keith; Baldin, Evgenii; Balek, Petr; Balestri, Thomas; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Bannoura, Arwa A E; Bansil, Hardeep Singh; Barak, Liron; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnes, Sarah Louise; Barnett, Bruce; Barnett, Michael; Barnovska, Zuzana; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Basalaev, Artem; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batista, Santiago Juan; Batley, Richard; Battaglia, Marco; Bauce, Matteo; Bauer, Florian; Bawa, Harinder Singh; Beacham, James Baker; Beattie, Michael David; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Maurice; Becker, Sebastian; Beckingham, Matthew; Becot, Cyril; Beddall, Andrew; Beddall, Ayda; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Janna Katharina; Belanger-Champagne, Camille; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bender, Michael; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Bentvelsen, Stan; Beresford, Lydia; Beretta, Matteo; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Beringer, Jürg; Bernard, Clare; Bernard, Nathan Rogers; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertoli, Gabriele; Bertolucci, Federico; Bertsche, Carolyn; Bertsche, David; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia Bylund, Olga; Bessner, Martin Florian; Besson, Nathalie; Betancourt, Christopher; Bethke, Siegfried; Bevan, Adrian John; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Biedermann, Dustin; Bieniek, Stephen Paul; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Biondi, Silvia; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blanco, Jacobo Ezequiel; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Bock, Christopher; Boehler, Michael; Bogaerts, Joannes Andreas; Bogavac, Danijela; Bogdanchikov, Alexander; Bohm, Christian; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Boldyrev, Alexey; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Borisov, Anatoly; Borissov, Guennadi; Borroni, Sara; Bortfeldt, Jonathan; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boudreau, Joseph; Bouffard, Julian; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozic, Ivan; Bracinik, Juraj; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brazzale, Simone Federico; Breaden Madden, William Dmitri; Brendlinger, Kurt; Brennan, Amelia Jean; Brenner, Lydia; Brenner, Richard; Bressler, Shikma; Bristow, Kieran; Bristow, Timothy Michael; Britton, Dave; Britzger, Daniel; Brochu, Frederic; Brock, Ian; Brock, Raymond; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Brown, Jonathan; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Bruscino, Nello; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Buchholz, Peter; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Buehrer, Felix; Bugge, Lars; Bugge, Magnar Kopangen; Bulekov, Oleg; Bullock, Daniel; Burckhart, Helfried; Burdin, Sergey; Burghgrave, Blake; Burke, Stephen; Burmeister, Ingo; Busato, Emmanuel; Büscher, Daniel; Büscher, Volker; Bussey, Peter; Butler, John; Butt, Aatif Imtiaz; Buttar, Craig; Butterworth, Jonathan; Butti, Pierfrancesco; Buttinger, William; Buzatu, Adrian; Buzykaev, Aleksey; Cabrera Urbán, Susana; Caforio, Davide; Cairo, Valentina; Cakir, Orhan; Calace, Noemi; Calafiura, Paolo; Calandri, Alessandro; Calderini, Giovanni; Calfayan, Philippe; Caloba, Luiz; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarda, Stefano; Camarri, Paolo; Cameron, David; Caminal Armadans, Roger; Campana, Simone; Campanelli, Mario; Campoverde, Angel; Canale, Vincenzo; Canepa, Anadi; Cano Bret, Marc; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Caputo, Regina; Cardarelli, Roberto; Cardillo, Fabio; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Casolino, Mirkoantonio; Castaneda-Miranda, Elizabeth; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catastini, Pierluigi; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Caudron, Julien; Cavaliere, Viviana; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerio, Benjamin; Cerny, Karel; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cerv, Matevz; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chalupkova, Ina; Chang, Philip; Chapman, John Derek; Charlton, Dave; Chau, Chav Chhiv; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chegwidden, Andrew; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Liming; Chen, Shenjian; Chen, Xin; Chen, Ye; Cheng, Hok Chuen; Cheng, Yangyang; Cheplakov, Alexander; Cheremushkina, Evgenia; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Chiarelli, Giorgio; Childers, John Taylor; Chiodini, Gabriele; Chisholm, Andrew; Chislett, Rebecca Thalatta; Chitan, Adrian; Chizhov, Mihail; Choi, Kyungeon; Chouridou, Sofia; Chow, Bonnie Kar Bo; Christodoulou, Valentinos; Chromek-Burckhart, Doris; Chudoba, Jiri; Chuinard, Annabelle Julia; Chwastowski, Janusz; Chytka, Ladislav; Ciapetti, Guido; Ciftci, Abbas Kenan; Cinca, Diane; Cindro, Vladimir; Cioara, Irina Antonela; Ciocio, Alessandra; Citron, Zvi Hirsh; Ciubancan, Mihai; Clark, Allan G; Clark, Brian Lee; Clark, Philip James; Clarke, Robert; Cleland, Bill; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coffey, Laurel; Cogan, Joshua Godfrey; Colasurdo, Luca; Cole, Brian; Cole, Stephen; Colijn, Auke-Pieter; Collot, Johann; Colombo, Tommaso; Compostella, Gabriele; Conde Muiño, Patricia; Coniavitis, Elias; Connell, Simon Henry; Connelly, Ian; Consonni, Sofia Maria; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Côté, David; Cottin, Giovanna; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Cree, Graham; Crépé-Renaudin, Sabine; Crescioli, Francesco; Cribbs, Wayne Allen; Crispin Ortuzar, Mireia; Cristinziani, Markus; Croft, Vince; Crosetti, Giovanni; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cuthbert, Cameron; Czirr, Hendrik; Czodrowski, Patrick; D'Auria, Saverio; D'Onofrio, Monica; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dafinca, Alexandru; Dai, Tiesheng; Dale, Orjan; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Dandoy, Jeffrey Rogers; Dang, Nguyen Phuong; Daniells, Andrew Christopher; Danninger, Matthias; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darmora, Smita; Dassoulas, James; Dattagupta, Aparajita; Davey, Will; David, Claire; Davidek, Tomas; Davies, Eleanor; Davies, Merlin; Davison, Peter; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Benedetti, Abraham; De Castro, Stefano; De Cecco, Sandro; De Groot, Nicolo; de Jong, Paul; De la Torre, Hector; De Lorenzi, Francesco; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dedovich, Dmitri; Deigaard, Ingrid; Del Peso, Jose; Del Prete, Tarcisio; Delgove, David; Deliot, Frederic; Delitzsch, Chris Malena; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Dell'Orso, Mauro; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; DeMarco, David; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deterre, Cecile; Deviveiros, Pier-Olivier; Dewhurst, Alastair; Dhaliwal, Saminder; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Domenico, Antonio; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Diaconu, Cristinel; Diamond, Miriam; Dias, Flavia; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Diglio, Sara; Dimitrievska, Aleksandra; Dingfelder, Jochen; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Djuvsland, Julia Isabell; Barros do Vale, Maria Aline; Dobos, Daniel; Dobre, Monica; Doglioni, Caterina; Dohmae, Takeshi; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dova, Maria-Teresa; Doyle, Tony; Drechsler, Eric; Dris, Manolis; Dubreuil, Emmanuelle; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Duflot, Laurent; Duguid, Liam; Dührssen, Michael; Dunford, Monica; Duran Yildiz, Hatice; Düren, Michael; Durglishvili, Archil; Duschinger, Dirk; Dyndal, Mateusz; Eckardt, Christoph; Ecker, Katharina Maria; Edgar, Ryan Christopher; Edson, William; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Elliot, Alison; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Endo, Masaki; Erdmann, Johannes; Ereditato, Antonio; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Esposito, Bellisario; Etienvre, Anne-Isabelle; Etzion, Erez; Evans, Hal; Ezhilov, Alexey; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Falla, Rebecca Jane; Faltova, Jana; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Faucci Giannelli, Michele; Favareto, Andrea; Fayard, Louis; Federic, Pavol; Fedin, Oleg; Fedorko, Wojciech; Feigl, Simon; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Feremenga, Last; Fernandez Martinez, Patricia; Fernandez Perez, Sonia; Ferrando, James; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filipčič, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Adam; Fischer, Cora; Fischer, Julia; Fisher, Wade Cameron; Fitzgerald, Eric Andrew; Flaschel, Nils; Fleck, Ivor; Fleischmann, Philipp; Fleischmann, Sebastian; Fletcher, Gareth Thomas; Fletcher, Gregory; Fletcher, Rob Roy MacGregor; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Flowerdew, Michael; Formica, Andrea; Forti, Alessandra; Fournier, Daniel; Fox, Harald; Fracchia, Silvia; Francavilla, Paolo; Franchini, Matteo; Francis, David; Franconi, Laura; Franklin, Melissa; Frate, Meghan; Fraternali, Marco; Freeborn, David; French, Sky; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fulsom, Bryan Gregory; Fusayasu, Takahiro; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gach, Grzegorz; Gadatsch, Stefan; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gao, Jun; Gao, Yanyan; Gao, Yongsheng; Garay Walls, Francisca; Garberson, Ford; García, Carmen; García Navarro, José Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gatti, Claudio; Gaudiello, Andrea; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gauzzi, Paolo; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Ge, Peng; Gecse, Zoltan; Gee, Norman; Geerts, Daniël Alphonsus Adrianus; Geich-Gimbel, Christoph; Geisler, Manuel Patrice; Gemme, Claudia; Genest, Marie-Hélène; Gentile, Simonetta; George, Matthias; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghasemi, Sara; Ghazlane, Hamid; Giacobbe, Benedetto; Giagu, Stefano; Giangiobbe, Vincent; Giannetti, Paola; Gibbard, Bruce; Gibson, Stephen; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gilles, Geoffrey; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giorgi, Filippo Maria; Giorgi, Francesco Michelangelo; Giraud, Pierre-Francois; Giromini, Paolo; Giugni, Danilo; Giuliani, Claudia; Giulini, Maddalena; Gjelsten, Børge Kile; Gkaitatzis, Stamatios; Gkialas, Ioannis; Gkougkousis, Evangelos Leonidas; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glaysher, Paul; Glazov, Alexandre; Goblirsch-Kolb, Maximilian; Goddard, Jack Robert; Godlewski, Jan; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez-Sevilla, Sergio; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gössling, Claus; Gostkin, Mikhail Ivanovitch; Goujdami, Driss; Goussiou, Anna; Govender, Nicolin; Gozani, Eitan; Grabas, Herve Marie Xavier; Graber, Lars; Grabowska-Bold, Iwona; Grafström, Per; Grahn, Karl-Johan; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Gray, Heather; Graziani, Enrico; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grivaz, Jean-Francois; Grohs, Johannes Philipp; Grohsjean, Alexander; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Grout, Zara Jane; Guan, Liang; Guenther, Jaroslav; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Guo, Jun; Guo, Yicheng; Gupta, Shaun; Gustavino, Giuliano; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haddad, Nacim; Haefner, Petra; Hageböck, Stephan; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Haley, Joseph; Hall, David; Halladjian, Garabed; Hallewell, Gregory David; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamer, Matthias; Hamilton, Andrew; Hamity, Guillermo Nicolas; Hamnett, Phillip George; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Hanke, Paul; Hanna, Remie; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Maike Christina; Hansen, Peter Henrik; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Hariri, Faten; Harkusha, Siarhei; Harrington, Robert; Harrison, Paul Fraser; Hartjes, Fred; Hasegawa, Makoto; Hasegawa, Satoshi; Hasegawa, Yoji; Hasib, A; Hassani, Samira; Haug, Sigve; Hauser, Reiner; Hauswald, Lorenz; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayashi, Takayasu; Hayden, Daniel; Hays, Chris; Hays, Jonathan Michael; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heim, Timon; Heinemann, Beate; Heinrich, Lukas; Hejbal, Jiri; Helary, Louis; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, James; Henderson, Robert; Heng, Yang; Hengler, Christopher; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Herbert, Geoffrey Henry; Hernández Jiménez, Yesenia; Herrberg-Schubert, Ruth; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hetherly, Jeffrey Wayne; Hickling, Robert; Higón-Rodriguez, Emilio; Hill, Ewan; Hill, John; Hiller, Karl Heinz; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hinman, Rachel Reisner; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoenig, Friedrich; Hohlfeld, Marc; Hohn, David; Holmes, Tova Ray; Homann, Michael; Hong, Tae Min; Hooft van Huysduynen, Loek; Hopkins, Walter; Horii, Yasuyuki; Horton, Arthur James; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hrynevich, Aliaksei; Hsu, Catherine; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Qipeng; Hu, Xueye; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hülsing, Tobias Alexander; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Ideal, Emma; Idrissi, Zineb; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikematsu, Katsumasa; Ikeno, Masahiro; Ilchenko, Iurii; Iliadis, Dimitrios; Ilic, Nikolina; Ince, Tayfun; Introzzi, Gianluca; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Iturbe Ponce, Julia Mariana; Iuppa, Roberto; Ivarsson, Jenny; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jabbar, Samina; Jackson, Brett; Jackson, Matthew; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jakubek, Jan; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansky, Roland; Janssen, Jens; Janus, Michel; Jarlskog, Göran; Javadov, Namig; Javůrek, Tomáš; Jeanty, Laura; Jejelava, Juansher; Jeng, Geng-yuan; Jennens, David; Jenni, Peter; Jentzsch, Jennifer; Jeske, Carl; Jézéquel, Stéphane; Ji, Haoshuang; Jia, Jiangyong; Jiang, Yi; Jiggins, Stephen; Jimenez Pena, Javier; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Joergensen, Morten Dam; Johansson, Per; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tim; Jongmanns, Jan; Jorge, Pedro; Joshi, Kiran Daniel; Jovicevic, Jelena; Ju, Xiangyang; Jung, Christian; Jussel, Patrick; Juste Rozas, Aurelio; Kaci, Mohammed; Kaczmarska, Anna; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kahn, Sebastien Jonathan; Kajomovitz, Enrique; Kalderon, Charles William; Kama, Sami; Kamenshchikov, Andrey; Kanaya, Naoko; Kaneti, Steven; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kaplan, Laser Seymour; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karamaoun, Andrew; Karastathis, Nikolaos; Kareem, Mohammad Jawad; Karnevskiy, Mikhail; Karpov, Sergey; Karpova, Zoya; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Katre, Akshay; Katzy, Judith; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Keeler, Richard; Kehoe, Robert; Keller, John; Kempster, Jacob Julian; Keoshkerian, Houry; Kepka, Oldrich; Kerševan, Borut Paul; Kersten, Susanne; Keyes, Robert; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharlamov, Alexey; Khoo, Teng Jian; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hee Yeun; Kim, Hyeon Jin; Kim, Shinhong; Kim, Young-Kee; Kimura, Naoki; Kind, Oliver Maria; King, Barry; King, Matthew; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kiss, Florian; Kiuchi, Kenji; Kivernyk, Oleh; Kladiva, Eduard; Klein, Matthew Henry; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klioutchnikova, Tatiana; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Knapik, Joanna; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Aine; Kobayashi, Dai; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohlmann, Simon; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kolanoski, Hermann; Koletsou, Iro; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kondrashova, Nataliia; Köneke, Karsten; König, Adriaan; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Köpke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Kortner, Oliver; Kortner, Sandra; Kosek, Tomas; Kostyukhin, Vadim; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumeli-Charalampidi, Athina; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kramarenko, Viktor; Kramberger, Gregor; Krasnopevtsev, Dimitriy; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kreiss, Sven; Kretz, Moritz; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Peter; Krizka, Karol; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Krumnack, Nils; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kucuk, Hilal; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuger, Fabian; Kuhl, Andrew; Kuhl, Thorsten; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunigo, Takuto; Kupco, Alexander; Kurashige, Hisaya; Kurochkin, Yurii; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwan, Tony; Kyriazopoulos, Dimitrios; La Rosa, Alessandro; La Rosa Navarro, Jose Luis; La Rotonda, Laura; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Lambourne, Luke; Lammers, Sabine; Lampen, Caleb; Lampl, Walter; Lançon, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lange, J örn Christian; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Lanza, Agostino; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Lasagni Manghi, Federico; Lassnig, Mario; Laurelli, Paolo; Lavrijsen, Wim; Law, Alexander; Laycock, Paul; Lazovich, Tomo; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; LeBlanc, Matthew Edgar; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire Alexandra; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leight, William Axel; Leisos, Antonios; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Leney, Katharine; Lenz, Tatjana; Lenzi, Bruno; Leone, Robert; Leone, Sandra; Leonidopoulos, Christos; Leontsinis, Stefanos; Leroy, Claude; Lester, Christopher; Levchenko, Mikhail; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Levy, Mark; Lewis, Adrian; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Haifeng; Li, Ho Ling; Li, Lei; Li, Liang; Li, Shu; Li, Yichen; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Liblong, Aaron; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Lin, Simon; Lin, Tai-Hua; Linde, Frank; Lindquist, Brian Edward; Linnemann, James; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Hao; Liu, Jian; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanwen; Livan, Michele; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loginov, Andrey; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Long, Brian Alexander; Long, Jonathan; Long, Robin Eamonn; Looper, Kristina Anne; Lopes, Lourenco; Lopez Mateos, David; Lopez Paredes, Brais; Lopez Paz, Ivan; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Lösel, Philipp Jonathan; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lu, Nan; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lundberg, Olof; Lund-Jensen, Bengt; Lynn, David; Lysak, Roman; Lytken, Else; Ma, Hong; Ma, Lian Liang; Maccarrone, Giovanni; Macchiolo, Anna; Macdonald, Calum Michael; Machado Miguens, Joana; Macina, Daniela; Madaffari, Daniele; Madar, Romain; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeland, Steffen; Maeno, Tadashi; Maevskiy, Artem; Magradze, Erekle; Mahboubi, Kambiz; Mahlstedt, Joern; Maiani, Camilla; Maidantchik, Carmen; Maier, Andreas Alexander; Maier, Thomas; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mamuzic, Judita; Mancini, Giada; Mandelli, Beatrice; Mandelli, Luciano; Mandić, Igor; Mandrysch, Rocco; Maneira, José; Manfredini, Alessandro; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Mantifel, Rodger; Mantoani, Matteo; Mapelli, Livio; March, Luis; Marchiori, Giovanni; Marcisovsky, Michal; Marino, Christopher; Marjanovic, Marija; Marley, Daniel; Marroquim, Fernando; Marsden, Stephen Philip; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian Thomas; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Mario; Martin-Haugh, Stewart; Martoiu, Victor Sorin; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massa, Lorenzo; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Mättig, Peter; Mattmann, Johannes; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazza, Simone Michele; Mazzaferro, Luca; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; McMahon, Steve; McPherson, Robert; Medinnis, Michael; Meehan, Samuel; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mercurio, Kevin Michael; Mergelmeyer, Sebastian; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Middleton, Robin; Miglioranzi, Silvia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Milesi, Marco; Milic, Adriana; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Minaenko, Andrey; Minami, Yuto; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Miucci, Antonio; Miyagawa, Paul; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Mochizuki, Kazuya; Mohapatra, Soumya; Mohr, Wolfgang; Molander, Simon; Moles-Valls, Regina; Mönig, Klaus; Monini, Caterina; Monk, James; Monnier, Emmanuel; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Morange, Nicolas; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Morgenstern, Marcus; Mori, Daniel; Morii, Masahiro; Morinaga, Masahiro; Morisbak, Vanja; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Mortensen, Simon Stark; Morton, Alexander; Morvaj, Ljiljana; Mosidze, Maia; Moss, Josh; Motohashi, Kazuki; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Muanza, Steve; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Ralph Soeren Peter; Mueller, Thibaut; Muenstermann, Daniel; Mullen, Paul; Mullier, Geoffrey; Murillo Quijada, Javier Alberto; Murray, Bill; Musheghyan, Haykuhi; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagai, Yoshikazu; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagata, Kazuki; Nagel, Martin; Nagy, Elemer; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Naranjo Garcia, Roger Felipe; Narayan, Rohin; Naumann, Thomas; Navarro, Gabriela; Nayyar, Ruchika; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Nef, Pascal Daniel; Negri, Andrea; Negrini, Matteo; Nektarijevic, Snezana; Nellist, Clara; Nelson, Andrew; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neves, Ricardo; Nevski, Pavel; Newman, Paul; Nguyen, Duong Hai; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Nielsen, Jason; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolopoulos, Konstantinos; Nilsen, Jon Kerr; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nomachi, Masaharu; Nomidis, Ioannis; Nooney, Tamsin; Norberg, Scarlet; Nordberg, Markus; Novgorodova, Olga; Nowak, Sebastian; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; Nuti, Francesco; O'Brien, Brendan Joseph; O'grady, Fionnbarr; O'Neil, Dugan; O'Shea, Val; Oakham, Gerald; Oberlack, Horst; Obermann, Theresa; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Ochoa-Ricoux, Juan Pedro; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohman, Henrik; Oide, Hideyuki; Okamura, Wataru; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olivares Pino, Sebastian Andres; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, António; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Owen, Rhys Edward; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagáčová, Martina; Pagan Griso, Simone; Paganis, Efstathios; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palestini, Sandro; Palka, Marek; Pallin, Dominique; Palma, Alberto; Pan, Yibin; Panagiotopoulou, Evgenia; Pandini, Carlo Enrico; Panduro Vazquez, William; Pani, Priscilla; Panitkin, Sergey; Pantea, Dan; Paolozzi, Lorenzo; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Michael Andrew; Parker, Kerry Ann; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pasqualucci, Enrico; Passaggio, Stefano; Pastore, Fernanda; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Pauly, Thilo; Pearce, James; Pearson, Benjamin; Pedersen, Lars Egholm; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Pelikan, Daniel; Penc, Ondrej; Peng, Cong; Peng, Haiping; Penning, Bjoern; Penwell, John; Perepelitsa, Dennis; Perez Codina, Estel; Pérez García-Estañ, María Teresa; Perini, Laura; Pernegger, Heinz; Perrella, Sabrina; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petroff, Pierre; Petrolo, Emilio; Petrucci, Fabrizio; Pettersson, Nora Emilia; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Pickering, Mark Andrew; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, João Antonio; Pinamonti, Michele; Pinfold, James; Pingel, Almut; Pinto, Belmiro; Pires, Sylvestre; Pirumov, Hayk; Pitt, Michael; Pizio, Caterina; Plazak, Lukas; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Pluth, Daniel; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Polesello, Giacomo; Poley, Anne-luise; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Prell, Soeren; Price, Darren; Price, Lawrence; Primavera, Margherita; Prince, Sebastien; Proissl, Manuel; Prokofiev, Kirill; Prokoshin, Fedor; Protopapadaki, Eftychia-sofia; Protopopescu, Serban; Proudfoot, James; Przybycien, Mariusz; Ptacek, Elizabeth; Puddu, Daniele; Pueschel, Elisa; Puldon, David; Purohit, Milind; Puzo, Patrick; Qian, Jianming; Qin, Gang; Qin, Yang; Quadt, Arnulf; Quarrie, David; Quayle, William; Queitsch-Maitland, Michaela; Quilty, Donnchadha; Raddum, Silje; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Rados, Pere; Ragusa, Francesco; Rahal, Ghita; Rajagopalan, Srinivasan; Rammensee, Michael; Rangel-Smith, Camila; Rauscher, Felix; Rave, Stefan; Ravenscroft, Thomas; Raymond, Michel; Read, Alexander Lincoln; Readioff, Nathan Peter; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Rehnisch, Laura; Reisin, Hernan; Relich, Matthew; Rembser, Christoph; Ren, Huan; Renaud, Adrien; Rescigno, Marco; Resconi, Silvia; Rezanova, Olga; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Richter, Stefan; Richter-Was, Elzbieta; Ricken, Oliver; Ridel, Melissa; Rieck, Patrick; Riegel, Christian Johann; Rieger, Julia; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Ristić, Branislav; Ritsch, Elmar; Riu, Imma; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Roda, Chiara; Roe, Shaun; Røhne, Ole; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romano Saez, Silvestre Marino; Romero Adam, Elena; Rompotis, Nikolaos; Ronzani, Manfredi; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Peyton; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Rud, Viacheslav; Rudolph, Christian; Rudolph, Matthew Scott; Rühr, Frederik; Ruiz-Martinez, Aranzazu; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Russell, Heather; Rutherfoord, John; Ruthmann, Nils; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Saavedra, Aldo; Sabato, Gabriele; Sacerdoti, Sabrina; Saddique, Asif; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Saimpert, Matthias; Saito, Tomoyuki; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sammel, Dirk; Sampsonidis, Dimitrios; Sanchez, Arturo; Sánchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sandbach, Ruth Laura; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sannino, Mario; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, João; Sarrazin, Bjorn; Sasaki, Osamu; Sasaki, Yuichi; Sato, Koji; Sauvage, Gilles; Sauvan, Emmanuel; Savage, Graham; Savard, Pierre; Sawyer, Craig; Sawyer, Lee; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Scarfone, Valerio; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schaefer, Ralph; Schaeffer, Jan; Schaepe, Steffen; Schaetzel, Sebastian; Schäfer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Schiavi, Carlo; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Sebastian; Schmitt, Stefan; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schopf, Elisabeth; Schorlemmer, Andre Lukas; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schramm, Steven; Schreyer, Manuel; Schroeder, Christian; Schuh, Natascha; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwanenberger, Christian; Schwartzman, Ariel; Schwarz, Thomas Andrew; Schwegler, Philipp; Schweiger, Hansdieter; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Sciacca, Gianfranco; Scifo, Estelle; Sciolla, Gabriella; Scuri, Fabrizio; Scutti, Federico; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Seema, Pienpen; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Sekhon, Karishma; Sekula, Stephen; Seliverstov, Dmitry; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Serre, Thomas; Sessa, Marco; Seuster, Rolf; Severini, Horst; Sfiligoj, Tina; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shang, Ruo-yu; Shank, James; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Shaw, Savanna Marie; Shcherbakova, Anna; Shehu, Ciwake Yusufu; Sherwood, Peter; Shi, Liaoshan; Shimizu, Shima; Shimmin, Chase Owen; Shimojima, Makoto; Shiyakova, Mariya; Shmeleva, Alevtina; Shoaleh Saadi, Diane; Shochet, Mel; Shojaii, Seyedruhollah; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Shushkevich, Stanislav; Sicho, Petr; Sidebo, Per Edvin; Sidiropoulou, Ourania; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silva, José; Silver, Yiftah; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simon, Dorian; Simoniello, Rosa; Sinervo, Pekka; Sinev, Nikolai; Sioli, Maximiliano; Siragusa, Giovanni; Sisakyan, Alexei; Sivoklokov, Serguei; Sjölin, Jörgen; Sjursen, Therese; Skinner, Malcolm Bruce; Skottowe, Hugh Philip; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Slawinska, Magdalena; Sliwa, Krzysztof; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Matthew; Smith, Russell; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snyder, Scott; Sobie, Randall; Socher, Felix; Soffer, Abner; Soh, Dart-yin; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solodkov, Alexander; Soloshenko, Alexei; Solovyanov, Oleg; Solovyev, Victor; Sommer, Philip; Song, Hong Ye; Soni, Nitesh; Sood, Alexander; Sopczak, Andre; Sopko, Bruno; Sopko, Vit; Sorin, Veronica; Sosa, David; Sosebee, Mark; Sotiropoulou, Calliope Louisa; Soualah, Rachik; Soukharev, Andrey; South, David; Sowden, Benjamin; Spagnolo, Stefania; Spalla, Margherita; Spanò, Francesco; Spearman, William Robert; Sperlich, Dennis; Spettel, Fabian; Spighi, Roberto; Spigo, Giancarlo; Spiller, Laurence Anthony; Spousta, Martin; Spreitzer, Teresa; St Denis, Richard Dante; Staerz, Steffen; Stahlman, Jonathan; Stamen, Rainer; Stamm, Soren; Stanecka, Ewa; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staszewski, Rafal; Stavina, Pavel; Steinberg, Peter; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoicea, Gabriel; Stolte, Philipp; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Stramaglia, Maria Elena; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Stroynowski, Ryszard; Strubig, Antonia; Stucci, Stefania Antonia; Stugu, Bjarne; Styles, Nicholas Adam; Su, Dong; Su, Jun; Subramaniam, Rajivalochan; Succurro, Antonella; Sugaya, Yorihito; Suhr, Chad; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Siyuan; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Shota; Svatos, Michal; Swedish, Stephen; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Taccini, Cecilia; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Shuji; Tannenwald, Benjamin Bordy; Tannoury, Nancy; Tapprogge, Stefan; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Teoh, Jia Jian; Tepel, Fabian-Phillipp; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Theveneaux-Pelzer, Timothée; Thomas, Juergen; Thomas-Wilsker, Joshuha; Thompson, Emily; Thompson, Paul; Thompson, Ray; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thun, Rudolf; Tibbetts, Mark James; Ticse Torres, Royer Edson; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tiouchichine, Elodie; Tipton, Paul; Tisserant, Sylvain; Todome, Kazuki; Todorov, Theodore; Todorova-Nova, Sharka; Tojo, Junji; Tokár, Stanislav; Tokushuku, Katsuo; Tollefson, Kirsten; Tolley, Emma; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Trischuk, William; Trocmé, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; True, Patrick; Truong, Loan; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsuno, Soshi; Tsybychev, Dmitri; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turra, Ruggero; Turvey, Andrew John; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ugland, Maren; Uhlenbrock, Mathias; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Unverdorben, Christopher; Urban, Jozef; Urquijo, Phillip; Urrejola, Pedro; Usai, Giulio; Usanova, Anna; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valderanis, Chrysostomos; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Den Wollenberg, Wouter; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; Van Der Leeuw, Robin; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vanguri, Rami; Vaniachine, Alexandre; Vannucci, Francois; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veloce, Laurelle Maria; Veloso, Filipe; Velz, Thomas; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigne, Ralph; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vogel, Marcelo; Vokac, Petr; Volpi, Guido; Volpi, Matteo; von der Schmitt, Hans; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vorobev, Konstantin; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Peter; Wagner, Wolfgang; Wahlberg, Hernan; Wahrmund, Sebastian; Wakabayashi, Jun; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wang, Chao; Wang, Fuquan; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Xiaoxiao; Wanotayaroj, Chaowaroj; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Warsinsky, Markus; Washbrook, Andrew; Wasicki, Christoph; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Webster, Jordan S; Weidberg, Anthony; Weinert, Benjamin; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; Wharton, Andrew Mark; White, Andrew; White, Martin; White, Ryan; White, Sebastian; Whiteson, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wildauer, Andreas; Wilkens, Henric George; Williams, Hugh; Williams, Sarah; Willis, Christopher; Willocq, Stephane; Wilson, Alan; Wilson, John; Wingerter-Seez, Isabelle; Winklmeier, Frank; Winter, Benedict Tobias; Wittgen, Matthias; Wittkowski, Josephine; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wu, Mengqing; Wu, Miles; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yakabe, Ryota; Yamada, Miho; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Shimpei; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Yi; Yao, Weiming; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yeletskikh, Ivan; Yen, Andy L; Yildirim, Eda; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jiaming; Yu, Jie; Yuan, Li; Yuen, Stephanie P; Yurkewicz, Adam; Yusuff, Imran; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zalieckas, Justas; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zengel, Keith; Zenin, Oleg; Ženiš, Tibor; Zerwas, Dirk; Zhang, Dongliang; Zhang, Fangzhou; Zhang, Huijun; Zhang, Jinlong; Zhang, Lei; Zhang, Ruiqi; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Xiandong; Zhao, Yongke; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Chen; Zhou, Lei; Zhou, Li; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zhukov, Konstantin; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Stephanie; Zinonos, Zinonas; Zinser, Markus; Ziolkowski, Michael; Živković, Lidija; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zurzolo, Giovanni; Zwalinski, Lukasz
2015-09-15
This paper describes the concept, technical realisation and validation of a largely data-driven method to model events with $Z\\to\\tau\\tau$ decays. In $Z\\to\\mu\\mu$ events selected from proton-proton collision data recorded at $\\sqrt{s}=8$ TeV with the ATLAS experiment at the LHC in 2012, the $Z$ decay muons are replaced by $\\tau$ leptons from simulated $Z\\to\\tau\\tau$ decays at the level of reconstructed tracks and calorimeter cells. The $\\tau$ lepton kinematics are derived from the kinematics of the original muons. Thus, only the well-understood decays of the $Z$ boson and $\\tau$ leptons as well as the detector response to the $\\tau$ decay products are obtained from simulation. All other aspects of the event, such as the $Z$ boson and jet kinematics as well as effects from multiple interactions, are given by the actual data. This so-called $\\tau$-embedding method is particularly relevant for Higgs boson searches and analyses in $\\tau\\tau$ final states, where $Z\\to\\tau\\tau$ decays constitute a large irreducible...
Directory of Open Access Journals (Sweden)
Love, Jr., Paul M.
2013-02-01
Full Text Available This article is aimed at analyzing the medieval and modern source material dealing with the history of Djerba under the Rustamid Imāmate in an attempt to clarify the nature of both the historical and historiographical relationship between them. It will begin by discussing the available primary and secondary source material, including the historiographical challenges they present. An analysis of the textual and archeological evidence connecting the Rustamids and Djerba will follow. Next, it will attempt to synthesize the scattered bits of evidence available in the historical record in an effort to present a clearer picture of Djerba in the Rustamid period. On the basis of this textual and archeological evidence, it will be argued that Djerba was home to an ibādī community independent of the government in Tahert for the majority ‒if not all‒ of that Imāmate’s existence ‒distinguishing the island from the surrounding areas of the Djerid (in southern Tunisia, parts of Aghlabid Ifrīqiya and the Jebel Nafūsa. Furthermore, it will be shown that evidence suggests this independence was not only a political, but also a religious one.
Este ensayo analiza las fuentes de origen medieval y moderno sobre la historia de Ŷarba en el Imāmato rustamí en un intento de aclarar la naturaleza de la relación histórica e historiográfica entre ellos. Se empieza por discutir las fuentes primarias y secundarias disponibles, incluyendo los retos historiográficos que plantean y se presenta a continuación un análisis de las evidencias textuales y arqueológicas que conectan a los rustamíes con Ŷarba. Se intenta después sintetizar las piezas dispersas de la evidencia disponible en el registro histórico con el fin de presentar una imagen más clara de Ŷarba durante el período rustamí. Con base en esta evidencia textual y arqueológica, se argumentará que Ŷarba era hogar de una comunidad ibādí independiente del gobierno en Tāhert
Cluster radioactivity of Z=125 super heavy nuclei
International Nuclear Information System (INIS)
Manjunatha, H.C.; Seenappa, L.
2015-01-01
For atomic numbers larger than 121 cluster decay and spontaneous fission may compete with α decay. Hence there is a need to make reliable calculations for the cluster decay half-lives of superheavy nuclei to predict the possible isotopes super heavy nuclei. So, in the present work, we have studied the decay of clusters such as 8 Be, 10 Be, 12 C, 14 C, 16 C, 18 O, 20 O, 22 Ne, 24 Ne, 25 Ne, 26 Ne, 28 Mg, 30 Mg, 32 Si, 34 Si, 36 Si, 40 S, 48 Ca, 50 Ca and 52 Ti from the super heavy nuclei Z=125
ANSI laser standards, education (Z136.5), research, development or testing (Z136.8)
Barat, K.
2014-07-01
Several factors affect laser use in educational settings. First is the lower cost of lasers, in particular, diode have made lasers more accessible for laser classroom use (think of the hand held laser in red, green and blue). Second in the research and development, no technology has made the impact of the laser. Third the importance of introducing students to this technology. To the point no discipline is laser free. To address laser safety in the academic setting two American National Standard Institute Standards have been developed. The most recent Z136.8 Safe Use of Lasers in Research, Development and Testing Setting, published in 2012, Z136.5 Laser Safety in Education -2009 version was published. Z136.5 provides guidance for educators starting in public school and ranging into the college level. This includes classroom demonstrations and science fair demonstrations. Z136.8 is geared for the Graduate and Commercial research level. Z136.5 relies on the use of pre-approved safety lessons plans and appreciation of student maturity or lack of, Z136.8 relies heavily on cooperation between the user and the laser safety officer. The presentation will cover the contents of each and the different approaches taken.
International Nuclear Information System (INIS)
Mathieu, Bruno
1990-01-01
This research thesis addresses an example of transition of a corrosion process in gaseous phase towards corrosion in aqueous environment, specifically in the case of the corrosion of the Z2CN18-10 stainless steel by gaseous iodine in presence of water vapour (and possibly nitrogen dioxide). This transition occurs in two steps: initiation in gaseous phase and growth in aqueous environment. This transition is due to hygroscopic properties of mostly chromium iodides and, to a lesser extent, iron iodides. Morphological, electrochemical and thermogravimetry studies have been performed by varying different parameters governing corrosion processes: corrosion temperature, iodine concentration, relative humidity, and reaction time [fr
Energy Technology Data Exchange (ETDEWEB)
Gobat, R.; Strazzullo, V.; Daddi, E. [Laboratoire AIM-Paris-Saclay, CEA/DSM-CNRS-Université Paris Diderot, Irfu/Service d' Astrophysique, CEA Saclay, Orme des Merisiers, F-91191 Gif sur Yvette (France); Onodera, M.; Carollo, M. [Institute for Astronomy, ETH Zürich Wolfgang-Pauli-strasse 27, 8093 Zürich (Switzerland); Renzini, A. [INAF-Osservatorio Astronomico di Padova Vicolo dell' Osservatorio 5, I-35122 Padova (Italy); Finoguenov, A. [University of Helsinki, P.O. Box 33 (Yliopistonkatu 4), FI-00014 Helsinki (Finland); Cimatti, A. [Università di Bologna, Dipartimento di Astronomia Via Ranzani 1, I-40127 Bologna (Italy); Scarlata, C. [School of Physics and Astronomy, University of Minnesota 116 Church Street Southeast, Minneapolis, MN 55455 (United States); Arimoto, N. [Subaru Telescope, National Astronomical Observatory of Japan 650 North A' ohoku Place, Hilo, HI 96720 (United States)
2013-10-10
We present deep Hubble Space Telescope Wide Field Camera 3 (HST/WFC3) slitless spectroscopic observations of the distant cluster Cl J1449+0856. These cover a single pointing with 18 orbits of G141 spectroscopy and F140W imaging, allowing us to derive secure redshifts down to M{sub 140} ∼ 25.5 AB and 3σ line fluxes of ∼5 × 10{sup –18} erg s{sup –1} cm{sup –2}. In particular, we were able to spectroscopically confirm 12 early-type galaxies (ETGs) in the field up to z ∼ 3, 6 of which are in the cluster core, which represents the first direct spectroscopic confirmation of quiescent galaxies in a z = 2 cluster environment. With 140 redshifts in a ∼6 arcmin{sup 2} field, we can trace the spatial and redshift galaxy distribution in the cluster core and background field. We find two strong peaks at z = 2.00 and z = 2.07, where only one was seen in our previously published ground-based data. Due to the spectroscopic confirmation of the cluster ETGs, we can now reevaluate the redshift of Cl J1449+0856 at z = 2.00, rather than z = 2.07, with the background overdensity being revealed to be sparse and {sup s}heet{sup -}like. This presents an interesting case of chance alignment of two close yet unrelated structures, each one preferentially selected by different observing strategies. With 6 quiescent or early-type spectroscopic members and 20 star-forming ones, Cl J1449+0856 is now reliably confirmed to be at z = 2.00. The identified members can now allow for a detailed study of galaxy properties in the densest environment at z = 2.
Energy Technology Data Exchange (ETDEWEB)
Bouwens, R. J.; Labbé, I.; Franx, M.; Smit, R. [Leiden Observatory, Leiden University, NL-2300 RA Leiden (Netherlands); Illingworth, G. D.; Oesch, P. A.; Gonzalez, V.; Magee, D. [UCO/Lick Observatory, University of California, Santa Cruz, CA 95064 (United States); Van Dokkum, P. G. [Department of Astronomy, Yale University, New Haven, CT 06520 (United States); Trenti, M. [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom)
2014-10-01
We measure the UV-continuum slope β for over 4000 high-redshift galaxies over a wide range of redshifts z ∼ 4-8 and luminosities from the HST HUDF/XDF, HUDF09-1, HUDF09-2, ERS, CANDELS-N, and CANDELS-S data sets. Our new β results reach very faint levels at z ∼ 4 (–15.5 mag: 0.006 L{sub z=3}{sup ∗}), z ∼ 5 (–16.5 mag: 0.014 L{sub z=3}{sup ∗}), and z ∼ 6 and z ∼ 7 (–17 mag: 0.025 L{sub z=3}{sup ∗}). Inconsistencies between previous studies led us to conduct a comprehensive review of systematic errors and develop a new technique for measuring β that is robust against biases that arise from the impact of noise. We demonstrate, by object-by-object comparisons, that all previous studies, including our own and those done on the latest HUDF12 data set, suffered from small systematic errors in β. We find that after correcting for the systematic errors (typically Δβ ∼ 0.1-0.2) all β results at z ∼ 7 from different groups are in excellent agreement. The mean β we measure for faint (–18 mag: 0.1 L{sub z=3}{sup ∗}) z ∼ 4, z ∼ 5, z ∼ 6, and z ∼ 7 galaxies is –2.03 ± 0.03 ± 0.06 (random and systematic errors), –2.14 ± 0.06 ± 0.06, –2.24 ± 0.11 ± 0.08, and –2.30 ± 0.18 ± 0.13, respectively. Our new β values are redder than we have reported in the past, but bluer than other recent results. Our previously reported trend of bluer β's at lower luminosities is confirmed, as is the evolution to bluer β's at high redshifts. β appears to show only a mild luminosity dependence faintward of M {sub UV,AB} ∼ –19 mag, suggesting that the mean β asymptotes to ∼–2.2 to –2.4 for faint z ≥ 4 galaxies. At z ∼ 7, the observed β's suggest non-zero, but low dust extinction, and they agree well with values predicted in cosmological hydrodynamical simulations.
International Nuclear Information System (INIS)
Bouwens, R. J.; Labbé, I.; Franx, M.; Smit, R.; Illingworth, G. D.; Oesch, P. A.; Gonzalez, V.; Magee, D.; Van Dokkum, P. G.; Trenti, M.
2014-01-01
We measure the UV-continuum slope β for over 4000 high-redshift galaxies over a wide range of redshifts z ∼ 4-8 and luminosities from the HST HUDF/XDF, HUDF09-1, HUDF09-2, ERS, CANDELS-N, and CANDELS-S data sets. Our new β results reach very faint levels at z ∼ 4 (–15.5 mag: 0.006 L z=3 ∗ ), z ∼ 5 (–16.5 mag: 0.014 L z=3 ∗ ), and z ∼ 6 and z ∼ 7 (–17 mag: 0.025 L z=3 ∗ ). Inconsistencies between previous studies led us to conduct a comprehensive review of systematic errors and develop a new technique for measuring β that is robust against biases that arise from the impact of noise. We demonstrate, by object-by-object comparisons, that all previous studies, including our own and those done on the latest HUDF12 data set, suffered from small systematic errors in β. We find that after correcting for the systematic errors (typically Δβ ∼ 0.1-0.2) all β results at z ∼ 7 from different groups are in excellent agreement. The mean β we measure for faint (–18 mag: 0.1 L z=3 ∗ ) z ∼ 4, z ∼ 5, z ∼ 6, and z ∼ 7 galaxies is –2.03 ± 0.03 ± 0.06 (random and systematic errors), –2.14 ± 0.06 ± 0.06, –2.24 ± 0.11 ± 0.08, and –2.30 ± 0.18 ± 0.13, respectively. Our new β values are redder than we have reported in the past, but bluer than other recent results. Our previously reported trend of bluer β's at lower luminosities is confirmed, as is the evolution to bluer β's at high redshifts. β appears to show only a mild luminosity dependence faintward of M UV,AB ∼ –19 mag, suggesting that the mean β asymptotes to ∼–2.2 to –2.4 for faint z ≥ 4 galaxies. At z ∼ 7, the observed β's suggest non-zero, but low dust extinction, and they agree well with values predicted in cosmological hydrodynamical simulations.
Haplotype analysis of the interleukin-18 gene in Czech patients with allergic disorders
Czech Academy of Sciences Publication Activity Database
Izakovicova Holla, L.; Hrdličková, B.; Schüller, M.; Bučková, Dana; Kindlova, D.; Izakovic, V.; Vasku, A.
2010-01-01
Roč. 71, č. 6 (2010), s. 592-597 ISSN 0198-8859 Institutional research plan: CEZ:AV0Z50450515 Keywords : allergic diseases * asthma * IL-18 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.872, year: 2010
Source Header List. Volume 2. L through Z
1998-07-01
U 2-- 2- o-h 2-2 W- 1- 2- V) 2- aJ w- 2 w 22 2 - 3 - 2- 1-U.M0 .1- .1-0 IU LL. 1-W ILLJW tun wWA 1-WN 2 W U lox W -W 1W O WE CoO 0o oU- 0Co0100I C...0.4z a.U-W Z<. a-C a. a. ZAw a. a-I- a 1- UC I4 M M0 14 04 _ 4 " ( M Z 0 "( X 4 " ~ 14 < "U " 4 - 0.U_ Z1-0 1- 1- LU LU Wz z WE W z LUz Z W" ZU -J 2...34j1.4 >In >’-’ m130 >w.-Ia aW w44 40 40 <W~ <W ~ 0 41~ <W <Z <ZW 4z Z444 zaw a UI z K za Z- n I- 20 9a3 ZI aI- OIw OIm2 >- Z 2 2 Z 2 2 2 Z 2 2 Z 2 2
Pulsed power performance of PBFA Z
International Nuclear Information System (INIS)
Spielman, R.B.; Stygar, W.A.; Seamen, J.F.
1997-01-01
PBFA Z is a new 60-TW/5-MJ electrical driver located at Sandia National Laboratories. The authors use PBFA Z to drive z pinches. The pulsed power design of PBFA Z is based on conventional single-pulse Marx generator, water-line pulse-forming technology used on the earlier Saturn and PBFA II accelerators. PBFA Z stores 11.4 MJ in its 36 Marx generators, couples 5 MJ in a 60-TW/105-ns pulse to the output water transmission lines, and delivers 3.0 MJ and 50 TW of electrical energy to the z-pinch load. Depending on the initial load inductance and the implosion time, the authors attain peak currents of 16-20 MA with a rise time of 105 ns. Current is fed to the z-pinch load through self magnetically-insulated transmission lines (MITLs). Peak electric fields in the MITLs exceed 2 MV/cm. The current from the four independent conical-disk MITLs is combined together in a double post-hole vacuum convolute with an efficiency greater than 95%. The authors achieved x-ray powers of 200 TW and x-ray energies of 1.9 MJ from tungsten wire-array z-pinch loads
Z(prime) Phenomenology and the LHC
International Nuclear Information System (INIS)
Rizzo, Thomas G.
2006-01-01
A brief pedagogical overview of the phenomenology of Z(prime) gauge bosons is ILC in determining Z(prime) properties is also discussed. and explore in detail how the LHC may discover and help elucidate the models, review the current constraints on the possible properties of a Z(prime) nature of these new particles. We provide an overview of the Z(prime) studies presented. Such particles can arise in various electroweak extensions of that have been performed by both ATLAS and CMS. The role of the the Standard Model (SM). We provide a quick survey of a number of Z(prime)
Czech Academy of Sciences Publication Activity Database
Stavreva, D.; Gichner, Tomáš
2002-01-01
Roč. 514, - (2002), s. 147-152 ISSN 1383-5718 R&D Projects: GA ČR GA521/02/0400 Institutional research plan: CEZ:AV0Z5038910 Keywords : DNA * peroxide * tobacco Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.636, year: 2002
Czech Academy of Sciences Publication Activity Database
Hill, M.; Popov, P.; Havlíková, H.; Kancheva, L.; Vrbíková, J.; Meloun, M.; Kancheva, R.; Cibula, D.; Pouzar, Vladimír; Černý, Ivan; Stárka, L.
2005-01-01
Roč. 29, č. 6 (2005), s. 1010-1017 ISSN 0145-6008 R&D Projects: GA MZd(CZ) NB7070 Institutional research plan: CEZ:AV0Z4055905 Keywords : pregnanolone * progesterone * detoxification therapy Subject RIV: CC - Organic Chemistry Impact factor: 2.636, year: 2005
Top-quark loop corrections in Z+jet and Z + 2 jet production
Energy Technology Data Exchange (ETDEWEB)
Campbell, John M.; Keith Ellis, R.
2017-01-01
The sophistication of current predictions for $Z+$jet production at hadron colliders necessitates a re-evaluation of any approximations inherent in the theoretical calculations. In this paper we address one such issue, the inclusion of mass effects in top-quark loops. We ameliorate an existing calculation of $Z+1$~jet and $Z+2$~jet production by presenting exact analytic formulae for amplitudes containing top-quark loops that enter at next-to-leading order in QCD. Although approximations based on an expansion in powers of $1/m_t^2$ can lead to poor high-energy behavior, an exact treatment of top-quark loops demonstrates that their effect is small and has limited phenomenological interest.
Search for new gauge bosons decaying into dielectrons in bar pp collisions at √s=1.8 TeV
International Nuclear Information System (INIS)
Abe, F.; Albrow, M.G.; Amidei, D.; Antos, J.; Anway-Wiese, C.; Apollinari, G.; Areti, H.; Atac, M.; Auchincloss, P.; Azfar, F.; Azzi, P.; Bacchetta, N.; Badgett, W.; Bailey, M.W.; Bao, J.; Barbaro, P.D.; Barbaro-Galtieri, A.; Barnes, V.E.; Barnett, B.A.; Bartalini, P.; Bauer, G.; Baumann, T.; Bedeschi, F.; Behrends, S.; Belforte, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Benlloch, J.; Bensinger, J.; Benton, D.; Beretvas, A.; Berge, J.P.; Bertolucci, S.; Bhatti, A.; Biery, K.; Binkley, M.; Bird, F.; Bisello, D.; Blair, R.E.; Blocker, C.; Bodek, A.; Bolognesi, V.; Bortoletto, D.; Boswell, C.; Boulos, T.; Brandenburg, G.; Buckley-Geer, E.; Budd, H.S.; Burkett, K.; Busetto, G.; Byon-Wagner, A.; Byrum, K.L.; Cammerata, J.; Campagnari, C.; Campbell, M.; Caner, A.; Carithers, W.; Carlsmith, D.; Castro, A.; Cen, Y.; Cervelli, F.; Chapman, J.; Cheng, M.; Chiarelli, G.; Chikamatsu, T.; Cihangir, S.; Clark, A.G.; Cobal, M.; Contreras, M.; Conway, J.; Cooper, J.; Cordelli, M.; Crane, D.; Cunningham, J.D.; Daniels, T.; DeJongh, F.; Delchamps, S.; Dell'Agnello, S.; Dell'Orso, M.; Demortier, L.; Denby, B.; Deninno, M.; Derwent, P.F.; Devlin, T.; Dickson, M.; Donati, S.; Drucker, R.B.; Dunn, A.; Einsweiler, K.; Elias, J.E.; Ely, R.; Engels, E. Jr.; Eno, S.; Errede, D.; Errede, S.; Fan, Q.; Farhat, B.; Fiori, I.; Flaugher, B.; Foster, G.W.; Franklin, M.; Frautschi, M.; Freeman, J.; Friedman, J.; Frisch, H.; Fry, A.; Fuess, T.A.; Fukui, Y.; Funaki, S.; Gagliardi, G.; Galeotti, S.; Gallinaro, M.; Garfinkel, A.F.; Geer, S.; Gerdes, D.W.; Giannetti, P.; Giokaris, N.; Giromini, P.; Gladney, L.; Glenzinski, D.; Gold, M.; Gonzalez, J.; Gordon, A.; Goshaw, A.T.; Goulianos, K.; Grassmann, H.; Grewal, A.; Grieco, G.; Groer, L.; Grosso-Pilcher, C.; Haber, C.; Hahn, S.R.; Hamilton, R.; Handler, R.; Hans, R.M.; Hara, K.; Harral, B.; Harris, R.M.; Hauger, S.A.; Hauser, J.; Hawk, C.; Hayashi, E.; Heinrich, J.; Cronin-Hennessy, D.; Hollebeek, R.; Holloway, L.; Hoelscher, A.
1995-01-01
We have searched for heavy neutral gauge bosons (Z ' ) in bar pp collisions at √s=1.8 TeV. The data were obtained using the CDF detector during the 1992--1993 run corresponding to an integrated luminosity of 19.7±0.7 pb -1 . We present a 95% confidence level upper limit on the production cross section times the branching ratio of Z ' decaying into dielectrons as a function of Z ' mass. Assuming standard model coupling strengths, we exclude a Z ' with a mass less than 505 GeV/c 2 . We also present lower mass limits for Z ' bosons from E 6 models and the alternative left-right model
18F-FDG PET brain images as features for Alzheimer classification
Azmi, M. H.; Saripan, M. I.; Nordin, A. J.; Ahmad Saad, F. F.; Abdul Aziz, S. A.; Wan Adnan, W. A.
2017-08-01
2-Deoxy-2-[fluorine-18] fluoro-D-glucose (18F-FDG) Positron Emission Tomography (PET) imaging offers meaningful information for various types of diseases diagnosis. In Alzheimer's disease (AD), the hypometabolism of glucose which observed on the low intensity voxel in PET image may relate to the onset of the disease. The importance of early detection of AD is inevitable because the resultant brain damage is irreversible. Several statistical analysis and machine learning algorithm have been proposed to investigate the rate and the pattern of the hypometabolism. This study focus on the same aim with further investigation was performed on several hypometabolism pattern. Some pre-processing steps were implemented to standardize the data in order to minimize the effect of resolution and anatomical differences. The features used are the mean voxel intensity within the AD pattern mask, which derived from several z-score and FDR threshold values. The global mean voxel (GMV) and slice-based mean voxel (SbMV) intensity were observed and used as input to the neural network. Several neural network architectures were tested and compared to the nearest neighbour method. The highest accuracy equals to 0.9 and recorded at z-score ≤-1.3 with 1 node neural network architecture (sensitivity=0.81 and specificity=0.95) and at z-score ≤-0.7 with 10 nodes neural network (sensitivity=0.83 and specificity=0.94).
Energy Technology Data Exchange (ETDEWEB)
Moreno, E. [Centro de Estudios de Semiconductores, Departamento de Fisica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101 (Venezuela, Bolivarian Republic of); Quintero, M., E-mail: mquinter@ula.v [Centro de Estudios de Semiconductores, Departamento de Fisica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101 (Venezuela, Bolivarian Republic of); Morocoima, M.; Quintero, E.; Grima, P.; Tovar, R.; Bocaranda, P. [Centro de Estudios de Semiconductores, Departamento de Fisica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101 (Venezuela, Bolivarian Republic of); Delgado, G.E.; Contreras, J.E. [Laboratorio de Cristalografia, Departamento de Quimica, Facultad de Ciencias, Universidad de Los Andes, Merida 5101 (Venezuela, Bolivarian Republic of); Mora, A.E.; Briceno, J.M.; Avila Godoy, R.; Fernandez, J.L. [Laboratorio de Analisis Quimico y Estructural de Materiales, Departamento de Fisica, Universidad de Los Andes, Merida 5101 (Venezuela, Bolivarian Republic of); Henao, J.A.; Macias, M.A. [Grupo de Investigacion en Quimica Estructural (GIQUE), Facultad de Ciencias, Escuela de Quimica, Universidad Industrial de Santander, Apartado aereo 678, Bucaramanga (Colombia)
2009-11-03
X-ray powder diffraction measurements and differential thermal analysis (DTA) were made on polycrystalline samples of the Cu{sub 2}Cd{sub 1-z}Mn{sub z}SnSe{sub 4} and Cu{sub 2}Cd{sub 1-z}Fe{sub z}SnSe{sub 4} alloy systems. The diffraction patterns were used to show the equilibrium conditions and to derive lattice parameter values. For Cu{sub 2}Cd{sub 0.8}Fe{sub 0.2}SnSe{sub 4} as well as for Cu{sub 2}Cd{sub 0.2}Fe{sub 0.8}SnSe{sub 4} the crystal structures were refined using the Rietveld method. It was found that the internal distortion parameter sigma decreases as Cd is replaced by either Mn and/or Fe. For the Cu{sub 2}Cd{sub 1-z}Mn{sub z}SnSe{sub 4} and Cu{sub 2}Cd{sub 1-z}Fe{sub z}SnSe{sub 4} alloy systems, only two single solid phase fields, the tetragonal stannite alpha(I4-bar2m) and the wurtz-stannite delta (Pmn2{sub 1}) structures were found to occur in the diagram. In addition to the tetragonal stannite alpha phase extra X-ray diffraction lines due to MnSe and/or FeSe{sub 2} were observed for as grown samples in the range 0.7 < z < 1.0. However, it was found that the amount of the extra phase decreased for the compressed samples.
Oscillations of the polarized vacuum around a large Z(∼180) ''Nucleus''
International Nuclear Information System (INIS)
Kumano, S.; Iwazaki, A.
1988-01-01
We investigate a possible explanation of sharp e + peaks in heavy-ion collisions by analyzing a collective phenomenon in QED. We show that a highly polarized vacuum around a large Z ''nucleus'' has at least two neutral oscillation modes, whose energies are calculated to be 1.8 Mev and 1.5 Mev with an appropriate choice of the nuclear radius. They decay into a pair of e/sup /+-// through electromagnetic interactions. 10 refs., 3 figs
International Nuclear Information System (INIS)
Labbe, I.; Gonzalez, V.; Bouwens, R. J.; Illingworth, G. D.; Magee, D.; Oesch, P. A.; Carollo, C. M.; Van Dokkum, P. G.; Franx, M.; Stiavelli, M.; Trenti, M.; Kriek, M.
2010-01-01
We study the Spitzer Infrared Array Camera (IRAC) mid-infrared (rest-frame optical) fluxes of 14 newly WFC3/IR-detected z ∼ 7 z 850 -dropout galaxies and 5z ∼ 8 Y 105 -dropout galaxies. The WFC3/IR depth and spatial resolution allow accurate removal of contaminating foreground light, enabling reliable flux measurements at 3.6 μm and 4.5 μm. None of the galaxies are detected to [3.6] ∼ 26.9 (AB, 2σ), but a stacking analysis reveals a robust detection for the z 850 -dropouts and an upper limit for the Y 105 -dropouts. We construct average broadband spectral energy distributions using the stacked Advanced Camera for Surveys (ACS), WFC3, and IRAC fluxes and fit stellar population synthesis models to derive mean redshifts, stellar masses, and ages. For the z 850 -dropouts, we find z = 6.9 +0.1 -0.1 , (U - V) rest ∼ 0.4, reddening A V = 0, stellar mass (M*) = 1.2 +0.3 -0.6 x 10 9 M sun (Salpeter initial mass function). The best-fit ages ∼300 Myr, M/L V ∼ 0.2, and SSFR ∼1.7 Gyr -1 are similar to values reported for luminous z ∼ 7 galaxies, indicating the galaxies are smaller but not much younger. The sub-L* galaxies observed here contribute significantly to the stellar mass density and under favorable conditions may have provided enough photons for sustained reionization at 7 +0.1 -0.2 Y 105 -dropouts have stellar masses that are uncertain by 1.5 dex due to the near-complete reliance on far-UV data. Adopting the 2σ upper limit on the M/L(z = 8), the stellar mass density to M UV,AB +1.4 -1.8 x 10 6 M sun Mpc -3 to ρ*(z = 8) 5 M sun Mpc -3 , following ∝(1 + z) -6 over 3 < z < 8. Lower masses at z = 8 would signify more dramatic evolution, which can be established with deeper IRAC observations, long before the arrival of the James Webb Space Telescope.
Z-dark search with the ATLAS detector
INSPIRE-00212108
2016-01-01
The search of the "hidden sector" via new neutral light bosons Z-dark ($Z_{d}$) could be revealed by the study of the decay of the discovered Higgs-like boson or any other undiscovered Higgs boson. After the LHC concluded a successful first period of running, the ATLAS Collaboration published its latest results on the $H\\rightarrow Z_{d}Z_{d}\\rightarrow 4l$ analysis using up to 20 fb$^{-1}$ of integrated luminosity at $\\sqrt{s}=8$ TeV. In this proceeding I present a summary of the recent results on the search of the $Z_{d}$ in the signature $H\\rightarrow Z_{d}Z_{d}\\rightarrow 4l$ with the ATLAS detector at the LHC.
Silencing inhibits Cre-mediated recombination of the Z/AP and Z/EG reporters in adult cells.
Directory of Open Access Journals (Sweden)
Michael A Long
Full Text Available BACKGROUND: The Cre-loxP system has been used to enable tissue specific activation, inactivation and mutation of many genes in vivo and has thereby greatly facilitated the genetic dissection of several cellular and developmental processes. In such studies, Cre-reporter strains, which carry a Cre-activated marker gene, are frequently utilized to validate the expression profile of Cre transgenes, to act as a surrogate marker for excision of a second allele, and to irreversibly label cells for lineage tracing experiments. PRINCIPAL FINDINGS: We have studied three commonly used Cre-reporter strains, Z/AP, Z/EG and R26R-EYFP and have demonstrated that although each reporter can be reliably activated by Cre during early development, exposure to Cre in adult hematopoietic cells results in a much lower frequency of marker-positive cells in the Z/AP or Z/EG strains than in the R26R-EYFP strain. In marker negative cells derived from the Z/AP and Z/EG strains, the transgenic promoter is methylated and Cre-mediated recombination of the locus is inhibited. CONCLUSIONS: These results show that the efficiency of Cre-mediated recombination is not only dependent on the genomic context of a given loxP-flanked sequence, but also on stochastic epigenetic mechanisms underlying transgene variegation. Furthermore, our data highlights the potential shortcomings of utilizing the Z/AP and Z/EG reporters as surrogate markers of excision or in lineage tracing experiments.
Silencing inhibits Cre-mediated recombination of the Z/AP and Z/EG reporters in adult cells.
Long, Michael A; Rossi, Fabio M V
2009-01-01
The Cre-loxP system has been used to enable tissue specific activation, inactivation and mutation of many genes in vivo and has thereby greatly facilitated the genetic dissection of several cellular and developmental processes. In such studies, Cre-reporter strains, which carry a Cre-activated marker gene, are frequently utilized to validate the expression profile of Cre transgenes, to act as a surrogate marker for excision of a second allele, and to irreversibly label cells for lineage tracing experiments. We have studied three commonly used Cre-reporter strains, Z/AP, Z/EG and R26R-EYFP and have demonstrated that although each reporter can be reliably activated by Cre during early development, exposure to Cre in adult hematopoietic cells results in a much lower frequency of marker-positive cells in the Z/AP or Z/EG strains than in the R26R-EYFP strain. In marker negative cells derived from the Z/AP and Z/EG strains, the transgenic promoter is methylated and Cre-mediated recombination of the locus is inhibited. These results show that the efficiency of Cre-mediated recombination is not only dependent on the genomic context of a given loxP-flanked sequence, but also on stochastic epigenetic mechanisms underlying transgene variegation. Furthermore, our data highlights the potential shortcomings of utilizing the Z/AP and Z/EG reporters as surrogate markers of excision or in lineage tracing experiments.
Probing the z > 6 universe with the first Hubble frontier fields cluster A2744
International Nuclear Information System (INIS)
Atek, Hakim; Kneib, Jean-Paul; Richard, Johan; Clement, Benjamin; Egami, Eiichi; Ebeling, Harald; Jauzac, Mathilde; Jullo, Eric; Limousin, Marceau; Laporte, Nicolas; Natarajan, Priyamvada
2014-01-01
The Hubble Frontier Fields program combines the capabilities of the Hubble Space Telescope (HST) with the gravitational lensing of massive galaxy clusters to probe the distant universe to an unprecedented depth. Here, we present the results of the first combined HST and Spitzer observations of the cluster A-2744. We combine the full near-infrared data with ancillary optical images to search for gravitationally lensed high-redshift (z ≳ 6) galaxies. We report the detection of 15 I 814 dropout candidates at z ∼ 6-7 and one Y 105 dropout at z ∼ 8 in a total survey area of 1.43 arcmin 2 in the source plane. The predictions of our lens model also allow us to identify five multiply imaged systems lying at redshifts between z ∼ 6 and z ∼ 8. Thanks to constraints from the mass distribution in the cluster, we were able to estimate the effective survey volume corrected for completeness and magnification effects. This was in turn used to estimate the rest-frame ultraviolet luminosity function (LF) at z ∼ 6-8. Our LF results are generally in agreement with the most recent blank field estimates, confirming the feasibility of surveys through lensing clusters. Although based on a shallower observations than what will be achieved in the final data set including the full Advanced Camera for Survey observations, the LF presented here goes down to M UV ∼–18.5, corresponding to 0.2L * at z ∼ 7 with one identified object at M UV ∼–15 thanks to the highly magnified survey areas. This early study forecasts the power of using massive galaxy clusters as cosmic telescopes and its complementarity to blank fields.
Probing the z > 6 universe with the first Hubble frontier fields cluster A2744
Energy Technology Data Exchange (ETDEWEB)
Atek, Hakim; Kneib, Jean-Paul [Laboratoire d' Astrophysique, Ecole Polytechnique Fédérale de Lausanne, Observatoire de Sauverny, CH-1290 Versoix (Switzerland); Richard, Johan [CRAL, Observatoire de Lyon, Université Lyon 1, 9 Avenue Ch. André, 69561 Saint Genis Laval Cedex (France); Clement, Benjamin; Egami, Eiichi [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ, 85721 (United States); Ebeling, Harald [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, Hawaii 96822 (United States); Jauzac, Mathilde [Astrophysics and Cosmology Research Unit, School of Mathematical Sciences, University of KwaZulu-Natal, Durban, 4041 South Africa (South Africa); Jullo, Eric; Limousin, Marceau [Aix Marseille Université, CNRS, LAM (Laboratoire d' Astrophysique de Marseille) UMR 7326, 13388, Marseille (France); Laporte, Nicolas [Instituto de Astrofisica de Canarias (IAC), E-38200 La Laguna, Tenerife (Spain); Natarajan, Priyamvada [Department of Astronomy, Yale University, 260 Whitney Avenue, New Haven, CT 06511 (United States)
2014-05-01
The Hubble Frontier Fields program combines the capabilities of the Hubble Space Telescope (HST) with the gravitational lensing of massive galaxy clusters to probe the distant universe to an unprecedented depth. Here, we present the results of the first combined HST and Spitzer observations of the cluster A-2744. We combine the full near-infrared data with ancillary optical images to search for gravitationally lensed high-redshift (z ≳ 6) galaxies. We report the detection of 15 I {sub 814} dropout candidates at z ∼ 6-7 and one Y {sub 105} dropout at z ∼ 8 in a total survey area of 1.43 arcmin{sup 2} in the source plane. The predictions of our lens model also allow us to identify five multiply imaged systems lying at redshifts between z ∼ 6 and z ∼ 8. Thanks to constraints from the mass distribution in the cluster, we were able to estimate the effective survey volume corrected for completeness and magnification effects. This was in turn used to estimate the rest-frame ultraviolet luminosity function (LF) at z ∼ 6-8. Our LF results are generally in agreement with the most recent blank field estimates, confirming the feasibility of surveys through lensing clusters. Although based on a shallower observations than what will be achieved in the final data set including the full Advanced Camera for Survey observations, the LF presented here goes down to M {sub UV} ∼–18.5, corresponding to 0.2L {sup *} at z ∼ 7 with one identified object at M {sub UV} ∼–15 thanks to the highly magnified survey areas. This early study forecasts the power of using massive galaxy clusters as cosmic telescopes and its complementarity to blank fields.
Architecture of petawatt-class z-pinch accelerators
Directory of Open Access Journals (Sweden)
W. A. Stygar
2007-03-01
Full Text Available We have developed an accelerator architecture that can serve as the basis of the design of petawatt-class z-pinch drivers. The architecture has been applied to the design of two z-pinch accelerators, each of which can be contained within a 104-m-diameter cylindrical tank. One accelerator is driven by slow (∼1 μs Marx generators, which are a mature technology but which necessitate significant pulse compression to achieve the short pulses (≪1 μs required to drive z pinches. The other is powered by linear transformer drivers (LTDs, which are less mature but produce much shorter pulses than conventional Marxes. Consequently, an LTD-driven accelerator promises to be (at a given pinch current and implosion time more efficient and reliable. The Marx-driven accelerator produces a peak electrical power of 500 TW and includes the following components: (i 300 Marx generators that comprise a total of 1.8×10^{4} capacitors, store 98 MJ, and erect to 5 MV; (ii 600 water-dielectric triplate intermediate-store transmission lines, which also serve as pulse-forming lines; (iii 600 5-MV laser-triggered gas switches; (iv three monolithic radial-transmission-line impedance transformers, with triplate geometries and exponential impedance profiles; (v a 6-level 5.5-m-diameter 15-MV vacuum insulator stack; (vi six magnetically insulated vacuum transmission lines (MITLs; and (vii a triple-post-hole vacuum convolute that adds the output currents of the six MITLs, and delivers the combined current to a z-pinch load. The accelerator delivers an effective peak current of 52 MA to a 10-mm-length z pinch that implodes in 95 ns, and 57 MA to a pinch that implodes in 120 ns. The LTD-driven accelerator includes monolithic radial transformers and a MITL system similar to those described above, but does not include intermediate-store transmission lines, multimegavolt gas switches, or a laser trigger system. Instead, this accelerator is driven by 210
Energy Technology Data Exchange (ETDEWEB)
Bauce, Matteo [Padua U.
2009-01-01
This thesis describes the measurement of Z 0 Z 0 production cross section in pp collisions at the CDF (Compact Detector at Fermilab) experiment at Tevatron. The determination of this quantity is important to test Standard Model predictions of Electro-Weak couplings. Moreover the Z$^{0}$Z^{0}$ reconstruction is an important step for the Higgs boson searches in the high mass region. The cross section measurement has been done in the four massive lepton decay channel that has a small branching ratio but it is characterized by a very low background contribution. The search for Z$^{0$Z$^{0}$ $\\rightarrow$ $llll$ ($l=e,\\mu$) has been performed using 4.8 fb$^{-1}$ of data collected by CDF using lepton triggers. The number of expected signal events is 4.68 $\\pm$ 0.78 while the background contributes with 0.041 $\\pm$ 0.033 events. We observe 5 events, that corresponds to a significance of 5.70 $\\sigma$. This is the first observation of a Z$^{0}$Z$^{0}$ signal at CDF. With these events we measure a cross section of 1.56$^{+0.80}_{-0.63}$ (stat.) $\\pm$ 0.25(syst.) pb, in agreement with the Standard Model value 1.4 $\\pm$ 0.1 pb at Next to Leading Order.
Mishra, Saurabh; Jakkala, Kishor; Srinivasan, Ramanujam; Arumugam, Muthu; Ranjeri, Raghavendra; Gupta, Prabuddha; Rajeswari, Haryadi; Ajitkumar, Parthasarathi
2015-01-01
Nucleoside diphosphate kinase (NDK), conserved across bacteria to humans, synthesises NTP from NDP and ATP. The eukaryotic homologue, the NDPK, uses ATP to phosphorylate the tubulin-bound GDP to GTP for tubulin polymerisation. The bacterial cytokinetic protein FtsZ, which is the tubulin homologue, also uses GTP for polymerisation. Therefore, we examined whether NDK can interact with FtsZ to convert FtsZ-bound GDP and/or free GDP to GTP to trigger FtsZ polymerisation. Recombinant and native NDK and FtsZ proteins of Mycobacterium smegmatis and Mycobacterium tuberculosis were used as the experimental samples. FtsZ polymersation was monitored using 90° light scattering and FtsZ polymer pelleting assays. The γ32P-GTP synthesised by NDK from GDP and γ32P-ATP was detected using thin layer chromatography and quantitated using phosphorimager. The FtsZ bound 32P-GTP was quantitated using phosphorimager, after UV-crosslinking, followed by SDS-PAGE. The NDK-FtsZ interaction was determined using Ni2+-NTA-pulldown assay and co-immunoprecipitation of the recombinant and native proteins in vitro and ex vivo, respectively. NDK triggered instantaneous polymerisation of GDP-precharged recombinant FtsZ in the presence of ATP, similar to the polymerisation of recombinant FtsZ (not GDP-precharged) upon the direct addition of GTP. Similarly, NDK triggered polymerisation of recombinant FtsZ (not GDP-precharged) in the presence of free GDP and ATP as well. Mutant NDK, partially deficient in GTP synthesis from ATP and GDP, triggered low level of polymerisation of MsFtsZ, but not of MtFtsZ. As characteristic of NDK's NTP substrate non-specificity, it used CTP, TTP, and UTP also to convert GDP to GTP, to trigger FtsZ polymerisation. The NDK of one mycobacterial species could trigger the polymerisation of the FtsZ of another mycobacterial species. Both the recombinant and the native NDK and FtsZ showed interaction with each other in vitro and ex vivo, alluding to the possibility of direct
Mishra, Saurabh; Jakkala, Kishor; Srinivasan, Ramanujam; Arumugam, Muthu; Ranjeri, Raghavendra; Gupta, Prabuddha; Rajeswari, Haryadi; Ajitkumar, Parthasarathi
2015-01-01
Introduction Nucleoside diphosphate kinase (NDK), conserved across bacteria to humans, synthesises NTP from NDP and ATP. The eukaryotic homologue, the NDPK, uses ATP to phosphorylate the tubulin-bound GDP to GTP for tubulin polymerisation. The bacterial cytokinetic protein FtsZ, which is the tubulin homologue, also uses GTP for polymerisation. Therefore, we examined whether NDK can interact with FtsZ to convert FtsZ-bound GDP and/or free GDP to GTP to trigger FtsZ polymerisation. Methods Recombinant and native NDK and FtsZ proteins of Mycobacterium smegmatis and Mycobacterium tuberculosis were used as the experimental samples. FtsZ polymersation was monitored using 90° light scattering and FtsZ polymer pelleting assays. The γ32P-GTP synthesised by NDK from GDP and γ32P-ATP was detected using thin layer chromatography and quantitated using phosphorimager. The FtsZ bound 32P-GTP was quantitated using phosphorimager, after UV-crosslinking, followed by SDS-PAGE. The NDK-FtsZ interaction was determined using Ni2+-NTA-pulldown assay and co-immunoprecipitation of the recombinant and native proteins in vitro and ex vivo, respectively. Results NDK triggered instantaneous polymerisation of GDP-precharged recombinant FtsZ in the presence of ATP, similar to the polymerisation of recombinant FtsZ (not GDP-precharged) upon the direct addition of GTP. Similarly, NDK triggered polymerisation of recombinant FtsZ (not GDP-precharged) in the presence of free GDP and ATP as well. Mutant NDK, partially deficient in GTP synthesis from ATP and GDP, triggered low level of polymerisation of MsFtsZ, but not of MtFtsZ. As characteristic of NDK’s NTP substrate non-specificity, it used CTP, TTP, and UTP also to convert GDP to GTP, to trigger FtsZ polymerisation. The NDK of one mycobacterial species could trigger the polymerisation of the FtsZ of another mycobacterial species. Both the recombinant and the native NDK and FtsZ showed interaction with each other in vitro and ex vivo, alluding
Universality violations at the Z
International Nuclear Information System (INIS)
Rizzo, T.G.
1990-01-01
Universality violations (UV) in the decays of the Z would be a clear signal for new physics beyond the Standard Model (SM). We explore two scenarios which lead to UV in Z decays which may be observable at LEP/SLC and are easily distinguishable from each other. For simplicity, we concentrate on the leptonic decay modes of the Z and discuss present and future limits on these two models. 6 refs., 2 figs
FtsZ placement in nucleoid-free bacteria.
Directory of Open Access Journals (Sweden)
Manuel Pazos
Full Text Available We describe the placement of the cytoplasmic FtsZ protein, an essential component of the division septum, in nucleoid-free Escherichia coli maxicells. The absence of the nucleoid is accompanied in maxicells by degradation of the SlmA protein. This protein, together with the nucleoid, prevents the placement of the septum in the regions occupied by the chromosome by a mechanism called nucleoid occlusion (NO. A second septum placement mechanism, the MinCDE system (Min involving a pole-to-pole oscillation of three proteins, nonetheless remains active in maxicells. Both Min and NO act on the polymerization of FtsZ, preventing its assembly into an FtsZ-ring except at midcell. Our results show that even in the total absence of NO, Min oscillations can direct placement of FtsZ in maxicells. Deletion of the FtsZ carboxyl terminal domain (FtsZ*, a central hub that receives signals from a variety of proteins including MinC, FtsA and ZipA, produces a Min-insensitive form of FtsZ unable to interact with the membrane-anchoring FtsA and ZipA proteins. This protein produces a totally disorganized pattern of FtsZ localization inside the maxicell cytoplasm. In contrast, FtsZ*-VM, an artificially cytoplasmic membrane-anchored variant of FtsZ*, forms helical or repetitive ring structures distributed along the entire length of maxicells even in the absence of NO. These results show that membrane anchoring is needed to organize FtsZ into rings and underscore the role of the C-terminal hub of FtsZ for their correct placement.
FtsZ placement in nucleoid-free bacteria.
Pazos, Manuel; Casanova, Mercedes; Palacios, Pilar; Margolin, William; Natale, Paolo; Vicente, Miguel
2014-01-01
We describe the placement of the cytoplasmic FtsZ protein, an essential component of the division septum, in nucleoid-free Escherichia coli maxicells. The absence of the nucleoid is accompanied in maxicells by degradation of the SlmA protein. This protein, together with the nucleoid, prevents the placement of the septum in the regions occupied by the chromosome by a mechanism called nucleoid occlusion (NO). A second septum placement mechanism, the MinCDE system (Min) involving a pole-to-pole oscillation of three proteins, nonetheless remains active in maxicells. Both Min and NO act on the polymerization of FtsZ, preventing its assembly into an FtsZ-ring except at midcell. Our results show that even in the total absence of NO, Min oscillations can direct placement of FtsZ in maxicells. Deletion of the FtsZ carboxyl terminal domain (FtsZ*), a central hub that receives signals from a variety of proteins including MinC, FtsA and ZipA, produces a Min-insensitive form of FtsZ unable to interact with the membrane-anchoring FtsA and ZipA proteins. This protein produces a totally disorganized pattern of FtsZ localization inside the maxicell cytoplasm. In contrast, FtsZ*-VM, an artificially cytoplasmic membrane-anchored variant of FtsZ*, forms helical or repetitive ring structures distributed along the entire length of maxicells even in the absence of NO. These results show that membrane anchoring is needed to organize FtsZ into rings and underscore the role of the C-terminal hub of FtsZ for their correct placement.
Directory of Open Access Journals (Sweden)
Claire E Turner
Full Text Available Streptococcus pyogenes M/emm3 strains have been epidemiologically linked with enhanced infection severity and risk of streptococcal toxic shock syndrome (STSS, a syndrome triggered by superantigenic stimulation of T cells. Comparison of S. pyogenes strains causing STSS demonstrated that emm3 strains were surprisingly less mitogenic than other emm-types (emm1, emm12, emm18, emm28, emm87, emm89 both in vitro and in vivo, indicating poor superantigenic activity. We identified a 13 bp deletion in the superantigen smeZ gene of all emm3 strains tested. The deletion led to a premature stop codon in smeZ, and was not present in other major emm-types tested. Expression of a functional non-M3-smeZ gene successfully enhanced mitogenic activity in emm3 S. pyogenes and also restored mitogenic activity to emm1 and emm89 S. pyogenes strains where the smeZ gene had been disrupted. In contrast, the M3-smeZ gene with the 13 bp deletion could not enhance or restore mitogenicity in any of these S. pyogenes strains, confirming that M3-smeZ is non-functional regardless of strain background. The mutation in M3-smeZ reduced the potential for M3 S. pyogenes to induce cytokines in human tonsil, but not during invasive infection of superantigen-sensitive mice. Notwithstanding epidemiological associations with STSS and disease severity, emm3 strains have inherently poor superantigenicity that is explained by a conserved mutation in smeZ.
Directory of Open Access Journals (Sweden)
Marco A.C. Kneipp
2016-12-01
Full Text Available We consider a Yang–Mills–Higgs theory with the gauge group SU(3 broken to its center Z3 by two scalar fields in the adjoint representation and obtain new Z3 strings asymptotic configurations with the gauge field and magnetic field in the direction of the step operators.
Mikniūtė, Viktorija
2016-01-01
Raised paper problem- the coming of Z generation, which causes a lot of inconvenience enterprises, as the employers are not awere of this generation and the companies are worried about this. The emplyment of this new generation is influenced by the lack of employees, even in the media they are described as incompetent and lazy people. The goal of this paper- to analyse the factors which motivate Z generation by carrying out the overview of their distinctive features and by studying the fac...
The diverse evolutionary paths of simulated high-z massive, compact galaxies to z = 0
Wellons, Sarah; Torrey, Paul; Ma, Chung-Pei; Rodriguez-Gomez, Vicente; Pillepich, Annalisa; Nelson, Dylan; Genel, Shy; Vogelsberger, Mark; Hernquist, Lars
2016-02-01
Massive quiescent galaxies have much smaller physical sizes at high redshift than today. The strong evolution of galaxy size may be caused by progenitor bias, major and minor mergers, adiabatic expansion, and/or renewed star formation, but it is difficult to test these theories observationally. Herein, we select a sample of 35 massive, compact galaxies (M* = 1-3 × 1011 M⊙, M*/R1.5 > 1010.5 M⊙/kpc1.5) at z = 2 in the cosmological hydrodynamical simulation Illustris and trace them forwards to z = 0 to uncover their evolution and identify their descendants. By z = 0, the original factor of 3 difference in stellar mass spreads to a factor of 20. The dark matter halo masses similarly spread from a factor of 5 to 40. The galaxies' evolutionary paths are diverse: about half acquire an ex situ envelope and are the core of a more massive descendant, a third survive undisturbed and gain very little mass, 15 per cent are consumed in a merger with a more massive galaxy, and a small remainder are thoroughly mixed by major mergers. The galaxies grow in size as well as mass, and only ˜10 per cent remain compact by z = 0. The majority of the size growth is driven by the acquisition of ex situ mass. The most massive galaxies at z = 0 are the most likely to have compact progenitors, but this trend possesses significant dispersion which precludes a direct linkage to compact galaxies at z = 2. The compact galaxies' merger rates are influenced by their z = 2 environments, so that isolated or satellite compact galaxies (which are protected from mergers) are the most likely to survive to the present day.
Triglyceridy extrahované z tukových těles čmeláků
Czech Academy of Sciences Publication Activity Database
Krafková, Edita; Cvačka, Josef; Kindl, Jiří; Hovorka, Oldřich; Jiroš, Pavel; Valterová, Irena
2005-01-01
Roč. 99, č. 11 (2005), s. 852 ISSN 0009-2770. [Pokroky v organické, bioorganické a farmaceutické chemii /40./. 18.11.2005-20.11.2005, Nymburk] R&D Projects: GA AV ČR(CZ) IAA4055403 Institutional research plan: CEZ:AV0Z4055905 Keywords : triacylglycerols * bumblebee males Subject RIV: CC - Organic Chemistry
The zero curvature form of integrable hierarchies in the Z x Z-matrices
Helminck, G.F.; Opimakh, A.V.
2012-01-01
In this paper it is shown how one can associate to a finite number of commuting directions in the Lie algebra of upper triangular Z X Z-matrices an integrable hierarchy consisting of a set of evolution equations for perturbations of the basic directions inside the mentioned Lie algebra. They amount
The achievements of the Z-machine
International Nuclear Information System (INIS)
Larousserie, D.
2008-01-01
The ZR-machine that represents the latest generation of Z-pinch machines has recently begun preliminary testing before its full commissioning in Albuquerque (Usa). During its test the machine has well operated with electrical currents whose intensities of 26 million Ampere are already 2 times as high as the intensity of the operating current of the previous Z-machine. In 2006 the Z-machine reached temperatures of 2 billions Kelvin while 100 million Kelvin would be sufficient to ignite thermonuclear fusion. In fact the concept of Z-pinch machines was imagined in the fifties but the technological breakthrough that has allowed this recent success and the reborn of Z-machine, was the replacement of gas by an array of metal wires through which the electrical current flows and vaporizes it creating an imploding plasma. It is not well understood why Z-pinch machines generate far more radiation than theoretically expected. (A.C.)
Leontsinis, Stefanos
2018-01-01
The observation of the $\\mathrm{Z}$ boson rare decay to a $\\psi$ meson and two oppositely charged same-flavour leptons, $\\ell^+ \\ell^-$, where $\\psi$ represents the sum of $\\mathrm{J}/\\psi$ and $\\psi(\\mathrm{2S})\\to\\mathrm{J}/\\psi\\, X$, and $\\ell=\\mu,\\mathrm{e}$, is presented. The data sample used corresponds to an integrated luminosity of $35.9\\,\\mathrm{fb}^{-1}$ of proton-proton collisions at a center-of-mass energy of $13\\,\\mathrm{TeV}$ accumulated by the CMS experiment at the LHC. The signal is observed with a significance in excess of 5 standard deviations. Removing contributions from $\\psi(\\mathrm{2S})$ decays to $\\mathrm{J}/\\psi$, the signal is interpreted as being entirely from $\\mathrm{Z}\\to\\mathrm{J}/\\psi\\,\\ell^+\\ell^-$, with its fiducial branching fraction relative to that of the decay $\\mathrm{Z}\\to\\mu^+\\mu^-\\mu^+\\mu^-$ measured to be $$\\frac{\\mathcal{B}(\\mathrm{Z}\\to\\mathrm{J}/\\psi\\,\\ell^+\\ell^-)}{\\mathcal{B}(\\mathrm{Z}\\to\\mu^+\\mu^-\\mu^+\\mu^-)}=0.70\\pm 0.18\\, \\mathrm{(stat)} \\pm 0.05\\, \\mathrm{(s...
Bout, A.; Dirkx, G.H.P.
2012-01-01
In deze bijdrage komt aan bod hoe zeer de natuur van ons land gevormd is door menselijk handelen. De grote verscheidenheid die hert Nederlandse landschap kenmerkt is sterk bepaald door verschillen in landgebruik. Iedere streek kent zijn eigen boerderijen, gewassen, veerassen, verkavelingspatronen en
Trans-Z-source Neutral Point Clamped inverter
DEFF Research Database (Denmark)
Mo, W.; Loh, P. C.; Li, D.
2012-01-01
Transformer based Z-source (trans-Z-source) inverters are recently proposed by extending the traditional Z-source inverter with higher buck-boost capability as well as reducing the passive components at the same time. Multi-Level Z-source inverters are single-stage topological solutions used...... for buck-boost energy conversion with all the favourable advantages of multi-level switching retained. This paper presents three-level trans-Z-source Neutral Point Clamped (NPC) inverter topology, which achieves both the advantages of trans-Z-source and three-level NPC inverter configuration. With proper...... modulation scheme, the three-level trans-Z-source inverter can function with minimum of six device commutations per half carrier cycle (same as the traditional buck NPC inverter), while maintaining to produce the designed volt-sec average and inductive voltage boosting at ac output terminals. The designed...
Ferkinhoff, Carl
The 2nd generation z (Redshift) and Early Universe Spectrometer (ZEUS-2), is a long-slit echelle-grating spectrometer (R~1000) for observations at submillimeter wavelengths from 200 to 850 microm. Its design is optimized for the detection of redshifted far-infrared spectral lines from galaxies in the early universe. Combining exquisite sensitivity, broad wavelength coverage, and large (˜2.5%) instantaneous bandwidth, ZEUS-2 is uniquely suited for studying galaxies between z˜0.2 and 5---spanning the peaks in both the star formation rate and number of AGN in the universe. ZEUS-2 saw first light at the Caltech Submillimeter Observatory (CSO) in the Spring of 2012 and was commissioned on the Atacama Pathfinder Experiment (APEX) in November 2012. Here we detail the design and performance of ZEUS-2, first however we discuss important science results that are examples of the science enabled by ZEUS-2. Using the first generation z (Redshift) and Early Universe Spectrometer (ZEUS-1) we made the first high-z detections of the [NII] 122 microm and [OIII] 88 microm lines. We detect these lines from starburst galaxies between z ˜2.5 and 4 demonstrating the utility of these lines for characterizing the properties of early galaxies. Specifically we are able to determine the most massive star still on the main sequence, the number of those stars and a lower limit on the mass of ionized gas in the source. Next we present ZEUS-2's first science result. Using ZEUS-2 on APEX we have detected the [CII] 158 microm line from the z = 1.78 galaxy H-ATLAS J091043.1-000322 with a line flux of (6.44 +/- 0.42) ˜ 10-18 W m-2. Combined with its far-infrared luminosity and a new Herschel-PACS detection of the [OI] 63 microm line we are able to conclude that H-ATLAS J091043.1-000322 is a high redshift analogue of a local ultra-luminous infrared galaxy, i.e. it is likely the site of a compact starburst due to a major merger. This detection, combined with the ZEUS-1 observations of the [NII
Navy Advertising: Targeting Generation Z
2015-12-01
NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA MBA PROFESSIONAL REPORT NAVY ADVERTISING : TARGETING GENERATION Z December......study recommends improvements for Navy advertising efficiency by examining characteristics of recruits defined as Generation Z. Data gathered from five
Continuum photon spectrum from Z1Z1 annihilations in universal extra dimensions
International Nuclear Information System (INIS)
Melbéus, Henrik; Merle, Alexander; Ohlsson, Tommy
2012-01-01
We calculate the continuum photon spectrum from the pair annihilation of a Z 1 LKP in non-minimal universal extra dimensions. We find that, due to the preferred annihilation into W + W - pairs, the continuum flux of collinear photons is relatively small compared to the standard case of the B 1 as the LKP. This conclusion applies in particular to the spectral endpoint, where also the additional fermionic contributions are not large enough to increase the flux significantly. When searching for the line signal originating from Z 1 Z 1 annihilations, this is actually a perfect situation, since the continuum signal can be regarded as background to the smoking gun signature of a peak in the photon flux at an energy that is nearly equal to the mass of the dark matter particle. This signal, in combination with (probably) a non-observation of the continuum signal at lower photon energies, constitutes a perfect handle to probe the hypothesis of the Z 1 LKP being the dominant component of the dark matter observed in the Universe.
DISSECTION OF H{alpha} EMITTERS : LOW-z ANALOGS OF z > 4 STAR-FORMING GALAXIES
Energy Technology Data Exchange (ETDEWEB)
Shim, Hyunjin [Department of Earth Science Education, Kyungpook National University (Korea, Republic of); Chary, Ranga-Ram, E-mail: hjshim@knu.ac.kr [U.S. Planck Data Center, California Institute of Technology, MS 220-6, Pasadena, CA 91125 (United States)
2013-03-01
Strong H{alpha} emitters (HAEs) dominate the z {approx} 4 Lyman-break galaxy (LBG) population. We have identified local analogs of these HAEs using the Sloan Digital Sky Survey. At z < 0.4, only 0.04% of the galaxies are classified as HAEs with H{alpha} equivalent widths ({approx}> 500 A) comparable to that of z {approx} 4 HAEs. Local HAEs have lower stellar mass and lower ultraviolet (UV) luminosity than z {approx} 4 HAEs, yet the H{alpha}-to-UV luminosity ratio, as well as their specific star formation rate, is consistent with that of z {approx} 4 HAEs, indicating that they are scaled-down versions of high-z star-forming galaxies. Compared to the previously studied local analogs of LBGs selected using rest-frame UV properties, local HAEs show similar UV luminosity surface density, weaker D{sub n} (4000) break, lower metallicity, and lower stellar mass. This implies that the local HAEs are less evolved galaxies than the traditional Lyman break analogs. In the stacked spectrum, local HAEs show a significant He II {lambda}4686 emission line suggesting a population of hot, massive stars similar to that seen in some Wolf-Rayet galaxies. Low [N II]/[O III] line flux ratios imply that local HAEs are inconsistent with being systems that host bright active galactic nuclei. Instead, it is highly likely that local HAEs are galaxies with an elevated ionization parameter, either due to a high electron density or large escape fraction of hydrogen ionizing photons as in the case of Wolf-Rayet galaxies.
Directory of Open Access Journals (Sweden)
Marek Zawadzki
2011-08-01
Full Text Available Cel: Porównanie wpływu zażywania opatentowanego, stabilizowanego CO2 oleju z nowozelandzkich małży zielonych Perna canaliculus(PCSO-524™ oraz oleju z ryb [zawierającego standaryzowanąmieszaninę kwasu eikozapentaenowego (eicosapentaenoicacid – EPA – 18%, i kwasu dokozaheksaenowego (docosahexaenoicacid – DHA – 12%] na łagodzenie bólu, zmiany w wyznacznikachjakości życia i bezpieczeństwo u pacjentów z chorobą zwyrodnieniowąstawów kolanowych i/lub biodrowych.Materiały i metody: U 50 pacjentów w wieku powyżej 50 lat, którzypodpisali świadomą zgodę na udział w powyższym badaniu, leczonychw Poradni Reumatologicznej Akademickiego Szpitala Klinicznegowe Wrocławiu, stosowano kapsułki Lyprinol® zawierającePCSO-524™ lub kapsułki z olejem z ryb. Badanie przeprowadzonometodą podwójnie ślepej próby. U wszystkich uczestników badaniarozpoznano chorobę zwyrodnieniową dużych stawów obwodowych.Charakterystykę grup przedstawiono w tabelach I i II.Tuż przed rozpoczęciem badania oraz w 4., 8. i 12. tygodniu jegotrwania od pacjentów zbierano informacje dotyczące intensywnościodczuwanego bólu za pomocą wizualnej skali analogowej(VAS; oceny stanu zdrowia z zastosowaniem kwestionariuszaoceny stanu zdrowia; ogólnego stanu zdrowia i subiektywnej ocenyprzebiegu choroby. Aby określić bezpieczeństwo stosowania suplementów, przed rozpoczęciem badania i po jego zakończeniuprzeprowadzono analizę parametrów morfologii krwi, OB, poziomuAlAT oraz badania moczu.Wyniki: U pacjentów, którym podawano PCSO-524™, zaobserwowanoistotne obniżenie intensywności odczuwanego bólu związanegoz chorobą zwyrodnieniową stawów oraz ogólną poprawęjakości życia (tab. III–V, ryc. 1 i 2. U chorych z tej grupy nie wystąpiłyżadne działania niepożądane. W grupie pacjentów leczonycholejem z ryb zaobserwowano statystycznie istotną mniejszą poprawę(p < 0,05. Dodatkowo u niektórych z nich wystąpiły objawyniepo
18 CFR 284.8 - Release of firm capacity on interstate pipelines.
2010-04-01
... of this part is granted a limited-jurisdiction blanket certificate of public convenience and... utilized by the replacement shipper to provide the gas supply requirement of retail consumers pursuant to a... that provides delivery service to such retail consumers. [Order 636, 57 FR 13318, Apr. 16, 1992, as...
International Nuclear Information System (INIS)
Viotti, R.; Giangrande, A.; Ricciardi, O.; Cassatella, A.
1982-01-01
Z And is considered as the ''prototype'' of the symbiotic stars. Besides its symbiotic spectrum, the star is also known for its characteristic light curve (and for the related spectral variations). Since many theoretical speculations on Z And and similar objects have been based on the luminosity and spectral variations of this star, the authors critically analyse the observational data concerning it. (Auth.)
Determination of the δ15N and δ18O of nitrate in water; RSIL lab code 2900
Coplen, Tyler B.; Qi, Haiping; Revesz, Kinga; Casciotti, Karen; Hannon, Janet E.
2007-01-01
The purpose of the Reston Stable Isotope Laboratory (RSIL) lab code 2900 is to determine the δ15N and δ18O of nitrate (NO3-) in water. The δ15N and δ18O of the dissolved NO3- are analyzed by converting the NO3- to nitrous oxide (N2O), which serves as the analyte for mass spectrometry. A culture of denitrifying bacteria is used in the enzymatic conversion of the NO3- to N2O, which follows the pathway shown in equation 1: NO3- → NO2- → NO → 1/2 N2O (1) Because the bacteria Pseudomonas aureofaciens lack N2O reductive activity, the reaction stops at N2O, unlike the typical denitrification reaction that goes to N2. After several hours, the conversion is complete, and the N2O is extracted from the vial, separated from volatile organic vapor and water vapor by an automated -65 °C isopropanol-slush trap, a Nafion drier, a CO2 and water removal unit (Costech #021020 carbon dioxide absorbent with Mg(ClO4)2), and trapped in a small-volume trap immersed in liquid nitrogen with a modified Finnigan MAT (now Thermo Scientific) GasBench 2 introduction system. After the N2O is released, it is further purified by gas chromatography before introduction to the isotope-ratio mass spectrometer (IRMS). The IRMS is a Thermo Scientific Delta V Plus continuous flow IRMS (CF-IRMS). It has a universal triple collector, consisting of two wide cups with a narrow cup in the middle; it is capable of simultaneously measuring mass/charge (m/z) of the N2O molecule 44, 45, and 46. The ion beams from these m/z values are as follows: m/z = 44 = N2O = 14N14N16O; m/z = 45 = N2O = 14N15N16O or 14N14N17O; m/z = 46 = N2O = 14N14N18O. The 17O contributions to the m/z 44 and m/z 45 ion beams are accounted for before δ15N values are reported.
Z-Z' mixing effects in W±-boson pair production processes at hadron and lepton high-energy colliders
International Nuclear Information System (INIS)
Bobovnikov, I.D.; Pankov, A.A.
2016-01-01
The potential to search for Z−Z' mixing in the W ± -boson pair production processes in proton-proton and electron-positron collisions at the Large Hadron Collider (LHC) and International Linear Collider (ILC), respectively, was studied. We found that the W ± -boson pair production processes are very sensitive to Z−Z' mixing angle, and their measurements at current and future collider experiments allow one to improve the present limits on Z−Z' mixing for the investigated models with extended gauge sector. The LHC at nominal energy and integrated luminosity, 14 TeV and 100 fb -1 , can provide a much more precise information on Z-Z' mixing and Z 2 mass, M 2 , with respect to those which can be obtained at the lepton collider ILC (0.5 TeV)
DEFF Research Database (Denmark)
Danielsen, Hilmar; Hald, John
2004-01-01
The complex nitride Z-phase, Cr(V,Nb)N, has recently been identified as a major cause for premature breakdown in creep strength of a number of new 9-12%Cr martensitic steels. A thermodynamic model of the Z-phase has been created based on the Thermo-Calc software. The model predicts the Z-phase to......The complex nitride Z-phase, Cr(V,Nb)N, has recently been identified as a major cause for premature breakdown in creep strength of a number of new 9-12%Cr martensitic steels. A thermodynamic model of the Z-phase has been created based on the Thermo-Calc software. The model predicts the Z......-phase to be stable in all of the new 9-12%Cr martensitic steels. This has generally been confirmed by the performed experiments. Z-phase precipitation seems to be a kinetic problem, and drivning force calculations using Thermo-Calc with the developed model have been used to predict steel compositions, which...
Sirunyan, A. M.; Tumasyan, A.; Adam, W.; Ambrogi, F.; Asilar, E.; Bergauer, T.; Brandstetter, J.; Brondolin, E.; Dragicevic, M.; Erö, J.; Flechl, M.; Friedl, M.; Frühwirth, R.; Ghete, V. M.; Grossmann, J.; Hrubec, J.; Jeitler, M.; König, A.; Krammer, N.; Krätschmer, I.; Liko, D.; Madlener, T.; Mikulec, I.; Pree, E.; Rabady, D.; Rad, N.; Rohringer, H.; Schieck, J.; Schöfbeck, R.; Spanring, M.; Spitzbart, D.; Waltenberger, W.; Wittmann, J.; Wulz, C.-E.; Zarucki, M.; Chekhovsky, V.; Mossolov, V.; Suarez Gonzalez, J.; De Wolf, E. A.; Di Croce, D.; Janssen, X.; Lauwers, J.; Van Haevermaet, H.; Van Mechelen, P.; Van Remortel, N.; Abu Zeid, S.; Blekman, F.; D'Hondt, J.; De Bruyn, I.; De Clercq, J.; Deroover, K.; Flouris, G.; Lontkovskyi, D.; Lowette, S.; Moortgat, S.; Moreels, L.; Python, Q.; Skovpen, K.; Tavernier, S.; Van Doninck, W.; Van Mulders, P.; Van Parijs, I.; Brun, H.; Clerbaux, B.; De Lentdecker, G.; Delannoy, H.; Fasanella, G.; Favart, L.; Goldouzian, R.; Grebenyuk, A.; Karapostoli, G.; Lenzi, T.; Luetic, J.; Maerschalk, T.; Marinov, A.; Randle-conde, A.; Seva, T.; Vander Velde, C.; Vanlaer, P.; Vannerom, D.; Yonamine, R.; Zenoni, F.; Zhang, F.; Cimmino, A.; Cornelis, T.; Dobur, D.; Fagot, A.; Gul, M.; Khvastunov, I.; Poyraz, D.; Roskas, C.; Salva, S.; Tytgat, M.; Verbeke, W.; Zaganidis, N.; Bakhshiansohi, H.; Bondu, O.; Brochet, S.; Bruno, G.; Caputo, C.; Caudron, A.; De Visscher, S.; Delaere, C.; Delcourt, M.; Francois, B.; Giammanco, A.; Jafari, A.; Komm, M.; Krintiras, G.; Lemaitre, V.; Magitteri, A.; Mertens, A.; Musich, M.; Piotrzkowski, K.; Quertenmont, L.; Vidal Marono, M.; Wertz, S.; Beliy, N.; Aldá Júnior, W. L.; Alves, F. L.; Alves, G. A.; Brito, L.; Correa Martins Junior, M.; Hensel, C.; Moraes, A.; Pol, M. E.; Rebello Teles, P.; Belchior Batista Das Chagas, E.; Carvalho, W.; Chinellato, J.; Custódio, A.; Da Costa, E. M.; Da Silveira, G. G.; De Jesus Damiao, D.; Fonseca De Souza, S.; Huertas Guativa, L. M.; Malbouisson, H.; Melo De Almeida, M.; Mora Herrera, C.; Mundim, L.; Nogima, H.; Santoro, A.; Sznajder, A.; Tonelli Manganote, E. J.; Torres Da Silva De Araujo, F.; Vilela Pereira, A.; Ahuja, S.; Bernardes, C. A.; Fernandez Perez Tomei, T. R.; Gregores, E. M.; Mercadante, P. G.; Novaes, S. F.; Padula, Sandra S.; Romero Abad, D.; Ruiz Vargas, J. C.; Aleksandrov, A.; Hadjiiska, R.; Iaydjiev, P.; Misheva, M.; Rodozov, M.; Shopova, M.; Stoykova, S.; Sultanov, G.; Dimitrov, A.; Glushkov, I.; Litov, L.; Pavlov, B.; Petkov, P.; Fang, W.; Gao, X.; Ahmad, M.; Bian, J. G.; Chen, G. M.; Chen, H. S.; Chen, M.; Chen, Y.; Jiang, C. H.; Leggat, D.; Liao, H.; Liu, Z.; Romeo, F.; Shaheen, S. M.; Spiezia, A.; Tao, J.; Wang, C.; Wang, Z.; Yazgan, E.; Zhang, H.; Zhang, S.; Zhao, J.; Ban, Y.; Chen, G.; Li, Q.; Liu, S.; Mao, Y.; Qian, S. J.; Wang, D.; Xu, Z.; Avila, C.; Cabrera, A.; Chaparro Sierra, L. F.; Florez, C.; González Hernández, C. F.; Ruiz Alvarez, J. D.; Courbon, B.; Godinovic, N.; Lelas, D.; Puljak, I.; Ribeiro Cipriano, P. M.; Sculac, T.; Antunovic, Z.; Kovac, M.; Brigljevic, V.; Ferencek, D.; Kadija, K.; Mesic, B.; Starodumov, A.; Susa, T.; Ather, M. W.; Attikis, A.; Mavromanolakis, G.; Mousa, J.; Nicolaou, C.; Ptochos, F.; Razis, P. A.; Rykaczewski, H.; Finger, M.; Finger, M.; Carrera Jarrin, E.; Assran, Y.; Elgammal, S.; Mahrous, A.; Dewanjee, R. K.; Kadastik, M.; Perrini, L.; Raidal, M.; Tiko, A.; Veelken, C.; Eerola, P.; Pekkanen, J.; Voutilainen, M.; Härkönen, J.; Järvinen, T.; Karimäki, V.; Kinnunen, R.; Lampén, T.; Lassila-Perini, K.; Lehti, S.; Lindén, T.; Luukka, P.; Tuominen, E.; Tuominiemi, J.; Tuovinen, E.; Talvitie, J.; Tuuva, T.; Besancon, M.; Couderc, F.; Dejardin, M.; Denegri, D.; Faure, J. L.; Ferri, F.; Ganjour, S.; Ghosh, S.; Givernaud, A.; Gras, P.; Hamel de Monchenault, G.; Jarry, P.; Kucher, I.; Locci, E.; Machet, M.; Malcles, J.; Negro, G.; Rander, J.; Rosowsky, A.; Sahin, M. Ö.; Titov, M.; Abdulsalam, A.; Antropov, I.; Baffioni, S.; Beaudette, F.; Busson, P.; Cadamuro, L.; Charlot, C.; Granier de Cassagnac, R.; Jo, M.; Lisniak, S.; Lobanov, A.; Martin Blanco, J.; Nguyen, M.; Ochando, C.; Ortona, G.; Paganini, P.; Pigard, P.; Salerno, R.; Sauvan, J. B.; Sirois, Y.; Stahl Leiton, A. G.; Strebler, T.; Yilmaz, Y.; Zabi, A.; Zghiche, A.; Agram, J.-L.; Andrea, J.; Bloch, D.; Brom, J.-M.; Buttignol, M.; Chabert, E. C.; Chanon, N.; Collard, C.; Conte, E.; Coubez, X.; Fontaine, J.-C.; Gelé, D.; Goerlach, U.; Jansová, M.; Le Bihan, A.-C.; Tonon, N.; Van Hove, P.; Gadrat, S.; Beauceron, S.; Bernet, C.; Boudoul, G.; Chierici, R.; Contardo, D.; Depasse, P.; El Mamouni, H.; Fay, J.; Finco, L.; Gascon, S.; Gouzevitch, M.; Grenier, G.; Ille, B.; Lagarde, F.; Laktineh, I. B.; Lethuillier, M.; Mirabito, L.; Pequegnot, A. L.; Perries, S.; Popov, A.; Sordini, V.; Vander Donckt, M.; Viret, S.; Toriashvili, T.; Tsamalaidze, Z.; Autermann, C.; Feld, L.; Kiesel, M. K.; Klein, K.; Lipinski, M.; Preuten, M.; Schomakers, C.; Schulz, J.; Verlage, T.; Zhukov, V.; Albert, A.; Dietz-Laursonn, E.; Duchardt, D.; Endres, M.; Erdmann, M.; Erdweg, S.; Esch, T.; Fischer, R.; Güth, A.; Hamer, M.; Hebbeker, T.; Heidemann, C.; Hoepfner, K.; Knutzen, S.; Merschmeyer, M.; Meyer, A.; Millet, P.; Mukherjee, S.; Olschewski, M.; Pook, T.; Radziej, M.; Reithler, H.; Rieger, M.; Scheuch, F.; Teyssier, D.; Thüer, S.; Flügge, G.; Kargoll, B.; Kress, T.; Künsken, A.; Lingemann, J.; Müller, T.; Nehrkorn, A.; Nowack, A.; Pistone, C.; Pooth, O.; Stahl, A.; Aldaya Martin, M.; Arndt, T.; Asawatangtrakuldee, C.; Beernaert, K.; Behnke, O.; Behrens, U.; Bermúdez Martínez, A.; Bin Anuar, A. A.; Borras, K.; Botta, V.; Campbell, A.; Connor, P.; Contreras-Campana, C.; Costanza, F.; Diez Pardos, C.; Eckerlin, G.; Eckstein, D.; Eichhorn, T.; Eren, E.; Gallo, E.; Garay Garcia, J.; Geiser, A.; Gizhko, A.; Grados Luyando, J. M.; Grohsjean, A.; Gunnellini, P.; Guthoff, M.; Harb, A.; Hauk, J.; Hempel, M.; Jung, H.; Kalogeropoulos, A.; Kasemann, M.; Keaveney, J.; Kleinwort, C.; Korol, I.; Krücker, D.; Lange, W.; Lelek, A.; Lenz, T.; Leonard, J.; Lipka, K.; Lohmann, W.; Mankel, R.; Melzer-Pellmann, I.-A.; Meyer, A. B.; Mittag, G.; Mnich, J.; Mussgiller, A.; Ntomari, E.; Pitzl, D.; Raspereza, A.; Roland, B.; Savitskyi, M.; Saxena, P.; Shevchenko, R.; Spannagel, S.; Stefaniuk, N.; Van Onsem, G. P.; Walsh, R.; Wen, Y.; Wichmann, K.; Wissing, C.; Zenaiev, O.; Bein, S.; Blobel, V.; Centis Vignali, M.; Dreyer, T.; Garutti, E.; Gonzalez, D.; Haller, J.; Hinzmann, A.; Hoffmann, M.; Karavdina, A.; Klanner, R.; Kogler, R.; Kovalchuk, N.; Kurz, S.; Lapsien, T.; Marchesini, I.; Marconi, D.; Meyer, M.; Niedziela, M.; Nowatschin, D.; Pantaleo, F.; Peiffer, T.; Perieanu, A.; Scharf, C.; Schleper, P.; Schmidt, A.; Schumann, S.; Schwandt, J.; Sonneveld, J.; Stadie, H.; Steinbrück, G.; Stober, F. M.; Stöver, M.; Tholen, H.; Troendle, D.; Usai, E.; Vanelderen, L.; Vanhoefer, A.; Vormwald, B.; Akbiyik, M.; Barth, C.; Baur, S.; Butz, E.; Caspart, R.; Chwalek, T.; Colombo, F.; De Boer, W.; Dierlamm, A.; Freund, B.; Friese, R.; Giffels, M.; Gilbert, A.; Haitz, D.; Hartmann, F.; Heindl, S. M.; Husemann, U.; Kassel, F.; Kudella, S.; Mildner, H.; Mozer, M. U.; Müller, Th.; Plagge, M.; Quast, G.; Rabbertz, K.; Schäfer, D.; Schröder, M.; Shvetsov, I.; Sieber, G.; Simonis, H. J.; Ulrich, R.; Wayand, S.; Weber, M.; Weiler, T.; Williamson, S.; Wöhrmann, C.; Wolf, R.; Anagnostou, G.; Daskalakis, G.; Geralis, T.; Giakoumopoulou, V. A.; Kyriakis, A.; Loukas, D.; Topsis-Giotis, I.; Karathanasis, G.; Kesisoglou, S.; Panagiotou, A.; Saoulidou, N.; Kousouris, K.; Evangelou, I.; Foudas, C.; Kokkas, P.; Mallios, S.; Manthos, N.; Papadopoulos, I.; Paradas, E.; Strologas, J.; Triantis, F. A.; Csanad, M.; Filipovic, N.; Pasztor, G.; Veres, G. I.; Bencze, G.; Hajdu, C.; Horvath, D.; Hunyadi, Á.; Sikler, F.; Veszpremi, V.; Zsigmond, A. J.; Beni, N.; Czellar, S.; Karancsi, J.; Makovec, A.; Molnar, J.; Szillasi, Z.; Bartók, M.; Raics, P.; Trocsanyi, Z. L.; Ujvari, B.; Choudhury, S.; Komaragiri, J. R.; Bahinipati, S.; Bhowmik, S.; Mal, P.; Mandal, K.; Nayak, A.; Sahoo, D. K.; Sahoo, N.; Swain, S. K.; Bansal, S.; Beri, S. B.; Bhatnagar, V.; Chawla, R.; Dhingra, N.; Kalsi, A. K.; Kaur, A.; Kaur, M.; Kumar, R.; Kumari, P.; Mehta, A.; Singh, J. B.; Walia, G.; Kumar, Ashok; Shah, Aashaq; Bhardwaj, A.; Chauhan, S.; Choudhary, B. C.; Garg, R. B.; Keshri, S.; Kumar, A.; Malhotra, S.; Naimuddin, M.; Ranjan, K.; Sharma, R.; Bhardwaj, R.; Bhattacharya, R.; Bhattacharya, S.; Bhawandeep, U.; Dey, S.; Dutt, S.; Dutta, S.; Ghosh, S.; Majumdar, N.; Modak, A.; Mondal, K.; Mukhopadhyay, S.; Nandan, S.; Purohit, A.; Roy, A.; Roy, D.; Roy Chowdhury, S.; Sarkar, S.; Sharan, M.; Thakur, S.; Behera, P. K.; Chudasama, R.; Dutta, D.; Jha, V.; Kumar, V.; Mohanty, A. K.; Netrakanti, P. K.; Pant, L. M.; Shukla, P.; Topkar, A.; Aziz, T.; Dugad, S.; Mahakud, B.; Mitra, S.; Mohanty, G. B.; Sur, N.; Sutar, B.; Banerjee, S.; Bhattacharya, S.; Chatterjee, S.; Das, P.; Guchait, M.; Jain, Sa.; Kumar, S.; Maity, M.; Majumder, G.; Mazumdar, K.; Sarkar, T.; Wickramage, N.; Chauhan, S.; Dube, S.; Hegde, V.; Kapoor, A.; Kothekar, K.; Pandey, S.; Rane, A.; Sharma, S.; Chenarani, S.; Eskandari Tadavani, E.; Etesami, S. M.; Khakzad, M.; Mohammadi Najafabadi, M.; Naseri, M.; Paktinat Mehdiabadi, S.; Rezaei Hosseinabadi, F.; Safarzadeh, B.; Zeinali, M.; Felcini, M.; Grunewald, M.; Abbrescia, M.; Calabria, C.; Colaleo, A.; Creanza, D.; Cristella, L.; De Filippis, N.; De Palma, M.; Errico, F.; Fiore, L.; Iaselli, G.; Lezki, S.; Maggi, G.; Maggi, M.; Miniello, G.; My, S.; Nuzzo, S.; Pompili, A.; Pugliese, G.; Radogna, R.; Ranieri, A.; Selvaggi, G.; Sharma, A.; Silvestris, L.; Venditti, R.; Verwilligen, P.; Abbiendi, G.; Battilana, C.; Bonacorsi, D.; Braibant-Giacomelli, S.; Campanini, R.; Capiluppi, P.; Castro, A.; Cavallo, F. R.; Chhibra, S. S.; Codispoti, G.; Cuffiani, M.; Dallavalle, G. M.; Fabbri, F.; Fanfani, A.; Fasanella, D.; Giacomelli, P.; Grandi, C.; Guiducci, L.; Marcellini, S.; Masetti, G.; Montanari, A.; Navarria, F. L.; Perrotta, A.; Rossi, A. M.; Rovelli, T.; Siroli, G. P.; Tosi, N.; Albergo, S.; Costa, S.; Di Mattia, A.; Giordano, F.; Potenza, R.; Tricomi, A.; Tuve, C.; Barbagli, G.; Chatterjee, K.; Ciulli, V.; Civinini, C.; D'Alessandro, R.; Focardi, E.; Lenzi, P.; Meschini, M.; Paoletti, S.; Russo, L.; Sguazzoni, G.; Strom, D.; Viliani, L.; Benussi, L.; Bianco, S.; Fabbri, F.; Piccolo, D.; Primavera, F.; Calvelli, V.; Ferro, F.; Robutti, E.; Tosi, S.; Benaglia, A.; Brianza, L.; Brivio, F.; Ciriolo, V.; Dinardo, M. E.; Fiorendi, S.; Gennai, S.; Ghezzi, A.; Govoni, P.; Malberti, M.; Malvezzi, S.; Manzoni, R. A.; Menasce, D.; Moroni, L.; Paganoni, M.; Pauwels, K.; Pedrini, D.; Pigazzini, S.; Ragazzi, S.; Redaelli, N.; Tabarelli de Fatis, T.; Buontempo, S.; Cavallo, N.; Di Guida, S.; Fabozzi, F.; Fienga, F.; Iorio, A. O. M.; Khan, W. A.; Lista, L.; Meola, S.; Paolucci, P.; Sciacca, C.; Thyssen, F.; Azzi, P.; Bacchetta, N.; Benato, L.; Bisello, D.; Boletti, A.; Carlin, R.; Carvalho Antunes De Oliveira, A.; Checchia, P.; Dall'Osso, M.; De Castro Manzano, P.; Dorigo, T.; Dosselli, U.; Gasparini, F.; Gasparini, U.; Gozzelino, A.; Lacaprara, S.; Lujan, P.; Margoni, M.; Meneguzzo, A. T.; Pozzobon, N.; Ronchese, P.; Rossin, R.; Sgaravatto, M.; Torassa, E.; Zanetti, M.; Zumerle, G.; Braghieri, A.; Magnani, A.; Montagna, P.; Ratti, S. P.; Re, V.; Ressegotti, M.; Riccardi, C.; Salvini, P.; Vai, I.; Vitulo, P.; Alunni Solestizi, L.; Biasini, M.; Bilei, G. M.; Cecchi, C.; Ciangottini, D.; Fanò, L.; Lariccia, P.; Leonardi, R.; Manoni, E.; Mantovani, G.; Mariani, V.; Menichelli, M.; Rossi, A.; Santocchia, A.; Spiga, D.; Androsov, K.; Azzurri, P.; Bagliesi, G.; Boccali, T.; Borrello, L.; Castaldi, R.; Ciocci, M. A.; Dell'Orso, R.; Fedi, G.; Giannini, L.; Giassi, A.; Grippo, M. T.; Ligabue, F.; Lomtadze, T.; Manca, E.; Mandorli, G.; Martini, L.; Messineo, A.; Palla, F.; Rizzi, A.; Savoy-Navarro, A.; Spagnolo, P.; Tenchini, R.; Tonelli, G.; Venturi, A.; Verdini, P. G.; Barone, L.; Cavallari, F.; Cipriani, M.; Daci, N.; Del Re, D.; Di Marco, E.; Diemoz, M.; Gelli, S.; Longo, E.; Margaroli, F.; Marzocchi, B.; Meridiani, P.; Organtini, G.; Paramatti, R.; Preiato, F.; Rahatlou, S.; Rovelli, C.; Santanastasio, F.; Amapane, N.; Arcidiacono, R.; Argiro, S.; Arneodo, M.; Bartosik, N.; Bellan, R.; Biino, C.; Cartiglia, N.; Cenna, F.; Costa, M.; Covarelli, R.; Degano, A.; Demaria, N.; Kiani, B.; Mariotti, C.; Maselli, S.; Migliore, E.; Monaco, V.; Monteil, E.; Monteno, M.; Obertino, M. M.; Pacher, L.; Pastrone, N.; Pelliccioni, M.; Pinna Angioni, G. L.; Ravera, F.; Romero, A.; Ruspa, M.; Sacchi, R.; Shchelina, K.; Sola, V.; Solano, A.; Staiano, A.; Traczyk, P.; Belforte, S.; Casarsa, M.; Cossutti, F.; Della Ricca, G.; Zanetti, A.; Kim, D. H.; Kim, G. N.; Kim, M. S.; Lee, J.; Lee, S.; Lee, S. W.; Moon, C. S.; Oh, Y. D.; Sekmen, S.; Son, D. C.; Yang, Y. C.; Lee, A.; Kim, H.; Moon, D. H.; Oh, G.; Brochero Cifuentes, J. A.; Goh, J.; Kim, T. J.; Cho, S.; Choi, S.; Go, Y.; Gyun, D.; Ha, S.; Hong, B.; Jo, Y.; Kim, Y.; Lee, K.; Lee, K. S.; Lee, S.; Lim, J.; Park, S. K.; Roh, Y.; Almond, J.; Kim, J.; Kim, J. S.; Lee, H.; Lee, K.; Nam, K.; Oh, S. B.; Radburn-Smith, B. C.; Seo, S. h.; Yang, U. K.; Yoo, H. D.; Yu, G. B.; Choi, M.; Kim, H.; Kim, J. H.; Lee, J. S. H.; Park, I. C.; Choi, Y.; Hwang, C.; Lee, J.; Yu, I.; Dudenas, V.; Juodagalvis, A.; Vaitkus, J.; Ahmed, I.; Ibrahim, Z. A.; Md Ali, M. A. B.; Mohamad Idris, F.; Wan Abdullah, W. A. T.; Yusli, M. N.; Zolkapli, Z.; Reyes-Almanza, R.; Ramirez-Sanchez, G.; Duran-Osuna, M. C.; Castilla-Valdez, H.; De La Cruz-Burelo, E.; Heredia-De La Cruz, I.; Rabadan-Trejo, R. I.; Lopez-Fernandez, R.; Mejia Guisao, J.; Sanchez-Hernandez, A.; Carrillo Moreno, S.; Oropeza Barrera, C.; Vazquez Valencia, F.; Pedraza, I.; Salazar Ibarguen, H. A.; Uribe Estrada, C.; Morelos Pineda, A.; Krofcheck, D.; Butler, P. H.; Ahmad, A.; Ahmad, M.; Hassan, Q.; Hoorani, H. R.; Saddique, A.; Shah, M. A.; Shoaib, M.; Waqas, M.; Bialkowska, H.; Bluj, M.; Boimska, B.; Frueboes, T.; Górski, M.; Kazana, M.; Nawrocki, K.; Szleper, M.; Zalewski, P.; Bunkowski, K.; Byszuk, A.; Doroba, K.; Kalinowski, A.; Konecki, M.; Krolikowski, J.; Misiura, M.; Olszewski, M.; Pyskir, A.; Walczak, M.; Bargassa, P.; Beirão Da Cruz E Silva, C.; Di Francesco, A.; Faccioli, P.; Galinhas, B.; Gallinaro, M.; Hollar, J.; Leonardo, N.; Lloret Iglesias, L.; Nemallapudi, M. V.; Seixas, J.; Strong, G.; Toldaiev, O.; Vadruccio, D.; Varela, J.; Afanasiev, S.; Bunin, P.; Gavrilenko, M.; Golutvin, I.; Gorbunov, I.; Kamenev, A.; Karjavin, V.; Lanev, A.; Malakhov, A.; Matveev, V.; Palichik, V.; Perelygin, V.; Shmatov, S.; Shulha, S.; Skatchkov, N.; Smirnov, V.; Voytishin, N.; Zarubin, A.; Ivanov, Y.; Kim, V.; Kuznetsova, E.; Levchenko, P.; Murzin, V.; Oreshkin, V.; Smirnov, I.; Sulimov, V.; Uvarov, L.; Vavilov, S.; Vorobyev, A.; Andreev, Yu.; Dermenev, A.; Gninenko, S.; Golubev, N.; Karneyeu, A.; Kirsanov, M.; Krasnikov, N.; Pashenkov, A.; Tlisov, D.; Toropin, A.; Epshteyn, V.; Gavrilov, V.; Lychkovskaya, N.; Popov, V.; Pozdnyakov, I.; Safronov, G.; Spiridonov, A.; Stepennov, A.; Toms, M.; Vlasov, E.; Zhokin, A.; Aushev, T.; Bylinkin, A.; Chadeeva, M.; Markin, O.; Parygin, P.; Philippov, D.; Polikarpov, S.; Rusinov, V.; Andreev, V.; Azarkin, M.; Dremin, I.; Kirakosyan, M.; Terkulov, A.; Baskakov, A.; Belyaev, A.; Boos, E.; Bunichev, V.; Dubinin, M.; Dudko, L.; Ershov, A.; Gribushin, A.; Klyukhin, V.; Kodolova, O.; Lokhtin, I.; Miagkov, I.; Obraztsov, S.; Petrushanko, S.; Savrin, V.; Blinov, V.; Skovpen, Y.; Shtol, D.; Azhgirey, I.; Bayshev, I.; Bitioukov, S.; Elumakhov, D.; Kachanov, V.; Kalinin, A.; Konstantinov, D.; Petrov, V.; Ryutin, R.; Sobol, A.; Troshin, S.; Tyurin, N.; Uzunian, A.; Volkov, A.; Adzic, P.; Cirkovic, P.; Devetak, D.; Dordevic, M.; Milosevic, J.; Rekovic, V.; Alcaraz Maestre, J.; Barrio Luna, M.; Cerrada, M.; Colino, N.; De La Cruz, B.; Delgado Peris, A.; Escalante Del Valle, A.; Fernandez Bedoya, C.; Fernández Ramos, J. P.; Flix, J.; Fouz, M. C.; Garcia-Abia, P.; Gonzalez Lopez, O.; Goy Lopez, S.; Hernandez, J. M.; Josa, M. I.; Moran, D.; Pérez-Calero Yzquierdo, A.; Puerta Pelayo, J.; Quintario Olmeda, A.; Redondo, I.; Romero, L.; Soares, M. S.; Álvarez Fernández, A.; de Trocóniz, J. F.; Missiroli, M.; Cuevas, J.; Erice, C.; Fernandez Menendez, J.; Gonzalez Caballero, I.; González Fernández, J. R.; Palencia Cortezon, E.; Sanchez Cruz, S.; Vischia, P.; Vizan Garcia, J. M.; Cabrillo, I. J.; Calderon, A.; Chazin Quero, B.; Curras, E.; Duarte Campderros, J.; Fernandez, M.; Garcia-Ferrero, J.; Gomez, G.; Lopez Virto, A.; Marco, J.; Martinez Rivero, C.; Martinez Ruiz del Arbol, P.; Matorras, F.; Piedra Gomez, J.; Rodrigo, T.; Ruiz-Jimeno, A.; Scodellaro, L.; Trevisani, N.; Vila, I.; Vilar Cortabitarte, R.; Abbaneo, D.; Auffray, E.; Baillon, P.; Ball, A. H.; Barney, D.; Bianco, M.; Bloch, P.; Bocci, A.; Botta, C.; Camporesi, T.; Castello, R.; Cepeda, M.; Cerminara, G.; Chapon, E.; Chen, Y.; d'Enterria, D.; Dabrowski, A.; Daponte, V.; David, A.; De Gruttola, M.; De Roeck, A.; Dobson, M.; Dorney, B.; du Pree, T.; Dünser, M.; Dupont, N.; Elliott-Peisert, A.; Everaerts, P.; Fallavollita, F.; Franzoni, G.; Fulcher, J.; Funk, W.; Gigi, D.; Gill, K.; Glege, F.; Gulhan, D.; Harris, P.; Hegeman, J.; Innocente, V.; Janot, P.; Karacheban, O.; Kieseler, J.; Kirschenmann, H.; Knünz, V.; Kornmayer, A.; Kortelainen, M. J.; Krammer, M.; Lange, C.; Lecoq, P.; Lourenço, C.; Lucchini, M. T.; Malgeri, L.; Mannelli, M.; Martelli, A.; Meijers, F.; Merlin, J. A.; Mersi, S.; Meschi, E.; Milenovic, P.; Moortgat, F.; Mulders, M.; Neugebauer, H.; Orfanelli, S.; Orsini, L.; Pape, L.; Perez, E.; Peruzzi, M.; Petrilli, A.; Petrucciani, G.; Pfeiffer, A.; Pierini, M.; Racz, A.; Reis, T.; Rolandi, G.; Rovere, M.; Sakulin, H.; Schäfer, C.; Schwick, C.; Seidel, M.; Selvaggi, M.; Sharma, A.; Silva, P.; Sphicas, P.; Stakia, A.; Steggemann, J.; Stoye, M.; Tosi, M.; Treille, D.; Triossi, A.; Tsirou, A.; Veckalns, V.; Verweij, M.; Zeuner, W. D.; Bertl, W.; Caminada, L.; Deiters, K.; Erdmann, W.; Horisberger, R.; Ingram, Q.; Kaestli, H. C.; Kotlinski, D.; Langenegger, U.; Rohe, T.; Wiederkehr, S. A.; Bachmair, F.; Bäni, L.; Berger, P.; Bianchini, L.; Casal, B.; Dissertori, G.; Dittmar, M.; Donegà, M.; Grab, C.; Heidegger, C.; Hits, D.; Hoss, J.; Kasieczka, G.; Klijnsma, T.; Lustermann, W.; Mangano, B.; Marionneau, M.; Meinhard, M. T.; Meister, D.; Micheli, F.; Musella, P.; Nessi-Tedaldi, F.; Pandolfi, F.; Pata, J.; Pauss, F.; Perrin, G.; Perrozzi, L.; Quittnat, M.; Reichmann, M.; Schönenberger, M.; Shchutska, L.; Tavolaro, V. R.; Theofilatos, K.; Vesterbacka Olsson, M. L.; Wallny, R.; Zhu, D. H.; Aarrestad, T. K.; Amsler, C.; Canelli, M. F.; De Cosa, A.; Del Burgo, R.; Donato, S.; Galloni, C.; Hreus, T.; Kilminster, B.; Ngadiuba, J.; Pinna, D.; Rauco, G.; Robmann, P.; Salerno, D.; Seitz, C.; Takahashi, Y.; Zucchetta, A.; Candelise, V.; Doan, T. H.; Jain, Sh.; Khurana, R.; Kuo, C. M.; Lin, W.; Pozdnyakov, A.; Yu, S. S.; Kumar, Arun; Chang, P.; Chao, Y.; Chen, K. F.; Chen, P. H.; Fiori, F.; Hou, W.-S.; Hsiung, Y.; Liu, Y. F.; Lu, R.-S.; Paganis, E.; Psallidas, A.; Steen, A.; Tsai, J. f.; Asavapibhop, B.; Kovitanggoon, K.; Singh, G.; Srimanobhas, N.; Boran, F.; Cerci, S.; Damarseckin, S.; Demiroglu, Z. S.; Dozen, C.; Dumanoglu, I.; Girgis, S.; Gokbulut, G.; Guler, Y.; Hos, I.; Kangal, E. E.; Kara, O.; Kayis Topaksu, A.; Kiminsu, U.; Oglakci, M.; Onengut, G.; Ozdemir, K.; Sunar Cerci, D.; Tali, B.; Turkcapar, S.; Zorbakir, I. S.; Zorbilmez, C.; Bilin, B.; Karapinar, G.; Ocalan, K.; Yalvac, M.; Zeyrek, M.; Gülmez, E.; Kaya, M.; Kaya, O.; Tekten, S.; Yetkin, E. A.; Agaras, M. N.; Atay, S.; Cakir, A.; Cankocak, K.; Grynyov, B.; Levchuk, L.; Aggleton, R.; Ball, F.; Beck, L.; Brooke, J. J.; Burns, D.; Clement, E.; Cussans, D.; Davignon, O.; Flacher, H.; Goldstein, J.; Grimes, M.; Heath, G. P.; Heath, H. F.; Jacob, J.; Kreczko, L.; Lucas, C.; Newbold, D. M.; Paramesvaran, S.; Poll, A.; Sakuma, T.; Seif El Nasr-storey, S.; Smith, D.; Smith, V. J.; Bell, K. W.; Belyaev, A.; Brew, C.; Brown, R. M.; Calligaris, L.; Cieri, D.; Cockerill, D. J. A.; Coughlan, J. A.; Harder, K.; Harper, S.; Olaiya, E.; Petyt, D.; Shepherd-Themistocleous, C. H.; Thea, A.; Tomalin, I. R.; Williams, T.; Auzinger, G.; Bainbridge, R.; Breeze, S.; Buchmuller, O.; Bundock, A.; Casasso, S.; Citron, M.; Colling, D.; Corpe, L.; Dauncey, P.; Davies, G.; De Wit, A.; Della Negra, M.; Di Maria, R.; Elwood, A.; Haddad, Y.; Hall, G.; Iles, G.; James, T.; Lane, R.; Laner, C.; Lyons, L.; Magnan, A.-M.; Malik, S.; Mastrolorenzo, L.; Matsushita, T.; Nash, J.; Nikitenko, A.; Palladino, V.; Pesaresi, M.; Raymond, D. M.; Richards, A.; Rose, A.; Scott, E.; Seez, C.; Shtipliyski, A.; Summers, S.; Tapper, A.; Uchida, K.; Vazquez Acosta, M.; Virdee, T.; Wardle, N.; Winterbottom, D.; Wright, J.; Zenz, S. C.; Cole, J. E.; Hobson, P. R.; Khan, A.; Kyberd, P.; Reid, I. D.; Symonds, P.; Teodorescu, L.; Turner, M.; Borzou, A.; Call, K.; Dittmann, J.; Hatakeyama, K.; Liu, H.; Pastika, N.; Smith, C.; Bartek, R.; Dominguez, A.; Buccilli, A.; Cooper, S. I.; Henderson, C.; Rumerio, P.; West, C.; Arcaro, D.; Avetisyan, A.; Bose, T.; Gastler, D.; Rankin, D.; Richardson, C.; Rohlf, J.; Sulak, L.; Zou, D.; Benelli, G.; Cutts, D.; Garabedian, A.; Hakala, J.; Heintz, U.; Hogan, J. M.; Kwok, K. H. M.; Laird, E.; Landsberg, G.; Mao, Z.; Narain, M.; Pazzini, J.; Piperov, S.; Sagir, S.; Syarif, R.; Yu, D.; Band, R.; Brainerd, C.; Burns, D.; Calderon De La Barca Sanchez, M.; Chertok, M.; Conway, J.; Conway, R.; Cox, P. T.; Erbacher, R.; Flores, C.; Funk, G.; Gardner, M.; Ko, W.; Lander, R.; Mclean, C.; Mulhearn, M.; Pellett, D.; Pilot, J.; Shalhout, S.; Shi, M.; Smith, J.; Squires, M.; Stolp, D.; Tos, K.; Tripathi, M.; Wang, Z.; Bachtis, M.; Bravo, C.; Cousins, R.; Dasgupta, A.; Florent, A.; Hauser, J.; Ignatenko, M.; Mccoll, N.; Regnard, S.; Saltzberg, D.; Schnaible, C.; Valuev, V.; Bouvier, E.; Burt, K.; Clare, R.; Ellison, J.; Gary, J. W.; Ghiasi Shirazi, S. M. A.; Hanson, G.; Heilman, J.; Jandir, P.; Kennedy, E.; Lacroix, F.; Long, O. R.; Olmedo Negrete, M.; Paneva, M. I.; Shrinivas, A.; Si, W.; Wang, L.; Wei, H.; Wimpenny, S.; Yates, B. R.; Branson, J. G.; Cittolin, S.; Derdzinski, M.; Gerosa, R.; Hashemi, B.; Holzner, A.; Klein, D.; Kole, G.; Krutelyov, V.; Letts, J.; Macneill, I.; Masciovecchio, M.; Olivito, D.; Padhi, S.; Pieri, M.; Sani, M.; Sharma, V.; Simon, S.; Tadel, M.; Vartak, A.; Wasserbaech, S.; Wood, J.; Würthwein, F.; Yagil, A.; Zevi Della Porta, G.; Amin, N.; Bhandari, R.; Bradmiller-Feld, J.; Campagnari, C.; Dishaw, A.; Dutta, V.; Franco Sevilla, M.; George, C.; Golf, F.; Gouskos, L.; Gran, J.; Heller, R.; Incandela, J.; Mullin, S. D.; Ovcharova, A.; Qu, H.; Richman, J.; Stuart, D.; Suarez, I.; Yoo, J.; Anderson, D.; Bendavid, J.; Bornheim, A.; Lawhorn, J. M.; Newman, H. B.; Nguyen, T.; Pena, C.; Spiropulu, M.; Vlimant, J. R.; Xie, S.; Zhang, Z.; Zhu, R. Y.; Andrews, M. B.; Ferguson, T.; Mudholkar, T.; Paulini, M.; Russ, J.; Sun, M.; Vogel, H.; Vorobiev, I.; Weinberg, M.; Cumalat, J. P.; Ford, W. T.; Jensen, F.; Johnson, A.; Krohn, M.; Leontsinis, S.; Mulholland, T.; Stenson, K.; Wagner, S. R.; Alexander, J.; Chaves, J.; Chu, J.; Dittmer, S.; Mcdermott, K.; Mirman, N.; Patterson, J. R.; Rinkevicius, A.; Ryd, A.; Skinnari, L.; Soffi, L.; Tan, S. M.; Tao, Z.; Thom, J.; Tucker, J.; Wittich, P.; Zientek, M.; Abdullin, S.; Albrow, M.; Apollinari, G.; Apresyan, A.; Apyan, A.; Banerjee, S.; Bauerdick, L. A. T.; Beretvas, A.; Berryhill, J.; Bhat, P. C.; Bolla, G.; Burkett, K.; Butler, J. N.; Canepa, A.; Cerati, G. B.; Cheung, H. W. K.; Chlebana, F.; Cremonesi, M.; Duarte, J.; Elvira, V. D.; Freeman, J.; Gecse, Z.; Gottschalk, E.; Gray, L.; Green, D.; Grünendahl, S.; Gutsche, O.; Harris, R. M.; Hasegawa, S.; Hirschauer, J.; Hu, Z.; Jayatilaka, B.; Jindariani, S.; Johnson, M.; Joshi, U.; Klima, B.; Kreis, B.; Lammel, S.; Lincoln, D.; Lipton, R.; Liu, M.; Liu, T.; Lopes De Sá, R.; Lykken, J.; Maeshima, K.; Magini, N.; Marraffino, J. M.; Maruyama, S.; Mason, D.; McBride, P.; Merkel, P.; Mrenna, S.; Nahn, S.; O'Dell, V.; Pedro, K.; Prokofyev, O.; Rakness, G.; Ristori, L.; Schneider, B.; Sexton-Kennedy, E.; Soha, A.; Spalding, W. J.; Spiegel, L.; Stoynev, S.; Strait, J.; Strobbe, N.; Taylor, L.; Tkaczyk, S.; Tran, N. V.; Uplegger, L.; Vaandering, E. W.; Vernieri, C.; Verzocchi, M.; Vidal, R.; Wang, M.; Weber, H. A.; Whitbeck, A.; Acosta, D.; Avery, P.; Bortignon, P.; Bourilkov, D.; Brinkerhoff, A.; Carnes, A.; Carver, M.; Curry, D.; Field, R. D.; Furic, I. K.; Konigsberg, J.; Korytov, A.; Kotov, K.; Ma, P.; Matchev, K.; Mei, H.; Mitselmakher, G.; Rank, D.; Sperka, D.; Terentyev, N.; Thomas, L.; Wang, J.; Wang, S.; Yelton, J.; Joshi, Y. R.; Linn, S.; Markowitz, P.; Rodriguez, J. L.; Ackert, A.; Adams, T.; Askew, A.; Hagopian, S.; Hagopian, V.; Johnson, K. F.; Kolberg, T.; Martinez, G.; Perry, T.; Prosper, H.; Saha, A.; Santra, A.; Sharma, V.; Yohay, R.; Baarmand, M. M.; Bhopatkar, V.; Colafranceschi, S.; Hohlmann, M.; Noonan, D.; Roy, T.; Yumiceva, F.; Adams, M. R.; Apanasevich, L.; Berry, D.; Betts, R. R.; Cavanaugh, R.; Chen, X.; Evdokimov, O.; Gerber, C. E.; Hangal, D. A.; Hofman, D. J.; Jung, K.; Kamin, J.; Sandoval Gonzalez, I. D.; Tonjes, M. B.; Trauger, H.; Varelas, N.; Wang, H.; Wu, Z.; Zhang, J.; Bilki, B.; Clarida, W.; Dilsiz, K.; Durgut, S.; Gandrajula, R. P.; Haytmyradov, M.; Khristenko, V.; Merlo, J.-P.; Mermerkaya, H.; Mestvirishvili, A.; Moeller, A.; Nachtman, J.; Ogul, H.; Onel, Y.; Ozok, F.; Penzo, A.; Snyder, C.; Tiras, E.; Wetzel, J.; Yi, K.; Blumenfeld, B.; Cocoros, A.; Eminizer, N.; Fehling, D.; Feng, L.; Gritsan, A. V.; Maksimovic, P.; Roskes, J.; Sarica, U.; Swartz, M.; Xiao, M.; You, C.; Al-bataineh, A.; Baringer, P.; Bean, A.; Boren, S.; Bowen, J.; Castle, J.; Khalil, S.; Kropivnitskaya, A.; Majumder, D.; Mcbrayer, W.; Murray, M.; Royon, C.; Sanders, S.; Schmitz, E.; Tapia Takaki, J. D.; Wang, Q.; Ivanov, A.; Kaadze, K.; Maravin, Y.; Mohammadi, A.; Saini, L. K.; Skhirtladze, N.; Toda, S.; Rebassoo, F.; Wright, D.; Anelli, C.; Baden, A.; Baron, O.; Belloni, A.; Calvert, B.; Eno, S. C.; Ferraioli, C.; Hadley, N. J.; Jabeen, S.; Jeng, G. Y.; Kellogg, R. G.; Kunkle, J.; Mignerey, A. C.; Ricci-Tam, F.; Shin, Y. H.; Skuja, A.; Tonwar, S. C.; Abercrombie, D.; Allen, B.; Azzolini, V.; Barbieri, R.; Baty, A.; Bi, R.; Brandt, S.; Busza, W.; Cali, I. A.; D'Alfonso, M.; Demiragli, Z.; Gomez Ceballos, G.; Goncharov, M.; Hsu, D.; Iiyama, Y.; Innocenti, G. M.; Klute, M.; Kovalskyi, D.; Lai, Y. S.; Lee, Y.-J.; Levin, A.; Luckey, P. D.; Maier, B.; Marini, A. C.; Mcginn, C.; Mironov, C.; Narayanan, S.; Niu, X.; Paus, C.; Roland, C.; Roland, G.; Salfeld-Nebgen, J.; Stephans, G. S. F.; Tatar, K.; Velicanu, D.; Wang, J.; Wang, T. W.; Wyslouch, B.; Benvenuti, A. C.; Chatterjee, R. M.; Evans, A.; Hansen, P.; Kalafut, S.; Kubota, Y.; Lesko, Z.; Mans, J.; Nourbakhsh, S.; Ruckstuhl, N.; Rusack, R.; Turkewitz, J.; Acosta, J. G.; Oliveros, S.; Avdeeva, E.; Bloom, K.; Claes, D. R.; Fangmeier, C.; Gonzalez Suarez, R.; Kamalieddin, R.; Kravchenko, I.; Monroy, J.; Siado, J. E.; Snow, G. R.; Stieger, B.; Alyari, M.; Dolen, J.; Godshalk, A.; Harrington, C.; Iashvili, I.; Nguyen, D.; Parker, A.; Rappoccio, S.; Roozbahani, B.; Alverson, G.; Barberis, E.; Hortiangtham, A.; Massironi, A.; Morse, D. M.; Nash, D.; Orimoto, T.; Teixeira De Lima, R.; Trocino, D.; Wood, D.; Bhattacharya, S.; Charaf, O.; Hahn, K. A.; Mucia, N.; Odell, N.; Pollack, B.; Schmitt, M. H.; Sung, K.; Trovato, M.; Velasco, M.; Dev, N.; Hildreth, M.; Hurtado Anampa, K.; Jessop, C.; Karmgard, D. J.; Kellams, N.; Lannon, K.; Loukas, N.; Marinelli, N.; Meng, F.; Mueller, C.; Musienko, Y.; Planer, M.; Reinsvold, A.; Ruchti, R.; Smith, G.; Taroni, S.; Wayne, M.; Wolf, M.; Woodard, A.; Alimena, J.; Antonelli, L.; Bylsma, B.; Durkin, L. S.; Flowers, S.; Francis, B.; Hart, A.; Hill, C.; Ji, W.; Liu, B.; Luo, W.; Puigh, D.; Winer, B. L.; Wulsin, H. W.; Cooperstein, S.; Driga, O.; Elmer, P.; Hardenbrook, J.; Hebda, P.; Higginbotham, S.; Lange, D.; Luo, J.; Marlow, D.; Mei, K.; Ojalvo, I.; Olsen, J.; Palmer, C.; Piroué, P.; Stickland, D.; Tully, C.; Malik, S.; Norberg, S.; Barker, A.; Barnes, V. E.; Das, S.; Folgueras, S.; Gutay, L.; Jha, M. K.; Jones, M.; Jung, A. W.; Khatiwada, A.; Miller, D. H.; Neumeister, N.; Peng, C. C.; Schulte, J. F.; Sun, J.; Wang, F.; Xie, W.; Cheng, T.; Parashar, N.; Stupak, J.; Adair, A.; Akgun, B.; Chen, Z.; Ecklund, K. M.; Geurts, F. J. M.; Guilbaud, M.; Li, W.; Michlin, B.; Northup, M.; Padley, B. P.; Roberts, J.; Rorie, J.; Tu, Z.; Zabel, J.; Bodek, A.; de Barbaro, P.; Demina, R.; Duh, Y. t.; Ferbel, T.; Galanti, M.; Garcia-Bellido, A.; Han, J.; Hindrichs, O.; Khukhunaishvili, A.; Lo, K. H.; Tan, P.; Verzetti, M.; Ciesielski, R.; Goulianos, K.; Mesropian, C.; Agapitos, A.; Chou, J. P.; Gershtein, Y.; Gómez Espinosa, T. A.; Halkiadakis, E.; Heindl, M.; Hughes, E.; Kaplan, S.; Kunnawalkam Elayavalli, R.; Kyriacou, S.; Lath, A.; Montalvo, R.; Nash, K.; Osherson, M.; Saka, H.; Salur, S.; Schnetzer, S.; Sheffield, D.; Somalwar, S.; Stone, R.; Thomas, S.; Thomassen, P.; Walker, M.; Delannoy, A. G.; Foerster, M.; Heideman, J.; Riley, G.; Rose, K.; Spanier, S.; Thapa, K.; Bouhali, O.; Castaneda Hernandez, A.; Celik, A.; Dalchenko, M.; De Mattia, M.; Delgado, A.; Dildick, S.; Eusebi, R.; Gilmore, J.; Huang, T.; Kamon, T.; Mueller, R.; Pakhotin, Y.; Patel, R.; Perloff, A.; Perniè, L.; Rathjens, D.; Safonov, A.; Tatarinov, A.; Ulmer, K. A.; Akchurin, N.; Damgov, J.; De Guio, F.; Dudero, P. R.; Faulkner, J.; Gurpinar, E.; Kunori, S.; Lamichhane, K.; Lee, S. W.; Libeiro, T.; Peltola, T.; Undleeb, S.; Volobouev, I.; Wang, Z.; Greene, S.; Gurrola, A.; Janjam, R.; Johns, W.; Maguire, C.; Melo, A.; Ni, H.; Padeken, K.; Sheldon, P.; Tuo, S.; Velkovska, J.; Xu, Q.; Arenton, M. W.; Barria, P.; Cox, B.; Hirosky, R.; Joyce, M.; Ledovskoy, A.; Li, H.; Neu, C.; Sinthuprasith, T.; Wang, Y.; Wolfe, E.; Xia, F.; Harr, R.; Karchin, P. E.; Sturdy, J.; Zaleski, S.; Brodski, M.; Buchanan, J.; Caillol, C.; Dasu, S.; Dodd, L.; Duric, S.; Gomber, B.; Grothe, M.; Herndon, M.; Hervé, A.; Hussain, U.; Klabbers, P.; Lanaro, A.; Levine, A.; Long, K.; Loveless, R.; Pierro, G. A.; Polese, G.; Ruggles, T.; Savin, A.; Smith, N.; Smith, W. H.; Taylor, D.; Woods, N.; CMS Collaboration
2018-04-01
Results are presented from a search in the dijet final state for new massive narrow resonances decaying to pairs of W and Z bosons or to a W /Z boson and a quark. Results are based on data recorded in proton-proton collisions at √{s }=13 TeV with the CMS detector at the CERN LHC. The data correspond to an integrated luminosity of 35.9 fb-1 . The mass range investigated extends upwards from 1.2 TeV. No excess is observed above the estimated standard model background and limits are set at 95% confidence level on cross sections, which are interpreted in terms of various models that predict gravitons, heavy spin-1 bosons, and excited quarks. In a heavy vector triplet model, W' and Z' resonances, with masses below 3.2 and 2.7 TeV, respectively, and spin-1 resonances with degenerate masses below 3.8 TeV are excluded at 95% confidence level. In the case of a singlet W' resonance masses between 3.3 and 3.6 TeV can be excluded additionally. Similarly, excited quark resonances, q*, decaying to q W and q Z with masses less than 5.0 and 4.7 TeV, respectively, are excluded. In a narrow-width bulk graviton model, upper limits are set on cross sections ranging from 0.6 fb for high resonance masses above 3.6 TeV, to 36.0 fb for low resonance masses of 1.3 TeV.
Klementinský Nový zákon, památka na pomezí druhé biblické redakce
Czech Academy of Sciences Publication Activity Database
Kreisingerová, Hana
2011-01-01
Roč. 3, č. 2 (2011), s. 14-18 ISSN 1803-876X R&D Projects: GA ČR GAP406/10/1140; GA MŠk(CZ) LC546 Institutional research plan: CEZ:AV0Z90610518 Keywords : Old Czech * translation * Bible Subject RIV: AI - Linguistics
THE EXTENDED He IIλ4686-EMITTING REGION IN IZw 18 UNVEILED: CLUES FOR PECULIAR IONIZING SOURCES
Energy Technology Data Exchange (ETDEWEB)
Kehrig, C.; Vílchez, J. M.; Pérez-Montero, E.; Iglesias-Páramo, J.; Bayo, F. M. [Instituto de Astrofísica de Andalucía (CSIC), Glorieta de la Astronomía s/n, E-18008 Granada (Spain); Brinchmann, J. [Leiden Observatory, Leiden University, P.O. Box 9513, NL-2300 RA Leiden (Netherlands); Kunth, D.; Durret, F. [Institut d’Astrophysique de Paris, UMR 7095, CNRS and UPMC, 98 bis Bd Arago, F-75014 Paris (France)
2015-03-10
New integral field spectroscopy has been obtained for IZw 18, the nearby lowest-metallicity galaxy considered to be our best local analog of systems forming at high redshift (z). Here we report the spatially resolved spectral map of the nebular He ii λ4686 emission in IZw 18, from which we derived for the first time its total He ii-ionizing flux. Nebular He ii emission implies the existence of a hard radiation field. He ii-emitters are observed to be more frequent among high-z galaxies than for local objects. Therefore, investigating the He ii-ionizing source(s) in IZw 18 may reveal the ionization processes at high z. He ii emission in star-forming galaxies has been suggested to be mainly associated with Wolf–Rayet stars (WRs), but WRs cannot satisfactorily explain the He ii-ionization at all times, particularly at the lowest metallicities. Shocks from supernova remnants, or X-ray binaries, have been proposed as additional potential sources of He ii-ionizing photons. Our data indicate that conventional He ii-ionizing sources (WRs, shocks, X-ray binaries) are not sufficient to explain the observed nebular He iiλ4686 emission in IZw 18. We find that the He ii-ionizing radiation expected from models for either low-metallicity super-massive O stars or rotating metal-free stars could account for the He ii-ionization budget measured, while only the latter models could explain the highest values of He iiλ4686/Hβ observed. The presence of such peculiar stars in IZw 18 is suggestive and further investigation in this regard is needed. This letter highlights that some of the clues of the early universe can be found here in our cosmic backyard.
Energy Technology Data Exchange (ETDEWEB)
Jiang, Zhi-Yu [SUNY, Stony Brook
1995-08-01
This thesis is organized as the following: * Chapter 1 gives a brief introduction to the theoretical understanding of Z production.* Chapter 2 brie y discusses the modern technological wonder: the Fermilab Tevatron, a pp collider that made this thesis possible. * In chapter 3, the D0 detector and its relevant sub-components for this analysis are outlined. * In chapter 4, the data sample for this analysis and its quality are described. * The fast Monte Carlo simulation, a critical part of this thesis, is described in chapter 5. * In chapter 6, the measurement of the $\\frac{dN(Z \\to e^+ e^-)}{dP_{T}}$ is discussed.* In chapter 7, the measurement of the $\\frac{d\\sigma(p\\bar{p} \\to Z + X)}{dP_{T}}$ is presented. * The conclusion and discussion are given in Chapter 8.
Finite-Larmor-radius effects on z-pinch stability
Energy Technology Data Exchange (ETDEWEB)
Scheffel, J.; Faghihi, M. (Royal Inst. of Tech., Stockholm (Sweden))
1989-06-01
The effect of finite Larmor radius (FLR) on the stability of m = 1 small-axial-wavelength kinks in a z-pinch with purely poloidal magnetic field is investigated. The incompressible FLR MHD model is used; a collisionless fluid model that consistently includes the relevant FLR terms due to ion gyroviscosity, Hall effect and electron diamagnetism. With FLR terms absent, the Kadomtsev criterion of ideal MHD, 2rdp/dr+m{sup 2}B{sup 2}/{mu}{sub 0}{ge}0 predicts instability for internal modes unless the current density is singular at the centre of the pinch. The same result is obtained in the present model, with FLR terms absent. When the LFR terms are included, a normal-mode analysis of the linearized equations yields the following results. Marginally unstable (ideal) modes are stabilized by gyroviscosity. The Hall term has a damping (but no absolutely stabilizing) effect - in agreement with earlier work. On specifying a constant current and particle density equilibrium, the effect of electron diamagnetism vanishes. For a z-pinch with parameters relevant to the EXTRAP experiment, the m = 1 modes are then fully stabilized over the cross-section for wavelengths {lambda}/{alpha}{le}1, where {alpha} denotes the pinch radius. As a general z-pinch result a critical line-density limit ''N''{sub max}=5x10{sup 18}m{sup -1} is found, above which gyroviscous stabilization near the plasma boundary becomes insufficient. This limit corresponds to about five Larmor radii along the pinch radius. The result holds for wavelengths close to, or smaller than, the pinch radius and for realistic equilibrium profiles. This limit is far below the required limit for a reactor with contained alpha particles, which is in excess of 10{sup 20} m{sup -1}. (author).
Finite-Larmor-radius effects on z-pinch stability
International Nuclear Information System (INIS)
Scheffel, J.; Faghihi, M.
1989-01-01
The effect of finite Larmor radius (FLR) on the stability of m = 1 small-axial-wavelength kinks in a z-pinch with purely poloidal magnetic field is investigated. The incompressible FLR MHD model is used; a collisionless fluid model that consistently includes the relevant FLR terms due to ion gyroviscosity, Hall effect and electron diamagnetism. With FLR terms absent, the Kadomtsev criterion of ideal MHD, 2rdp/dr+m 2 B 2 /μ 0 ≥0 predicts instability for internal modes unless the current density is singular at the centre of the pinch. The same result is obtained in the present model, with FLR terms absent. When the LFR terms are included, a normal-mode analysis of the linearized equations yields the following results. Marginally unstable (ideal) modes are stabilized by gyroviscosity. The Hall term has a damping (but no absolutely stabilizing) effect - in agreement with earlier work. On specifying a constant current and particle density equilibrium, the effect of electron diamagnetism vanishes. For a z-pinch with parameters relevant to the EXTRAP experiment, the m = 1 modes are then fully stabilized over the cross-section for wavelengths λ/α≤1, where α denotes the pinch radius. As a general z-pinch result a critical line-density limit ''N'' max =5x10 18 m -1 is found, above which gyroviscous stabilization near the plasma boundary becomes insufficient. This limit corresponds to about five Larmor radii along the pinch radius. The result holds for wavelengths close to, or smaller than, the pinch radius and for realistic equilibrium profiles. This limit is far below the required limit for a reactor with contained alpha particles, which is in excess of 10 20 m -1 . (author)
Probing the distance-duality relation with high- z data
Energy Technology Data Exchange (ETDEWEB)
Holanda, R.F.L. [Departamento de Física, Universidade Estadual da Paraíba, 58429-500, Campina Grande—PB (Brazil); Busti, V.C. [Departamento de Física Matemática, Instituto de Física, Universidade de São Paulo, CEP 05508-090, São Paulo—SP (Brazil); Lima, F.S. [Departamento de Física, Universidade Federal de Campina Grande, 58429-900, Campina Grande—PB (Brazil); Alcaniz, J.S., E-mail: holanda@uepb.edu.br, E-mail: viniciusbusti@gmail.com, E-mail: limasdl@bol.com.br, E-mail: alcaniz@on.br [Departamento de Astronomia, Observatório Nacional, 20921-400, Rio de Janeiro—RJ (Brazil)
2017-09-01
Measurements of strong gravitational lensing jointly with type Ia supernovae (SNe Ia) observations have been used to test the validity of the cosmic distance duality relation (CDDR), D{sub L}( z )/[(1+ z ){sup 2D{sub A}}( z )]=η=1, where D{sub L}(z) and D{sub A}(z) are the luminosity and the angular diameter distances to a given redshift z , respectively. However, several lensing systems lie in the interval 1.4 ≤ z ≤ 3.6 i.e., beyond the redshift range of current SNe Ia compilations ( z ≈ 1.50), which prevents this kind of test to be fully explored. In this paper, we circumvent this problem by testing the CDDR considering observations of strong gravitational lensing along with SNe Ia and (a subsample from) the latest gamma-ray burst distance modulus data, whose redshift range is 0.033 ≤ z ≤ 9.3. We parameterize their luminosity distances with a second degree polynomial function and search for possible deviations from the CDDR validity by using four different η( z ) functions: η( z )=1+η{sub 0z}, η( z )=1+η{sub 0z}/(1+ z ), η( z )=(1+ z ){sup η{sub 0}} and η( z )=1+η{sub 0ln}(1+ z ). Unlike previous tests done at redshifts lower than 1.50, the likelihood for η{sub 0} depends strongly on the η( z ) function considered, but we find no significant deviation from the CDDR validity (η{sub 0}=0). However, our analyses also point to the fact that caution is needed when one fits data in higher redshifts to test the CDDR as well as a better understanding of the mass distribution of lenses also is required for more accurate results.
Measurement of D+s meson production in Z decays and of the anti B0s lifetime
International Nuclear Information System (INIS)
Buskulic, D.; Casper, D.; Bonis, I. de
1996-01-01
D + s mesons produced in Z 0 →b anti b events were separated from the Z 0 →c anti c component using a lifetime tag. Using a sample of 1.5 million hadronic Z decays collected with the ALEPH detector the anti B 0 s and D + s yields have been measured: B(b→ anti B 0 s )B(anti B 0 s →D + s )=0.088±0.020(stat.)±0.020(syst.), B(c→D + s )=0.128±0.019(stat.) +0.019 -0.016 (syst.). The anti B 0 s lifetime was measured in a anti B 0 s enriched sample reconstructing the decay length from the vertex of the D + s with a hadron from the anti B 0 s decay. The result obtained is: τ B s =1.61 +0.30 -0.29 (stat.) +0.18 -0.16 (syst.) ps. (orig.)
Clinical experience in coronary stenting with the Vivant Z Stent.
Chee, K H; Siaw, F S; Chan, C G; Chong, W P; Imran, Z A; Haizal, H K; Azman, W; Tan, K H
2005-06-01
This single centre study was designed to demonstrate feasibility, safety and efficacy of the Vivant Z stent (PFM AG, Cologne, Germany). Patients with de novo lesion were recruited. Coronary angioplasty was performed with either direct stenting or after balloon predilatation. Repeated angiogram was performed 6 months later or earlier if clinically indicated. Between January to June 2003, a total of 50 patients were recruited (mean age 55.8 +/- 9 years). A total of 52 lesions were stented successfully. Mean reference diameter was 2.77 mm (+/-0.59 SD, range 2.05-4.39 mm) with mean target lesion stenosis of 65.5% (+/-11.6 SD, range 50.1-93.3%). Forty-six lesions (88.5%) were American College of Cardiologist/American Heart Association class B/C types. Direct stenting was performed in 18 (34.6%) lesions. Mean stent diameter was 3.18 mm (+/-0.41 SD, range 2.5-4 mm), and mean stent length was 14.86 mm (+/-2.72 SD, range 9-18 mm). The procedure was complicated in only one case which involved the loss of side branch with no clinical sequelae. All treated lesions achieved Thrombolysis In Myocardial Infarction 3 flow. Mean residual diameter stenosis was 12.2% (+/-7.55 SD, range 0-22.6%) with acute gain of 1.72 mm (+/-0.50 SD, range 0.5-2.8). At 6 months, there was no major adverse cardiovascular event. Repeated angiography after 6 months showed a restenosis rate of 17% (defined as >50% diameter restenosis). Mean late loss was 0.96 mm (+/-0.48 SD) with loss index of 0.61 (+/-0.38 SD). The restenosis rate of those lesions less than 3.0 mm in diameter was 22.2% compared with 6.25% in those lesions more than 3.0 mm in diameter. The Vivant Z stent was shown to be safe and efficacious with low restenosis rate in de novo coronary artery lesion.
International Nuclear Information System (INIS)
Nyman, U.; Dinnetz, G.; Andersson, I.
1984-01-01
A new barium sulphate suspension, E-Z-CAT, for use as an oral contrast medium at computed tomography of the abdomen has been compared with the commonly used water-soluble iodinated contrast medium Gastrografin as regards patient tolerance and diagnostic information. The investigation was conducted as an unpaired randomized single-blind study in 100 consecutive patients. E-Z-CAT seems to be preferred because of its better taste, its lesser tendency to cause diarrhoea, and for usage in patients who are known to be hypersensitive to iodinated contrast media. The diagnostic information was the same for both contrast media. (Auth.)
3-DB, 3-D Multigroup Diffusion, X-Y-Z, R-Theta-Z, Triangular-Z Geometry, Fast Reactor Burnup
International Nuclear Information System (INIS)
Hardie, R.W.; Little, W.W. Jr.; Mroz, W.
1974-01-01
1 - Description of problem or function: 3DB is a three-dimensional (x-y-z, r-theta-z, triangular-z) multigroup diffusion code for use in detailed fast-reactor criticality and burnup analysis. The code can be used to - (a) compute k eff and perform criticality searches on time absorption, reactor composition, and reactor dimensions by means of either a flux or an adjoint model, (b) compute material burnup using a flexible material shuffling scheme, and (c) compute flux distributions for an arbitrary extraneous source. 2 - Method of solution: Eigenvalues are computed by standard source- iteration techniques. Group re-balancing and successive over-relaxation with line inversion are used to accelerate convergence. Adjoint solutions are obtained by inverting the input data and redefining the source terms. Material burnup is by reactor zone. The burnup rate is determined by the zone and energy-averaged cross sections which are recomputed after each time-step. The isotopic chains, which can contain any number of isotopes are formed by the user. The code does not contain built- in or internal chains. 3 - Restrictions on the complexity of the problem: Since variable dimensioning is employed, no simple bounds can be stated
Study the Z-Plane Strip Capacitance
International Nuclear Information System (INIS)
Parikh, H.; Swain, S.
2005-01-01
The BaBaR detector at the Stanford Linear Accelerator Center is currently undergoing an upgrade to improve its muon and neutral hadron detection system. The Resistive Plate Chambers (RPCs) that had been used till now have deteriorated in performance over the past few years and are being replaced by Limited Streamer Tube (LSTs). Each layer of the system consists of a set of up to 10 streamer tube modules which provide one coordinate (φ coordinate) and a single ''Z-plane'' which provides the Z coordinate of the hit. The large area Z-planes (up to 12m 2 ) are 1mm thick and contain 96 copper strips that detect the induced charge from avalanches created in the streamer tube wires. All the Z-planes needed for the upgrade have already been constructed, but only a third of the planes were installed last summer. After installing the 24 Z-planes last year, it was learned that 0.7% of the strips were dead when put inside the detector. This was mainly due to the delicate solder joint between the read-out cable and the strip, and since it is difficult to access or replace the Z-planes inside the detector, it is very important to perform various tests to make sure that the Z-planes will be efficient and effective in the long term. We measure the capacitance between the copper strips and the ground plane, and compare it to the theoretical value that we expect. Instead of measuring the capacitance channel by channel, which would be a very tedious job, we developed a more effective method of measuring the capacitance. Since all the Z-planes were built at SLAC, we also built a smaller 46 cm by 30 cm Z-plane with 12 strips just to see how they were constructed and to gain a better understanding about the solder joints
Načrtovanje virtualne in realne robotske celice za varjenje z ATIG postopkom z robotom ACMA XR701
Pal, Matej
2016-01-01
Cilj tega magistrskega dela je preveriti razliko med navadnim TIG varjenjem in ATIG varjenjem z aktivnima praškoma oz. premazoma dveh različnih proizvajalcev, ter hkrati preveriti obstoječo virtualno in realno robotsko celico in ju po potrebi popraviti. Pri tem je bilo naprej potrebno dopolniti virtualno in realno robotsko celico. Varjenje smo izvedli z industrijskim robotom ACMA XR701 z navadnim TIG varjenjem in ATIG varjenjem z različnima aktivnima praškoma oz. premazoma (QuickTIG in BC-31)...
MzrA-EnvZ Interactions in the Periplasm Influence the EnvZ/OmpR Two-Component Regulon▿ †
Gerken, Henri; Misra, Rajeev
2010-01-01
MzrA was identified as a modulator of the EnvZ/OmpR two-component signal transduction system. Previous evidence indicated that MzrA interacts with EnvZ and modulates its enzymatic activities to influence OmpR phosphate (OmpR∼P) levels. Moreover, MzrA was shown to connect the bacterial envelope stress response systems CpxA/CpxR and σE to EnvZ/OmpR to widen the defensive response regulatory network. In this study, experiments were carried out to establish whether the membrane or periplasmic domain of MzrA is critical for MzrA-EnvZ interactions and to reveal MzrA residues that play an important role in these interactions. Data obtained from chimeric constructs, in which the transmembrane domain of MzrA was replaced with the unrelated transmembrane domain of NarX or signal sequence of PhoA, showed that the transmembrane domain residues of MzrA do not play a critical role in MzrA-EnvZ interactions. The importance of the periplasmic domain of MzrA in MzrA-EnvZ interactions was revealed by characterizing bifunctional, fully soluble, and periplasmically localized MalE::MzrA chimeras. This was further corroborated through the isolation of loss-of-function, single-amino-acid substitutions in the conserved periplasmic domain of MzrA that interfered with MzrA-EnvZ binding in a bacterial two-hybrid system. Together, the data suggest that the binding of MzrA to EnvZ influences the ability of EnvZ to receive and/or respond to environmental signals in the periplasm and modulate its biochemical output to OmpR. PMID:20889743
Evolution in the Colors of Lyman Break Galaxies from z~4 to z~3
Papovich, Casey; Dickinson, Mark; Ferguson, Henry C.; Giavalisco, Mauro; Lotz, Jennifer; Madau, Piero; Idzi, Rafal; Kretchmer, Claudia; Moustakas, Leonidas A.; de Mello, Duilia F.; Gardner, Jonathan P.; Rieke, Marcia J.; Somerville, Rachel S.; Stern, Daniel
2004-01-01
The integrated colors of distant galaxies provide a means for interpreting the properties of their stellar content. Here we use rest-frame UV-to-optical colors to constrain the spectral energy distributions and stellar populations of color-selected, B-dropout galaxies at z~4 in the Great Observatories Origins Deep Survey (GOODS). We combine the Advanced Camera for Surveys data with ground-based near-infrared images, which extend the coverage of galaxies at z~4 to the rest-frame B band. We observe a color-magnitude trend in the rest-frame m(UV)-B versus B diagram for the z~4 galaxies that has a fairly well-defined ``blue envelope,'' and is strikingly similar to that of color-selected, U-dropout galaxies at z~3. We also find that although the co-moving luminosity density at rest-frame UV wavelengths (1600 Å) is roughly comparable at z~3 and ~4, the luminosity density at rest-frame optical wavelengths increases by about one-third from z~4 to ~3. Although the star formation histories of individual galaxies may involve complex and stochastic events, the evolution in the global luminosity density of the UV-bright galaxy population corresponds to an average star formation history with a star formation rate that is constant or increasing over these redshifts. This suggests that the evolution in the luminosity density corresponds to an increase in the stellar mass density of >~33%. Based on observations taken with the NASA/ESA Hubble Space Telescope, which is operated by the Association of Universities for Research in Astronomy (AURA), Inc., under NASA contract NAS5-26555, and based on observations collected at the European Southern Observatory, Chile (ESO programs 168.A-0485, 64.O-0643, 66.A-0572, and 68.A-0544).
International Nuclear Information System (INIS)
Vesey, Roger A.; Cuneo, Michael E.; Porter, John L. Jr.; Adams, Richard G.; Aragon, Rafael A.; Rambo, Patrick K.; Ruggles, Laurence E.; Simpson, Walter W.; Smith, Ian C.; Bennett, Guy R.
2003-01-01
The double Z-pinch hohlraum high-yield concept [Hammer et al., Phys. Plasmas 6, 2129 (1999)] utilizes two 63-MA Z pinches to heat separate primary hohlraums at either end of a secondary hohlraum containing the cryogenic fusion capsule. Recent experiments on the Z accelerator [Spielman et al., Phys. Plasmas 5, 2105 (1998)] at Sandia National Laboratories have developed an advanced single-sided power feed, double Z-pinch load to study radiation symmetry and pinch power balance using implosion capsules [Cuneo et al., Phys. Rev. Lett. 88, 215004 (2002)]. Point-projection x-ray imaging with the Z-Beamlet Laser mapped the trajectory and distortion of 2-mm diameter plastic ablator capsules. Using the backlit capsule distortion as a symmetry diagnostic, the ability to predictably tune symmetry at the 2 Legendre mode asymmetry coefficient over a range of ±6% (±2% considering points nearest the optimum) was achieved by varying the length of the cylindrical secondary hohlraum containing the capsule, in agreement with viewfactor and radiation-hydrodynamics simulations
International Nuclear Information System (INIS)
Goldflam, R.; Kouri, D.J.
1976-01-01
New methods for predicting the full matrix of integral cross sections are developed by combining the surprisal analysis of Bernstein and Levine with the j/sub z/-conserving coupled states method (j/sub z/CCS) of McGuire, Kouri, and Pack and with the statistical j/sub z/ approximation (Sj/sub z/) of Kouri, Shimoni, and Heil. A variety of approaches is possible and only three are studied in the present work. These are (a) a surprisal fit of the j=0→j' column of the j/sub z/CCS cross section matrix (thereby requiring only a solution of the lambda=0 set of j/sub z/CCS equations), (b) a surprisal fit of the lambda-bar=0 Sj/sub z/ cross section matrix (again requiring solution of the lambda=0 set of j/sub z/CCS equations only), and (c) a surprisal fit of a lambda-bar not equal to 0 Sj/sub z/ submatrix (involving input cross sections for j,j'> or =lambda-bar transitions only). The last approach requires the solution of the lambda=lambda-bar set of j/sub z/CCS equations only, which requires less computation effort than the effective potential method. We explore three different choices for the prior and two-parameter (i.e., linear) and three-parameter (i.e., parabolic) fits as applied to Ar--N 2 collisions. The results are in general very encouraging and for one choice of prior give results which are within 20% of the exact j/sub z/CCS results
Bouwens, R. J.; Illingworth, G. D.; Franx, M.; Chary, R.-R.; Meurer, G. R.; Conselice, C. J.; Ford, H.; Giavalisco, M.; van Dokkum, P.
2009-11-01
We provide a systematic measurement of the rest-frame UV continuum slope β over a wide range in redshift (z ~ 2-6) and rest-frame UV luminosity (0.1 L* z = 3 to 2 L* z = 3) to improve estimates of the star formation rate (SFR) density at high redshift. We utilize the deep optical and infrared data (Advanced Camera for Surveys/NICMOS) over the Chandra Deep Field-South and Hubble Deep Field-North Great Observatories Origins Deep Survey fields, as well as the UDF for our primary UBVi "dropout" Lyman Break Galaxy sample. We also use strong lensing clusters to identify a population of very low luminosity, high-redshift dropout galaxies. We correct the observed distributions for both selection biases and photometric scatter. We find that the UV-continuum slope of the most luminous galaxies is substantially redder at z ~ 2-4 than it is at z ~ 5-6 (from ~-2.4 at z ~ 6 to ~-1.5 at z ~ 2). Lower luminosity galaxies are also found to be bluer than higher luminosity galaxies at z ~ 2.5 and z ~ 4. We do not find a large number of galaxies with β's as red as -1 in our dropout selections at z ~ 4, and particularly at z gsim 5, even though such sources could be readily selected from our data (and also from Balmer Break Galaxy searches at z ~ 4). This suggests that star-forming galaxies at z gsim 5 almost universally have very blue UV-continuum slopes, and that there are not likely to be a substantial number of dust-obscured galaxies at z gsim 5 that are missed in "dropout" searches. Using the same relation between UV-continuum slope and dust extinction as has been found to be appropriate at both z ~ 0 and z ~ 2, we estimate the average dust extinction of galaxies as a function of redshift and UV luminosity in a consistent way. As expected, we find that the estimated dust extinction increases substantially with cosmic time for the most UV luminous galaxies, but remains small (lsim2 times) at all times for lower luminosity galaxies. Because these same lower luminosity galaxies
CP violation in the 3 jet and 4 jet decays of the Z boson at GigaZ
International Nuclear Information System (INIS)
Nachtmann, O.
2003-08-01
We review CP-violating effects in Z → 3 jet and Z → 4 jet decays, assuming the presence of CP-violating effective ZbbG and ZbbGG couplings. Longitudinal beam polarization is included in the studies. We propose a direct search for such CP-violating couplings by using various CP-odd observables. The data of a future linear collider running at the Z-resonance in the so-called GigaZ option should give significant information on the couplings. Finally we show that stringent bounds on the mass of excited b quarks can be derived if appropriate couplings are of a size characteristic of a strong interaction. (orig.)
International Nuclear Information System (INIS)
Qiu Chun; Guan Yihui; Chen Limin; Sun Bomin; Li Dianyou; Huang Zhemin; Zhao Jun; Zuo Chuantao
2011-01-01
Objective: To investigate the glucose metabolic pattern of brain functional loop in patients with refractory obsessive compulsive disorder (OCD) using 18 F-FDG PET. Methods: Eight patients with refractory OCD and 8 age- and gender-matched healthy volunteers underwent 18 F-FDG PET brain imaging. SPM software was used for image post-processing and quantitative analysis. Correlation analysis between 18 F-FDG uptake and Yale-Brown obsessive compulsive scale(Y-BOCS) score was performed. Results: Compared with the controls, the glucose metabolism of bilateral frontal cortices (including the rectal gyrus,orbital gyrus and cingulate gyrus), left thalamus,right temporal lobe and bilateral cerebellum in refractory OCD patients increased significantly (Z max =3.45-5.80, all P<0.001). Bilateral motor cortices and bilateral parietal lobes (BA7), however, showed decreased glucose metabolism (Z max =3.44-4.46, all P<0.001). Y-BOCS score was positively correlated with the glucose metabolism of the bilateral anterior cingulate cortex (Z max =3.77, 3.48 and 2.97, all P<0.01). Conclusions: There is a characteristic metabolic pattern of increased glucose utilization in the fronto-striato-thalamic loop and decreased glucose utilization in bilateral motor cortices and parietal lobes in patients with OCD. The glucose metabolism in the anterior cingulate cortex might serve as a quantitative parameter for the assessment of the severity of OCD. (authors)
Electron exchange between tin impurity U{sup –} centers in PbS{sub z}Se{sub 1–z} alloys
Energy Technology Data Exchange (ETDEWEB)
Marchenko, A. V. [Alexander Herzen State Pedagogical University of Russia (Russian Federation); Terukov, E. I. [Russian Academy of Sciences, Ioffe Physical–Technical Institute (Russian Federation); Seregin, P. P., E-mail: ppseregin@mail.ru; Rasnjuk, A. N.; Kiselev, V. S. [Alexander Herzen State Pedagogical University of Russia (Russian Federation)
2016-07-15
Using emission {sup 119mm}Sn({sup 119m}Sn) and {sup 119}Sb({sup 119m}Sn) Mössbauer spectroscopy, it is shown that impurity tin atoms in PbS{sub z}Se{sub 1–z} alloys substitute lead atoms and are two-electron donors with negative correlation energy (U{sup –} centers). It is found that the energy levels related to impurity tin atoms are in the lower half of the band gap at z ≥ 0.5 against the background of allowed valence-band states at z ≤ 0.4. The electron exchange between neutral and doubly ionized tin U{sup –} centers in partially compensated Pb{sub 0.99}Sn{sub 0.005}Na{sub 0.005}S{sub z}Se{sub 1–z} alloys is studied. The activation energy of this process decreases from 0.111(5) eV for a composition with z = 1 to 0.049(5) eV for compositions with c ≤ 0. For all z, the exchange is implemented via the simultaneous transfer of two electrons using delocalized valence-band states.
CARCASS AND MEAT QUALITY OF AFRICANDER Ar{D TERSEY ...
African Journals Online (AJOL)
wore not sgnificantlf diffcrent bctw€cn thc fiw typer of stcers. The Jersy oompares ... was determined by a method similar to that of Hill (1966). Muscle samples wcre herted for ... than thc Jerscy croscs (7t ar comparcd to 9Jt). Thc ud- mds with thc ...
Renaissance des Mittelalters (Teil 1) : oder Alte Fragen mit Neuen Antworten
drs. Frans van den Reep
2014-01-01
Man kann das Heute mit keiner Zeit vorher vergleichen? Zu schnell sind die Veränderungen, zu gravierend die technologischen Möglichkeiten der Digitalisierung, des Internets? Frans van der Reep nähert sich in vielen überraschenden Parallelen in der gesellschaftlichen Entwicklung dem Gestern und
U.S. EPA, Pesticide Product Label, RAMROD AND ATRAZINE FLOWABLE HERBICIDE, 09/03/1982
2011-04-14
... OF CCrn-"tl. i"''''i.I'I, Push f,b or ~\\iri 'f'::tb Illtnt_ of "gt~r !cr 3\\ '!3St 15 mh"~!J 'At .. ... te Il!td ~r other hertliC'd! ':an: .. !' tv e.!~~ jar mrhd ".itt·, .niS"" ~!lJJt'., ...
Internationalisierung der Versicherungsrechnungslegung in China
Xu, Xian
2010-01-01
In der vorliegenden Dissertation wird untersucht, inwiefern die Vorschriften zur Rechnungslegung von Versicherungsunternehmen in China mit denjenigen nach IFRS konvergieren, d.h., wie sich China durch Reformen des Rechnungslegungsrechts schrittweise an die IFRS annähert. Hierbei wird der gegenwärtige chinesische Rechnungslegungsrahmen auch kritisch diskutiert.
Singh, Parminder; Jindal, Bhavya; Surolia, Avadhesha; Panda, Dulal
2012-07-10
A perturbation of FtsZ assembly dynamics has been shown to inhibit bacterial cytokinesis. In this study, the antibacterial activity of 151 rhodanine compounds was assayed using Bacillus subtilis cells. Of 151 compounds, eight strongly inhibited bacterial proliferation at 2 μM. Subsequently, we used the elongation of B. subtilis cells as a secondary screen to identify potential FtsZ-targeted antibacterial agents. We found that three compounds significantly increased bacterial cell length. One of the three compounds, namely, CCR-11 [(E)-2-thioxo-5-({[3-(trifluoromethyl)phenyl]furan-2-yl}methylene)thiazolidin-4-one], inhibited the assembly and GTPase activity of FtsZ in vitro. CCR-11 bound to FtsZ with a dissociation constant of 1.5 ± 0.3 μM. A docking analysis indicated that CCR-11 may bind to FtsZ in a cavity adjacent to the T7 loop and that short halogen-oxygen, H-bonding, and hydrophobic interactions might be important for the binding of CCR-11 with FtsZ. CCR-11 inhibited the proliferation of B. subtilis cells with a half-maximal inhibitory concentration (IC(50)) of 1.2 ± 0.2 μM and a minimal inhibitory concentration of 3 μM. It also potently inhibited proliferation of Mycobacterium smegmatis cells. Further, CCR-11 perturbed Z-ring formation in B. subtilis cells; however, it neither visibly affected nucleoid segregation nor altered the membrane integrity of the cells. CCR-11 inhibited HeLa cell proliferation with an IC(50) value of 18.1 ± 0.2 μM (∼15 × IC(50) of B. subtilis cell proliferation). The results suggested that CCR-11 inhibits bacterial cytokinesis by inhibiting FtsZ assembly, and it can be used as a lead molecule to develop FtsZ-targeted antibacterial agents.
Energy Technology Data Exchange (ETDEWEB)
Ferkinhoff, Carl; Brisbin, Drew; Parshley, Stephen; Nikola, Thomas; Stacey, Gordon J.; Schoenwald, Justin; Riechers, Dominik [Department of Astronomy, Cornell University, Ithaca, NY 14853 (United States); Higdon, James L.; Higdon, Sarah J. U. [Department of Physics, Georgia Southern University, Statesboro, GA 30460 (United States); Verma, Aprajita [Department of Physics, University of Oxford, Oxford, OX1 3RH (United Kingdom); Hailey-Dunsheath, Steven [California Institute of Technology, Pasadena, CA 91125 (United States); Menten, Karl M.; Güsten, Rolf; Weiß, Axel [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Irwin, Kent; Cho, Hsiao M. [NIST Boulder, Boulder, CO 80305 (United States); Niemack, Michael [Department of Physics, Cornell University, Ithaca, NY 14853 (United States); Halpern, Mark; Amiri, Mandana [Department of Physics and Astronomy, University of British Columbia, Vancouver, BC, V6T 1Z1 (Canada); Hasselfield, Matthew, E-mail: carl.ferkinhoff@cornell.edu [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); and others
2014-01-10
We recently commissioned our new spectrometer, the second-generation z(Redshift) and Early Universe Spectrometer (ZEUS-2) on the Atacama Pathfinder Experiment telescope. ZEUS-2 is a submillimeter grating spectrometer optimized for detecting the faint and broad lines from distant galaxies that are redshifted into the telluric windows from 200 to 850 μm. It uses a focal plane array of transition-edge sensed bolometers, the first use of these arrays for astrophysical spectroscopy. ZEUS-2 promises to be an important tool for studying galaxies in the years to come because of its synergy with Atacama Large Millimeter Array and its capabilities in the short submillimeter windows that are unique in the post-Herschel era. Here, we report on our first detection of the [C II] 158 μm line with ZEUS-2. We detect the line at z ∼ 1.8 from H-ATLAS J091043.1–000322 with a line flux of (6.44 ± 0.42) × 10{sup –18} W m{sup –2}. Combined with its far-IR luminosity and a new Herschel-PACS detection of the [O I] 63 μm line, we model the line emission as coming from a photo-dissociation region with far-ultraviolet radiation field, G ∼ 2 × 10{sup 4} G {sub 0}, gas density, n ∼ 1 × 10{sup 3} cm{sup –3} and size between ∼0.4 and 1 kpc. On the basis of this model, we conclude that H-ATLAS J091043.1–000322 is a high-redshift analog of a local ultra-luminous IR galaxy; i.e., it is likely the site of a compact starburst caused by a major merger. Further identification of these merging systems is important for constraining galaxy formation and evolution models.
Ferkinhoff, Carl; Brisbin, Drew; Parshley, Stephen; Nikola, Thomas; Stacey, Gordon J.; Schoenwald, Justin; Higdon, James L.; Higdon, Sarah J. U.; Verma, Aprajita; Riechers, Dominik; Hailey-Dunsheath, Steven; Menten, Karl M.; Güsten, Rolf; Weiß, Axel; Irwin, Kent; Cho, Hsiao M.; Niemack, Michael; Halpern, Mark; Amiri, Mandana; Hasselfield, Matthew; Wiebe, D. V.; Ade, Peter A. R.; Tucker, Carol E.
2014-01-01
We recently commissioned our new spectrometer, the second-generation z(Redshift) and Early Universe Spectrometer (ZEUS-2) on the Atacama Pathfinder Experiment telescope. ZEUS-2 is a submillimeter grating spectrometer optimized for detecting the faint and broad lines from distant galaxies that are redshifted into the telluric windows from 200 to 850 μm. It uses a focal plane array of transition-edge sensed bolometers, the first use of these arrays for astrophysical spectroscopy. ZEUS-2 promises to be an important tool for studying galaxies in the years to come because of its synergy with Atacama Large Millimeter Array and its capabilities in the short submillimeter windows that are unique in the post-Herschel era. Here, we report on our first detection of the [C II] 158 μm line with ZEUS-2. We detect the line at z ~ 1.8 from H-ATLAS J091043.1-000322 with a line flux of (6.44 ± 0.42) × 10-18 W m-2. Combined with its far-IR luminosity and a new Herschel-PACS detection of the [O I] 63 μm line, we model the line emission as coming from a photo-dissociation region with far-ultraviolet radiation field, G ~ 2 × 104 G 0, gas density, n ~ 1 × 103 cm-3 and size between ~0.4 and 1 kpc. On the basis of this model, we conclude that H-ATLAS J091043.1-000322 is a high-redshift analog of a local ultra-luminous IR galaxy; i.e., it is likely the site of a compact starburst caused by a major merger. Further identification of these merging systems is important for constraining galaxy formation and evolution models.
International Nuclear Information System (INIS)
Ferkinhoff, Carl; Brisbin, Drew; Parshley, Stephen; Nikola, Thomas; Stacey, Gordon J.; Schoenwald, Justin; Riechers, Dominik; Higdon, James L.; Higdon, Sarah J. U.; Verma, Aprajita; Hailey-Dunsheath, Steven; Menten, Karl M.; Güsten, Rolf; Weiß, Axel; Irwin, Kent; Cho, Hsiao M.; Niemack, Michael; Halpern, Mark; Amiri, Mandana; Hasselfield, Matthew
2014-01-01
We recently commissioned our new spectrometer, the second-generation z(Redshift) and Early Universe Spectrometer (ZEUS-2) on the Atacama Pathfinder Experiment telescope. ZEUS-2 is a submillimeter grating spectrometer optimized for detecting the faint and broad lines from distant galaxies that are redshifted into the telluric windows from 200 to 850 μm. It uses a focal plane array of transition-edge sensed bolometers, the first use of these arrays for astrophysical spectroscopy. ZEUS-2 promises to be an important tool for studying galaxies in the years to come because of its synergy with Atacama Large Millimeter Array and its capabilities in the short submillimeter windows that are unique in the post-Herschel era. Here, we report on our first detection of the [C II] 158 μm line with ZEUS-2. We detect the line at z ∼ 1.8 from H-ATLAS J091043.1–000322 with a line flux of (6.44 ± 0.42) × 10 –18 W m –2 . Combined with its far-IR luminosity and a new Herschel-PACS detection of the [O I] 63 μm line, we model the line emission as coming from a photo-dissociation region with far-ultraviolet radiation field, G ∼ 2 × 10 4 G 0 , gas density, n ∼ 1 × 10 3 cm –3 and size between ∼0.4 and 1 kpc. On the basis of this model, we conclude that H-ATLAS J091043.1–000322 is a high-redshift analog of a local ultra-luminous IR galaxy; i.e., it is likely the site of a compact starburst caused by a major merger. Further identification of these merging systems is important for constraining galaxy formation and evolution models.
Energy Technology Data Exchange (ETDEWEB)
Faellmar, David; Larsson, Elna-Marie [Uppsala University, Department of Surgical Sciences, Radiology, Uppsala (Sweden); Haller, Sven [Uppsala University, Department of Surgical Sciences, Radiology, Uppsala (Sweden); University Medical Center Freiburg, Department of Neuroradiology, Freiburg (Germany); University of Geneva, Faculty of Medicine, Geneva (Switzerland); Affidea CDRC - Centre Diagnostique Radiologique de Carouge, Carouge (Switzerland); Lilja, Johan [Uppsala University, Department of Surgical Sciences, Nuclear Medicine and PET, Uppsala (Sweden); Hermes Medical Solutions, Stockholm (Sweden); Danfors, Torsten [Uppsala University, Department of Surgical Sciences, Nuclear Medicine and PET, Uppsala (Sweden); Kilander, Lena [Uppsala University, Department of Public Health and Caring Sciences, Geriatrics, Uppsala (Sweden); Tolboom, Nelleke; Croon, Philip M.; Berckel, Bart N.M. van [VU University Medical Center, Department of Radiology and Nuclear Medicine, Amsterdam (Netherlands); Egger, Karl [University Medical Center Freiburg, Department of Neuroradiology, Freiburg (Germany); Kellner, Elias [Medical Center University of Freiburg, Department of Radiology, Medical Physics, Faculty of Medicine, Freiburg (Germany); Verfaillie, Sander C.J.; Ossenkoppele, Rik [VU University Medical Center, Department of Neurology, Alzheimer Center Amsterdam, Amsterdam (Netherlands); Barkhof, Frederik [VU University Medical Center, Department of Radiology and Nuclear Medicine, Amsterdam (Netherlands); UCL, Institutes of Neurology and Healthcare Engineering, London (United Kingdom)
2017-10-15
Cerebral perfusion analysis based on arterial spin labeling (ASL) MRI has been proposed as an alternative to FDG-PET in patients with neurodegenerative disease. Z-maps show normal distribution values relating an image to a database of controls. They are routinely used for FDG-PET to demonstrate disease-specific patterns of hypometabolism at the individual level. This study aimed to compare the performance of Z-maps based on ASL to FDG-PET. Data were combined from two separate sites, each cohort consisting of patients with Alzheimer's disease (n = 18 + 7), frontotemporal dementia (n = 12 + 8) and controls (n = 9 + 29). Subjects underwent pseudocontinuous ASL and FDG-PET. Z-maps were created for each subject and modality. Four experienced physicians visually assessed the 166 Z-maps in random order, blinded to modality and diagnosis. Discrimination of patients versus controls using ASL-based Z-maps yielded high specificity (84%) and positive predictive value (80%), but significantly lower sensitivity compared to FDG-PET-based Z-maps (53% vs. 96%, p < 0.001). Among true-positive cases, correct diagnoses were made in 76% (ASL) and 84% (FDG-PET) (p = 0.168). ASL-based Z-maps can be used for visual assessment of neurodegenerative dementia with high specificity and positive predictive value, but with inferior sensitivity compared to FDG-PET. (orig.)
Beisner, Kimberly R.; Paretti, Nicholas V.; Tucci, Rachel S.
2016-04-25
Stable isotope delta values (δ18O and δ2H) of precipitation can vary with elevation, and quantification of the precipitation elevation gradient can be used to predict recharge elevation within a watershed. Precipitation samples were analyzed for stable isotope delta values between 2003 and 2014 from the Verde River watershed of north-central Arizona. Results indicate a significant decrease in summer isotopic values overtime at 3,100-, 4,100-, 6,100-, 7,100-, and 8,100-feet elevation. The updated local meteoric water line for the area is δ2H = 7.11 δ18O + 3.40. Equations to predict stable isotopic values based on elevation were updated from previous publications in Blasch and others (2006), Blasch and Bryson (2007), and Bryson and others (2007). New equations were separated for samples from the Camp Verde to Flagstaff transect and the Prescott to Chino Valley transect. For the Camp Verde to Flagstaff transect, the new equations for winter precipitation are δ18O = -0.0004z − 8.87 and δ2H = -0.0029z − 59.8 (where z represents elevation in feet) and the summer precipitation equations were not statistically significant. For the Prescott to Chino Valley transect, the new equations for summer precipitation are δ18O = -0.0005z − 3.22 and δ2H = -0.0022z − 27.9; the winter precipitation equations were not statistically significant and, notably, stable isotope values were similar across all elevations. Interpretation of elevation of recharge contributing to surface and groundwaters in the Verde River watershed using the updated equations for the Camp Verde to Flagstaff transect will give lower elevation values compared with interpretations presented in the previous studies. For waters in the Prescott and Chino Valley area, more information is needed to understand local controls on stable isotope values related to elevation.
Review of high Z materials for PSI applications
International Nuclear Information System (INIS)
Tanabe, Tetsuo; Noda, Nobuaki; Nakamura, Hiroo.
1992-06-01
Application of carbon based low Z materials to PFM has significantly improved plasma parameters in large tokamaks. There are, however, serious concerns of erosion, neutron damage etc. for application of low Z materials in future D - T burning machine. To apply high Z metals to PFM, there are several issues to be solved; high Z impurity production by sputtering, their accumulation in plasma center, and high radiation loss. Because of these concerns high Z metals are not widely employed nor planned to be used in the present large tokamaks. Since our efforts have been concentrated to optimize the low Z materials, little systematic investigations for high Z materials in tokamak have been done, lacking data base especially those concerning the impacts on plasma core. In order to employ high Z material as PFM near future, material properties related to impurity production and hydrogen recycling are reviewed and discussed what is important and what shall be done. (author) 109 refs
INSPIRE-00236828
The observation of the $\\mathrm{Z}$ boson rare decay to a $\\psi$ meson and two oppositely charged same-flavour leptons, $\\ell^+ \\ell^-$, where $\\psi$ represents the sum of $\\mathrm{J}/\\psi$ and $\\psi(\\mathrm{2S})\\to\\mathrm{J}/\\psi\\, X$, and $\\ell=\\mu,\\mathrm{e}$, is presented. The data sample used corresponds to an integrated luminosity of $35.9\\,\\mathrm{fb}^{-1}$ of proton-proton collisions at a center-of-mass energy of $13\\,\\mathrm{TeV}$ accumulated by the CMS experiment at the LHC. The signal is observed with a significance in excess of 5 standard deviations. Removing contributions from $\\psi(\\mathrm{2S})$ decays to $\\mathrm{J}/\\psi$, the signal is interpreted as being entirely from $\\mathrm{Z}\\to\\mathrm{J}/\\psi\\,\\ell^+\\ell^-$, with its fiducial branching fraction relative to that of the decay $\\mathrm{Z}\\to\\mu^+\\mu^-\\mu^+\\mu^-$ measured to be $$\\frac{\\mathcal{B}(\\mathrm{Z}\\to\\mathrm{J}/\\psi\\,\\ell^+\\ell^-)}{\\mathcal{B}(\\mathrm{Z}\\to\\mu^+\\mu^-\\mu^+\\mu^-)}=0.70\\pm 0.18\\, \\mathrm{(stat)} \\pm 0.05\\, \\mathrm{(s...
Discovering hidden sectors with monophoton Z' searches
International Nuclear Information System (INIS)
Gershtein, Yuri; Petriello, Frank; Quackenbush, Seth; Zurek, Kathryn M.
2008-01-01
In many theories of physics beyond the standard model, from extra dimensions to Hidden Valleys and models of dark matter, Z ' bosons mediate between standard model particles and hidden sector states. We study the feasibility of observing such hidden states through an invisibly decaying Z ' at the LHC. We focus on the process pp→γZ ' →γXX † , where X is any neutral, (quasi-) stable particle, whether a standard model neutrino or a new state. This complements a previous study using pp→ZZ ' →l + l - XX † . Only the Z ' mass and two effective charges are needed to describe this process. If the Z ' decays invisibly only to standard model neutrinos, then these charges are predicted by observation of the Z ' through the Drell-Yan process, allowing discrimination between Z ' decays to standard model ν's and invisible decays to new states. We carefully discuss all backgrounds and systematic errors that affect this search. We find that hidden sector decays of a 1 TeV Z ' can be observed at 5σ significance with 50 fb -1 at the LHC. Observation of a 1.5 TeV state requires super-LHC statistics of 1 ab -1 . Control of the systematic errors, in particular, the parton distribution function uncertainty of the dominant Zγ background, is crucial to maximize the LHC search reach.
1983-01-01
This image taken by the UA1 experiment on 30 April 1983 was the first detection of a Z0 particle. UA1 observed proton-antiproton collisions on the SPS between 1981 and 1993 to look for the Z and W bosons, which mediate the weak fundamental force. The Z0 decays very quickly so cannot be seen, but the electron-positron pair produced in the decay can be seen in blue.
THREETRAN (hex, z) users' manual
International Nuclear Information System (INIS)
Walters, W.F.; O'Dell, R.D.; Brinkley, F.W. Jr.
1979-10-01
THREETRAN (hex,z) is a three-dimensional, multigroup, discrete-ordinates neutral-particle transport code for use in solving problems in hexagonal, z geometries. An efficient and flexible data management strategy is incorporated and uses three hierarchies of storage: fast core (or small core memory), extended core (or large core memory), and random access disk. Both isotropic (P 0 ) and linearly anisotropic (P 1 ) scattering can be treated. This manual is intended to be a guide for the users of THREETRAN (hex,z) in setting up problem input and in interpreting the output. It is not intended to provide a description of code theory or architecture. 5 figures, 4 tables
International Nuclear Information System (INIS)
Shumlak, U.; Nelson, B. A.
2005-01-01
The results from the ZaP experiment are consistent with the theoretical predictions of sheared flow stabilization. Z pinches with a sheared flow are generated in the ZaP experiment using a coaxial accelerator coupled to an assembly region. The current sheet in the accelerator initially acts as a snowplow. As the Z pinch forms, plasma formation in the accelerator transits to a deflagration process. The plasma exits the accelerator and maintains the flow in the Z pinch. During the quiescent period in the magnetic mode activity at z=0 cm, a stable Z pinch is seen on the axis of the assembly region. The evolution of the axial velocity profile shows a large velocity shear is measured at the edge of the Z pinch during the quiescent period. The velocity shear is above the theoretical threshold. As the velocity shear decreases towards 0.1kV A , the predicted stability threshold, the quiescent period ends. The present understanding of the ZaP experiment shows that it may be possible for the Z pinch to operate in a steady state if the deflagration process can be maintained by constantly supplying neutral gas or plasma to the accelerator
CLASH: DISCOVERY OF A BRIGHT z {approx_equal} 6.2 DWARF GALAXY QUADRUPLY LENSED BY MACS J0329.6-0211
Energy Technology Data Exchange (ETDEWEB)
Zitrin, A. [Institut fuer Theoretische Astrophysik, Universitaet Heidelberg, Heidelberg (Germany); Moustakas, J. [Center for Astrophysics and Space Sciences, University of California, San Diego, CA (United States); Bradley, L.; Coe, D.; Postman, M.; Koekemoer, A. [Space Telescope Science Institute, Baltimore, MD (United States); Moustakas, L. A. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA (United States); Shu, X. [Department of Astronomy, University of Science and Technology of China, Hefei, Anhui (China); Zheng, W.; Ford, H. [Department of Physics and Astronomy, Johns Hopkins University, Baltimore, MD (United States); Benitez, N. [Instituto de Astrofisica de Andalucia (CSIC), Granada (Spain); Bouwens, R. [Leiden Observatory, University of Leiden, Leiden (Netherlands); Broadhurst, T. [Department of Theoretical Physics, University of Basque Country, Bilbao (Spain); Host, O.; Jouvel, S. [Department of Physics and Astronomy, University College London, London (United Kingdom); Meneghetti, M. [INAF, Osservatorio Astronomico di Bologna, Bologna (Italy); Rosati, P. [European Southern Observatory, Garching bei Muenchen (Germany); Donahue, M. [Physics and Astronomy Department, Michigan State University, East Lansing, MI (United States); Grillo, C. [Excellence Cluster Universe, Technische Universitaet Muenchen, Muenchen (Germany); Kelson, D., E-mail: adizitrin@gmail.com [Observatories of the Carnegie Institution of Washington, Pasadena, CA (United States); and others
2012-03-15
We report the discovery of a z{sub phot} = 6.18{sup +0.05}{sub -0.07} (95% confidence level) dwarf galaxy, lensed into four images by the galaxy cluster MACS J0329.6-0211 (z{sub l} = 0.45). The galaxy is observed as a high-redshift dropout in HST/ACS/WFC3 CLASH and Spitzer/IRAC imaging. Its redshift is securely determined due to a clear detection of the Lyman break in the 18-band photometry, making this galaxy one of the highest-redshift multiply lensed objects known to date with an observed magnitude of F125W =24.00 {+-} 0.04 AB mag for its most magnified image. We also present the first strong-lensing analysis of this cluster uncovering 15 additional multiply imaged candidates of five lower-redshift sources spanning the range z{sub s} {approx_equal} 2-4. The mass model independently supports the high photometric redshift and reveals magnifications of 11.6{sup +8.9}{sub -4.1}, 17.6{sup +6.2}{sub -3.9}, 3.9{sup +3.0}{sub -1.7}, and 3.7{sup +1.3}{sub -0.2}, respectively, for the four images of the high-redshift galaxy. By delensing the most magnified image we construct an image of the source with a physical resolution of {approx}200 pc when the universe was {approx}0.9 Gyr old, where the z {approx_equal} 6.2 galaxy occupies a source-plane area of approximately 2.2 kpc{sup 2}. Modeling the observed spectral energy distribution using population synthesis models, we find a demagnified stellar mass of {approx}10{sup 9} M{sub Sun }, subsolar metallicity (Z/Z{sub Sun} {approx} 0.5), low dust content (A{sub V} {approx} 0.1 mag), a demagnified star formation rate (SFR) of {approx}3.2 M{sub Sun} yr{sup -1}, and a specific SFR of {approx}3.4 Gyr{sup -1}, all consistent with the properties of local dwarf galaxies.
CP violation in the 3 jet and 4 jet decays of the Z boson at GigaZ
International Nuclear Information System (INIS)
Nachtmann, O.; Schwanenberger, C.
2004-01-01
We review CP-violating effects in Z → 3 jet and Z → 4 jet decays, assuming the presence of CP-violating effective Zb anti bG and Zb anti bGG couplings. Longitudinal beam polarization is included in the studies. We propose a direct search for such CP-violating couplings by using various CP-odd observables. The data of a future linear collider running at the Z-resonance in the so-called GigaZ option should give significant information on the couplings. Finally we show that stringent bounds on the mass of excited b quarks can be derived if appropriate couplings are of a size characteristic of a strong interaction. (orig.)
Czech Academy of Sciences Publication Activity Database
Burša, Milan; Kenyon, S.; Kouba, J.; Šíma, Zdislav; Vatrt, V.; Vítek, V.; Vojtíšková, M.
2007-01-01
Roč. 81, č. 2 (2007), s. 103-110 ISSN 0949-7714 R&D Projects: GA ČR GA205/05/2381 Institutional research plan: CEZ:AV0Z10030501 Keywords : geopotential * vertical datum unification * relativistic atomic time scale Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.636, year: 2007
Piezoelectric PZT thin films on flexible copper-coated polymer films
Czech Academy of Sciences Publication Activity Database
Suchaneck, G.; Volkonskiy, O.; Gerlach, G.; Hubička, Zdeněk; Dejneka, Alexandr; Jastrabík, Lubomír; Kiselev, D.; Bdikin, I.; Kholkin, A.
636/637, - (2010), s. 392-397 ISSN 0255-5476 R&D Projects: GA ČR GC202/09/J017; GA AV ČR KJB100100703 Institutional research plan: CEZ:AV0Z10100522 Keywords : plasma jet deposition * PZT * kapton® film substrate * piezoresponse force microscopy Subject RIV: BM - Solid Matter Physics ; Magnetism
Letter to the Editor: Backbone resonance assignment of protease from Mason-Pfizer monkey virus
Czech Academy of Sciences Publication Activity Database
Veverka, V.; Bauerová, Helena; Zábranský, Aleš; Pichová, Iva; Hrabal, R.
2001-01-01
Roč. 20, - (2001), s. 291-292 ISSN 0925-2738 R&D Projects: GA ČR GA203/00/1241 Grant - others:Fogarty International Award(US) TW00050 Institutional research plan: CEZ:AV0Z4055905 Keywords : Mason-Pfizer monkey virus * retroviral protease Subject RIV: CE - Biochemistry Impact factor: 4.636, year: 2001
Analysis list: Su(z)12 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Su(z)12 Embryo,Larvae + dm3 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/S...u(z)12.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/Su(z)12.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/dm3/target/Su(z)12.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Su(z)12.Embryo....tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Su(z)12.Larvae.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/dm3/colo/Embryo.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Larvae.gml ...
FtsZ Polymerization Assays : Simple Protocols and Considerations
Król, Ewa; Scheffers, Dirk-Jan
2013-01-01
During bacterial cell division, the essential protein FtsZ assembles in the middle of the cell to form the so-called Z-ring. FtsZ polymerizes into long filaments in the presence of GTP in vitro, and polymerization is regulated by several accessory proteins. FtsZ polymerization has been extensively
Directory of Open Access Journals (Sweden)
Kelly Polyana Pereira Santos
2015-12-01
Full Text Available Na comunidade de pescadores Z-18, do município de União/PI, evidencia-se uma importância cultural de sobrevivência através do uso dos recursos naturais locais. Dados etnobiológicos a respeito das artes e estratégias de pesca e técnicas na construção e reparo de canoas foram revelados após a aplicação de entrevistas semiestrururadas, observação direta, registro fotográfico e análise quantitativa dos dados. Homens e mulheres participam diretamente da pesca, utilizando-se de oito artefatos, destacando-se o engancho. Foram apontadas 10 espécies de peixes raras e 15 espécies comuns. Quanto à distribuição do conhecimento etnozoológico por gênero, não houve diferenças significativas, por faixa etária, apenas os jovens possuem menos conhecimento do que adultos e idosos, estes, não diferem significativamente. Quatro espécies vegetais são utilizadas na fabricação e reparo das canoas. Os pescadores possuem um amplo conhecimento em relação à atividade pesqueira, sendo esta transmitida de geração a geração.
Zaburzenia lipidowe u pacjentów z zawrotami głowy
Directory of Open Access Journals (Sweden)
Hanna Zielińska-Bliźniewska
2012-11-01
Full Text Available Wprowadzenie: Celem pracy była ocena zaburzeń lipidowych u pacjentów z zawrotami głowy. Materiał i metody: Badania przeprowadzono na grupie 918 chorych, w tym 598 kobiet i 320 mężczyzn, w wieku 18–83 lat (średnia wieku 55±0,5, leczonych w latach 2009–2011 w Klinice Otolaryngologii i Onkologii Laryngologicznej z Zespołem Pracowni Audiologicznych i Foniatrycznych Uniwersyteckiego Szpitala Klinicznego im. WAM w Łodzi z powodu zawrotów głowy. U wszystkich chorych przeprowadzono szczegółowy wywiad, badanie przedmiotowe otolaryngologiczne, otoneurologiczne. Każdy pacjent był konsultowany neurologicznie, okulistycznie i internistycznie oraz miał wykonywane USG naczyń doczaszkowych, tomografię komputerową odcinka szyjnego kręgosłupa i głowy w celu wykluczenia schorzeń organicznych ośrodkowego układu nerwowego. Przeprowadzono także badania laboratoryjne, takie jak stężenie cholesterolu całkowitego, triglicerydy, frakcję cholesterolu LDL i HDL oraz stężenie glukozy w surowicy krwi. Wyniki: W grupie 918 pacjentów z zawrotami głowy u 539 (58,71% miały one pochodzenie ośrodkowe, a u 379 chorych (41,28% charakter mieszany, w tym u 366 kobiet (67,90% rozpoznano zawroty pochodzenia ośrodkowego, a u 232 (61,21% typu mieszanego. Spośród 320 mężczyzn (34,78% z zawrotami głowy u 173 (32,09% stwierdzono zawroty pochodzenia ośrodkowego, a u 147 (38,78% typu mieszanego. Analizując stężenia frakcji lipidów u badanych, odnotowano podwyższone wartości cholesterolu całkowitego u 67,03% z nich, w tym u 71,34% mężczyzn i 64,76% kobiet. Podwyższone stężenia frakcji cholesterolu LDL zaobserwowano u 51,57% pacjentów, w tym u 54,83% mężczyzn i 49,83% kobiet. Frakcja HDL cholesterolu u większości chorych (61,99% była w normie. Również stężenie triglicerydów u większości badanych (u 69,45% nie odbiegało od normy, podobnie jak stężenie glukozy (u 59,25% mężczyzn oraz 67,78% kobiet. Wnioski: Zaburzenia
Physics of the N = Z and N = Z + 1 Nuclei in the A = 80 -100 Region
International Nuclear Information System (INIS)
Bucurescu, D.
2007-01-01
A review of the experimental work performed at the GASP array with the purpose of the identification and first spectroscopic measurements of the heaviest even-even N = Z and odd-A N = Z + 1 nuclei (mass larger than 80) is made. Systematic experiments in this mass region led to the first study of seven such nuclei: 88 Ru, 81 Zr, 85 Mo, 89 Ru, 91 Rh, 93 Pd, and 95 Ag, and extensive data on many other nuclei in their neighborhood. The systematic evolution of the level structures in both even-even and odd-A nuclei, between N ∼ Z ∼ 40 and N ∼ Z ∼ 47 is briefly presented. The possibility that effects of the neutron-proton pairing have been observed, as well as the type of collectivity observed in this region are discussed. (author)
Naturalness of three generations in free fermionic Z2n direct-product Z4 string models
International Nuclear Information System (INIS)
Faraggi, A.E.; Nanopoulos, D.V.
1993-01-01
We study the construction of free fermionic spin structure models with Z 2 n direct-product Z 4 boundary-condition vectors. We argue that requiring chiral space-time fermions in the massless spectrum and the existence of a well-defined hidden gauge group severely constrain the allowed boundary-condition vectors. We show that the minimal way to obtain these requirements is given by a unique set of Z 2 5 boundary-condition vectors. We classify the possible extensions to this basic set. We argue that a result of this fundamental set is that obtaining three generations in this construction is correlated with projecting out all the enhanced gauge symmetries which arise from nonzero vacuum expectation values of background fields. We propose that this correlation and the properties of the fundamental Z 2 5 subset suggest that three generations is natural in this construction
Z-Pinch Fusion for Energy Applications
Energy Technology Data Exchange (ETDEWEB)
SPIELMAN,RICK B.
2000-01-01
Z pinches, the oldest fusion concept, have recently been revisited in light of significant advances in the fields of plasma physics and pulsed power engineering. The possibility exists for z-pinch fusion to play a role in commercial energy applications. We report on work to develop z-pinch fusion concepts, the result of an extensive literature search, and the output for a congressionally-mandated workshop on fusion energy held in Snowmass, Co July 11-23,1999.
Z-Pinch Fusion for Energy Applications
International Nuclear Information System (INIS)
SPIELMAN, RICK B.
2000-01-01
Z pinches, the oldest fusion concept, have recently been revisited in light of significant advances in the fields of plasma physics and pulsed power engineering. The possibility exists for z-pinch fusion to play a role in commercial energy applications. We report on work to develop z-pinch fusion concepts, the result of an extensive literature search, and the output for a congressionally-mandated workshop on fusion energy held in Snowmass, Co July 11-23,1999
International Nuclear Information System (INIS)
Bouwens, Rychard J.; Illingworth, Garth D.; Gonzalez, Valentino; Holden, Brad; Magee, Dan; Labbe, Ivo; Franx, Marijn; Conselice, Christopher J.; Blakeslee, John; Van Dokkum, Pieter; Marchesini, Danilo; Zheng Wei
2010-01-01
We use ∼88 arcmin 2 of deep (∼>26.5 mag at 5σ) NICMOS data over the two GOODS fields and the HDF-South to conduct a search for bright z ∼> 7 galaxy candidates. This search takes advantage of an efficient preselection over 58 arcmin 2 of NICMOS H 160 -band data where only plausible z ∼> 7 candidates are followed up with NICMOS J 110 -band observations. ∼248 arcmin 2 of deep ground-based near-infrared data (∼>25.5 mag, 5σ) are also considered in the search. In total, we report 15 z 850 -dropout candidates over this area-7 of which are new to these search fields. Two possible z ∼ 9 J 110 -dropout candidates are also found, but seem unlikely to correspond to z ∼ 9 galaxies (given the estimated contamination levels). The present z ∼ 9 search is used to set upper limits on the prevalence of such sources. Rigorous testing is undertaken to establish the level of contamination of our selections by photometric scatter, low-mass stars, supernovae, and spurious sources. The estimated contamination rate of our z ∼ 7 selection is ∼24%. Through careful simulations, the effective volume available to our z ∼> 7 selections is estimated and used to establish constraints on the volume density of luminous (L* z =3 , or ∼-21 mag) galaxies from these searches. We find that the volume density of luminous star-forming galaxies at z ∼ 7 is 13 +8 -5 times lower than at z ∼ 4 and >25 times lower (1σ) at z ∼ 9 than at z ∼ 4. This is the most stringent constraint yet available on the volume density of ∼>L* z =3 galaxies at z ∼ 9. The present wide-area, multi-field search limits cosmic variance to ∼ 850 -dropout sample (18 candidates) identified from all NICMOS observations to date (over the two GOODS fields, the HUDF, galaxy clusters).
Determination of the δ15N and δ18O of nitrate in solids; RSIL lab code 2897
Coplen, Tyler B.; Qi, Haiping; Revesz, Kinga; Casciotti, Karen; Hannon, Janet E.
2007-01-01
The purpose of the Reston Stable Isotope Laboratory (RSIL) lab code 2897 is to determine the δ15N and δ18O of nitrate (NO3-) in solids. The NO3- fraction of the nitrogen species is dissolved by water (called leaching) and can be analyzed by the bacterial method covered in RSIL lab code 2900. After leaching, the δ15N and δ18O of the dissolved NO3- is analyzed by conversion of the NO3- to nitrous oxide (N2O), which serves as the analyte for mass spectrometry. A culture of denitrifying bacteria is used in the enzymatic conversion of NO3- to N2O, which follows the pathway shown in equation 1: NO3- → NO2- → NO → 1/2 N2O (1) Because the bacteria Pseudomonas aureofaciens lack N2O reductive activity, the reaction stops at N2O, unlike the typical denitrification reaction that goes to N2. After several hours, the conversion is complete, and the N2O is extracted from the vial, separated from volatile organic vapor and water vapor by an automated -65 °C isopropanol-slush trap, a Nafion drier, a CO2 and water removal unit (Costech #021020 carbon dioxide absorbent with Mg(ClO4)2), and trapped in a small-volume trap immersed in liquid nitrogen with a modified Finnigan MAT (now Thermo Scientific) GasBench 2 introduction system. After the N2O is released, it is further purified by gas chromatography before introduction to the isotope-ratio mass spectrometer (IRMS). The IRMS is a Thermo Scientific Delta V Plus continuous flow IRMS (CF-IRMS). It has a universal triple collector, consisting of two wide cups with a narrow cup in the middle; it is capable of simultaneously measuring mass/charge (m/z) of the N2O molecule 44, 45, and 46. The ion beams from these m/z values are as follows: m/z = 44 = N2O = 14N14N16O; m/z = 45 = N2O = 14N15N16O or 14N14N17O; m/z = 46 = N2O = 14N14N18O. The 17O contributions to the m/z 44 and m/z 45 ion beams are accounted for before δ15N values are reported.
Energy Technology Data Exchange (ETDEWEB)
Barenboim, G.; Bernabeu, J.; Vives, O. [Universitat de Valencia, Departament de Fisica Teorica, Burjassot (Spain); Universitat de Valencia-CSIC, Parc Cientific U.V., IFIC, Paterna (Spain); Mitsou, V.A.; Romero, E. [Universitat de Valencia-CSIC, Parc Cientific U.V., IFIC, Paterna (Spain)
2016-02-15
Recently the ATLAS experiment announced a 3 σ excess at the Z-peak consisting of 29 pairs of leptons together with two or more jets, E{sub T}{sup miss} > 225 GeV and HT > 600 GeV, to be compared with 10.6 ± 3.2 expected lepton pairs in the Standard Model. No excess outside the Z-peak was observed. By trying to explain this signal with SUSY we find that only relatively light gluinos, m{sub g}
International Nuclear Information System (INIS)
Barenboim, G.; Bernabeu, J.; Vives, O.; Mitsou, V.A.; Romero, E.
2016-01-01
Recently the ATLAS experiment announced a 3 σ excess at the Z-peak consisting of 29 pairs of leptons together with two or more jets, E T miss > 225 GeV and HT > 600 GeV, to be compared with 10.6 ± 3.2 expected lepton pairs in the Standard Model. No excess outside the Z-peak was observed. By trying to explain this signal with SUSY we find that only relatively light gluinos, m g
The dynamics of z = 0.8 Hα-selected star-forming galaxies from KMOS/CF-HiZELS
International Nuclear Information System (INIS)
Sobral, D.; Matthee, J.; Swinbank, A. M.; Stott, J. P.; Bower, R. G.; Smail, Ian; Sharples, R. M.; Best, P.; Geach, J. E.
2013-01-01
We present the spatially resolved Hα dynamics of 16 star-forming galaxies at z ∼ 0.81 using the new KMOS multi-object integral field spectrograph on the ESO Very Large Telescope. These galaxies, selected using 1.18 μm narrowband imaging from the 10 deg 2 CFHT-HiZELS survey of the SA 22 hr field, are found in a ∼4 Mpc overdensity of Hα emitters and likely reside in a group/intermediate environment, but not a cluster. We confirm and identify a rich group of star-forming galaxies at z = 0.813 ± 0.003, with 13 galaxies within 1000 km s –1 of each other, and seven within a diameter of 3 Mpc. All of our galaxies are 'typical' star-forming galaxies at their redshift, 0.8 ± 0.4 SFR z=0.8 ∗ , spanning a range of specific star formation rates (sSFRs) of 0.2-1.1 Gyr –1 and have a median metallicity very close to solar of 12 + log(O/H) = 8.62 ± 0.06. We measure the spatially resolved Hα dynamics of the galaxies in our sample and show that 13 out of 16 galaxies can be described by rotating disks and use the data to derive inclination corrected rotation speeds of 50-275 km s –1 . The fraction of disks within our sample is 75% ± 8%, consistent with previous results based on Hubble Space Telescope morphologies of Hα-selected galaxies at z ∼ 1 and confirming that disks dominate the SFR density at z ∼ 1. Our Hα galaxies are well fitted by the z ∼ 1-2 Tully-Fisher (TF) relation, confirming the evolution seen in the zero point. Apart from having, on average, higher stellar masses and lower sSFRs, our group galaxies at z = 0.81 present the same mass-metallicity and TF relation as z ∼ 1 field galaxies and are all disk galaxies.
Supersymmetric Higgs boson production in Z decays
International Nuclear Information System (INIS)
Gamberini, G.; Giudice, G.F.; Ridolfi, G.
1987-01-01
The problem of distinguishing between the standard model and the supersymmetric Higgs bosons is considered in the context of Z 0 decays. We find that, for some choices of the parameters, the branching ratio for Z 0 → H 0 γ is strongly enhanced by the exchange of supersymmetric fermions as virtual particles. This makes the study of this process at LEP very interesting, since other Z 0 branching modes into Higgs bosons, such as Z 0 → H 0 μ + μ - , are not so clearly modified by supersymmetry. (orig.)
Five-level Z-source diode-clamped inverter
DEFF Research Database (Denmark)
Gao, F.; Loh, Poh Chiang; Blaabjerg, Frede
2010-01-01
This study proposes a five-level Z-source diode-clamped inverter designed with two intermediate Z-source networks connected between the dc input sources and rear-end inverter circuitry. By partially shorting the Z-source networks, new operating states not previously reported for two-level Z......-source inverter are introduced here for operating the proposed inverter with voltage buck–boost energy conversion ability and five-level phase voltage switching. These characteristic features are in fact always ensured at the inverter terminal output by simply adopting a properly designed carrier modulation...
AN OPTICAL GROUP CATALOG TO z = 1 FROM THE zCOSMOS 10 k SAMPLE
International Nuclear Information System (INIS)
Knobel, C.; Lilly, S. J.; Porciani, C.; Kovac, K.; Carollo, C. M.; Caputi, K.; Iovino, A.; Cucciati, O.; Finoguenov, A.; Zamorani, G.; Bardelli, S.; Bolzonella, M.; Kitzbichler, M. G.; Contini, T.; Kneib, J.-P.; Le Fevre, O.; Mainieri, V.; Renzini, A.; Scodeggio, M.; Bongiorno, A.
2009-01-01
We present a galaxy group catalog spanning the redshift range 0.1 ∼ 2 COSMOS field, based on the first ∼10,000 zCOSMOS spectra. The performance of both the Friends-of-Friends (FOF) and Voronoi-Delaunay method (VDM) approaches to group identification has been extensively explored and compared using realistic mock catalogs. We find that the performance improves substantially if groups are found by progressively optimizing the group-finding parameters for successively smaller groups, and that the highest fidelity catalog, in terms of completeness and purity, is obtained by combining the independently created FOF and VDM catalogs. The final completeness and purity of this catalog, both in terms of the groups and of individual members, compares favorably with recent results in the literature. The current group catalog contains 102 groups with N ≥ 5 spectroscopically confirmed members, with a further ∼700 groups with 2 ≤ N ≤ 4. Most of the groups can be assigned a velocity dispersion and a dark-matter mass derived from the mock catalogs, with quantifiable uncertainties. The fraction of zCOSMOS galaxies in groups is about 25% at low redshift and decreases toward ∼15% at z ∼ 0.8. The zCOSMOS group catalog is broadly consistent with that expected from the semianalytic evolution model underlying the mock catalogs. Not least, we show that the number density of groups with a given intrinsic richness increases from redshift z ∼ 0.8 to the present, consistent with the hierarchical growth of structure.
High-Z organic-scintillation solution
International Nuclear Information System (INIS)
Berlman, I.B.; Fluornoy, J.M.; Ashford, C.B.; Lyons, P.B.
1983-01-01
In the present experiment, an attempt is made to raise the average Z of a scintillation solution with as little attendant quenching as possible. Since high-Z atoms quench by means of a close encounter, such encounters are minimized by the use of alkyl groups substituted on the solvent, solute, and heavy atoms. The aromatic compound 1,2,4-trimethylbenzene (pseudocumene) is used as the solvent; 4,4''-di(5-tridecyl)-p-terphenyl (SC-180) as the solute; and tetrabutyltin as the high-Z material. To establish the validity of our ideas, various experiments have been performed with less protected solvents, and heavy atoms. These include benzene, toluene, p-terphenyl, bromobutane, and bromobenzene
Dynamic strength of titin's Z-disk end.
Kollár, Veronika; Szatmári, Dávid; Grama, László; Kellermayer, Miklós S Z
2010-01-01
Titin is a giant filamentous protein traversing the half sarcomere of striated muscle with putative functions as diverse as providing structural template, generating elastic response, and sensing and relaying mechanical information. The Z-disk region of titin, which corresponds to the N-terminal end of the molecule, has been thought to be a hot spot for mechanosensing while also serving as anchorage for its sarcomeric attachment. Understanding the mechanics of titin's Z-disk region, particularly under the effect of binding proteins, is of great interest. Here we briefly review recent findings on the structure, molecular associations, and mechanics of titin's Z-disk region. In addition, we report experimental results on the dynamic strength of titin's Z1Z2 domains measured by nanomechanical manipulation of the chemical dimer of a recombinant protein fragment.
Z-2 Prototype Space Suit Development
Ross, Amy; Rhodes, Richard; Graziosi, David; Jones, Bobby; Lee, Ryan; Haque, Bazle Z.; Gillespie, John W., Jr.
2014-01-01
NASA's Z-2 prototype space suit is the highest fidelity pressure garment from both hardware and systems design perspectives since the Space Shuttle Extravehicular Mobility Unit (EMU) was developed in the late 1970's. Upon completion the Z-2 will be tested in the 11 foot human-rated vacuum chamber and the Neutral Buoyancy Laboratory (NBL) at the NASA Johnson Space Center to assess the design and to determine applicability of the configuration to micro-, low- (asteroid), and planetary- (surface) gravity missions. This paper discusses the 'firsts' that the Z-2 represents. For example, the Z-2 sizes to the smallest suit scye bearing plane distance for at least the last 25 years and is being designed with the most intensive use of human models with the suit model.
Rules of thumb for the Z line shape
International Nuclear Information System (INIS)
Beenakker, W.; Berends, F.A.; Marck, S.C. van der
1990-01-01
In this paper the theoretical parameters of the Z line shape, such as M Z and Γ Z , and the one photon exchange diagram are related to a set of parameters characterizing the experimental line shape. The latter are the peak height σ max , peak position √S max and half peak positions √S ± . The rules of thumb are accurate within 10 MeV. As a result we obtain approximate formulae which express M Z and Γ Z in the measured √S max and √S + -√S - . (orig.)
Matere z motnjami v duševnem razvoju
Kolarič, Sandra
2015-01-01
S pregledom tuje literature in že opravljenih raziskav v tujini smo v teoretičnem delu magistrske naloge zajeli značilnosti mater z motnjami v duševnem razvoju, dejavnike, ki vplivajo na uspešnost opravljanja materinske vloge, ter pravice oseb z motnjami v duševnem razvoju do starševstva, v povezavi z zakonodajo na slovenskem. Navedli smo vzroke za omejevanje reprodukcije pri ženskah z motnjami v duševnem razvoju in problematiko odvzema skrbništva materam z motnjami v duševnem razvoju nad otr...
Energy Technology Data Exchange (ETDEWEB)
Jaacks, Jason; Thompson, Robert [Department of Physics and Astronomy, University of Nevada, Las Vegas, 4505 S. Maryland Pkwy, Las Vegas, NV 89154-4002 (United States); Nagamine, Kentaro, E-mail: jaacksj@physics.unlv.edu [Visiting Scientist. Kavli Institute for the Physics and Mathematics for the Universe (IPMU), University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa 277-8583, Japan. (Japan)
2013-04-01
We present the results of a numerical study examining the effect of an H{sub 2}-based star formation (SF) model on the rest-frame UV luminosity function and star formation rate function (SFRF) of z {>=} 6 galaxies, and the implications for reionization. Using cosmological hydrodynamical simulations outfitted with an H{sub 2}-SF model, we find good agreement with our previous results (non-H{sub 2} SF model) and observations at M{sub uv} {<=} -18. However, at M{sub uv} > -18, we find that the LF deviates from both our previous work and current observational extrapolations, producing significantly fewer low-luminosity galaxies and exhibiting additional turnover at the faint end. We constrain the redshift evolution of this turnover point using a modified Schechter function that includes additional terms to quantify the turnover magnitude (M{sub uv}{sup t}) and subsequent slope ({beta}). We find that M{sub uv}{sup t} evolves from M{sub uv}{sup t}=-17.33 (at z = 8) to -15.38 (z = 6), while {beta} becomes shallower by {Delta}{beta} = 0.22 during the same epoch. This occurs in an M{sub uv} range that will be observable by James Webb Space Telescope. By integrating the SFRF, we determine that even though the H{sub 2}-SF model significantly reduces the number density of low-luminosity galaxies at M{sub uv} > -18, it does not suppress the total SFR density enough to affect the capability of SF to maintain reionization.
Akers, R J; Allison, J; Anderson, K J; Arcelli, S; Astbury, Alan; Axen, D A; Azuelos, Georges; Baines, J T M; Ball, A H; Banks, J; Barlow, R J; Barnett, S; Bartoldus, R; Batley, J Richard; Beaudoin, G; Beck, A; Beck, G A; Becker, J; Beeston, C; Behnke, T; Bell, K W; Bella, G; Bentkowski, P; Berlich, P; Bethke, Siegfried; Biebel, O; Bloodworth, Ian J; Bock, P; Boden, B; Bosch, H M; Boutemeur, M; Breuker, Horst; Bright-Thomas, P G; Brown, R M; Buijs, A; Burckhart, Helfried J; Burgard, C; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chu, S L; Clarke, P E L; Clayton, J C; Cohen, I; Conboy, J E; Cooper, M; Coupland, M; Cuffiani, M; Dado, S; Dallavalle, G M; De Jong, S; del Pozo, L A; Deng, H; Dieckmann, A; Dittmar, Michael; Dixit, M S; do Couto e Silva, E; Duboscq, J E; Duchovni, E; Duckeck, G; Duerdoth, I P; Dumas, D J P; Elcombe, P A; Estabrooks, P G; Etzion, E; Evans, H G; Fabbri, Franco Luigi; Fabbro, B; Fierro, M; Fincke-Keeler, Margret; Fischer, H M; Fong, D G; Foucher, M; Gaidot, A; Gary, J W; Gascon, J; Geddes, N I; Geich-Gimbel, C; Gensler, S W; Gentit, F X; Giacomelli, G; Giacomelli, R; Gibson, V; Gibson, W R; Gillies, James D; Goldberg, J; Gingrich, D M; Goodrick, M J; Gorn, W; Grandi, C; Grant, F C; Hagemann, J; Hanson, G G; Hansroul, M; Hargrove, C K; Harrison, P F; Hart, J; Hattersley, P M; Hauschild, M; Hawkes, C M; Heflin, E; Hemingway, Richard J; Herten, G; Heuer, R D; Hill, J C; Hillier, S J; Hilse, T; Hinshaw, D A; Hobbs, J D; Hobson, P R; Hochman, D; Homer, R James; Honma, A K; Hughes-Jones, R E; Humbert, R; Igo-Kemenes, P; Ihssen, H; Imrie, D C; Janissen, A C; Jawahery, A; Jeffreys, P W; Jeremie, H; Jimack, Martin Paul; Jones, M; Jones, R W L; Jovanovic, P; Jui, C; Karlen, D A; Kawagoe, K; Kawamoto, T; Keeler, Richard K; Kellogg, R G; Kennedy, B W; King, J; Kluth, S; Kobayashi, T; Koetke, D S; Kokott, T P; Komamiya, S; Kral, J F; Kowalewski, R V; Von Krogh, J; Kroll, J; Kyberd, P; Lafferty, G D; Lafoux, H; Lahmann, R; Lamarche, F; Lauber, J; Layter, J G; Leblanc, P; Lee, A M; Lefebvre, E; Lehto, M H; Lellouch, Daniel; Leroy, C; Letts, J; Levinson, L; Lloyd, S L; Loebinger, F K; Lorah, J M; Lorazo, B; Losty, Michael J; Lou, X C; Ludwig, J; Luig, A; Mannelli, M; Marcellini, S; Markus, C; Martin, A J; Martin, J P; Mashimo, T; Mättig, P; Maur, U; McKenna, J A; McMahon, T J; McNutt, J R; Meijers, F; Menszner, D; Merritt, F S; Mes, H; Michelini, Aldo; Middleton, R P; Mikenberg, G; Mildenberger, J L; Miller, D J; Mir, R; Mohr, W; Moisan, C; Montanari, A; Mori, T; Morii, M; Müller, U; Nellen, B; Nguyen, H H; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oram, C J; Oreglia, M J; Orito, S; Pansart, J P; Panzer-Steindel, B; Paschievici, P; Patrick, G N; Paz-Jaoshvili, N; Pearce, M J; Pfister, P; Pilcher, J E; Pinfold, James L; Pitman, D; Plane, D E; Poffenberger, P R; Poli, B; Pritchard, T W; Przysiezniak, H; Quast, G; Redmond, M W; Rees, D L; Richards, G E; Rison, M; Robins, S A; Robinson, D; Rollnik, A; Roney, J M; Ros, E; Rossberg, S; Rossi, A M; Rosvick, M; Routenburg, P; Runge, K; Runólfsson, O; Rust, D R; Sasaki, M; Sbarra, C; Schaile, A D; Schaile, O; Schappert, W; Scharf, F; Scharff-Hansen, P; Schenk, P; Schmitt, B; von der Schmitt, H; Schröder, M; Schwick, C; Schwiening, J; Scott, W G; Settles, M; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Skillman, A; Skuja, A; Smith, A M; Smith, T J; Snow, G A; Sobie, Randall J; Springer, R W; Sproston, M; Stahl, A; Stegmann, C; Stephens, K; Steuerer, J; Ströhmer, R; Strom, D; Takeda, H; Takeshita, T; Tarem, S; Tecchio, M; Teixeira-Dias, P; Tesch, N; Thomson, M A; Torrente-Lujan, E; Towers, S; Tranströmer, G; Tresilian, N J; Tsukamoto, T; Turner, M F; Van den Plas, D; Van Kooten, R; VanDalen, G J; Vasseur, G; Wagner, A; Wagner, D L; Wahl, C; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Weber, M; Weber, P; Wells, P S; Wermes, N; Whalley, M A; Wilkens, B; Wilson, G W; Wilson, J A; Winterer, V H; Wlodek, T; Wolf, G; Wotton, S A; Wyatt, T R; Yaari, R; Yeaman, A; Yekutieli, G; Yurko, M; Zeuner, W; Zorn, G T
1993-01-01
Measurements of $B^{0}-\\overline{B}^{0}$ Mixing, $\\Gamma(Z^{0} \\to b\\overline{b}) / \\Gamma (Z^{0} \\to$ Hadrons) and Semileptonic Branching Ratios for $b$-Flavoured Hadrons in Hadronic $Z^{0}$ Decays
V ropě vidím kritický neuralgický bod západní civilizace : rozhovor s Václavem Cílkem
Czech Academy of Sciences Publication Activity Database
Bojar, T.; Cílek, Václav
2008-01-01
Roč. 9, č. 302 (2008), s. 18-20 ISSN 1213-1911 Institutional research plan: CEZ:AV0Z30130516 Keywords : oil * petroleum * energy * civilization Subject RIV: DB - Geology ; Mineralogy http://www.novyprostor.cz/casopis/pdf/302.pdf
International Nuclear Information System (INIS)
Bouwens, R. J.; Illingworth, G. D.; Franx, M.; Chary, R.-R.; Meurer, G. R.; Ford, H.; Conselice, C. J.; Giavalisco, M.; Van Dokkum, P.
2009-01-01
We provide a systematic measurement of the rest-frame UV continuum slope β over a wide range in redshift (z ∼ 2-6) and rest-frame UV luminosity (0.1 L* z = 3 to 2 L* z= 3 ) to improve estimates of the star formation rate (SFR) density at high redshift. We utilize the deep optical and infrared data (Advanced Camera for Surveys/NICMOS) over the Chandra Deep Field-South and Hubble Deep Field-North Great Observatories Origins Deep Survey fields, as well as the UDF for our primary UBVi 'dropout' Lyman Break Galaxy sample. We also use strong lensing clusters to identify a population of very low luminosity, high-redshift dropout galaxies. We correct the observed distributions for both selection biases and photometric scatter. We find that the UV-continuum slope of the most luminous galaxies is substantially redder at z ∼ 2-4 than it is at z ∼ 5-6 (from ∼-2.4 at z ∼ 6 to ∼-1.5 at z ∼ 2). Lower luminosity galaxies are also found to be bluer than higher luminosity galaxies at z ∼ 2.5 and z ∼ 4. We do not find a large number of galaxies with β's as red as -1 in our dropout selections at z ∼ 4, and particularly at z ∼> 5, even though such sources could be readily selected from our data (and also from Balmer Break Galaxy searches at z ∼ 4). This suggests that star-forming galaxies at z ∼> 5 almost universally have very blue UV-continuum slopes, and that there are not likely to be a substantial number of dust-obscured galaxies at z ∼> 5 that are missed in 'dropout' searches. Using the same relation between UV-continuum slope and dust extinction as has been found to be appropriate at both z ∼ 0 and z ∼ 2, we estimate the average dust extinction of galaxies as a function of redshift and UV luminosity in a consistent way. As expected, we find that the estimated dust extinction increases substantially with cosmic time for the most UV luminous galaxies, but remains small (∼ 4.
NARloy-Z-Carbon Nanotube Composites
Bhat, Biliyar N.
2012-01-01
Motivation: (1) NARloy-Z (Cu-3%Ag-0.5%Zr) is the state of the art, high thermal conductivity structural alloy used for making liquid rocket engine main combustion chamber liner. It has a Thermal conductivity approx 80% of pure copper. (2) Improving the thermal conductivity of NARloy-Z will help to improve the heat transfer efficiency of combustion chamber. (3)Will also help to reduce the propulsion system mass and increase performance. It will also increases thrust to weight ratio. (4) Improving heat transfer helps to design and build better thermal management systems for nuclear propulsion and other applications. Can Carbon nanotubes (CNT) help to improve the thermal conductivity (TC)of NARloy-Z? (1)CNT's have TC of approx 20X that of copper (2) 5vol% CNT could potentially double the TC of NARloy-Z if properly aligned (3) Improvement will be less if CNT s are randomly distributed, provided there is a good thermal bond between CNT and matrix. Prior research has shown poor results (1) No TC improvement in the copper-CNT composite reported (2)Reported values are typically lower (3) Attributed to high contact thermal resistance between CNT and Cu matrix (4)Results suggest that a bonding material between CNT and copper matrix is required to lower the contact thermal resistance It is hypothesized that Zr in NARloy-Z could act as a bonding agent to lower the contact thermal resistance between CNT and matrix.
In situ measurement of low-Z material coating thickness on high Z substrate for tokamaks
Energy Technology Data Exchange (ETDEWEB)
Mueller, D., E-mail: dmueller@pppl.gov; Roquemore, A. L.; Jaworski, M.; Skinner, C. H.; Miller, J.; Creely, A. [Princeton Plasma Physics Laboratory, Princeton, New Jersey 08543 (United States); Raman, P.; Ruzic, D. [Department of Nuclear, Plasma, and Radiological Engineering, Center for Plasma Material Interaction, University of Illinois, Urbana, Illinois 61801 (United States)
2014-11-15
Rutherford backscattering of energetic particles can be used to determine the thickness of a coating of a low-Z material over a heavier substrate. Simulations indicate that 5 MeV alpha particles from an {sup 241}Am source can be used to measure the thickness of a Li coating on Mo tiles between 0.5 and 15 μm thick. Using a 0.1 mCi source, a thickness measurement can be accomplished in 2 h of counting. This technique could be used to measure any thin, low-Z material coating (up to 1 mg/cm{sup 2} thick) on a high-Z substrate, such as Be on W, B on Mo, or Li on Mo. By inserting a source and detector on a moveable probe, this technique could be used to provide an in situ measurement of the thickness of Li coating on NSTX-U Mo tiles. A test stand with an alpha source and an annular solid-state detector was used to investigate the measurable range of low-Z material thicknesses on Mo tiles.
Genetical genomic determinants of alcohol consumption in rats and humans
Czech Academy of Sciences Publication Activity Database
Tabakoff, B.; Saba, L.; Printz, M.; Flodman, P.; Hodgkinson, C.; Goldman, D.; Koob, G.; Richardson, H.N.; Kechris, K.; Bell, R.L.; Hübner, N.; Heinig, M.; Pravenec, Michal; Mangion, J.; Legault, L.; Dongier, M.; Conigrave, K.M.; Whitfield, J.B.; Saunders, J.; Grant, B.; Hoffman, P.L.
2009-01-01
Roč. 7, - (2009), s. 70-70 ISSN 1741-7007 R&D Projects: GA MŠk(CZ) 1M0520 Grant - others:Howard Hughes Medical Institute(US) 55005624 Institutional research plan: CEZ:AV0Z50110509 Keywords : alcohol consumption * rat * gene expression profiles Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.636, year: 2009
Czech Academy of Sciences Publication Activity Database
Storchová, Lucie
2007-01-01
Roč. 52, 1-4 (2007), s. 9-18 ISSN 0036-5351. [Bohuslav Hasištejnský z Lobkovic a kultura jeho doby. Praha, 25.05.2007] Institutional research plan: CEZ:AV0Z90090514 Keywords : Bohuslav Hasištejnský of Lobkowicz * Renaissance Humanism * Bohemia Subject RIV: AB - History
[Research Progress on Forensic Toxicology of Z-drugs].
Zhang, Yong-zhi; He, Hong-yuan; She, Cai-meng; Lian, Jie
2015-08-01
The Z-drugs (zolpidem, zopiclone, and zaleplon), as the innovative hypnotics, have an improvement over the traditional benzodiazepines in the management of insomnia. Z-drugs have significant hypnotic effects by reducing sleep latency and improving sleep quality, though duration of sleep may not be significantly increased. As benzodiazepines, Z-drugs exert their effects through increasing the transmission of γ-aminobutyric acid. Z-drugs overdose are less likely to be fatal, more likely would result in poisoning. Z-drugs can be detected in blood, urine, saliva, and other postmortem specimens through liquid chromatography-mass spectrometry techniques. Zolpidem and zaleplon exhibit significant postmortem redistribution. Z-drugs have improved pharmacokinetic profiles, but incidence of neuropsychiatric sequelae, poisoning, and death may prove to be similar to the other hypnotics. This review focuses on the pharmacology and toxicology of Z-drugs with respect to their adverse effect profile and toxicity and toxicology data in the field of forensic medicine.
Kazakov, Alexander; Prudnikov, Valerii; Granovsky, Alexander; Perov, Nikolai; Dubenko, Igor; Pathak, Arjun Kumar; Samanta, Tapas; Stadler, Shane; Ali, Naushad; Zhukov, Arcady; Ilyin, Maxim; Gonzalez, Julian
2012-09-01
The magnetic, magnetotransport, and magnetocaloric properties near compound phase transitions in Ni50Mn35In14Z (Z = In, Ge, Al), and Ni48Co2Mn35In15 Heusler alloys have been studied using VSM and SQUID magnetometers (at magnetic fields (H) up to 5 T), four-probe method (at H = 0.005-1.5 T), and an adiabatic magnetocalorimeter (for H changes up to deltaH = 1.8 T), respectively. The martensitic transformation (MT) is accompanied by large magnetoresistance (up to 70%), a significant change in resistivity (up to 200%), and a sign reversal of the ordinary Hall effect coefficient, all related to a strong change in the electronic spectrum at the MT. The field dependences of the Hall resistance are complex in the vicinity of the MT, indicating a change in the relative concentrations of the austenite and martensite phases at strong fields. Negative and positive changes in adiabatic temperatures of about -2 K and +2 K have been observed in the vicinity of MT and Curie temperatures, respectively, for deltaH = 1.8 T.
Directory of Open Access Journals (Sweden)
Balbachevsky Daniel
2011-06-01
Full Text Available Abstract Background Z-effect and reverse Z-effect are complications that arise from the surgical treatment of pertrochanteric fractures of the femur with proximal femoral nails (PFN comprising two interlocking head screws. Such complications are induced by the migration of screws in opposite directions, which may lead to failure of the osteosynthesis. Findings The paper describes three cases of pertrochanteric fractures that were treated with PFN with two interlocking screws that evolved to either Z-effect or reverse Z-effect. Literature-based explanations for this phenomenon are provided together with recommendations of how to avoid such complications. Conclusions Although intramedullary fixation is an established method of treatment of femoral intertrochanteric and subtrochanteric fractures, the evolution of the procedure may include complications associated with the migration of the interlocking head screws. The occurrence of Z-effect and reverse Z-effect has not been completely elucidated, but the main causes of such complications are probably fracture fixation in varus position, severe medial comminution, inappropriate entry point of the nail and poor bone quality.
Dynamic Strength of Titin's Z-Disk End
Directory of Open Access Journals (Sweden)
Veronika Kollár
2010-01-01
Full Text Available Titin is a giant filamentous protein traversing the half sarcomere of striated muscle with putative functions as diverse as providing structural template, generating elastic response, and sensing and relaying mechanical information. The Z-disk region of titin, which corresponds to the N-terminal end of the molecule, has been thought to be a hot spot for mechanosensing while also serving as anchorage for its sarcomeric attachment. Understanding the mechanics of titin's Z-disk region, particularly under the effect of binding proteins, is of great interest. Here we briefly review recent findings on the structure, molecular associations, and mechanics of titin's Z-disk region. In addition, we report experimental results on the dynamic strength of titin's Z1Z2 domains measured by nanomechanical manipulation of the chemical dimer of a recombinant protein fragment.
Engineering Education for Generation Z
Moore, Kevin; Jones, Carol; Frazier, Robert Scott
2017-01-01
Generation Z is gaining popularity as the name used to refer to those born beginning in the mid to late 1990s. This is the generation that follows the Millennials, and they are just starting to arrive on college campuses. Much attention has been paid to Millennials and their impact on society, and because of this Generation Z members are often…
Dattagupta, Aparajita; The ATLAS collaboration
2016-01-01
A detailed study of the techniques for identifying boosted hadronically decaying W or Z bosons is presented. The best performing algorithm for reconstructing, grooming and tagging bosonic jets as seen in studies using 8 TeV data and simulation is validated for W bosons with a wide range of transverse momenta using 13 TeV data and MC simulations. The same is studied for Z bosons in 13 TeV MC simulation. Improvement in tagger performance using detector tracking information is also studied. In addition, given that a hadronic jet has been identified as resulting from the hadronic decay of a W or Z, a technique is developed to discriminate between W and Z bosons using 8 TeV data. The alternative of using variable-R jets for capturing the hadronic decay products compared to standard techniques is also discussed.
Shan, Hangying; Xiao, Jun; Chu, Qiyi
2018-05-01
The Z-Pin interfacial bond properties play an important role in the structural performance of X-Cor® sandwich structures. This paper presents an experimental investigation on bond-slip behavior of Z-Pin interfaces using Z-Pin pull-out test. Based on the experimental data the whole Z-Pin pull-out process consists of three stages: initial bonding, debonding and frictional sliding. Comparative experimental study on the influence of design parameters on bond-slip behavior of Z-Pin interfaces has also been performed. Numerical analyses were conducted with the ABAQUS finite element (FE) program to simulate the Z-Pins bond-slip response of the pull-out test. The Z-Pins interfacial bond-slip behavior was implemented using nonlinear spring elements characterized with the constitutive relation from experimental results. Numerical results were validated by comparison with experimental data, and reasonably good agreement was achieved between experimental and analytical pull-out force-slip curves.
Leptophobic Z' in models with multiple Higgs doublet fields
Chiang, Cheng-Wei; Nomura, Takaaki; Yagyu, Kei
2015-05-01
We study the collider phenomenology of the leptophobic Z' boson from an extra U(1)' gauge symmetry in models with N -Higgs doublet fields. We assume that the Z' boson at tree level has (i) no Z- Z' mixing, (ii) no interaction with the charged leptons, and (iii) no flavour-changing neutral current. Under such a setup, it is shown that in the N = 1 case, all the U(1)' charges of left-handed quark doublets and right-handed up- and down- type quarks are required to be the same, while in the N ≥ 3 case one can take different charges for the three types of quarks. The N = 2 case is not well-defined under the above three requirements. We study the processes ( V = γ , Z and W ±) with the leptonic decays of Z and W ± at the LHC. The most promising discovery channel or the most stringent constraint on the U(1)' gauge coupling constant comes from the Z'γ process below the threshold and from the process above the threshold. Assuming the collision energy of 8 TeV and integrated luminosity of 19.6 fb-1, we find that the constraint from the Z'γ search in the lower mass regime can be stronger than that from the UA2 experiment. In the N ≥ 3 case, we consider four benchmark points for the Z' couplings with quarks. If such a Z' is discovered, a careful comparison between the Z'γ and Z' W signals is crucial to reveal the nature of Z' couplings with quarks. We also present the discovery reach of the Z' boson at the 14-TeV LHC in both N = 1 and N ≥ 3 cases.
African Journals Online (AJOL)
6(20C3) 9- 14. The Inhibitory Action of Aqueous Garlic Extract -oh the Growth of Certain Pathogenic Bacteria. Z. ASTAL. Khan Younis Hospital Laboratory, Khan Younis, Gaza-Palestinian Authority. This work reports the antibacterial effect of aqueous garlic (Allium sativum) extract on certain pathogenic Gram positive bacteria ...
Five-Level Z-Source Neutral Point-Clamped Inverter
DEFF Research Database (Denmark)
Gao, F.; Loh, P.C.; Blaabjerg, Frede
2007-01-01
This paper proposes a five-level Z-source neutralpoint- clamped (NPC) inverter with two Z-source networks functioning as intermediate energy storages coupled between dc sources and NPC inverter circuitry. Analyzing the operational principles of Z-source network with partial dclink shoot......-through scheme reveals the hidden theories in the five-level Z-source NPC inverter unlike the operational principle appeared in the general two-level Z-source inverter, so that the five-level Z-source NPC inverter can be designed with the modulation of carrier-based phase disposition (PD) or alternative phase...
Dualiy for Z(N) gauge theories
International Nuclear Information System (INIS)
Korthals Altes, C.P.
1978-04-01
The duality properties of simple Z(N) gauge theories are discussed. For N 4 these systems are not self dual. Also the order parameter is discussed. The general Z(N) gauge theory is found to be self dual for all N
INFERENCES ON THE DISTRIBUTION OF Ly{alpha} EMISSION OF z {approx} 7 AND z {approx} 8 GALAXIES
Energy Technology Data Exchange (ETDEWEB)
Treu, Tommaso; Auger, Matthew W. [Department of Physics, University of California, Santa Barbara, CA 93106 (United States); Trenti, Michele [University of Colorado, Center for Astrophysics and Space Astronomy, 389-UCB, Boulder, CO 80309 (United States); Stiavelli, Massimo; Bradley, Larry D., E-mail: tt@physics.ucsb.edu [Space Telescope Science Institute, 3700 San Martin Dr, Baltimore MD 21218 (United States)
2012-03-01
Spectroscopic confirmation of galaxies at z {approx} 7 and above has been extremely difficult, owing to a drop in intensity of Ly{alpha} emission in comparison with samples at z {approx} 6. This crucial finding could potentially signal the ending of cosmic reionization. However, it is based on small data sets, often incomplete and heterogeneous in nature. We introduce a flexible Bayesian framework, useful to interpret such evidence. Within this framework, we implement two simple phenomenological models: a smooth one where the distribution of Ly{alpha} is attenuated by a factor {epsilon}{sub s} with respect to z {approx} 6 and a patchy one where a fraction {epsilon}{sub p} is absorbed/non-emitted while the rest is unabsorbed. From a compilation of 39 observed z {approx} 7 galaxies, we find {epsilon}{sub s} = 0.69 {+-} 0.12 and {epsilon}{sub p} = 0.66 {+-} 0.16. The models can be used to compute fractions of emitters above any equivalent width W. For W > 25 A, we find X{sup 25}{sub z=7} = 0.37 {+-} 0.11 (0.14 {+-} 0.06) for galaxies fainter (brighter) than M{sub UV} = -20.25 for the patchy model, consistent with previous work, but with smaller uncertainties by virtue of our full use of the data. At z {approx} 8 we combine new deep (5{sigma} flux limit 10{sup -17} erg s{sup -1} cm{sup -2}) Keck/NIRSPEC observations of a bright Y-dropout identified by our Brightest of Reionization Galaxies Survey, with those of three objects from the literature and find that the inference is inconclusive. We compute predictions for future near-infrared spectroscopic surveys and show that it is challenging but feasible to constrain the distribution of Ly{alpha} emitters at z {approx} 8 and distinguish between models.
INFERENCES ON THE DISTRIBUTION OF Lyα EMISSION OF z ∼ 7 AND z ∼ 8 GALAXIES
International Nuclear Information System (INIS)
Treu, Tommaso; Auger, Matthew W.; Trenti, Michele; Stiavelli, Massimo; Bradley, Larry D.
2012-01-01
Spectroscopic confirmation of galaxies at z ∼ 7 and above has been extremely difficult, owing to a drop in intensity of Lyα emission in comparison with samples at z ∼ 6. This crucial finding could potentially signal the ending of cosmic reionization. However, it is based on small data sets, often incomplete and heterogeneous in nature. We introduce a flexible Bayesian framework, useful to interpret such evidence. Within this framework, we implement two simple phenomenological models: a smooth one where the distribution of Lyα is attenuated by a factor ε s with respect to z ∼ 6 and a patchy one where a fraction ε p is absorbed/non-emitted while the rest is unabsorbed. From a compilation of 39 observed z ∼ 7 galaxies, we find ε s = 0.69 ± 0.12 and ε p = 0.66 ± 0.16. The models can be used to compute fractions of emitters above any equivalent width W. For W > 25 Å, we find X 25 z=7 = 0.37 ± 0.11 (0.14 ± 0.06) for galaxies fainter (brighter) than M UV = –20.25 for the patchy model, consistent with previous work, but with smaller uncertainties by virtue of our full use of the data. At z ∼ 8 we combine new deep (5σ flux limit 10 –17 erg s –1 cm –2 ) Keck/NIRSPEC observations of a bright Y-dropout identified by our Brightest of Reionization Galaxies Survey, with those of three objects from the literature and find that the inference is inconclusive. We compute predictions for future near-infrared spectroscopic surveys and show that it is challenging but feasible to constrain the distribution of Lyα emitters at z ∼ 8 and distinguish between models.
Top-philic Z ' forces at the LHC
Fox, Patrick J.; Low, Ian; Zhang, Yue
2018-03-01
Despite extensive searches for an additional neutral massive gauge boson at the LHC, a Z ' at the weak scale could still be present if its couplings to the first two generations of quarks are suppressed, in which case the production in hadron colliders relies on tree-level processes in association with heavy flavors or one-loop processes in association with a jet. We consider the low-energy effective theory of a top-philic Z ' and present possible UV completions. We clarify theoretical subtleties in evaluating the production of a top-philic Z ' at the LHC and examine carefully the treatment of ananomalous Z ' current in the low-energy effective theory. Recipes for properly computing the production rate in the Z ' + j channel are given. We discuss constraints from colliders and low-energy probes of new physics. As an application, we apply these considerations to models that use a weak-scale Z ' to explain possible violations of lepton universality in B meson decays, and show that the future running of a high luminosity LHC can potentially cover much of the remaining parameter space favored by this particular interpretation of the B physics anomaly.
Directory of Open Access Journals (Sweden)
Luiz Tadeu Moraes Figueiredo
1990-03-01
Full Text Available Colônias de células de mosquito Aedes albopictus C6/36 foram infectadas com 23 arbovirus, sendo 19 destes existentes no Brasil, pertencentes às famílias Togaviridae, Flaviviridae, Bunyaviridae e Rhabdoviridae. A Replicação virai foi detectada por imunofluorescência indireta com todos os vírus estudados enquanto que o efeito citopático foi observado durante a infecção por alguns destes. No teste de imunofluorescência indireta utilizou-se fluidos ascíticos imunes de camundongos, específicos para os vírus estudados. A replicação virai caracterizada por grande produção de antígeno recomenda a utilização de células C6/36 na propagação e em tentativas de isolamento desses arbovirus. A técnica de imunofluorescência ofereceu importantes subsídios na classificação e identificação de vírus que replicam nestas células.
Exposing Dark Sector with Future Z-Factories arXiv
Liu, Jia; Wang, Xiao-Ping; Xue, Wei
We investigate the prospects of searching dark sector models via exotic Z-boson decay at future $e^+ e^-$ colliders with Giga Z and Tera Z options. Four general categories of dark sector models: Higgs portal dark matter, vector portal dark matter, inelastic dark matter and axion-like particles, are considered. Focusing on channels motivated by the dark sector models, we carry out a model independent study of the sensitivities of Z-factories in probing exotic decays. The limits on branching ratios of the exotic Z decay are typically $\\mathcal{O} (10^{-6} - 10^{-8.5}) $ for the Giga Z and $\\mathcal{O} (10^{-7.5} - 10^{-11})$ for the Tera Z, and they are compared with the projection for the high luminosity LHC. We demonstrate that future Z-factories can provide its unique and leading sensitivity, and highlight the complementarity with other experiments, including the indirect and direct dark matter search limits, and the existing collider limits. Future Z factories will play a leading role to uncover the hidden ...
Czech Academy of Sciences Publication Activity Database
Makrlík, E.; Toman, Petr; Vaňura, P.; Moyer, B. A.
2013-01-01
Roč. 1033, 6 February (2013), s. 14-18 ISSN 0022-2860 R&D Projects: GA ČR(CZ) GAP205/10/2280 Institutional research plan: CEZ:AV0Z40500505 Institutional support: RVO:61389013 Keywords : cesium cation * calix[4]arene-bis(t-octylbenzo-18-crown-6) * complexation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.599, year: 2013
Duality for Z(N) gauge theories
International Nuclear Information System (INIS)
Korthals Altes, C.P.
1978-01-01
The duality properties of simple Z(N) gauge theories are discussed. For N 4 these systems are not self dual. Also, the order parameter is discussed. The general Z(N) gauge theory is found to be self dual for all N. (Auth.)
Czech Academy of Sciences Publication Activity Database
Čapková, M.; Hansíková, H.; Godinot, C.; Houšťková, H.; Houštěk, Josef; Zeman, J.
2002-01-01
Roč. 141, č. 20 (2002), s. 636-641 ISSN 0008-7335 R&D Projects: GA MZd NE6555 Grant - others:GA UK(CZ) 8/2000/C; CZ - FR(XC) Projekt Barrande 2001/028-1 Institutional research plan: CEZ:AV0Z5011922 Keywords : Leigh syndrome * SURF1 gene * SURF1 protein Subject RIV: EB - Genetics ; Molecular Biology
Interaction of high cycle fatigue with high temperature creep in superalloy single crystals
Czech Academy of Sciences Publication Activity Database
Lukáš, Petr; Kunz, Ludvík; Svoboda, Milan
2002-01-01
Roč. 93, č. 7 (2002), s. 661-665 ISSN 0044-3093 R&D Projects: GA AV ČR IAA2041002; GA AV ČR KSK1010104 Institutional research plan: CEZ:AV0Z2041904 Keywords : Single crystals * Creep/fatigue interaction * Persistent slip bands Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.636, year: 2002
Czech Academy of Sciences Publication Activity Database
Schneider, G. F.; Šubr, Vladimír; Ulbrich, Karel; Decher, G.
2009-01-01
Roč. 9, č. 2 (2009), s. 636-642 ISSN 1530-6984 R&D Projects: GA AV ČR KAN200200651 Grant - others:Marie Curie Fellowship(XE) HPMT-CT-2001-00396 Institutional research plan: CEZ:AV0Z40500505 Keywords : nanoparticles * N-(2-hydroxypropyl)methacrylamide copolymers * doxorubicin Subject RIV: CD - Macromolecular Chemistry Impact factor: 9.991, year: 2009
$Z_b(10650)$ and $Z_b(10610)$ states in a chiral quark model
Li, M. T.; Wang, W. L.; Dong, Y. B.; Zhang, Z. Y.
2012-01-01
We perform a systematic study of $B\\bar{B}^*$, $B^*\\bar{B}^*$, $D\\bar{D}^*$ and $D^*\\bar{D}^*$ systems by using effective interaction in our chiral quark model. Our results show that the interactions of $B\\bar{B}^*$, $B^*\\bar{B}^*$, $D\\bar{D}^*$ and $D^*\\bar{D}^*$ states are attractive, which consequently result in $B\\bar{B}^*$, $B^*\\bar{B}^*$, $D\\bar{D}^*$ and $D^*\\bar{D}^*$ bound states. The recent observed exotic-like hadrons of $Z_b(10610)$ and $Z_b(10650)$ are, therefore in our approach,...
Strongly interacting W's and Z's
International Nuclear Information System (INIS)
Gaillard, M.K.
1984-01-01
The study focussed primarily on the dynamics of a strongly interacting W, Z(SIW) sector, with the aim of sharpening predictions for total W, Z yield and W, Z multiplicities expected from WW fusion for various scenarios. Specific issues raised in the context of the general problem of modeling SIW included the specificity of the technicolor (or, equivalently, QCD) model, whether or not a composite scalar model can be evaded, and whether the standard model necessarily implies an I = J = O state (≅ Higgs particle) that is relatively ''light'' (M ≤ hundreds of TeV). The consensus on the last issue was that existing arguments are inconclusive. While the author shall briefly address compositeness and alternatives to the technicolor model, quantitative estimates will be of necessity based on technicolor or an extrapolation of pion data
A high impedance mega-ampere generator for fiber z-pinch experiments
International Nuclear Information System (INIS)
Mitchell, I.H.; Bayley, J.M.; Chittenden, J.P.; Worley, J.F.; Dangor, A.E.; Haines, M.G.; Choi, P.
1996-01-01
At Imperial College a mega-ampere generator for plasma implosion experiments has been designed, built, and commissioned. With a final line impedance of 1.25 Ω this terawatt class generator has been designed primarily to drive a maximum current of 1.8 MA with a rise time of 150 ns into high inductance z-pinch loads of interest to radiative collapse studies. This article describes the design and tests of the generator which has a novel configuration of lines and a new design of a magnetically insulated transmission line (MITL). In summary, the generator consists of four Marx generators each of the Hermes III type (2.4 MV, 84 kJ), each connected to 5 Ω pulse forming lines and trigatron gas switches. The power is fed into the matched 1.25 Ω vertical transfer line which feeds a diode stack and a short conical MITL in vacuum which concentrates the power into the z-pinch load. At 80% charge a current rising to 1.4 MA in 150 ns has been measured in a 15 nH inductive short. Similar results are obtained when using a plasma load. copyright 1996 American Institute of Physics
[(Z-O-Ethyl N-(4-nitrophenylthiocarbamato-κS](triethylphosphine-κPgold(I
Directory of Open Access Journals (Sweden)
Soo Yei Ho
2009-11-01
Full Text Available In the title compound, [Au(C9H9N2O3S(C6H15P], two virtually identical molecules comprise the asymmetric unit. These are connected by Au...Au [3.6796 (4 Å] and Au...S [3.6325 (18 and 3.5471 (18 Å] contacts, forming a dimeric aggregate. The presence of intramolecular Au...O contacts [2.993 (5 and 2.957 (5 Å] is responsible for the slight deviations from the ideal linear coordination environments about the AuI ions. The conformation about the central C=N double bond is Z. Supramolecular chains sustained by π–π [3.573 (4 Å] and C—H...π interactions are evident in the crystal structure. These are connected into layers via weak intermolecular C—H...O interactions involving the nitro-group O atoms.
Czech Academy of Sciences Publication Activity Database
Ehala, Sille; Toman, Petr; Makrlík, E.; Kašička, Václav
2009-01-01
Roč. 1216, č. 45 (2009), s. 7927-7931 ISSN 0021-9673 R&D Projects: GA ČR(CZ) GA203/08/1428; GA AV ČR 1ET400500402 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z40500505 Keywords : affinity capillary electrophoresis * benzo-18-crown-6-ether * density functional theory Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.101, year: 2009
International Nuclear Information System (INIS)
Burnham, C.A.; Kaufman, D.E.; Chesler, D.A.; Stearns, C.W.; Correia, J.A.; Brownell, G.L.
1990-01-01
In order to examine the potential of low-Z detector materials for PET, a small field imaging system using plastic detectors has been designed. In this system the site of a photon interaction in the detector is located using light produced by the first Compton electron. This is in contrast to high-Z detectors where multiple interactions occur. The calculated performance of the detector and supporting measurements are presented
Directory of Open Access Journals (Sweden)
Shin-Ya eMiyagishima
2014-09-01
Full Text Available The chloroplast division machinery is a mixture of a stromal FtsZ-based complex descended from a cyanobacterial ancestor of chloroplasts and a cytosolic dynamin-related protein (DRP 5B-based complex derived from the eukaryotic host. Molecular genetic studies have shown that each component of the division machinery is normally essential for normal chloroplast division. However, several exceptions have been found. In the absence of the FtsZ ring, nonphotosynthetic plastids are able to proliferate, likely by elongation and budding. Depletion of DRP5B impairs, but does not stop chloroplast division. Chloroplasts in glaucophytes, which possesses a peptidoglycan (PG layer, divide without DRP5B. Certain parasitic eukaryotes possess nonphotosynthetic plastids of secondary endosymbiotic origin, but neither FtsZ nor DRP5B is encoded in their genomes. Elucidation of the FtsZ- and/or DRP5B-less chloroplast division mechanism will lead to a better understanding of the function and evolution of the chloroplast division machinery and the finding of the as-yet-unknown mechanism that is likely involved in chloroplast division. Recent studies have shown that FtsZ was lost from a variety of prokaryotes, many of which lost PG by regressive evolution. In addition, even some of the FtsZ-bearing bacteria are able to divide when FtsZ and PG are depleted experimentally. In some cases, alternative mechanisms for cell division, such as budding by an increase of the cell surface-to-volume ratio, are proposed. Although PG is believed to have been lost from chloroplasts other than in glaucophytes, there is some indirect evidence for the existence of PG in chloroplasts. Such information is also useful for understanding how nonphotosynthetic plastids are able to divide in FtsZ-depleted cells and the reason for the retention of FtsZ in chloroplast division. Here we summarize information to facilitate analyses of FtsZ- and/or DRP5B-less chloroplast and nonphotosynthetic plastid
Skarka, M.; Liška, J.; Dřevěný, R.; Sódor, Á.; Barnes, T.; Kolenberg, K.
2018-04-01
We comment on short- and long-term pulsation period variations of Z CVn, a classical RR Lyrae star with the Blazhko effect. Z CVn shows cyclic-like O-C diagram that can be interpreted as a consequence of binarity throught the light travel time effect. We show that this hypothesis is false and that the observed long-term period variations must be caused by some effect that is intrinsic to the star. We also show that the Blazhko period is not simply anti-correlated with the long-term period variations as was suggested by previous authors.
Short CommuniCationS, noteS and reportS
African Journals Online (AJOL)
Lappet-faced Vultures with white feathers hein van Grouw. Curator, Bird Group, Dept. of Zoology, The Natural History Museum, Akeman Street,. Tring, Herts, HP23 6AP, UK. e-mail: h.van-grouw@nhm.ac.uk. Two different Lappet-faced Vultures Torgos tracheliotos with remarkable white feathers over their bodies are seen.
Dark Z implication for flavor physics
Energy Technology Data Exchange (ETDEWEB)
Xu, Fanrong [Institute of Physics, Academia Sinica, Taipei, Taiwan 11529, R.O. (China); Department of Physics, Jinan University, Guangzhou 510632 (China); Kavli Institute for Theoretical Physics China, Chinese Academy of Sciences, Beijing 100190 (China)
2015-06-25
Dark Z/dark photon (Z{sup ′}) is one candidate of dark force carrier, which helps to interpret the properties of dark matter (DM). Other than conventional studies of DM including direct detection, indirect detection and collider simulation, in this work we take flavor physics as a complementary approach to investigate the features of dark matter. We give an exact calculation of the new type of penguin diagram induced by Z{sup ′} which further modifies the well-known X,Y,Z functions in penguin-box expansion. The measurement of rare decays B→K{sup (∗)}μ{sup +}μ{sup −} and B{sub s}→μ{sup +}μ{sup −} at LHC, together with direct CP violation ε{sup ′}/ε in K→ππ as well as K{sub L}→μ{sup +}μ{sup −}, are used to determine the parameter space. The size of coupling constant, however, is found to be O(1) which is much weaker than the known constraints.
International Nuclear Information System (INIS)
Ly Chun; Lee, Janice C.; Momcheva, Ivelina; Dale, Daniel A.; Staudaher, Shawn; Moore, Carolynn A.; Salim, Samir; Finn, Rose
2011-01-01
We present new measurements of the Hα luminosity function (LF) and star formation rate (SFR) volume density for galaxies at z ∼ 0.8. Our analysis is based on 1.18 μm narrowband data from the NEWFIRM Hα (NewHα) Survey, a comprehensive program designed to capture deep samples of intermediate redshift emission-line galaxies using narrowband imaging in the near-infrared. The combination of depth (∼1.9 x 10 -17 erg s -1 cm -2 in Hα at 3σ) and areal coverage (0.82 deg 2 ) of the 1.18 μm observations complements other recent Hα studies at similar redshifts, and enables us to minimize the impact of cosmic variance and place robust constraints on the shape of the LF. The present sample contains 818 NB118 excess objects, 394 of which are selected as Hα emitters. Optical spectroscopy has been obtained for 62% of the NB118 excess objects. Empirical optical broadband color classification is used to sort the remainder of the sample. A comparison of the LFs constructed for the four individual fields covered by the observations reveals significant cosmic variance, emphasizing that multiple, widely separated observations are required for such analyses. The dust-corrected LF is well described by a Schechter function with L * = 10 43.00±0.52 erg s -1 , Φ * = 10 -3.20±0.54 Mpc -3 , and α = -1.6 ± 0.19. We compare our Hα LF and SFR density to those at z ∼ 3.4 , which we attribute to significant L * evolution. Our Hα SFR density of 10 -1.00±0.18 M sun yr -1 Mpc -3 is consistent with UV and [O II] measurements at z ∼ 1. We discuss how these results compare to other Hα surveys at z ∼ 0.8, and find that the different methods used to determine survey completeness can lead to inconsistent results. This suggests that future surveys probing fainter luminosities are needed, and more rigorous methods of estimating the completeness should be adopted as standard procedure (for example, with simulations which try to simultaneously reproduce the observed Hα LF and
Decays A →Z γ γ and ϕ →Z γ γ (ϕ =h , H ) in two-Higgs doublet models
Sánchez-Vélez, R.; Tavares-Velasco, G.
2018-05-01
The one-loop contributions to the decays of the C P -odd and C P -even scalar bosons A →Z γ γ and ϕ →Z γ γ (ϕ =h , H ) are calculated within the framework of C P -conserving two-Higgs doublet models (THDMs), where they are induced by box and reducible Feynman diagrams. The behavior of the corresponding branching ratios are then analyzed within the type-II THDM in a region of the parameter space around the alignment limit and still consistent with experimental data. It is found that the A →Z γ γ branching ratio is only relevant when mA>mH+mZ , but it is negligible otherwise. For mA>600 GeV and tβ≃O (1 ), BR (A →Z γ γ ) can reach values of the order of 10-5-10-4, but it decreases by about 1 order of magnitude as tβ increases up to 10. A similar behavior is followed by the H →Z γ γ decay, which only has a non-negligible branching ratio when mH>mA+mZ and can reach the level of 10-4-10-3 for mH>600 GeV and tβ≃O (1 ). We also estimated the branching ratios of these rare decays in the type-I THDM, where they can be about 1 order of magnitude larger than in type-II THDM. As far as the h →Z γ γ decay is concerned, since the properties of this scalar boson must be nearly identical to those of the SM Higgs boson, the h →Z γ γ branching ratio does not deviate significantly from the SM prediction, where it is negligibly small, of the order of 10-9. This result is in agreement with previous calculations.
Xin, Qi-Lin; Deng, Cheng-Lin; Chen, Xi; Wang, Jun; Wang, Shao-Bo; Wang, Wei; Deng, Fei; Zhang, Bo; Xiao, Gengfu; Zhang, Lei-Ke
2017-06-15
Zika virus (ZIKV) is an emerging arbovirus belonging to the genus Flavivirus of the family Flaviviridae During replication processes, flavivirus manipulates host cell systems to facilitate its replication, while the host cells activate antiviral responses. Identification of host proteins involved in the flavivirus replication process may lead to the discovery of antiviral targets. The mosquitoes Aedes aegypti and Aedes albopictus are epidemiologically important vectors for ZIKV, and effective restrictions of ZIKV replication in mosquitoes will be vital in controlling the spread of virus. In this study, an iTRAQ-based quantitative proteomic analysis of ZIKV-infected Aedes albopictus C6/36 cells was performed to investigate host proteins involved in the ZIKV infection process. A total of 3,544 host proteins were quantified, with 200 being differentially regulated, among which CHCHD2 can be upregulated by ZIKV infection in both mosquito C6/36 and human HeLa cells. Our further study indicated that CHCHD2 can promote ZIKV replication and inhibit beta interferon (IFN-β) production in HeLa cells, suggesting that ZIKV infection may upregulate CHCHD2 to inhibit IFN-I production and thus promote virus replication. Bioinformatics analysis of regulated host proteins highlighted several ZIKV infection-regulated biological processes. Further study indicated that the ubiquitin proteasome system (UPS) plays roles in the ZIKV entry process and that an FDA-approved inhibitor of the 20S proteasome, bortezomib, can inhibit ZIKV infection in vivo Our study illustrated how host cells respond to ZIKV infection and also provided a candidate drug for the control of ZIKV infection in mosquitoes and treatment of ZIKV infection in patients. IMPORTANCE ZIKV infection poses great threats to human health, and there is no FDA-approved drug available for the treatment of ZIKV infection. During replication, ZIKV manipulates host cell systems to facilitate its replication, while host cells activate
The Identification of Z-dropouts in Pan-STARRS1: Three Quasars at 6.5< z< 6.7
Venemans, B. P.; Bañados, E.; Decarli, R.; Farina, E. P.; Walter, F.; Chambers, K. C.; Fan, X.; Rix, H.-W.; Schlafly, E.; McMahon, R. G.; Simcoe, R.; Stern, D.; Burgett, W. S.; Draper, P. W.; Flewelling, H.; Hodapp, K. W.; Kaiser, N.; Magnier, E. A.; Metcalfe, N.; Morgan, J. S.; Price, P. A.; Tonry, J. L.; Waters, C.; AlSayyad, Y.; Banerji, M.; Chen, S. S.; González-Solares, E. A.; Greiner, J.; Mazzucchelli, C.; McGreer, I.; Miller, D. R.; Reed, S.; Sullivan, P. W.
2015-03-01
Luminous distant quasars are unique probes of the high-redshift intergalactic medium (IGM) and of the growth of massive galaxies and black holes in the early universe. Absorption due to neutral hydrogen in the IGM makes quasars beyond a redshift of z≃ 6.5 very faint in the optical z band, thus locating quasars at higher redshifts requires large surveys that are sensitive above 1 micron. We report the discovery of three new z\\gt 6.5 quasars, corresponding to an age of the universe of \\lt 850 Myr, selected as z-band dropouts in the Pan-STARRS1 survey. This increases the number of known z\\gt 6.5 quasars from four to seven. The quasars have redshifts of z = 6.50, 6.52, and 6.66, and include the brightest z-dropout quasar reported to date, PSO J036.5078 + 03.0498 with {{M}1450}=-27.4. We obtained near-infrared spectroscopy for the quasars, and from the Mg ii line, we estimate that the central black holes have masses between 5 × 108 and 4 × 109 {{M}⊙ } and are accreting close to the Eddington limit ({{L}Bol}/{{L}Edd}=0.13-1.2). We investigate the ionized regions around the quasars and find near-zone radii of {{R}NZ}=1.5-5.2 proper Mpc, confirming the trend of decreasing near-zone sizes with increasing redshift found for quasars at 5.7\\lt z\\lt 6.4. By combining RNZ of the PS1 quasars with those of 5.7\\lt z\\lt 7.1 quasars in the literature, we derive a luminosity-corrected redshift evolution of {{R}NZ,corrected}=(7.2+/- 0.2)-(6.1+/- 0.7)× (z-6) Mpc. However, the large spread in RNZ in the new quasars implies a wide range in quasar ages and/or a large variation in the neutral hydrogen fraction along different lines of sight. Based in part on observations collected at the European Southern Observatory, Chile, programs 179.A-2010, 092.A-0150, 093.A-0863, and 093.A-0574, and at the Centro Astronómico Hispano Alemán (CAHA) at Calar Alto, operated jointly by the Max-Planck Institut für Astronomie and the Instituto de Astrofísica de Andalucía (CSIC). This paper
Production of W/Z bosons at LHC
International Nuclear Information System (INIS)
Pioppi, M.
2014-01-01
Studies from the ATLAS and CMS experiments about the production mechanism of the heavy bosons Z and W in pp collisions at the LHC are presented. The results concern the measurement of absolute W and Z cross-sections, of differential W and Z cross-sections, of lepton charge asymmetry from W and of W polarization. Results are compared to predictions from theory and an overall good agreement is found between expectations and observations
Rare Z decays and neutrino flavor universality
Energy Technology Data Exchange (ETDEWEB)
Durieux, Gauthier [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Cornell Univ. Ithaca, NY (United States). Lab. for Elementary Particle Physics; Univ. Catholique de Louvain, Louvain-la-Neuve (Belgium). Centre for Cosmology, Particle Physics and Phenomenology; Grossman, Yuval; Kuflik, Erik [Cornell Univ. Ithaca, NY (United States). Lab. for Elementary Particle Physics; Koenig, Matthias [Mainz Univ. (Germany). PRISMA Cluster of Excellence; Mainz Univ. (Germany). Mainz Inst. for Theoretical Physics; Ray, Shamayita [Cornell Univ. Ithaca, NY (United States). Lab. for Elementary Particle Physics; Calcutta Univ. (India). Dept. of Physics
2015-12-15
We study rare four-body decays of the Z-boson involving at least one neutrino and one charged lepton. Large destructive interferences make these decays very sensitive to the Z couplings to neutrinos. As the identified charged leptons can determine the neutrino flavors, these decays probe the universality of the Z couplings to neutrinos. The rare four-body processes could be accurately measured at future lepton colliders, leading to percent level precision.
Directory of Open Access Journals (Sweden)
Ferenczy Alex
2010-11-01
Full Text Available Abstract Background HPV burden is a predictor for high-grade cervical intraepithelial neoplasia and cancer. The natural history of HPV load in young women being recently exposed to HPV is described in this paper. Methods A total of 636 female university students were followed for 2 years. Cervical specimens with HPV-16, -18, -31, or -45 DNA by consensus PCR were further evaluated with type-specific and β-globin real-time PCR assays. Proportional hazards regression was used to estimate hazard ratios (HR of infection clearance. Generalized estimating equations assessed whether HPV loads was predictive of HPV infection at the subsequent visit. Results HPV loads were consistently higher among women Conclusions The association between HPV load and persistence is not uniform across high-risk genital genotypes. HPV-16 integration was only rarely demonstrated in young women.
International Nuclear Information System (INIS)
Bliss, David Emery; Vesey, Roger Alan; Rambo, Patrick K.; Lebedev, Sergey V.; Hanson, David L.; Nash, Thomas J.; Yu, Edmund P.; Matzen, Maurice Keith; Afeyan, Bedros B.; Smith, Ian Craig; Stygar, William A.; Porter, John Larry Jr.; Cuneo, Michael Edward; Bennett, Guy R.; Campbell, Robert B.; Sinars, Daniel Brian; Chittenden, Jeremy Paul; Waisman, Eduardo Mario; Mehlhorn, Thomas Alan
2005-01-01
Over the last several years, rapid progress has been made evaluating the double-z-pinch indirect-drive, inertial confinement fusion (ICF) high-yield target concept (Hammer et al 1999 Phys. Plasmas 6 2129). We have demonstrated efficient coupling of radiation from two wire-array-driven primary hohlraums to a secondary hohlraum that is large enough to drive a high yield ICF capsule. The secondary hohlraum is irradiated from two sides by z-pinches to produce low odd-mode radiation asymmetry. This double-pinch source is driven from a single electrical power feed (Cuneo et al 2002 Phys. Rev. Lett. 88 215004) on the 20 MA Z accelerator. The double z-pinch has imploded ICF capsules with even-mode radiation symmetry of 3.1 ± 1.4% and to high capsule radial convergence ratios of 14-21 (Bennett et al 2002 Phys. Rev. Lett. 89 245002; Bennett et al 2003 Phys. Plasmas 10 3717; Vesey et al 2003 Phys. Plasmas 10 1854). Advances in wire-array physics at 20 MA are improving our understanding of z-pinch power scaling with increasing drive current. Techniques for shaping the z-pinch radiation pulse necessary for low adiabat capsule compression have also been demonstrated.
THE CHANDRA COSMOS-LEGACY SURVEY: THE z > 3 SAMPLE
Energy Technology Data Exchange (ETDEWEB)
Marchesi, S.; Civano, F.; Urry, C. M. [Yale Center for Astronomy and Astrophysics, 260 Whitney Avenue, New Haven, CT 06520 (United States); Salvato, M. [Max-Planck-Institut für extraterrestrische Physik, Giessenbachstrasse 1, D-85748 Garching bei München (Germany); Shankar, F. [Department of Physics and Astronomy, University of Southampton, Highfield, SO17 1BJ (United Kingdom); Comastri, A.; Lanzuisi, G.; Vignali, C.; Zamorani, G.; Brusa, M.; Gilli, R. [INAF–Osservatorio Astronomico di Bologna, via Ranzani 1, 40127 Bologna (Italy); Elvis, M. [Harvard Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Trakhtenbrot, B.; Schawinski, K. [Institute for Astronomy, Department of Physics, ETH Zurich, Wolfgang-Pauli-Strasse 27, CH-8093 Zurich (Switzerland); Allevato, V. [Department of Physics, University of Helsinki, Gustaf Hällströmin katu 2a, FI-00014 Helsinki (Finland); Fiore, F. [INAF–Osservatorio Astronomico di Roma, via di Frascati 33, I-00040 Monte Porzio Catone (Italy); Griffiths, R. [Physics and Astronomy Department, Natural Sciences Division, University of Hawaii at Hilo, 200 W. Kawili Street, Hilo, HI 96720 (United States); Hasinger, G. [Institute for Astronomy, 2680 Woodlawn Drive, University of Hawaii, Honolulu, HI 96822 (United States); Miyaji, T. [Instituto de Astronomía sede Ensenada, Universidad Nacional Autónoma de México, Km. 103, Carret. Tijunana-Ensenada, Ensenada, BC (Mexico); Treister, E. [Universidad de Concepción, Departamento de Astronomía, Casilla 160-C, Concepción (Chile)
2016-08-20
We present the largest high-redshift (3 < z < 6.85) sample of X-ray-selected active galactic nuclei (AGNs) on a contiguous field, using sources detected in the Chandra COSMOS-Legacy survey. The sample contains 174 sources, 87 with spectroscopic redshift and the other 87 with photometric redshift (z {sub phot}). In this work, we treat z {sub phot} as a probability-weighted sum of contributions, adding to our sample the contribution of sources with z {sub phot} < 3 but z {sub phot} probability distribution >0 at z > 3. We compute the number counts in the observed 0.5–2 keV band, finding a decline in the number of sources at z > 3 and constraining phenomenological models of the X-ray background. We compute the AGN space density at z > 3 in two different luminosity bins. At higher luminosities (log L (2–10 keV) > 44.1 erg s{sup −1}), the space density declines exponentially, dropping by a factor of ∼20 from z ∼ 3 to z ∼ 6. The observed decline is ∼80% steeper at lower luminosities (43.55 erg s{sup −1} < logL(2–10 keV) < 44.1 erg s{sup −1}) from z ∼ 3 to z ∼ 4.5. We study the space density evolution dividing our sample into optically classified Type 1 and Type 2 AGNs. At log L (2–10 keV) > 44.1 erg s{sup −1}, unobscured and obscured objects may have different evolution with redshift, with the obscured component being three times higher at z ∼ 5. Finally, we compare our space density with predictions of quasar activation merger models, whose calibration is based on optically luminous AGNs. These models significantly overpredict the number of expected AGNs at log L (2–10 keV) > 44.1 erg s{sup −1} with respect to our data.
Enzyme-linked immunosorbent assays for Z-DNA.
Thomas, M J; Strobl, J S
1988-10-01
Dot blot and transblot enzyme-linked immunosorbent assays (e.l.i.s.a.) are described which provide sensitive non-radioactive methods for screening Z-DNA-specific antisera and for detecting Z-DNA in polydeoxyribonucleotides and supercoiled plasmids. In the alkaline phosphatase dot blot e.l.i.s.a., Z-DNA, Br-poly(dG-dC).poly(dG-dC), or B-DNA, poly(dG-dC).poly(dG-dC), poly(dA-dT).poly(dA-dT), Br-poly(dI-dC).poly(dI-dC), or salmon sperm DNA were spotted onto nitrocellulose discs and baked. The e.l.i.s.a. was conducted in 48-well culture dishes at 37 degrees C using a rabbit polyclonal antiserum developed against Br-poly(dG-dC).poly(dG-dC), an alkaline phosphatase-conjugated second antibody, and p-nitrophenol as the substrate. Under conditions where antibody concentrations were not limiting, alkaline phosphatase activity was linear for 2 h. Dot blot e.l.i.s.a. conditions are described which allow quantification of Z-DNA [Br-poly(dG-dC).poly(dG-dC)] within the range 5-250 ng. Dot blot and transblot horseradish peroxidase e.l.i.s.a. are described that detect Z-DNA within supercoiled plasmid DNAs immobilized on diazophenylthioether (DPT) paper. In the transblot e.l.i.s.a., plasmid pUC8 derivatives containing 16, 24, or 32 residues of Z-DNA were electrophoresed in agarose gels and electrophoretically transferred to DPT paper. Z-DNA-antibody complexes were detected by the horseradish peroxidase-catalysed conversion of 4-chloro-1-naphthol to a coloured product that was covalently bound to the DPT paper. Z-DNA antibody reactivity was specific for supercoiled Z-DNA containing plasmids after removal of the antibodies cross-reactive with B-DNA by absorption onto native DNA-cellulose. The transblot e.l.i.s.a. was sensitive enough to detect 16 base pairs of alternating G-C residues in 100 ng of pUC8 DNA.
Energy Technology Data Exchange (ETDEWEB)
Krasberg, Mark T. [Univ. of Michigan, Ann Arbor, MI (United States)
2003-01-01
In 1961 Sheldon Lee Glashow, while working on electroweak unification gauge theory, developed a model in which he introduced a massive neutral intermediate vector boson, call Z [1], [2], [3]. By 1967 Steven Weinberg and Abdus Salam had independently solved the theoretical problems with this model and developed their own self-consistent theory. In this thesis the Z gauge boson production rate at CDF as a function of the Z transverse momentum is studied in the dimuon channel.
Energy Technology Data Exchange (ETDEWEB)
Christofek, Leonard Steven [Illinois U., Urbana
2001-01-01
The production cross section times decay branching ratios for W + $\\gamma$ and Z/DY + $\\gamma$ have been measured in $\\sqrt{s}$ = 1.8 TeV $\\overline{p}p$ collisions using muon and electron data samples obtained during the 1992-1993 and 1994-1995 collider runs at the Fermilab Tevatron with the CDF detector corresponding to a total integrated luminosity of 110 pb . For photons with transverse energy E > 7.0 GeV, pseudorapidity in the central or plug region ($\\mid \\eta \\mid$ < 2.4) and a lepton-photon angular separation $\\Delta$R > 0.7, we observed 122(213) muon(electron) W$\\gamma$ candidates and 36(43) muon(electron) Z/DY + $\\gamma$ candidates. We observe a total of 335 muon plus electron W + $\\gamma$ and 79 muon plus electron Z/DY + $\\gamma$ candidates, whereas the standard model expectation is 264.6 $\\pm$ 18.2 W + $\\gamma$ events and 74.2 $\\pm$ 4.2 Z/DY + $\\gamma$ events. The combined electron plus muon channel results correspond to $\\sigma$ $\\cdot$ B(W + $\\gamma$ ) = 19.8 $\\pm$ 1.7 pb and $\\sigma$ $\\cdot$ B(Z/DY + $\\gamma$ ) = 5.5 $\\pm$ 0.8 pb. The next-to-leading-order standard model predictions are $\\sigma$ $\\cdot$ B(W + $\\gamma$ ) = 14.8 pb and $\\sigma$ $\\cdot$ B(Z/DY + $\\gamma$ ) = 5.8 pb. For W + $\\gamma$, this corresponds to a $\\sim$ 35% excess relative to the standard model prediction
Soubor kachlů z hradu a zámku Bechyně
Czech Academy of Sciences Publication Activity Database
Durdík, Tomáš; Pavlík, Č.
2008-01-01
Roč. 11, - (2008), s. 483-494 ISSN 1211-6831 Institutional research plan: CEZ:AV0Z80020508 Keywords : castle * castellology * stove tile * Bechyně * medieval archaeology * Middle Ages * Bohemia Subject RIV: AC - Archeology, Anthropology, Ethnology
Bouwens, Rychard J.; Illingworth, Garth D.; González, Valentino; Labbé, Ivo; Franx, Marijn; Conselice, Christopher J.; Blakeslee, John; van Dokkum, Pieter; Holden, Brad; Magee, Dan; Marchesini, Danilo; Zheng, Wei
2010-12-01
We use ~88 arcmin2 of deep (gsim26.5 mag at 5σ) NICMOS data over the two GOODS fields and the HDF-South to conduct a search for bright z >~ 7 galaxy candidates. This search takes advantage of an efficient preselection over 58 arcmin2 of NICMOS H 160-band data where only plausible z >~ 7 candidates are followed up with NICMOS J 110-band observations. ~248 arcmin2 of deep ground-based near-infrared data (gsim25.5 mag, 5σ) are also considered in the search. In total, we report 15 z 850-dropout candidates over this area—7 of which are new to these search fields. Two possible z ~ 9 J 110-dropout candidates are also found, but seem unlikely to correspond to z ~ 9 galaxies (given the estimated contamination levels). The present z ~ 9 search is used to set upper limits on the prevalence of such sources. Rigorous testing is undertaken to establish the level of contamination of our selections by photometric scatter, low-mass stars, supernovae, and spurious sources. The estimated contamination rate of our z ~ 7 selection is ~24%. Through careful simulations, the effective volume available to our z >~ 7 selections is estimated and used to establish constraints on the volume density of luminous (L* z = 3, or ~-21 mag) galaxies from these searches. We find that the volume density of luminous star-forming galaxies at z ~ 7 is 13+8 -5 times lower than at z ~ 4 and >25 times lower (1σ) at z ~ 9 than at z ~ 4. This is the most stringent constraint yet available on the volume density of gsimL* z = 3 galaxies at z ~ 9. The present wide-area, multi-field search limits cosmic variance to lsim20%. The evolution we find at the bright end of the UV LF is similar to that found from recent Subaru Suprime-Cam, HAWK-I or ERS WFC3/IR searches. The present paper also includes a complete summary of our final z ~ 7 z 850-dropout sample (18 candidates) identified from all NICMOS observations to date (over the two GOODS fields, the HUDF, galaxy clusters). Based on observations made with the
The hidden fermions in Z(2) theories
International Nuclear Information System (INIS)
Srednicki, M.
1983-01-01
Low dimensional Z(2) gauge theories have been rewritten in terms of locally coupled fermionic degrees of freedom by means of the Jordan-Wigner transformation. In this paper it is shown that higher dimensional Z(2) gauge theories are also fermionic theories in disguise. The SML solution to the 1+1 dimension Ising model is reviewed. Psi operators are represented pictorially as arrows, psi 1 points to the left, psi 2 to the right, each site of H a multiple of two operators. The 2+1 dimension Ising model is then considered. A fermion plaquette operator is introduced as the generator of a gauge symmetry for the fermionic H. Findings in 1+1 and 2+1 are then applied to 3+1 dimensional Z(2) gauge theory. A construction of this lattice is undertaken. Psi formalism replaces sigma formalism, as it permits extremely simple duality transformations to be made on any Z(2) Hamiltonian. It is shown that the fermionic formalism will lead to new ideas in Z(2) theories
Evolutionary Plasticity of AmrZ Regulation in Pseudomonas
Dougherty, Kevin; Diaz, Beatriz; Murillo, Rachel
2018-01-01
ABSTRACT amrZ encodes a master regulator protein conserved across pseudomonads, which can be either a positive or negative regulator of swimming motility depending on the species examined. To better understand plasticity in the regulatory function of AmrZ, we characterized the mode of regulation for this protein for two different motility-related phenotypes in Pseudomonas stutzeri. As in Pseudomonas syringae, AmrZ functions as a positive regulator of swimming motility within P. stutzeri, which suggests that the functions of this protein with regard to swimming motility have switched at least twice across pseudomonads. Shifts in mode of regulation cannot be explained by changes in AmrZ sequence alone. We further show that AmrZ acts as a positive regulator of colony spreading within this strain and that this regulation is at least partially independent of swimming motility. Closer investigation of mechanistic shifts in dual-function regulators like AmrZ could provide unique insights into how transcriptional pathways are rewired between closely related species. IMPORTANCE Microbes often display finely tuned patterns of gene regulation across different environments, with major regulatory changes controlled by a small group of “master” regulators within each cell. AmrZ is a master regulator of gene expression across pseudomonads and can be either a positive or negative regulator for a variety of pathways depending on the strain and genomic context. Here, we demonstrate that the phenotypic outcomes of regulation of swimming motility by AmrZ have switched at least twice independently in pseudomonads, so that AmrZ promotes increased swimming motility in P. stutzeri and P. syringae but represses this phenotype in Pseudomonas fluorescens and Pseudomonas aeruginosa. Since examples of switches in regulatory mode are relatively rare, further investigation into the mechanisms underlying shifts in regulator function for AmrZ could provide unique insights into the
Online branding to generation Z
Wirokarto, Dewi Alismah
2013-01-01
Mestrado em Marketing/ JEL Classification System: M31, I21, D71 Generation Z is the first generation growing up in a digitalized world, where Internet has become a primary need. Growing up with touch screens, smartphones and tablets impacts the development of this generation. They are born between mid 1990s and 2010. This research will attempt to demonstrate and support the assumption that Generation Z exhibits more Early adopters than the other adopter levels. Analyses...
Heliopause Electrostatic Rapid Transit System (HERTS) (Phase II)
National Aeronautics and Space Administration — Our proposal builds upon our teams technical findings in Phase 1 - that an E-Sail propelled spacecraft can travel 100 AU in less than 10 years or to the Heliopause...
Tantalum-containing Z-phase in 12%Cr martensitic steels
DEFF Research Database (Denmark)
Danielsen, Hilmar Kjartansson; Hald, John
2009-01-01
Z-phases in tantalum-containing 12%Cr steels have been investigated. In 12%Cr steel without any Nb or V, the formation of CrTaN Z-phases was observed. In 12%Cr steel which also contained V, the Ta entered Z-phase as a minor element, Cr(V,Ta)N. The crystal structure of Cr(V,Ta)N seems to be identi......Z-phases in tantalum-containing 12%Cr steels have been investigated. In 12%Cr steel without any Nb or V, the formation of CrTaN Z-phases was observed. In 12%Cr steel which also contained V, the Ta entered Z-phase as a minor element, Cr(V,Ta)N. The crystal structure of Cr(V,Ta)N seems...
The Role of the Most Luminous Obscured AGNs in Galaxy Assembly at z ∼ 2
Energy Technology Data Exchange (ETDEWEB)
Farrah, Duncan [Department of Physics, Virginia Tech, Blacksburg, VA 24061 (United States); Petty, Sara [Green Science Policy Institute, Berkeley, CA 94709 (United States); Connolly, Brian [Cincinnati Children’s Hospital Medical Center, 3333 Burnet Avenue, Cincinnati, OH 45229 (United States); Blain, Andrew [Department of Physics and Astronomy, University of Leicester, Leicester LE1 7RH (United Kingdom); Efstathiou, Andreas [School of Sciences, European University Cyprus, Diogenes Street, Engomi, 1516 Nicosia (Cyprus); Lacy, Mark [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States); Stern, Daniel; Bridge, Carrie; Eisenhardt, Peter; Moustakas, Leonidas [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Lake, Sean; Tsai, Chao-Wei [Physics and Astronomy Department, University of California, Los Angeles, CA 90095 (United States); Jarrett, Tom [Department of Astronomy, University of Cape Town, 7700 Rondebosch, Capetown 7700 (South Africa); Benford, Dominic [Observational Cosmology Lab., Code 665, NASA at Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Jones, Suzy [Department of Space, Earth, and Environment, Chalmers University of Technology, Onsala Space Observatory, SE-43992 Onsala (Sweden); Assef, Roberto [Núcleo de Astronomía de la Facultad de Ingeniería, Universidad Diego Portales, Av. Ejército Libertador 441, Santiago (Chile); Wu, Jingwen [National Astronomical Observatories, Chinese Academy of Sciences, 20A Datun Road, Chaoyang District, Beijing, 100012 (China)
2017-08-01
We present Hubble Space Telescope WFC3 F160W imaging and infrared spectral energy distributions for 12 extremely luminous, obscured active galactic nuclei (AGNs) at 1.8 < z < 2.7 selected via “hot, dust-obscured” mid-infrared colors. Their infrared luminosities span (2–15) × 10{sup 13} L {sub ⊙}, making them among the most luminous objects in the universe at z ∼ 2. In all cases, the infrared emission is consistent with arising at least for the most part from AGN activity. The AGN fractional luminosities are higher than those in either submillimeter galaxies or AGNs selected via other mid-infrared criteria. Adopting the G , M {sub 20}, and A morphological parameters, together with traditional classification boundaries, infers that three-quarters of the sample are mergers. Our sample does not, however, show any correlation between the considered morphological parameters and either infrared luminosity or AGN fractional luminosity. Moreover, the asymmetries and effective radii of our sample are distributed identically to those of massive galaxies at z ∼ 2. We conclude that our sample is not preferentially associated with mergers, though a significant merger fraction is still plausible. Instead, we propose that our sample includes examples of the massive galaxy population at z ∼ 2 that harbor a briefly luminous, “flickering” AGN and in which the G and M {sub 20} values have been perturbed due to either the AGN and/or the earliest formation stages of a bulge in an inside-out manner. Furthermore, we find that the mass assembly of the central black holes in our sample leads the mass assembly of any bulge component. Finally, we speculate that our sample represents a small fraction of the immediate antecedents of compact star-forming galaxies at z ∼ 2.
A Lyman Break Galaxy Candidate at z ~ 9
Henry, Alaina L.; Malkan, Matthew A.; Colbert, James W.; Siana, Brian; Teplitz, Harry I.; McCarthy, Patrick
2008-06-01
We report the discovery of a z ~ 9 Lyman break galaxy candidate, selected from the NICMOS Parallel Imaging Survey as a J-dropout with J110 - H160 = 1.7. Spitzer/IRAC photometry reveals that the galaxy has a blue H160 - 3.6 μm color and a spectral break between 3.6 and 4.5 μm. We interpret this break as the Balmer break and derive a best-fit photometric redshift of z ~ 9. We use Monte Carlo simulations to test the significance of this photometric redshift, and we show that there is a 96% probability of z >= 7. We estimate that the lower limit to the comoving number density of such galaxies at z ~ 9 is phi > 3.8 × 10-6 Mpc-3. If the high redshift of this galaxy is confirmed, this will indicate that the luminous end of the rest-frame UV luminosity function has not evolved substantially from z ~ 9 to z ~ 3. Still, some small degeneracy remains between this z ~ 9 model and models at z ~ 2-3 deep optical imaging (reaching IAB ~ 29) can rule out the lower z models. This work is based in part on observations made with the Spitzer Space Telescope, which is operated by the Jet Propulsion Laboratory (JPL), California Institute of Technology, under a contract with NASA. Support for this work was provided by NASA through an award issued by JPL/Caltech. This work is also based in part on observations made with the NASA/ESA Hubble Space Telescope, obtained from the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with proposals 9484, 9865, 10226, and 10899.
Schrödinger holography for z < 2
International Nuclear Information System (INIS)
Andrade, Tomás; Peach, Alex; Ross, Simon F; Keeler, Cynthia
2015-01-01
We investigate holography for asymptotically Schrödinger spacetimes, using a frame formalism. Our dictionary is based on the anisotropic scaling symmetry. We consider z < 2, where the holographic dictionary is cleaner; we make some comments on z = 2. We propose a definition of asymptotically locally Schrödinger spacetime where the leading components of the frame fields provide suitable geometric boundary data. We show that an asymptotic expansion exists for generic boundary data satisfying our boundary conditions for z < 2. (paper)
Limits on the anomalous ZZγ and Zγγ couplings in p bar p collisions at √s=1.8 TeV
International Nuclear Information System (INIS)
Abachi, S.; Abbott, B.; Abolins, M.; Acharya, B.S.; Adam, I.; Adams, D.L.; Adams, M.; Ahn, S.; Aihara, H.; Alitti, J.; Alvarez, G.; Alves, G.A.; Amidi, E.; Amos, N.; Anderson, E.W.; Aronson, S.H.; Astur, R.; Avery, R.E.; Baden, A.; Balamurali, V.; Balderston, J.; Baldin, B.; Bantly, J.; Bartlett, J.F.; Bazizi, K.; Bendich, J.; Beri, S.B.; Bertram, I.; Bezzubov, V.A.; Bhat, P.C.; Bhatnagar, V.; Bhattacharjee, M.; Bischoff, A.; Biswas, N.; Blazey, G.; Blessing, S.; Boehnlein, A.; Bojko, N.I.; Borcherding, F.; Borders, J.; Boswell, C.; Brandt, A.; Brock, R.; Bross, A.; Buchholz, D.; Burtovoi, V.S.; Butler, J.M.; Casey, D.; Castilla-Valdez, H.; Chakraborty, D.; Chang, S.; Chekulaev, S.V.; Chen, L.; Chen, W.; Chevalier, L.; Chopra, S.; Choudhary, B.C.; Christenson, J.H.; Chung, M.; Claes, D.; Clark, A.R.; Cobau, W.G.; Cochran, J.; Cooper, W.E.; Cretsinger, C.; Cullen-Vidal, D.; Cummings, M.; Cutts, D.; Dahl, O.I.; De, K.; Demarteau, M.; Demina, R.; Denisenko, K.; Denisenko, N.; Denisov, D.; Denisov, S.P.; Dharmaratna, W.; Diehl, H.T.; Diesburg, M.; Di Loreto, G.; Dixon, R.; Draper, P.; Drinkard, J.; Ducros, Y.; Dugad, S.R.; Durston-Johnson, S.; Edmunds, D.; Efimov, A.O.; Ellison, J.; Elvira, V.D.; Engelmann, R.; Eno, S.; Eppley, G.; Ermolov, P.; Eroshin, O.V.; Evdokimov, V.N.; Fahey, S.; Fahland, T.; Fatyga, M.; Fatyga, M.K.; Featherly, J.; Feher, S.; Fein, D.; Ferbel, T.; Finocchiaro, G.; Fisk, H.E.; Fisyak, Y.; Flattum, E.; Forden, G.E.; Fortner, M.; Frame, K.C.; Franzini, P.; Fredriksen, S.; Fuess, S.; Galjaev, A.N.; Gallas, E.; Gao, C.S.; Gao, S.; Geld, T.L.; Genik, R.J. II; Genser, K.; Gerber, C.E.; Gibbard, B.; Glebov, V.; Glenn, S.; Gobbi, B.; Goforth, M.; Goldschmidt, A.; Gomez, B.; Goncharov, P.I.; Gordon, H.; Goss, L.T.; Graf, N.; Grannis, P.D.; Green, D.R.; Green, J.; Greenlee, H.; Griffin, G.; Grossman, N.; Grudberg, P.; Gruenendahl, S.; Guida, J.A.; Guida, J.M.; Guryn, W.; Gurzhiev, S.N.; Gutnikov, Y.E.; Hadley, N.J.; Haggerty, H.; Hagopian, S.
1995-01-01
We performed a direct search for the anomalous ZZγ and Zγγ couplings by studying p bar p→llγ+X (l=e,μ) events at √s=1.8 TeV with the D0 detector at the Fermilab Tevatron Collider. A fit to the transverse energy spectrum of the photon in the signal events, based on the data set corresponding to an integrated luminosity of 14.3pb -1 (13.7pb -1 ) for the electron (muon) channel, yields the following 95% confidence level limits on the anomalous CP-conserving ZZγ couplings: |h 30 Z | 40 Z =0) and |h 40 Z | 30 Z =0), for a form-factor scale Λ=500 GeV. Limits for the Zγγ couplings and CP-violating couplings are also discussed
Limits on the anomalous ZZγ and Zγγ couplings in p anti p collisions at √s = 1.8 TeV
International Nuclear Information System (INIS)
Abachi, S.
1995-07-01
The authors performed a direct search for the anomalous ZZγ and Zγγ couplings by studying p anti p → ell ell γ + X, (ell = e, μ) events at √s = 1.8 TeV with the D0 detector at the Fermilab Tevatron Collider. A fit to the transverse energy spectrum of the photon in the signal events, based on the data set corresponding to an integrated luminosity of 14.3 pb -1 (13.7 pb -1 ) for the electron (muon) channel, yields the following 95% confidence level limits on the anomalous CP-conserving ZZγ couplings: |h 30 Z | 40 Z = 0), and |h 40 Z | 30 Z = 0), for a form-factor scale Λ = 500 GeV. Limits for the Zγγ couplings and CP-violating couplings are also discussed
Z-scaling in proton-nucleus collisions at high energies
International Nuclear Information System (INIS)
Zborovsky, I.; Tokarev, M.V.; Panebrattsev, Yu.A.; Skoro, G.P.
1997-01-01
New scaling, z-scaling, in the inclusive particle production in pA collisions is studied. The scaling function H A (z) is expressed via the inclusive cross section of particle production Ed 3 σ/dq 3 and the particle multiplicity density dN/dη at pseudorapidity η=0 in the corresponding nucleon-nucleon (NN) center-of-mass (CMS) system. The dependence of H A (z) on scaling variable z, the center-of-mass energy √, and the detection angle θ is investigated. The available experimental data on inclusive particle production (π ± , K ± ) in pA interactions at high energies are used to verify the universality of z-scaling found in hadron-hadron collisions. The A-dependence of H A (z) for π + -meson production is studied. It is shown that the experimental data >from pd collisions confirm the scaling properties of the function H d (z). Some predictions for H au (z) concerning production of π + -mesons in pAu interaction using the HIJING Monte Carlo code have been made. The obtained results can be of interest for future experiments at RHI and LHC in searching the signals of quark-gluon plasma formation
Santos, Sara; Graça, José
2014-01-01
Suberin is a biopolyester responsible for the protection of secondary plant tissues, and yet its molecular structure remains unknown. The C18:1 ω-hydroxyacid and the C18:1 α,ω-diacid are major monomers in the suberin structure, but the configuration of the double bond remains to be elucidated. To unequivocally define the configuration of the C18:1 suberin acids. Pure C18:1 ω-hydroxyacid and C18:1 α,ω-diacid, isolated from cork suberin, and two structurally very close C18:1 model compounds of known stereochemistry, methyl oleate and methyl elaidate, were analysed by NMR spectroscopy, Fourier transform infrared (FTIR) and Raman spectroscopy, and GC-MS. The GC-MS analysis showed that both acids were present in cork suberin as only one geometric isomer. The analysis of dimethyloxazoline (DMOX) and picolinyl derivatives proved the double bond position to be at C-9. The FTIR spectra were concordant with a cis-configuration for both suberin acids, but their unambiguous stereochemical assignment came from the NMR analysis: (i) the chemical shifts of the allylic (13) C carbons were shielded comparatively to the trans model compound, and (ii) the complex multiplets of the olefinic protons could be simulated only with (3) JHH and long-range (4) JHH coupling constants typical of a cis geometry. The two C18:1 suberin acids in cork are (Z)-18-hydroxyoctadec-9-enoic acid and (Z)-octadec-9-enedoic acid. Copyright © 2013 John Wiley & Sons, Ltd.
Soldatov, Evgeny; The ATLAS collaboration
2016-01-01
The production of Z bosons with one or two isolated high energy photons is studied using pp collisions at 8 TeV. The analyses use a data sample with an integrated luminosity of 20.3 $fb^{-1}$ collected by the ATLAS detector during the 2012 LHC data taking. The $Z\\gamma$ and $Z\\gamma\\gamma$ production cross sections are measured with leptonic (ee, $\\mu\\mu$, $\
Radiation hydrodynamics of z-pinch plasmas
International Nuclear Information System (INIS)
Davis, J.
1993-01-01
Over the years there has been a sustained interest in and fascination with Z-pinch plasmas. Whether the interest is in radiation source development, fusion plasmas, or basic research there exits an extensive bibliography of literature promulgating and perpetuating a variety of claims regarding the performance of Z-pinch plasmas. In this paper an attempt will be made to present a coherent picture of the documented and commonly held views for a class of Z-pinch plasmas concerned primarily with soft x-ray radiation source development. Many of the issues and findings are common to Z-pinch plasmas in general but the attention here will be focused on gas puffs and multiple wire arrays. The role and importance of radiation on the dynamics and the interplay between the radiation and the dynamics will also be presented and discussed. A number of comparisons with experimental results will be made with 0-, 1-, and 2-D numerical simulations for several pulsed power drivers ranging in current from several mega-amps to 10's of mega-amps for a variety of risetimes and load materials
Topology, Geometry, and Mechanics of Z -Plasty
Matsumoto, Elisabetta A.; Liang, Haiyi; Mahadevan, L.
2018-02-01
Reconstructive surgeries often use topological manipulation of tissue to minimize postoperative scarring. The most common version of this, Z -plasty, involves modifying a straight line cut into a Z shape, followed by a rotational transposition of the resulting triangular pedicle flaps, and a final restitching of the wound. This locally reorients the anisotropic stress field and reduces the potential for scarring. We analyze the planar geometry and mechanics of the Z -plasty to quantify the rotation of the overall stress field and the local forces on the restitched cut using theory, simulations, and simple physical Z -plasty experiments with foam sheets that corroborate each other. Our study rationalizes the most typical surgical choice of this angle, and opens the way for a range of surgical decisions by characterizing the stresses along the cut.
Directory of Open Access Journals (Sweden)
Meghnath Dhimal
Full Text Available Young children are at greatest risk of exposure to lead and its effects. Although lead is one of the most widely used elements with known health hazard, there is little data on the blood lead level (BLL of children in the Kathmandu Valley. Thus, this study aimed to assess factors associated with high BLL in children who were 6-36 months of age and resided in the Kathmandu Valley. In this hospital-based cross-sectional study 6-36 month-old children visiting the Paediatrics Outpatient Department of Tribhuvan University Teaching Hospital, Patan Hospital, and Siddhi Memorial Hospital were enrolled. All three hospitals are located in different areas inside the Kathmandu Valley. Written informed consent was obtained from the parents, and exposure data were collected using a structured questionnaire. Portable Anodic Stripping Voltammetry (ASV was used to determine BLLs in children. Data were analyzed using SPSS version 16. Of 312 children enrolled in the study, 64.4% had BLLs ≥5μg/dl. A significant association was found between BLL and exposure to enamel paints in the household in the form of painting materials used in different parts of the house like walls, windows and doors (p = 0.001. Furthermore, multivariate analyses showed that BLLs were 4.5 times higher in children playing with dirt and dust (p = 0.006 and that children belonging to the community of lower caste/ethnicity groups had significantly higher BLLs compared to those from the upper caste groups (p = 0.02. Our study demonstrated that children living in households that have used enamel paints, children belonging to lower caste/ethnic groups, and children frequently playing with dirt and dust had significantly higher BLLs. The results of this study highlight the importance of policy decisions to limit environmental lead contamination, and to roll out awareness building measures designed to limit lead exposure and break the poverty cycle associated with chronic lead poisoning.
Plasma focus - dense Z pinch and their applications
International Nuclear Information System (INIS)
Ishii, Shozo
1986-02-01
''Workshop on the possibility of Z-pinch as a intense pulse light source'' in 1983 and ''Research meeting on plasma focus and Z-pinch'' in 1984 were held at Institute of Plasma Physics, Nagoya University under a collaborating research program. Research activities reported at the meetings on plasma focus, dense Z-pinch, and related phenomena are summerized. (author)
Finite Larmor radius effects on Z-pinch stability
International Nuclear Information System (INIS)
Scheffel, J.; Faghihi, M.
1987-10-01
The effect of finite Larmor radius (FLR) on the stability of m=1 small axial wavelength kinks in a z-pinch with purely poloidal magnetic field is investigated. We use the Incompressible FLR MHD model; a collisionless fluid model which consistently includes the relevant FLR terms due to ion gyroviscosity, Hall effect and electron diamagnetism. With FLR terms absent, the Kadomtsev criterion of ideal MHD 2rdp/dr+m 2 B 2 /μ 0 >=0 predicts instability for internal modes unless the current density becomes singular at the centre of the pinch. The same result is obtained in the present model, with FLR terms absent. When the FLR terms are included, a normal mode analysis of the linearized equations yields the following results. Marginally unstable (ideal) modes are stabilized by gyroviscosity. The Hall terms have a damping, however not stabilizing, effect, in agreement with earlier work. Specifying a constant current and particle density equilibrium, the effect of electron diamagnetism vanishes. For a z-pinch with parameters relevant to the EXTRAP experiment, the m=1 modes are then fully stabilized over the cross-section for wavelengths λ/a max =3-5x10 18 m -1 is found, above which gyroviscous stabilization near the plasma boundary becomes insufficient. The result holds for wavelengths close to, or smaller than, the pinch radius and for realistic equilibrium profiles. This limit is far below the required limit for a reactor with contained alpha particles, which is in excess of 10 20 m -1 . (authors)
Probing the z > 6 Universe with the First Hubble Frontier Fields Cluster A2744
Atek, Hakim; Richard, Johan; Kneib, Jean-Paul; Clement, Benjamin; Egami, Eiichi; Ebeling, Harald; Jauzac, Mathilde; Jullo, Eric; Laporte, Nicolas; Limousin, Marceau; Natarajan, Priyamvada
2014-05-01
The Hubble Frontier Fields program combines the capabilities of the Hubble Space Telescope (HST) with the gravitational lensing of massive galaxy clusters to probe the distant universe to an unprecedented depth. Here, we present the results of the first combined HST and Spitzer observations of the cluster A-2744. We combine the full near-infrared data with ancillary optical images to search for gravitationally lensed high-redshift (z >~ 6) galaxies. We report the detection of 15 I 814 dropout candidates at z ~ 6-7 and one Y 105 dropout at z ~ 8 in a total survey area of 1.43 arcmin2 in the source plane. The predictions of our lens model also allow us to identify five multiply imaged systems lying at redshifts between z ~ 6 and z ~ 8. Thanks to constraints from the mass distribution in the cluster, we were able to estimate the effective survey volume corrected for completeness and magnification effects. This was in turn used to estimate the rest-frame ultraviolet luminosity function (LF) at z ~ 6-8. Our LF results are generally in agreement with the most recent blank field estimates, confirming the feasibility of surveys through lensing clusters. Although based on a shallower observations than what will be achieved in the final data set including the full Advanced Camera for Survey observations, the LF presented here goes down to M UV ~-18.5, corresponding to 0.2L sstarf at z ~ 7 with one identified object at M UV ~-15 thanks to the highly magnified survey areas. This early study forecasts the power of using massive galaxy clusters as cosmic telescopes and its complementarity to blank fields. Based on observations made with the NASA/ESA Hubble Space Telescope (HST), which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with programs 13495 and 11689. Based in part on observations made with the Spitzer Space Telescope, which is operated by the Jet Propulsion Laboratory
Search for lepton flavour violation in Z0 decays
International Nuclear Information System (INIS)
Adeva, B.; Adriani, O.; Aguilar-Benitez, M.; Akbari, H.; Alcaraz, J.; Aloisio, A.; Alverson, G.; Alviggi, M.G.; Ambrosi, G.; An, Q.; Anderhub, H.; Anderson, A.L.; Andreev, V.P.; Angelov, T.; Antonov, L.; Antreasyan, D.; Arce, P.; Arefiev, A.; Azemoon, T.; Aziz, T.; Baba, P.V.K.S.; Bagnaia, P.; Bakken, J.A.; Baksay, L.; Ball, R.C.; Banerjee, S.; Bao, J.; Barillere, R.; Barone, L.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Behrens, J.; Beingessner, S.; Bencze, G.L.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Biland, A.; Bilei, G.M.; Bizzarri, R.; Blaising, J.J.; Bloemeke, P.; Blumenfeld, B.; Bobbink, G.J.; Bocciolini, M.; Bock, R.; Boehm, A.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Boutigny, D.; Bouwens, B.; Brambilla, E.; Branson, J.G.; Brock, I.C.; Bruyant, F.; Biusson, C.; Bujak, A.; Bujak, A.; Burger, J.D.; Burger, W.; Burq, J.P.; Busenitz, J.; Cai, X.D.; Capell, M.; Caria, M.; Carminati, F.; Catraccci, A.M.; Cerrada, M.; Cesaroni, F.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, C.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chen, J.; Chen, M.; Chen, M.L.; Chen, W.Y.; Chiefari, G.; Chien, C.Y.; Chmeissani, M.; Civinini, C.; Clare, I.; Clare, R.; Cohn, H.O.; Coignet, G.; Colino, N.; Commichau, V.; Contin, A.; Crijns, F.; Cui, X.Y.; Dai, T.S.; D'Alessandro, R.D.; Asmundis, R. de; Degre, A.; Deiters, K.; Denes, E.; Denes, P.; DeNotaristefani, F.; Dhina, M.; DiBitonto, D.; Diemoz, M.; Dimitrov, H.R.; Dionisi, C.; Dova, M.T.; Drago, E.; Driever, T.; Duchesneau, D.; Duinker, P.; Duran, I.; El Mamouni, H.; Engler, S.; Eppling, F.J.; Erne, F.C.; Extermann, P.; Fabbretti, R.; Fabre, M.; Falciano, S.; Fan, Q.; Fan, S.J.; Fackler, O.; Fay, J.; Felcini, M.; Ferguson, T.; Fernandez, G.; Ferroni, F.; Fesefeldt, H.; Fiandrini, E.; Field, J.; Filthaut, F.; Finocchiaro, G.; Fisher, P.H.; Forconi, G.; Foreman, T.; Freudenreich, K.; Friebel, W.; Fukushima, M.; Gailloud, M.; Galaktionov, Yu.; Gallo, E.; Ganguli, S.N.; Garcia-Abia, P.; Gau, S.S.; Gele, D.; Gentile, S.; Glaubman, M.; Goldfarb, S.; Gong, Z.F.; Gonzalez, EJ.; Gordeev, A.; Goettlicher, P.; Goujon, D.; Gratta, G.; Grinnell, C.; Gruenenwald, M.; Guanziroli, M.; Guo, J.K.; Gurtu, A.; Gustafson, H.R.; Gutay, L.J.; Haan, H.; Hasan, A.; Hauschildt, D.; He, C.F.; Hebbeker, T.; Hebert, M.; Herten, G.; Herten, U.; Herve, A.; Hilgers, K.; Hofer, H.; Hoorani, H.; Hsu, L.S.; Hu, G.; Hu, G.Q.; Ille, B.; Ilyas, M.M.; Innocente, V.; Janssen, H.; Jezyequel, S.; Jin, B.N.; Jones, S.W.; Kasser, A.; Khan, R.A.; Kamyshkov, Yu.; Karyotakis, Y.; Kaur, M.; Khokhar, S.; Khoze, V.; Kienzle-Focacci, M.N.; Kinnison, W.; Kirkby, D.; Kirsch, S.; Kittel, W.; Klimentov, A.; Koenig, A.C.
1991-01-01
We have searched for lepton flavour violation in Z 0 boson decays into lepton pairs, Z 0 →μτ, Z 0 →eτ, and Z - →eμ. The data sample is based on an integrated luminosity of 10.4 pb -1 corresponding to 370 000 Z 0 's produced. We obtain upper limits on the branching ratios of 4.8x10 -5 for the μτ, 3.4x10 -5 for the eτ and 2.4x10 -5 for the eμ decay modes at the 95% confidence level. (orig.)
Czech Academy of Sciences Publication Activity Database
Zelinger, Zdeněk; Perrin, A.; Střižík, M.; Kubát, Pavel
2008-01-01
Roč. 249, č. 2 (2008), s. 117-120 ISSN 0022-2852 R&D Projects: GA ČR GA202/06/0216; GA MŠk LC06071; GA MŠk OC 111 Institutional research plan: CEZ:AV0Z40400503 Keywords : infrared laser spectroscopy * molecular ions * Dunham coeffcients Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.636, year: 2008
International Nuclear Information System (INIS)
Lockman, F.J.
1983-01-01
There is evidence in surveys of HI in the inner Galaxy for gas more than 500 pc from the plane that shares the rotation of material in the plane. The percentage of HI with mod(z) > 500 pc at the subcentral points rises approximately montonically from less than 2% at R 15% near the solar neighborhood. Some cloudy structure is observed. Some of the high-z gas has a larger velocity dispersion than the HI confined more closely to the plane. (Auth.)
Energy of auroral electrons and Z mode generation
Krauss-Varban, D.; Wong, H. K.
1990-01-01
The present consideration of Z-mode radiation generation, in light of observational results indicating that the O mode and second-harmonic X-mode emissions can prevail over the X-mode fundamental radiation when suprathermal electron energy is low, gives attention to whether the thermal effect on the Z-mode dispersion can be equally important, and whether the Z-mode can compete for the available free-energy source. It is found that, under suitable circumstances, the growth rate of the Z-mode can be substantial even for low suprathermal auroral electron energies. Growth is generally maximized for propagation perpendicular to the magnetic field.
The Z boson spin observables as messengers of new physics
Energy Technology Data Exchange (ETDEWEB)
Aguilar-Saavedra, J.A. [Universidad de Granada, Departamento de Fisica Teorica y del Cosmos, Granada (Spain); Bernabeu, J.; Segarra, A. [Universitat de Valencia, Departament de Fisica Teorica, Burjassot (Spain); CSIC-Universitat de Valencia, Instituto de Fisica Corpuscular, Paterna (Spain); Mitsou, V.A. [CSIC-Universitat de Valencia, Instituto de Fisica Corpuscular, Paterna (Spain)
2017-04-15
We demonstrate that the eight multipole parameters describing the spin state of the Z boson are able to disentangle known Z production mechanisms and signals from new physics at the LHC. They can be extracted from appropriate asymmetries in the angular distribution of lepton pairs from the Z boson decay. The power of this analysis is illustrated by (1) the production of Z boson plus jets; (2) Z boson plus missing transverse energy; (3) W and Z bosons originating from the two-body decay of a heavy resonance. (orig.)
A study on Z-phase nucleation in martensitic chromium steels
DEFF Research Database (Denmark)
Golpayegani, Ardeshir; Andrén, Hans-Olof; Danielsen, Hilmar Kjartansson
2008-01-01
, initial stages of precipitation of Z-phase have been studied and characterized using energy-filtered transmission electron microscopy (EFTEM). Vanadium nitrides were found to provide the most suitable nucleation site for Z-phase, since the misfit between the (0 0 1) planes of VN and Z-phase is very small....... Furthermore, such a nucleation site would provide vanadium and nitrogen for the growth of Z-phase. The presence of niobium carbide has also been observed close to Z-phase nucleation sites, indicating niobium to be important for the nucleation and growth of Z-phase....
THE NONLINEAR BIASING OF THE zCOSMOS GALAXIES UP TO z ∼ 1 FROM THE 10k SAMPLE
International Nuclear Information System (INIS)
Kovac, K.; Porciani, C.; Lilly, S. J.; Oesch, P.; Peng, Y.; Carollo, C. M.; Marinoni, C.; Guzzo, L.; Iovino, A.; Cucciati, O.; Kneib, J.-P.; Le Fevre, O.; Zamorani, G.; Bolzonella, M.; Zucca, E.; Bardelli, S.; Meneux, B.; Contini, T.; Mainieri, V.; Renzini, A.
2011-01-01
We use the zCOSMOS galaxy overdensity field to study the biasing of galaxies in the COSMOS field. By comparing the probability distribution function of the galaxy density contrast δ g to the lognormal approximation of the mass density contrast δ, we obtain the mean biasing function b(δ, z, R) between the galaxy and matter overdensity fields and its second moments b-hat and b-tilde. Over the redshift interval 0.4 g |δ) = b(δ, z, R)δ is of a characteristic shape, requiring nonlinear biasing in the most overdense and underdense regions. Taking into account the uncertainties due to cosmic variance, we do not detect any significant evolution in the (δ g |δ) function, but we do detect a significant redshift evolution in the linear biasing parameter b-hat from 1.23 ± 0.11 at z ∼ 0.55 to 1.62 ± 0.14 at z ∼ 0.75, for a luminosity-complete sample of M B -1 Mpc, but increases systematically with luminosity (at 2σ-3σ significance between the M B B B 12 M sun with a small dependence on the adopted bias-mass relation. Our detailed error analysis and comparison with previous studies lead us to conclude that cosmic variance is the main contributor to the differences in the linear bias measured from different surveys. While our results support the general picture of biased galaxy formation up to z ∼ 1, the fine-tuning of the galaxy formation models is still limited by the restrictions of the current spectroscopic surveys at these redshifts.
The Z accelerator as a source of > 100 kJ of x-rays above 4.8 keV
International Nuclear Information System (INIS)
Deeney, C.; Coverdale, C.A.; Spielman, R.B.
1998-01-01
Recent K-shell scaling experiments on the 20 MA Z accelerator at Sandia National Laboratories have shown that large diameter (40 and 55 mm) arrays can be imploded with 80 to 210 wires of titanium or stainless steel. These implosions have produced up to 150 kJ of > 4.5 keV x-rays and 65 kJ of > 6.0 keV x-rays in 7 to 18 ns FWHM pulses. This is a major advance in plasma radiation source (PRS) capability since there is presently limited test capability above 3 keV. In fact, Z produces more > 4.5 keV x-rays than previous aboveground simulators produced at 1.5 keV. Z also produces some 200 kJ of x-rays between 1 and 3 keV in a continuous spectrum for these loads. The measured spectra and yields are consistent with 1-dimensional MHD calculations performed by NRL. Thermoelastic calorimeters, PVDF gauges, and optical impulse gauges have been successfully fielded with these sources
SHARDS: A Global View of the Star Formation Activity at z ~ 0.84 and z ~ 1.23
Cava, Antonio; Pérez-González, Pablo G.; Eliche-Moral, M. Carmen; Ricciardelli, Elena; Vidal-García, Alba; Alcalde Pampliega, Belen; Alonso-Herrero, Almudena; Barro, Guillermo; Cardiel, Nicolas; Cenarro, A. Javier; Charlot, Stephane; Daddi, Emanuele; Dessauges-Zavadsky, Miroslava; Domínguez Sánchez, Helena; Espino-Briones, Nestor; Esquej, Pilar; Gallego, Jesus; Hernán-Caballero, Antonio; Huertas-Company, Marc; Koekemoer, Anton M.; Muñoz-Tunon, Casiana; Rodriguez-Espinosa, Jose M.; Rodríguez-Muñoz, Lucia; Tresse, Laurence; Villar, Victor
2015-10-01
In this paper, we present a comprehensive analysis of star-forming galaxies (SFGs) at intermediate redshifts (z ˜ 1). We combine the ultra-deep optical spectro-photometric data from the Survey for High-z Absorption Red and Dead Sources (SHARDS) with deep UV-to-FIR observations in the GOODS-N field. Exploiting two of the 25 SHARDS medium-band filters, F687W17 and F823W17, we select [O ii] emission line galaxies at z ˜ 0.84 and z ˜ 1.23 and characterize their physical properties. Their rest-frame equivalent widths (EWrf([O ii])), line fluxes, luminosities, star formation rates (SFRs), and dust attenuation properties are investigated. The evolution of EWrf([O ii]) closely follows the SFR density evolution of the universe, with a trend of EWrf([O ii]) \\propto (1 + z)3 up to redshift z ≃ 1, followed by a possible flattening. The SF properties of the galaxies selected on the basis of their [O ii] emission are compared with complementary samples of SFGs selected by their MIR and FIR emission, and also with a general mass-selected sample of galaxies at the same redshifts. We demonstrate observationally that the UVJ diagram (or, similarly, a cut in the specific SFR) is only partially able to distinguish the quiescent galaxies from the SFGs. The SFR-M* relation is investigated for the different samples, yielding a logarithmic slope ˜1, in good agreement with previous results. The dust attenuations derived from different SFR indicators (UV(1600), UV(2800), [O ii], IR) are compared and show clear trends with respect to both the stellar mass and total SFR, with more massive and highly star-forming galaxies being affected by stronger dust attenuation.
Generalized z-scaling and pp collisions at RHIC
International Nuclear Information System (INIS)
Tokarev, Mikhail; Zborovsky, Imrich
2007-01-01
New generalization of the z-scaling in inclusive particle production is proposed. The scaling variable z is expressed in terms of the momentum fractions x 1 and x 2 of the incoming protons. Explicit dependence of z on the momentum fractions y a and y b of the scattered and recoil constituents carried by the inclusive particle and recoil object is included. The scaling function Ψ (z) for charged and identified hadrons produced in proton-proton collisions is constructed. The scheme allows unique description of data on inclusive cross sections of charged hadrons, pions, kaons, antiprotons and lambdas produced at RHIC energies. The obtained results suggest that the z-scaling may be used as a tool for searching for new physics phenomena of particle production in high transverse momentum and high multiplicity region at proton-proton colliders RHIC and LHC. (author)
Fully dense anisotropic nanocomposite Sm(Co,Fe,Zr,Cu,B)z (z=7.5-12) magnets
International Nuclear Information System (INIS)
Huang, M.Q.; Turgut, Z.; Wheeler, B.; Lee, D.; Liu, S.; Ma, B.M.; Peng, Y.G.; Chu, S.Y.; Laughlin, D.E.; Horwath, J.C.; Fingers, R.T.
2005-01-01
Fully dense anisotropic nanocomposite Sm(Co 0.58 Fe 0.31 Zr 0.05 Cu 0.04 B 0.02 ) z (z=7.5-12) magnets have been synthesized via rapid hot pressing and hot deformation processes. The highest (BH) max ∼10.6 MGOe was observed for a magnet with z=10. X-ray diffraction and M-H measurements indicated that the easy magnetization direction of magnets prefers to be in the hot pressing direction. Transmission electron microscopy investigation confirmed that plastic deformation is an important route for forming magnetic anisotropy in the Sm-Co-type nanocomposite magnets. Some stripe and/or platelike patterns have been observed inside the nanograins (50-200 nm), which may present as twins, and stacking faults. The (0001) twins have been observed in the 2:17R phase
Energy Technology Data Exchange (ETDEWEB)
Elahmar, M.H.; Rached, H.; Rached, D. [Laboratoire des Matériaux Magnétiques, Faculté des Sciences, Université Djillali Liabès de SidiBel-Abbès, SidiBel-Abbès 22000 (Algeria); Khenata, R., E-mail: khenata_rabah@yahoo.fr [Laboratoire de Physique Quantique et de Modélisation Mathématique, Université de Mascara, 29000 (Algeria); Murtaza, G. [Materials Modeling Lab, Department of Physics, Islamia College Peshawar, KPK (Pakistan); Bin Omran, S. [Department of Physics and Astronomy, College of Science, King Saud University, P.O. Box 2455, Riyadh 11451 (Saudi Arabia); Ahmed, W.K. [ERU, College of Engineering, United Arab Emirates University, Al Ain, Abu Dhabi (United Arab Emirates)
2015-11-01
The structural, mechanical, electronic and magnetic properties of the series of Heusler alloys CoFeMnZ (Z=Si, As, and Sb) have been investigated theoretically. The objective is to seek for stable half-metallic ferromagnets materials with Curie temperatures higher than room temperature. The series of CoFeMnZ (Z=Si, As and Sb) is found to exhibit half-metallic ferromagnetism with high magnetic moment and the localized moment in these magnetic compounds resides at the Mn atom. It has been observed that all our compounds have high Curie temperatures with high spin polarizations. - Highlights: • Density functional calculations for CoFeMnZ (Z=Si, As, Sb) compounds are performed. • Half-metallic ferromagnetism in CoFeMnZ (Z=Si, As, Sb) compounds is established. • The magnetic and mechanical properties for CoFeMnZ (Z=As, Sb) are studied for the first time. • The studied compounds possess high Curie temperatures with high spin polarizations.
Czech Academy of Sciences Publication Activity Database
Barák, P.; Poul, I.; Geršl, M.; Hladil, Jindřich; Pukaj, M.
2011-01-01
Roč. 18, č. 2 (2011), s. 88-93 ISSN 1212-6209 Institutional research plan: CEZ:AV0Z30130516 Keywords : Moravian Karst * Macocha Abyss * Macocha Formation * Devonian * structural geology Subject RIV: DB - Geology ; Mineralogy
THE KARAGÖZ OF CONTEXT IN SOCIAL IRONY / TOPLUMSAL ĐRONĐ BAĞLAMINDA KARAGÖZ
Directory of Open Access Journals (Sweden)
Dr. Ülkü ELİUZ
2008-05-01
Full Text Available The irony, being shaped in result of criticizing effort while beingsmiled is a method in respect of emphasizing the problems of the individualand society’s life. One of our cultural riches’ porters, Karagöz is shaped onirony expresion, existing with opposion, and difference of words or states.Irony in Karagöz is based on the contradictory between ‘being’ and ‘must be’and the division between ‘is emphasized’ and ‘wanted to be emphasized’. Inoffensive ordinary ‘small people’s pratical life problems and their existencestruggles in their external life’s reality. The problemical approach is madewith method of question-answer dialectic like the asked questions, the givedanswers and the new questions directed to answers. Critize way in appearence of shrinking and mocking directly supplies o regulator functionfor social iroy by completing with tendency to reach to good and right.The basic matris of Karagöz is the given gacing with one’s own,people opposite of him, and the social order with which he is living with inTurkish theatre tradition by renewing. Karagöz has also a pedagogical valuein respect of pointing out dangers that person thinks he knows while hedoesn’t know anything and supplying for person to be smart aganist thingsthat he doesn’t know.
A randomized controlled intervention with fish oil versus sunflower oil from 9 to 18 months of age
DEFF Research Database (Denmark)
Andersen, Anders D; Michaelsen, Kim F; Hellgren, Lars
2011-01-01
intake affects adipose tissue growth, we randomly allocated 154 healthy infants to daily supplementation with FO or sunflower oil (SO) from 9 to 18 mo of age and measured z-score changes in various anthropometric assessments of body size and skinfold thicknesses and plasma adipokine concentrations. Among...
GENERATION Z AND ITS PERCEPTION OF WORK
Directory of Open Access Journals (Sweden)
Maria-Cristina IORGULESCU
2016-06-01
Full Text Available One of the major demograhic phenomenon registered in the present times is represented by the aging of the Romanian population and, consequently, of the workforce, this issue having several implications for the human resource management in organizations. As generation Z prepares to enter the labor market, managers will be facing a set of generational differences between their employees. As a result, the paper presents the characteristics of generation Z, as highlighted by recent studies. Moreover, the paper presents the results of a survey based on a questionnaire adressed to university students, members of generation Z. The results of the study highlight generation Z perception of the ideal workplace and working conditions, the main priorities in selecting a job and its career expectations and aspirations. The implications of the study, as well as future research directions are discussed.
Energy Technology Data Exchange (ETDEWEB)
El Aribi, Houssain [Applied Biosystems/MDS Sciex, 71 Four Valley Drive, Concord, Ont., L4K 4V8 (Canada)]. E-mail: houssain.aribi@sciex.com; Le Blanc, Yves J.C. [Applied Biosystems/MDS Sciex, 71 Four Valley Drive, Concord, Ont., L4K 4V8 (Canada); Antonsen, Stephen [Dionex Canada Ltd., 1540 Cornwall Road, Oakville, Ont., L6J 7W5 (Canada); Sakuma, Takeo [Applied Biosystems/MDS Sciex, 71 Four Valley Drive, Concord, Ont., L4K 4V8 (Canada)
2006-05-10
A new IC-ESI-MS/MS method, with simple sample preparation procedure, has been developed for quantification and confirmation of perchlorate (ClO{sub 4} {sup -}) anions in water, fresh and canned food, wine and beer samples at low part-per-trillion (ng l{sup -1}) levels. To the best of our knowledge, this is the first time an analytical method is used for determination of perchlorate in wine and beer samples. The IC-ESI-MS/MS instrumentation consisted of an ICS-2500 ion chromatography (IC) system coupled to either an API 2000{sup TM} or an API 3200{sup TM} mass spectrometer. The IC-ESI-MS/MS system was optimized to monitor two pairs of precursor and fragment ion transitions, i.e., multiple reaction monitoring (MRM). All samples had oxygen-18 isotope labeled perchlorate internal standard (ISTD) added prior to extraction. Chlorine isotope ratio ({sup 35}Cl/{sup 37}Cl) was used as a confirmation tool. The transition of {sup 35}Cl{sup 16}O{sub 4} {sup -} (m/z 98.9) into {sup 35}Cl{sup 16}O{sub 3} {sup -} (m/z 82.9) was monitored for quantifying the main analyte; the transition of {sup 37}Cl{sup 16}O{sub 4} {sup -} (m/z 100.9) into {sup 37}Cl{sup 16}O{sub 3} {sup -} (m/z 84.9) was monitored for examining a proper isotopic abundance ratio of {sup 35}Cl/{sup 37}Cl; and the transition of {sup 35}Cl{sup 18}O{sub 4} {sup -} (m/z 107.0) into {sup 35}Cl{sup 18}O{sub 3} {sup -} (m/z 89.0) was monitored for quantifying the internal standard. The minimum detection limit (MDL) for this method in de-ionized water is 5 ng l{sup -1} (ppt) using the API 2000{sup TM} mass spectrometer and 0.5 ng l{sup -1} using the API 3200{sup TM} mass spectrometer. Over 350 food and beverage samples were analyzed mostly in triplicate. Except for four, all samples were found to contain measurable amounts of perchlorate. The levels found ranged from 5 ng l{sup -1} to 463.5 {+-} 6.36 {mu}g kg{sup -1} using MRM 98.9 {sup {yields}} 82.9 and 100 {mu}l injection.
International Nuclear Information System (INIS)
Horton, D.G.; Randall, R.R.
1998-09-01
This document describes the results of fiscal year 1998 vadose zone monitoring of three inactive liquid waste disposal facilities associated with the Plutonium Finishing Plant: the 216-Z-1A tile field, the 216-Z-9 trench, and the 216-Z-12 crib. Monitoring consisted of spectral gamma-ray logging of 21 boreholes. This work was performed by Pacific Northwest National Laboratory in conjunction with Three Rivers Scientific and Waste management Federal Services, inc. Northwest Operations. These three liquid waste disposal facilities were chosen for monitoring because they were identified as containing some of the most significant sources of radioactive contamination in the Hanford Site vadose zone. The basic question addressed by this logging activity is ''Has the configuration of subsurface contamination changed since it was last measured?'' Previous borehole logging and laboratory analyses provide the baseline data to help answer this question
International Nuclear Information System (INIS)
Marchesini, Danilo; Stefanon, Mauro; Brammer, Gabriel B.; Whitaker, Katherine E.
2012-01-01
We present the rest-frame V-band luminosity function (LF) of galaxies at 0.4 ≤ z < 4.0, measured from a near-infrared selected sample constructed from the NMBS, the FIRES, the FIREWORKS, and the ultra-deep NICMOS and WFC3 observations in the HDFN, HUDF, and GOODS-CDFS, all having high-quality optical-to-mid-infrared data. This unique sample combines data from surveys with a large range of depths and areas in a self-consistent way, allowing us to (1) minimize the uncertainties due to cosmic variance; and (2) simultaneously constrain the bright and faint ends with unprecedented accuracy over the targeted redshift range, probing the LF down to 0.1L* at z ∼ 3.9. We find that (1) the faint end is fairly flat and with a constant slope from z = 4, with α = –1.27 ± 0.05; (2) the characteristic magnitude has dimmed by 1.3 mag from z ∼ 3.7 to z = 0.1; (3) the characteristic density has increased by a factor of ∼8 from z ∼ 3.7 to z = 0.1, with 50% of this increase from z ∼ 4 to z ∼ 1.8; and (4) the luminosity density peaks at z ≈ 1-1.5, increasing by a factor of ∼4 from z = 4.0 to z ≈ 1-1.5, and subsequently decreasing by a factor of ∼1.5 by z = 0.1. We find no evidence for a steepening of the faint-end slope with redshift out to z = 4, in contrast with previous observational claims and theoretical predictions. The constant faint-end slope suggests that the efficiency of stellar feedback may evolve with redshift. Alternative interpretations are discussed, such as different masses of the halos hosting faint galaxies at low and high redshifts and/or environmental effects.
Thermal E/ Z Isomerization in First Generation Molecular Motors.
Kuwahara, Shunsuke; Suzuki, Yuri; Sugita, Naoya; Ikeda, Mari; Nagatsugi, Fumi; Harada, Nobuyuki; Habata, Yoichi
2018-04-20
Determination of a thermal E/ Z isomerization barrier of first generation molecular motors is reported. Stable ( E)-1a directly converts to stable ( Z)-1c without photochemical E/ Z isomerization. The activation Gibbs energy of the isomerization was determined to be 123 kJ mol -1 by circular dichroism spectral changes. Density functional theory calculations show that ( Z)-1c is ∼11.4 kJ mol -1 more stable than ( E)-1a.
Top forward-backward asymmetry with general Z' couplings
International Nuclear Information System (INIS)
Duraisamy, Murugeswaran; Datta, Alakabha; Rashed, Ahmed
2011-01-01
The measurement of the top forward-backward asymmetry in tt production measured at the Tevatron shows deviation from the standard model prediction. A u→t transition via a flavor-changing Z ' can explain the data. We show that left-handed t L u L Z ' couplings can be constrained from B d,s mixing while the constrains on the right-handed couplings t R u R Z ' vanish in the limit of m u →0. We then consider the most general form of the tuZ ' interaction which includes vector-axial vector as well as tensor type couplings and study how these couplings affect the top forward-backward asymmetry.
Xia, Zhiguo; Zhuang, Jiaqing; Meijerink, Andries; Jing, Xiping
2013-05-14
A new strategy based on the host composition design has been adopted to obtain efficient color-tunable emission from Ba2Ln(0.97-z)Tb(z)(BO3)2Cl:0.03Eu (Ln = Y, Gd and Lu, z = 0-0.97) phosphors. This study reveals that the single-phase Ba2Ln(1-z)Tb(z)(BO3)2Cl compounds can be applied to use allowed Eu(2+) absorption transitions to sensitize Eu(3+) emission via the energy transfer Eu(2+) → (Tb(3+))n → Eu(3+). The powder X-ray diffraction (XRD) and Rietveld refinement analysis shows single-phase Ba2Ln(1-z)Tb(z)(BO3)2Cl. As-prepared Ba2Ln(0.97-z)Tb(z)(BO3)2Cl:0.03Eu phosphors show intense green, yellow, orange and red emission under 377 nm near ultraviolet (n-UV) excitation due to a variation in the relative intensities of the Eu(2+), Tb(3+) and Eu(3+) emission depending on the Tb content (z) in the host composition, allowing color tuning. The variation in emission color is explained by energy transfer and has been investigated by photoluminescence and lifetime measurements and is further characterized by the Commission Internationale de l'éclairage (CIE) chromaticity indexes. The quantum efficiencies of the phosphors are high, up to 74%, and show good thermal stabilities up to 150 °C. This investigation demonstrates the possibility to sensitize Eu(3+) line emission by Eu(2+)via energy migration over Tb(3+) resulting in efficient color tunable phosphors which are promising for use in solid-state white light-emitting diodes (w-LEDs).
Rivera-Casas, Ciro; González-Romero, Rodrigo; Vizoso-Vazquez, Ángel; Cheema, Manjinder S; Cerdán, M Esperanza; Méndez, Josefina; Ausió, Juan; Eirin-Lopez, Jose M
2016-10-01
Histones are the fundamental constituents of the eukaryotic chromatin, facilitating the physical organization of DNA in chromosomes and participating in the regulation of its metabolism. The H2A family displays the largest number of variants among core histones, including the renowned H2A.X, macroH2A, H2A.B (Bbd), and H2A.Z. This latter variant is especially interesting because of its regulatory role and its differentiation into 2 functionally divergent variants (H2A.Z.1 and H2A.Z.2), further specializing the structure and function of vertebrate chromatin. In the present work we describe, for the first time, the presence of a second H2A.Z variant (H2A.Z.2) in the genome of a non-vertebrate animal, the mussel Mytilus. The molecular and evolutionary characterization of mussel H2A.Z.1 and H2A.Z.2 histones is consistent with their functional specialization, supported on sequence divergence at promoter and coding regions as well as on varying gene expression patterns. More precisely, the expression of H2A.Z.2 transcripts in gonadal tissue and its potential upregulation in response to genotoxic stress might be mirroring the specialization of this variant in DNA repair. Overall, the findings presented in this work complement recent reports describing the widespread presence of other histone variants across eukaryotes, supporting an ancestral origin and conserved role for histone variants in chromatin.
STAR FORMATION AT 4 < z < 6 FROM THE SPITZER LARGE AREA SURVEY WITH HYPER-SUPRIME-CAM (SPLASH)
Energy Technology Data Exchange (ETDEWEB)
Steinhardt, Charles L.; Capak, Peter; Masters, Dan; Petric, Andreea [Caltech, 1200 E. California Blvd., Pasadena, CA 91125 (United States); Speagle, Josh S.; Silverman, John D. [Kavli IPMU, University of Tokyo, Kashiwanoha 5-1-5, Kashiwa-shi, Chiba 277-8583 (Japan); Carollo, Marcella [ETH Zurich, Wolfgang-Pauli-Strasse 27, 8093 Zurich (Switzerland); Dunlop, James [Institute for Astronomy, University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Hashimoto, Yasuhiro [National Taiwan Normal University, No. 88, Sec. 4, Tingzhou Rd., Taipei 11677, Taiwan R.O.C. (China); Hsieh, Bau-Ching; Lin, Lihwai; Lin, Yen-Ting [ASIAA Sinica, AS/NTU. No. 1, Sec. 4, Roosevelt Rd., Taipei 10617, Taiwan, R.O.C. (China); Ilbert, Olivier; Le Fevre, Olivier [Laboratoire d' Astrophysique de Marseille, 38 rue Frederic Joliot Curie, F-13388 Marseille (France); Le Floc' h, Emeric [Service d' Astrophysique, CEA-Saclay, Orme des Merisiers, Bat. 709, F-91191 Gif-sur-Yvette (France); Lee, Nicholas; Sanders, Dave [Institute for Astronomy, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); McCracken, Henry J. [Institut d' Astrophysique de Paris, 98 bis boulevard Arago, F-75014 Paris (France); Nagao, Tohru [Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Salvato, Mara [Max Planck Institute for Extraterrestrial Physics (MPE), Giessenbachstr. 1, D-85748 Garching (Germany); and others
2014-08-20
Using the first 50% of data collected for the Spitzer Large Area Survey with Hyper-Suprime-Cam observations on the 1.8 deg{sup 2} Cosmological Evolution Survey we estimate the masses and star formation rates of 3398 M {sub *} > 10{sup 10} M {sub ☉} star-forming galaxies at 4 < z < 6 with a substantial population up to M {sub *} ≳ 10{sup 11.5} M {sub ☉}. We find that the strong correlation between stellar mass and star formation rate seen at lower redshift (the ''main sequence'' of star-forming galaxies) extends to z ∼ 6. The observed relation and scatter is consistent with a continued increase in star formation rate at fixed mass in line with extrapolations from lower-redshift observations. It is difficult to explain this continued correlation, especially for the most massive systems, unless the most massive galaxies are forming stars near their Eddington-limited rate from their first collapse. Furthermore, we find no evidence for moderate quenching at higher masses, indicating quenching either has not occurred prior to z ∼ 6 or else occurs rapidly, so that few galaxies are visible in transition between star-forming and quenched.
Hagebø, E
1969-01-01
Using the method of thick target and thick catchers, the ranges and other recoil properties of 13 (12) antimony isotopes between A = 115 and A = 131 (130) have been measured for the reaction of 570 MeV (18·2 GeV) protons with uranium. The kinetic energies T are almost independent of product mass number at 570 MeV but show a strong dependence at 18·2 GeV, the lightest isotopes having only about half the kinetic energy of the heavy ones. \\\\ \\\\The cascade deposition energies for production of antimony isotopes are almost equal at 570 MeV and 18·2 GeV and fit well to straight lines of the form E$^{∗}$ (A, Z) = E$^{∗}$ (A$_{0}$, Z) + b(A − A$_{0}$). Exceptions are the cascade deposition energies for $^{115}$Sb and $^{116}$Sb which seem to be somewhat too high at 18·2 GeV. By comparison with other work it seems that the slope $b$ of these lines is independent of product element, target and of proton irradiation energy above 450 MeV. \\\\ \\\\If we assume at 570 MeV, that the fissioning nucleus is a uranium ...
Trans-Z-source and Γ-Z-source neutral-point-clamped inverters
DEFF Research Database (Denmark)
Wei, Mo; Loh, Poh Chiang; Blaabjerg, Frede
2015-01-01
Z-source neutral-point-clamped (NPC) inverters are earlier proposed for obtaining voltage buck-boost and three-level switching simultaneously. Their performances are, however, constrained by a trade-off between their input-to-output gain and modulation ratio. This trade-off can lead to high...
Stolejda, Karel
2012-01-01
Cílem práce je definice a popis podnikatelského záměru. V prvních částech je popis zaměřen na teoretické poznatky. Je popsán rozdíl mezi podnikatelským plánem a záměrem. Jsou popsány důležité prvky a části podnikatelského záměru, jednotlivé druhy studií a fáze projektu. Důraz je kladen na analýzy projektu jako je SWOT a SLEPT analýza a analýza ekonomické efektivnosti. V praktické části práce je zpracována analýza podnikatelského záměru jako případný podklad pro rozhodnutí o realizaci nebo zam...
Mathematical tables tables of in g [z] for complex argument
Abramov, A A
1960-01-01
Mathematical Tables of In ? (z) for Complex Argument is a compilation of tables of In ? (z), z = x + iy, calculated for steps in x and y of 0.01 and with an accuracy of one unit in the last (the sixth) decimal place. Interpolation is used to calculate In ? (z) for intermediate values and is carried out separately for the real and imaginary parts of In ? (z). Six places are retained in interpolation.This book first explains how the values of In ? (z) are calculated using the asymptotic formula in a wide lattice with step h = 0.16, and how the tables and the nomograph are used. The values in the
Energy Technology Data Exchange (ETDEWEB)
Caldera, D. [Centro de Estudios de Semiconductores, Departamento de Física, Facultad de Ciencias, Universidad de Los Andes, Mérida 5101 (Venezuela, Bolivarian Republic of); Quintero, M., E-mail: mquinter@ula.ve [Centro de Estudios de Semiconductores, Departamento de Física, Facultad de Ciencias, Universidad de Los Andes, Mérida 5101 (Venezuela, Bolivarian Republic of); Morocoima, M.; Moreno, E.; Quintero, E.; Grima-Gallardo, P.; Bocaranda, P. [Centro de Estudios de Semiconductores, Departamento de Física, Facultad de Ciencias, Universidad de Los Andes, Mérida 5101 (Venezuela, Bolivarian Republic of); Henao, J.A.; Macías, M.A. [Grupo de Investigación en Química Estructural (GIQUE), Facultad de Ciencias, Escuela de Química, Universidad Industrial de Santander, Apartado aéreo 678, Bucaramanga (Colombia); Briceño, J.M.; Mora, A.E. [Laboratorio de Análisis Químico y Estructura de Materiales, Departamento de Física, Universidad de Los Andes, Mérida 5101 (Venezuela, Bolivarian Republic of)
2014-11-25
Highlights: • The samples were annealed at 500 °C for 1 month. • Samples in the ranges 0 < z < 0.375 had the tetragonal stannite α structure (I4{sup ¯}2m). • For 0.725 < z ⩽ 1 the wurtz–stannite δ structure (Pmn2{sub 1}). • Undercooling effects occur for samples in the range 0.725 < z < 0.925. - Abstract: The T(z) phase diagram of the Cu{sub 2}Zn{sub 1−z}Mn{sub z}GeSe{sub 4} alloy system is obtained from X-ray diffraction and differential thermal analysis DTA. At room temperature, the X-ray diffraction data showed that samples in the ranges 0 < z < 0.375 had the tetragonal stannite α structure (I4{sup ¯}2m), while for 0.725 < z ⩽ 1 the wurtz–stannite δ structure (Pmn2{sub 1}). The α and δ fields are separated by a relative wide three-phase field (α + δ + MnSe{sub 2}). The DTA thermograms were used to construct the phase diagram of the Cu{sub 2}Zn{sub 1−z}Mn{sub z}GeSe{sub 4} alloy system. It was confirmed that the Cu{sub 2}ZnGeSe{sub 4} and Cu{sub 2}MnGeSe{sub 4} compounds melt incongruently. It was observed that undercooling effects occur for samples in the range 0.725 < z < 0.925.
International Nuclear Information System (INIS)
Van de Sande, Jesse; Franx, Marijn; Labbe, Ivo; Kriek, Mariska; Van Dokkum, Pieter G.; Bezanson, Rachel; Whitaker, Katherine E.; Brammer, Gabriel; Groot, Paul J.; Kaper, Lex
2011-01-01
Recent photometric studies have shown that early-type galaxies at fixed stellar mass were smaller and denser at earlier times. In this Letter, we assess that finding by deriving the dynamical mass of such a compact quiescent galaxy at z = 1.8. We have obtained a high-quality spectrum with full UV-NIR wavelength coverage of galaxy NMBS-C7447 using X-Shooter on the Very Large Telescope. We determined a velocity dispersion of 294 ± 51 km s -1 . Given this velocity dispersion and the effective radius of 1.64 ± 0.15 kpc (as determined from Hubble Space Telescope Wide Field Camera 3 F160W observations) we derive a dynamical mass of (1.7 ± 0.5) x 10 11 M sun . Comparison of the full spectrum with stellar population synthesis models indicates that NMBS-C774 has a relatively young stellar population (0.40 Gyr) with little or no star formation and a stellar mass of M * ∼ 1.5 x 10 11 M sun . The dynamical and photometric stellar masses are in good agreement. Thus, our study supports the conclusion that the mass densities of quiescent galaxies were indeed higher at earlier times, and this earlier result is not caused by systematic measurement errors. By combining available spectroscopic measurements at different redshifts, we find that the velocity dispersion at fixed dynamical mass was a factor of ∼1.8 higher at z = 1.8 compared with z = 0. Finally, we show that the apparent discrepancies between the few available velocity dispersion measurements at z > 1.5 are consistent with the intrinsic scatter of the mass-size relation.
LABORATORYJNA INSTALACJA FOTOWOLTAICZNA Z MAGAZYNEM ENERGII
Directory of Open Access Journals (Sweden)
Adam MROZIŃSKI
Full Text Available W artykule przedstawiono zagadnienie wykorzystania w Polsce i w Europie instalacji fotowoltaicznych (PV z magazynami energii elektrycznej. Systemy PV będą miały w niedalekiej przyszłości znaczny udział w globalnej produkcji energii elektrycznej. Będzie to istotnie wpływało na ograniczenie emisji gazów cieplarnianych oraz na poprawę stanu środowiska naturalnego. W pracy przedstawiono budowę laboratoryjnej instalacji PV zlokalizowanej na WIM UTP w Bydgoszczy. Przedstawiono również wybrane wyniki pomiarów rozkładu produkcji i dystrybucji energii elektrycznej w czasie (produkcja przez układ PV, zużycie własne, magazynowanie w akum, przesył do sieci zewn. z wykorzystaniem systemu monitoringu. W instalacjach PV coraz większe znaczenie mają systemy zarządzania energią oraz układy magazynujące energię elektryczną. Dzięki tym systemom energia elektryczna produkowana w ciągu dnia będzie zużywana na bieżąco. Nadmiar energii trafi do przydomowego akumulatora. Zgromadzona energia efektywnie zostanie wykorzystana wieczorem, kiedy zapotrzebowanie na prąd jest najwyższe. Ewentualne niedobory pokryje energia z sieci - kupiona nocą lub wczesnym rankiem, kiedy cena energii jest najniższa. Inteligentne sieci przesyłowe współpracujące z przydomowymi instalacjami PV z magazynami energii umożliwią skuteczniejsze zarządzanie popytem i podażą energii w całym systemie energetycznym.
Pre-main-sequence disk accretion in Z Canis Majoris
International Nuclear Information System (INIS)
Hartmann, L.; Kenyon, S.J.; Hewett, R.; Edwards, S.; Strom, K.M.; Strom, S.E.; Stauffer, J.R.
1989-01-01
It is suggested that the pre-main-sequence object Z CMa is a luminous accretion disk, similar in many respects to the FU Orionis variables. Z CMa shows the broad, doubled optical absorption lines expected from a rapidly rotating accretion disk. The first overtone CO absorption detected in Z CMa is blue-shifted, suggesting line formation in a disk wind. Accretion at rates about 0.001 solar mass/yr over 100 yr is required to explain the luminosity of Z CMa. The large amount of material accreted (0.1 solar mass/yr) indicates that Z CMa is in a very early stage of stellar evolution, possibly in an initial phase of massive disk accretion. 41 references
Pre-main-sequence disk accretion in Z Canis Majoris
Hartmann, L.; Kenyon, S. J.; Hewett, R.; Edwards, S.; Strom, K. M.; Strom, S. E.; Stauffer, J. R.
1989-01-01
It is suggested that the pre-main-sequence object Z CMa is a luminous accretion disk, similar in many respects to the FU Orionis variables. Z CMa shows the broad, doubled optical absorption lines expected from a rapidly rotating accretion disk. The first overtone CO absorption detected in Z CMa is blue-shifted, suggesting line formation in a disk wind. Accretion at rates about 0.001 solar mass/yr over 100 yr is required to explain the luminosity of Z CMa. The large amount of material accreted (0.1 solar mass/yr) indicates that Z CMa is in a very early stage of stellar evolution, possibly in an initial phase of massive disk accretion.
Flavorful Z{sup '} signatures at LHC and ILC
Energy Technology Data Exchange (ETDEWEB)
Chen, S.-L. [Department of Physics and Center for Theoretical Sciences, National Taiwan University, Taipei, Taiwan (China); Okada, Nobuchika [Department of Physics, University of Maryland, College Park, MD 20742 (United States); Theory Group, KEK, Tsukuba 305-0801 (Japan)], E-mail: okadan@post.kek.jp
2008-10-30
There are lots of new physics models which predict an extra neutral gauge boson, referred as Z{sup '}-boson. In a certain class of these new physics models, the Z{sup '}-boson has flavor-dependent couplings with the fermions in the Standard Model (SM). Based on a simple model in which couplings of the SM fermions in the third generation with the Z{sup '}-boson are different from those of the corresponding fermions in the first two generations, we study the signatures of Z{sup '}-boson at the Large Hadron Collider (LHC) and the International Linear Collider (ILC). We show that at the LHC, the Z{sup '}-boson with mass around 1 TeV can be produced through the Drell-Yan processes and its dilepton decay modes provide us clean signatures not only for the resonant production of Z{sup '}-boson but also for flavor-dependences of the production cross sections. We also study fermion pair productions at the ILC involving the virtual Z{sup '}-boson exchange. Even though the center-of-energy of the ILC is much lower than a Z{sup '}-boson mass, the angular distributions and the forward-backward asymmetries of fermion pair productions show not only sizable deviations from the SM predictions but also significant flavor-dependences.
Magnelli, B.; Elbaz, D.; Chary, R. R.; Dickinson, M.; Le Borgne, D.; Frayer, D. T.; Willmer, C. N. A.
2011-04-01
Aims: We derive the evolution of the infrared luminosity function (LF) over the last 4/5ths of cosmic time using deep 24 and 70 μm imaging of the GOODS North and South fields. Methods: We use an extraction technique based on prior source positions at shorter wavelengths to build the 24 and 70 μm source catalogs. The majority (93%) of the sources have a spectroscopic (39%) or a photometric redshift (54%) and, in our redshift range of interest (i.e., 1.3 conversion between the infrared luminosity and star-formation rate (SFR) of a galaxy, we study the evolution of the SFR density of the Universe from z = 0 to z = 2.3. We find that the SFR density of the Universe strongly increased with redshift from z = 0 to z = 1.3, but is nearly constant at higher redshift out to z = 2.3. As part of the online material accompanying this article, we present source catalogs at 24 μm and 70 μm for both the GOODS-North and -South fields. Appendices are only available in electronic form at http://www.aanda.orgFull Tables B1-B4 are only available in electronic form at CDS via anonymous ftp to cdsarc.u-strasbg.fr (130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/528/A35
Coulomb Problem for Z > Zcr in Doped Graphene
Kuleshov, V. M.; Mur, V. D.; Fedotov, A. M.; Lozovik, Yu. E.
2017-12-01
The dynamics of charge carriers in doped graphene, i.e., graphene with a gap in the energy spectrum depending on the substrate, in the presence of a Coulomb impurity with charge Z is considered within the effective two-dimensional Dirac equation. The wave functions of carriers with conserved angular momentum J = M + 1/2 are determined for a Coulomb potential modified at small distances. This case, just as any two-dimensional physical system, admits both integer and half-integer quantization of the orbital angular momentum in plane, M = 0, ±1, ±2, …. For J = 0, ±1/2, ±1, critical values of the effective charge Z cr( J, n) are calculated for which a level with angular momentum J and radial quantum numbers n = 0 and n = 1 reaches the upper boundary of the valence band. For Z function of charge Z for the lowest values of orbital angular momentum M, the level with J = 0 being the first to descend to the band edge. For Z > Z cr ( J, n = 0), scattering phases are calculated as a function of hole energy for several values of supercriticality, as well as the positions ɛ0 and widths γ of quasistationary states as a function of supercriticality. The values of ɛ0* and width γ* are pointed out for which quasidiscrete levels may show up as Breit-Wigner resonances in the scattering of holes by a supercritical impurity. Since the phases are real, the partial scattering matrix is unitary, so that the radial Dirac equation is consistent even for Z > Z cr. In this single-particle approximation, there is no spontaneous creation of electron-hole pairs, and the impurity charge cannot be screened by this mechanism.
Z-2 Architecture Description and Requirements Verification Results
Graziosi, Dave; Jones, Bobby; Ferl, Jinny; Scarborough, Steve; Hewes, Linda; Ross, Amy; Rhodes, Richard
2016-01-01
The Z-2 Prototype Planetary Extravehicular Space Suit Assembly is a continuation of NASA's Z series of spacesuits. The Z-2 is another step in NASA's technology development roadmap leading to human exploration of the Martian surface. The suit was designed for maximum mobility at 8.3 psid, reduced mass, and to have high fidelity life support interfaces. As Z-2 will be man-tested at full vacuum in NASA JSC's Chamber B, it was manufactured as Class II, making it the most flight-like planetary walking suit produced to date. The Z-2 suit architecture is an evolution of previous EVA suits, namely the ISS EMU, Mark III, Rear Entry I-Suit and Z-1 spacesuits. The suit is a hybrid hard and soft multi-bearing, rear entry spacesuit. The hard upper torso (HUT) is an all-composite structure and includes a 2-bearing rolling convolute shoulder with Vernier sizing mechanism, removable suit port interface plate (SIP), elliptical hemispherical helmet and self-don/doff shoulder harness. The hatch is a hybrid aluminum and composite construction with Apollo style gas connectors, custom water pass-thru, removable hatch cage and interfaces to primary and auxiliary life support feed water bags. The suit includes Z-1 style lower arms with cam brackets for Vernier sizing and government furnished equipment (GFE) Phase VI gloves. The lower torso includes a telescopic waist sizing system, waist bearing, rolling convolute waist joint, hard brief, 2 bearing soft hip thigh, Z-1 style legs with ISS EMU style cam brackets for sizing, and conformal walking boots with ankle bearings. The Z-2 Requirements Verification Plan includes the verification of more than 200 individual requirements. The verification methods include test, analysis, inspection, demonstration or a combination of methods. Examples of unmanned requirements include suit leakage, proof pressure testing, operational life, mass, isometric man-loads, sizing adjustment ranges, internal and external interfaces such as in-suit drink bag
Z boson production in association with heavy quark jets at D0
Energy Technology Data Exchange (ETDEWEB)
Zennamo, III, Joseph Anthony [State Univ. of New York (SUNY), Buffalo, NY (United States)
2013-10-28
The dominant background in searches for a Higgs boson decaying into b-quarks at the Tevatron is production of a Z boson in association with either b- or c-quark initiated jets (b or c jets). This thesis describes the first measurements of the ratio of differential cross sections σ (Z + b jet)/ σ(Z + jet), and the first measurements of the ratio of cross sections σ (Z + c jet)/ σ(Z + jet) and σ (Z + c jet)/ σ(Z + b jet). These measurements are performed using the full D0 Run II data set corresponding to an integrated luminosity of 9.7 fb-1. The ratio of differential cross sections σ(Z + b jet)/σ (Z + jet) have been measured as a function of jet and Z boson pT , jet η , and Δφ(Z, jet). The Z+c jet ratios of differential cross sections are measured as a function of jet and Z boson pT .
Nogueira-de-Almeida, Carlos Alberto; Mello, Elza Daniel de
To evaluate the prevalence of abnormalities in plasma lipid and glucose profiles among overweight and obese children and adolescents, and to assess the presence of a correlation between body mass index Z-scores and indicators of comorbidities related to both profiles. This was a multicenter cross-sectional study conducted at two outpatient clinics. The study included all 417 comers for the first visit from 2008 to 2012, aged between 7 and 18 years, with BMI above the Z-score +1. Anthropometry and blood sampling were obtained. The prevalence of dyslipidemias, hyperglycemia, and insulin resistance were evaluated, together with the correlations of these variables with the increase of Z-BMI. Dyslipidemia was observed in 43.4% of the boys and 66.1% of the girls, with no difference between genders. High glucose levels were detected in 6.2% of the individuals. Insulin resistance was present in 32.3% and 41.7% of the cases, with no statistical significance between boys and girls. Correlations between the Z-BMI were noted for triglycerides in the entire group and among girls; for HDL-c, only among girls; for glucose, a correlation was observed for the entire group, but not when stratified by gender. The indicators of insulin resistance were all correlated with Z-BMI, even when corrected for age. Overweight and obesity give origin to a high prevalence of dyslipidemia and insulin resistance. BMI Z-scores showed a weak positive correlation with glucose and triglyceride, and negative with HDL-c. In turn, the strongest positive correlation was found with insulin resistance indicators. Copyright © 2017 Sociedade Brasileira de Pediatria. Published by Elsevier Editora Ltda. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Maier, C.; Ziegler, B. L. [Department of Astrophysics, University of Vienna, Türkenschanzstrasse 17, A-1180 Vienna (Austria); Lilly, S. J.; Peng, Y. [Institute of Astronomy, ETH Zurich, Wolfgang-Pauli-Strasse 27, CH-8093 Zurich (Switzerland); Contini, T. [Institut de Recherche en Astrophysique et Planétologie, CNRS, 14 avenue Édouard Belin, F-31400 Toulouse (France); Pérez Montero, E. [Instituto de Astrofísica de Andalucia, CSIC, Apartado de Correos 3004, E-18080 Granada (Spain); Balestra, I., E-mail: christian.maier@univie.ac.at [Max-Planck-Institut für Extraterrestrische Physik, Postfach 1312, Giessenbachstrasse, D-85741 Garching b. München (Germany)
2014-09-01
In the local universe, there is good evidence that, at a given stellar mass M, the gas-phase metallicity Z is anti-correlated with the star formation rate (SFR) of the galaxies. It has also been claimed that the resulting Z(M, SFR) relation is invariant with redshift—the so-called 'fundamental metallicity relation' (FMR). Given a number of difficulties in determining metallicities, especially at higher redshifts, the form of the Z(M, SFR) relation and whether it is really independent of redshift is still very controversial. To explore this issue at z > 2, we used VLT-SINFONI and Subaru-MOIRCS near-infrared spectroscopy of 20 zCOSMOS-deep galaxies at 2.1 < z < 2.5 to measure the strengths of up to five emission lines: [O II] λ3727, Hβ, [O III] λ5007, Hα, and [N II] λ6584. This near-infrared spectroscopy enables us to derive O/H metallicities, and also SFRs from extinction corrected Hα measurements. We find that the mass-metallicity relation (MZR) of these star-forming galaxies at z ≈ 2.3 is lower than the local Sloan Digital Sky Survey (SDSS) MZR by a factor of three to five, a larger change than found by Erb et al. using [N II]/Hα-based metallicities from stacked spectra. We discuss how the different selections of the samples and metallicity calibrations used may be responsible for this discrepancy. The galaxies show direct evidence that the SFR is still a second parameter in the MZR at these redshifts. However, determining whether the Z(M, SFR) relation is invariant with epoch depends on the choice of extrapolation used from local samples, because z > 2 galaxies of a given mass have much higher SFRs than the local SDSS galaxies. We find that the zCOSMOS galaxies are consistent with a non-evolving FMR if we use the physically motivated formulation of the Z(M, SFR) relation from Lilly et al., but not if we use the empirical formulation of Mannucci et al.
Search for Lepton Flavour Number violating $Z^0$-Decays
Abreu, P; Adye, T; Ajinenko, I; Alekseev, G D; Alemany, R; Allport, P P; Almehed, S; Amaldi, Ugo; Amato, S; Andreazza, A; Andrieux, M L; Antilogus, P; Apel, W D; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barate, R; Barbi, M S; Bardin, Dimitri Yuri; Baroncelli, A; Bärring, O; Barrio, J A; Bartl, Walter; Bates, M J; Battaglia, Marco; Baubillier, M; Baudot, J; Becks, K H; Begalli, M; Beillière, P; Belokopytov, Yu A; Belous, K S; Benvenuti, Alberto C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bianchi, F; Bigi, M; Bilenky, S M; Billoir, P; Bizouard, M A; Bloch, D; Blume, M; Bolognese, T; Bonesini, M; Bonivento, W; Booth, P S L; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Bozzo, M; Branchini, P; Brand, K D; Brenke, T; Brenner, R A; Bricman, C; Brown, R C A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschmann, P; Buys, A; Cabrera, S; Caccia, M; Calvi, M; Camacho-Rozas, A J; Camporesi, T; Canale, V; Canepa, M; Cankocak, K; Cao, F; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chen, M; Chierici, R; Chliapnikov, P V; Chochula, P; Chorowicz, V; Chudoba, J; Cindro, V; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Dahl-Jensen, Erik; Dahm, J; D'Almagne, B; Dam, M; Damgaard, G; Dauncey, P D; Davenport, Martyn; Da Silva, W; Defoix, C; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Brabandere, S; De Clercq, C; La Vaissière, C de; De Lotto, B; De Min, A; De Paula, L S; De Saint-Jean, C; Dijkstra, H; Di Ciaccio, Lucia; Di Diodato, A; Djama, F; Dolbeau, J; Dönszelmann, M; Doroba, K; Dracos, M; Drees, J; Drees, K A; Dris, M; Durand, J D; Edsall, D M; Ehret, R; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Elsing, M; Engel, J P; Erzen, B; Falk, E; Fassouliotis, D; Feindt, Michael; Ferrer, A; Fichet, S; Filippas-Tassos, A; Firestone, A; Fischer, P A; Föth, H; Fokitis, E; Fontanelli, F; Formenti, F; Franek, B J; Frenkiel, P; Fries, D E C; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gandelman, M; García, C; García, J; Gaspar, C; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerber, J P; Gokieli, R; Golob, B; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Graziani, E; Green, C; Grefrath, A; Gris, P; Grosdidier, G; Grzelak, K; Gumenyuk, S A; Gunnarsson, P; Günther, M; Guy, J; Hahn, F; Hahn, S; Hajduk, Z; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hedberg, V; Henriques, R P; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Higón, E; Hilke, Hans Jürgen; Hill, T S; Holmgren, S O; Holt, P J; Holthuizen, D J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, L B; Jönsson, P E; Joram, Christian; Juillot, P; Kaiser, M; Kapusta, F; Karafasoulis, K; Karlsson, M; Karvelas, E; Katsanevas, S; Katsoufis, E C; Keränen, R; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; King, B J; Kjaer, N J; Klapp, O; Klein, H; Klovning, A; Kluit, P M; Köne, B; Kokkinias, P; Koratzinos, M; Korcyl, K; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kreuter, C; Kronkvist, I J; Krumshtein, Z; Krupinski, W; Kubinec, P; Kucewicz, W; Kurvinen, K L; Lacasta, C; Laktineh, I; Lamsa, J; Lanceri, L; Lane, D W; Langefeld, P; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Legan, C K; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Libby, J; Liko, D; Lindner, R; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Maehlum, G; Mahon, J R; Maio, A; Malmgren, T G M; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Masik, J; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; Medbo, J; Merk, M; Meroni, C; Meyer, S; Meyer, W T; Michelotto, M; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Møller, R; Mönig, K; Monge, M R; Morettini, P; Müller, H; Münich, K; Mulders, M; Mundim, L M; Murray, W J; Muryn, B; Myatt, Gerald; Naraghi, F; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Neumann, W; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nieuwenhuizen, M; Nikolaenko, V; Niss, P; Nomerotski, A; Normand, Ainsley; Novák, M; Oberschulte-Beckmann, W; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Paganini, P; Paganoni, M; Pagès, P; Pain, R; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Passeri, A; Pegoraro, M; Peralta, L; Pernegger, H; Perrotta, A; Petridou, C; Petrolini, A; Petrovykh, M; Phillips, H T; Piana, G; Pierre, F; Pimenta, M; Podobrin, O; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Ratoff, P N; Read, A L; Reale, M; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Renton, P B; Resvanis, L K; Richard, F; Richardson, J; Rídky, J; Rinaudo, G; Ripp, I; Romero, A; Roncagliolo, I; Ronchese, P; Roos, L; Rosenberg, E I; Rosso, E; Roudeau, Patrick; Rovelli, T; Rückstuhl, W; Ruhlmann-Kleider, V; Ruiz, A; Rybicki, K; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sahr, O; Sajot, G; Salt, J; Sánchez, J; Sannino, M; Schimmelpfennig, M; Schneider, H; Schwickerath, U; Schyns, M A E; Sciolla, G; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seitz, A; Sekulin, R L; Serbelloni, L; Shellard, R C; Siegrist, P; Silvestre, R; Simonetti, S; Simonetto, F; Sissakian, A N; Sitár, B; Skaali, T B; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Sokolov, A; Sosnowski, R; Souza-Santos, D; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stanescu, C; Stapnes, Steinar; Stavitski, I; Stevenson, K; Stichelbaut, F; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Tavernet, J P; Chernyaev, E; Chikilev, O G; Thomas, J; Tilquin, A; Timmermans, J; Tkatchev, L G; Todorov, T; Todorova, S; Toet, D Z; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tranströmer, G; Treille, D; Trischuk, W; Tristram, G; Trombini, A; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tyndel, M; Tzamarias, S; Überschär, B; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Apeldoorn, G W; van Dam, P; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Vilanova, D; Vincent, P; Vitale, L; Vlasov, E; Vodopyanov, A S; Vrba, V; Wahlen, H; Walck, C; Waldner, F; Weierstall, M; Weilhammer, Peter; Weiser, C; Wetherell, Alan M; Wicke, D; Wickens, J H; Wielers, M; Wilkinson, G R; Williams, W S C; Winter, M; Witek, M; Wlodek, T; Woschnagg, K; Yip, K; Yushchenko, O P; Zach, F; Zaitsev, A; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zito, M; Zontar, D; Zucchelli, G C; Zumerle, G
1997-01-01
A search for lepton flavour number violating $Z^0$ decays in the channels \\begin{center} $Z^0\\rightarrow \\mu\\tau$,\\\\ $Z^0\\rightarrow e\\tau$, \\\\ $Z^0\\rightarrow e\\mu$, \\\\ \\end{center} using the DELPHI detector with data collected during the 1991--94 LEP runs, is described. No signal was found. Upper limits at 95\\% confidence level for the respective branching fractions of $1.2\\times 10^{-5}$, $2.2\\times 10^{-5}$, and $0.25\\times 10^{-5}$, were obtained.
Energy transformation in Z-pinch and plasma focus discharges with wire and wire-in-liner loads
International Nuclear Information System (INIS)
Kubes, Pavel; Kravarik, Jozef; Klir, Daniel; Scholz, Marek; Paduch, Marian; Tomaszewski, Krzysztof; Karpinski, Leslaw; Bakshaev, Yury L.; Blinov, Peter I.; Chernenko, Andrey S.; Dan'ko, Sergey A.; Korolev, Valery D.; Shashkov, Andrey Y.; Tumanov, Victor I.
2002-01-01
The results of the study of the Z-pinch and plasma-focus plasmas at presence of the axial C, Al, or Cu wires of sufficient high diameter are discussed in this paper. The wire was positioned on the top of the inner electrode of the PF 1000 plasma focus (1.8 MA, IPPLM Warsaw), or at the axis with or without the tungsten or alumine wire array load at the S-300 facility (3 MA, RRC Kurchatov Institute, Moscow), and at the axis of the small Z-pinch Z-150 (50 kA, CTU Prague). The plasma corona around the wire was generated both by the current going through the wires and by the implosion of the wire array or of the current sheath. The experiments showed interesting results often observed in some shots of Z-pinch type discharges - existence of helical structures, two relatively long and stable pinch phases, oscillation of pinch diameter, and back return of the plasma exploding from the pinch. All these observed phenomena can be evolved by spontaneous self-generation and transformation of the axial magnetic field in the pinch during the plasma implosion and explosion. A configuration of axial and azimuthal magnetic field confines the plasma and later transforms or dissipates during a few tens or hundreds ns. A fast transformation of internal magnetic fields can induce a sufficiently high electric field for generation of keV particles and radiation. Study and usage of Z-pinch discharges is connected with solving of two principal problems, limitation of instability development and a way of generation of high energy particles and radiation. The first problem is partially solved by the faster increase of the current, by better cylindrical symmetry of the load and plasma, by higher density of the plasma or by the presence of a stronger magnetized plasma
HI gas in galaxies from z = 0 to z = 0.2
van Gorkom, Jacqueline
2008-01-01
Probing the evolution of galaxies through the neutral hydrogen window has until recently been limited to studies of environmentally driven evolution in the local universe. Detailed imaging studies of galaxies in Virgo and volume limited surveys of clusters out to z = 0.08 show that ram pressure
Directory of Open Access Journals (Sweden)
Renata Dyląg
2010-04-01
Full Text Available Głównym przedmiotem działalności jednostek z branży deweloperskiej jest rea-lizacja kontraktów deweloperskich, polegających na budowie (bezpośrednio lub poprzez podwykonawców a następnie sprzedaży powierzchni w budynkach handlowych, rozrywkowych, biurowych, hotelowych i mieszkalnych. Brak precyzyjnych rozwią-zań dotyczących ujmowania przychodów z tych kontraktów powodował, że niektóre jednostki ujmowały przychody w momencie przekazania nieruchomości nabywcy (zgodnie z MSR 18 „Przychody”, natomiast inne ujmowały przychody w trakcie trwania okresu budowy tej nieruchomości (zgodnie z MSR 11 „Umowy o budowę”. Celem artykułu jest ocena – przyjmowanych przez spółki deweloperskie noto-wane na warszawskiej Giełdzie Papierów Wartościowych – rozwiązań dotyczących ujmowania przychodów i wyników z kontraktów deweloperskich oraz zaprezento-wanie wpływu interpretacji KIMSF 15 „Umowy dotyczące budowy nieruchomości” na sprawozdawczość tych spółek.
Nové pohledy na mechanismus z Antikythery
Czech Academy of Sciences Publication Activity Database
Hadrava, Petr; Hadravová, Alena
2008-01-01
Roč. 41, č. 4 (2008), s. 255-264 ISSN 0300-4414 Institutional research plan: CEZ:AV0Z10030501; CEZ:AV0Z80630520 Keywords : analog ancient computer * turn of the 2nd to 1st century B. C * Antikythera island Subject RIV: AB - History
Single W production from heavy Z decay in E6 theories
International Nuclear Information System (INIS)
Rizzo, T.G.
1987-02-01
We examine the production of single W bosons in the decay of heavy Z bosons, which are present in the low energy limit of E 6 grand unified theories, via the process Z' → W + l - anti nu/sub l/. The branching ratio for this process is found to be sensitive to the Z'-fermion couplings as well as the amount of mixing between Z' and the usual standard model Z over a wide range of Z' masses
de Hoogd, Sjoerd; Overbeek, Wieske A; Heerdink, Eibert R; Correll, Christoph U; de Graeff, Elisabeth R; Staal, Wouter G
2012-04-01
Weight gain and metabolic adverse effects of second-generation antipsychotics (SGAs) have become a major concern, particularly in youth. However, the specific contribution of SGAs versus other medications or the underlying illness is unclear. In a chart review study of psychiatric outpatients aged ≤ 18 years treated with SGAs and psychiatric controls without lifetime SGA, use body mass index (BMI) z-scores between patients and controls were compared in the entire sample, patients without co-medications, diagnostic subgroups, and age subgroups. In patients with follow-up data, weight z-score change was calculated. Altogether, 592 Caucasian patients aged 4-18 (mean: 10.0) years with a psychiatric diagnosis were included. BMI z-scores in 96 youth treated with SGAs for 9.0 ± 6.1 months were significantly higher than in 496 patients without lifetime SGA use (0.81 ± 1.1 vs. 0.05 ± 1.2; pz-score differences remained significant in all age groups z-score increased significantly from -0.17 ± 1.5 to 0.25 ± 1.4 (p<0.0001) with 12.5% transitioning to overweight or obese status. These data show robust and significant differences in sex- and age-adjusted body weight and weight status in young pediatric Caucasian samples with and without use of SGAs independent of Diagnostic and Statistical Manual of Mental Disorders, 4th edition, Text Revision (DSM-IV-TR) (American Psychiatric Association 2000 ) diagnosis and nonantipsychotic medications. Weight status and metabolic effects of SGAs require careful attention, especially in youth.
The Remarkable Similarity of Massive Galaxy Clusters from z ~ 0 to z ~ 1.9
Energy Technology Data Exchange (ETDEWEB)
McDonald, M.; Allen, S. W.; Bayliss, M.; Benson, B. A.; Bleem, L. E.; Brodwin, M.; Bulbul, E.; Carlstrom, J. E.; Forman, W. R.; Hlavacek-Larrondo, J.; Garmire, G. P.; Gaspari, M.; Gladders, M. D.; Mantz, A. B.; Murray, S. S.
2017-06-28
We present the results of a Chandra X-ray survey of the 8 most massive galaxy clusters at z>1.2 in the South Pole Telescope 2500 deg^2 survey. We combine this sample with previously-published Chandra observations of 49 massive X-ray-selected clusters at 0<z<0.1 and 90 SZ-selected clusters at 0.25<z<1.2 to constrain the evolution of the intracluster medium (ICM) over the past ~10 Gyr. We find that the bulk of the ICM has evolved self similarly over the full redshift range probed here, with the ICM density at r>0.2R500 scaling like E(z)^2. In the centers of clusters (r<0.1R500), we find significant deviations from self similarity (n_e ~ E(z)^{0.1+/-0.5}), consistent with no redshift dependence. When we isolate clusters with over-dense cores (i.e., cool cores), we find that the average over-density profile has not evolved with redshift -- that is, cool cores have not changed in size, density, or total mass over the past ~9-10 Gyr. We show that the evolving "cuspiness" of clusters in the X-ray, reported by several previous studies, can be understood in the context of a cool core with fixed properties embedded in a self similarly-evolving cluster. We find no measurable evolution in the X-ray morphology of massive clusters, seemingly in tension with the rapidly-rising (with redshift) rate of major mergers predicted by cosmological simulations. We show that these two results can be brought into agreement if we assume that the relaxation time after a merger is proportional to the crossing time, since the latter is proportional to H(z)^(-1).
Z-1 Prototype Space Suit Testing Summary
Ross, Amy
2013-01-01
The Advanced Space Suit team of the NASA-Johnson Space Center performed a series of test with the Z-1 prototype space suit in 2012. This paper discusses, at a summary level, the tests performed and results from those tests. The purpose of the tests were two-fold: 1) characterize the suit performance so that the data could be used in the downselection of components for the Z-2 Space Suit and 2) develop interfaces with the suitport and exploration vehicles through pressurized suit evaluations. Tests performed included isolated and functional range of motion data capture, Z-1 waist and hip testing, joint torque testing, CO2 washout testing, fit checks and subject familiarizations, an exploration vehicle aft deck and suitport controls interface evaluation, delta pressure suitport tests including pressurized suit don and doff, and gross mobility and suitport ingress and egress demonstrations in reduced gravity. Lessons learned specific to the Z-1 prototype and to suit testing techniques will be presented.
Composite weak bosons, anomalous Z decays and other consequences
International Nuclear Information System (INIS)
Renard, F.M.
1984-01-01
We first recall the motivations for considering W bosons as composite and the possible experimental tests proposed before W, Z discovery. We then present the Z → l + l - γ events and we discuss their possible interpretations (residual interaction, S, Z and l* enhancements). We propose additional tests using other Z and W decay modes like multiphoton and multifermion ones. We notice a possible similar enhancement of the crossed reactions e + e - → Zγ, qantiq → Zγ and of other 2-boson production processes
Z ring as executor of bacterial cell division.
Dajkovic, Alex; Lutkenhaus, Joe
2006-01-01
It has become apparent that bacteria possess ancestors of the major eukaryotic cytoskeletal proteins. FtsZ, the ancestral homologue of tubulin, assembles into a cytoskeletal structure associated with cell division, designated the Z ring. Formation of the Z ring represents a major point of both spatial and temporal regulation of cell division. Here we discuss findings concerning the structure and the formation of the ring as well as its spatial and temporal regulation.
Lewis acid catalyzed transformations of Z-ligustilide
Energy Technology Data Exchange (ETDEWEB)
Rios, Maria Yolanda [Universidad Autonoma del Estado de Morelos, Cuernavaca, Morelos (Mexico); Delgado, Guillermo [Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)
1999-08-01
Some Lewis acid mediated reactions of Z-ligustilide (1), a bioactive constituent of the medicinal species Ligusticum porteri, were investigated. These reactions provided varying mixtures of Z-butylidenephthalide (7), E-butylidenephthalide (8), n-butyphthalide (13), and novel linear dimeric phthalides (9-12) as the main products. The formation of the dimers occurred in low yields and with regio and situ-selectivity. Initial competitive O- and C- complexation of the Lewis acid with Z-ligustilide promoted the formation of the dimers occurred in low yields and with regio and situ- selectivity. Initial competitive O- and C- complexation of the Lewis acid with Z-ligustilide promoted the formation of carbocations at C(8), C(6) and C(7), which were stabilized by the addition of the C(6')-C(7') olefin of a second unit of the starting material, to provide cations at C(6') and C(7'). Subsequent isomerizations and elimination of the catalyst afforded the dimeric products 9-12. The yields and structure of the products are quite dependent on variations of the reaction conditions and the catalyst employed. [Spanish] Se investigaron algunas reacciones de Z-ligustilidas (1), un constituyente bioactivo de la planta medicinal Ligusticum porteri, catalizadas por acidos de Lewis. Estas reacciones produjeron mezclas variables de Z-butilidenftalida (7), E-butilidenftalida (8), n-butilftalida (13), y ftalidos dimetricos lineales novedosos (9-12) como productos principales. La formacion de los dimeros procedio en rendimientos bajos y con regio- y situ-selectividad. La O- y C- complejacion competitiva inicial del acido de Lewis con Z-lingustilida promueve la formacion de cationes en C(8), C(6) y C(7), los cuales son estabilizados por la adicion de la olefina C(6')-C(7') de una segunda unidad de la materia prima para generar los cationes en C(6')-C(7'). Isomerizaciones subsecuentes y la eliminacion del catalizador conducen a los productos dimericos 9
VizieR Online Data Catalog: z=4.5 and z=5.7 LAEs properties with Spitzer (Finkelstein+, 2015)
Finkelstein, K. D.; Finkelstein, S. L.; Tilvi, V.; Malhotra, S.; Rhoads, J. E.; Grogin, N. A.; Pirzkal, N.; Dey, A.; Jannuzi, B. T.; Mobasher, B.; Pakzad, S.; Salmon, B.; Wang, J.
2017-10-01
The LAEs targeted by the Spitzer survey were discovered by the Large Area Lyman Alpha (LALA) Survey (Rhoads et al. 2000ApJ...545L..85R), which includes the Bootes field and has accompanying deep broadband imaging in B, V, R, I, and z' bands taken with the MOSAIC camera on the 4 m Mayall telescope at the Kitt Peak National Observatory. To select the z=4.5 and 5.7 LAE candidates the following criteria were used: (1) a secure detection (>5σ) in the narrowband filter; (2) a strong narrowband excess, i.e., the flux density in the narrowband should exceed that in the broadband at the 4σ level, this is done by requiring a narrowband-broadband color <-0.75 mag; and (3) no flux at wavelengths shorter than the expected Lyman break. The last condition implies that at z=4.5, sources are undetected in the B-band, while for z=5.7 sources, they are undetected in both the B-band and V-band. (5 data files).
Energy Technology Data Exchange (ETDEWEB)
Zwingelstein, G [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1968-07-01
A simple method is described for identifying the transfer function of a linear retard-less system, based on the inversion of the Z transformation of the transmittance using a computer. It is assumed in this study that the signals at the entrance and at the exit of the circuit considered are of the deterministic type. The study includes: the theoretical principle of the inversion of the Z transformation, details about programming simulation, and identification of filters whose degrees vary from the first to the fifth order. (authors) [French] On decrit une methode simple d'identification de fonction de transfert d'un systeme lineaire sans retard, qui repose sur l'inversion de la transformee en Z de la transmittance a l'aide d'un calculateur. On suppose dans cette etude, que les signaux a l'entree et a la sortie du circuit considere sont de type deterministe. L'etude comporte: le principe theorique de l'inversion de la transformation en Z, les details de la programmation, la simulation et l'identification de filtres dont le degre varie du premier au cinquieme ordre. (auteurs)
A study on Z-phase nucleation in martensitic chromium steels
International Nuclear Information System (INIS)
Golpayegani, Ardeshir; Andren, Hans-Olof; Danielsen, Hilmar; Hald, John
2008-01-01
9-12% chromium martensitic steels are liable to the precipitation of Z-phase, Cr(V,Nb)N, after long time exposure at 550-650 deg. C. This complex nitride consumes vanadium nitrides and causes the creep strength of the material to fall drastically after several thousand hours of exposure. In this work, initial stages of precipitation of Z-phase have been studied and characterized using energy-filtered transmission electron microscopy (EFTEM). Vanadium nitrides were found to provide the most suitable nucleation site for Z-phase, since the misfit between the (0 0 1) planes of VN and Z-phase is very small. Furthermore, such a nucleation site would provide vanadium and nitrogen for the growth of Z-phase. The presence of niobium carbide has also been observed close to Z-phase nucleation sites, indicating niobium to be important for the nucleation and growth of Z-phase
Search for neutralinos in the Z0 decay at LEP
International Nuclear Information System (INIS)
Hidaka, K.; Ratcliffe, P.
1991-01-01
We investigate neutralino production process e - e + →Z 0 →z k z k' at the Z 0 peak. Recent LEP and SLC data on Z 0 decays (such as total and invisible width of Z 0 and unsuccessful searches for chargino pairs and acoplanar charged lepton pairs and jet pairs) and the gluino search experiments at S(p-bar)pS and TEVATRON significantly constrain the mass matrix parameters of chargino and neutralino sectors. We find that despite these constraints there still remains a sizable 'window' in the parameter space really open for discovering neutralinos in the Z 0 decay at LEP. Encouraged by this observation we evaluate the event distributions for the detected particles in this process. The information these can provide would be valuable in identifying this production mechanism and the new particles responsible for it, including their spins, masses and couplings. (author)
Energy Technology Data Exchange (ETDEWEB)
Gomez, Gervasio [Univ. of Maryland, College Park, MD (United States)
1999-01-01
This dissertation reports on measurements of inclusive cross sections times branching fractions into electrons for W and Z bosons produced in pp collisions at ps = 1.8 TeV. From an integrated luminosity of 84.5 pb-1 recorded in 1994-1995 by the D0 detector at the Fermilab Tevatron, the cross sections are measured to be (p$\\bar{p}$ → W +X) ∙ B(W → e )= 2310 ± 10 (stat) ± 50 (syst) ± 100 (lum) pb and (p$\\bar{p}$ → Z +X) ∙ B(Z → ee)= 221 ± 3 (stat) ± 4 (syst) ± 10 (lum) pb. The cross section ratio R is determined to be (p$\\bar{p}$ → W+X) B(W → e )= (p$\\bar{p}$ → Z + X) ∙ B(Z → ee) = 10.43 ± 0.15 (stat) 0.20 (syst) ± 0.10 (NLO), and R is used to determine B(W → ev ) = 0.1044 ± 0.0015 (stat) ± 0.0020 (syst) 0.0017 (theory) ± 0.0010 (NLO), and W = 2.169 ± 0.031 (stat) ± 0.042 (syst) 0.041 (theory) ± 0.022 (NLO) GeV. The latter is used to set a 95% confidence level upper limit on the partial decay width of the W boson into non-standard model final states, $inv\\atop{W}$ , of 0.213 GeV.
International Nuclear Information System (INIS)
Abe, K.; Abt, I.; Ahn, C.J.; Akagi, T.; Ash, W.W.; Aston, D.; Bacchetta, N.; Baird, K.G.; Baltay, C.; Band, H.R.; Barakat, M.B.; Baranko, G.; Bardon, O.; Barklow, T.; Bazarko, A.O.; Ben-David, R.; Benvenuti, A.C.; Bienz, T.; Bilei, G.M.; Bisello, D.; Blaylock, G.; Bogart, J.R.; Bolton, T.; Bower, G.R.; Brau, J.E.; Breidenbach, M.; Bugg, W.M.; Burke, D.; Burnett, T.H.; Burrows, P.N.; Busza, W.; Calcaterra, A.; Caldwell, D.O.; Calloway, D.; Camanzi, B.; Carpinelli, M.; Cassell, R.; Castaldi, R.; Castro, A.; Cavalli-Sforza, M.; Church, E.; Cohn, H.O.; Coller, J.A.; Cook, V.; Cotton, R.; Cowan, R.F.; Coyne, D.G.; D'Oliveira, A.; Damerell, C.J.S.; Dasu, S.; De Sangro, R.; De Simone, P.; Dell'Orso, R.; Dima, M.; Du, P.Y.C.; Dubois, R.; Eisenstein, B.I.; Elia, R.; Falciai, D.; Fan, C.; Fero, M.J.; Frey, R.; Furuno, K.; Gillman, T.; Gladding, G.; Gonzalez, S.; Hallewell, G.D.; Hart, E.L.; Hasegawa, Y.; Hedges, S.; Hertzbach, S.S.; Hildreth, M.D.; Huber, J.; Huffer, M.E.; Hughes, E.W.; Hwang, H.; Iwasaki, Y.; Jacques, P.; Jaros, J.; Johnson, A.S.; Johnson, J.R.; Johnson, R.A.; Junk, T.; Kajikawa, R.; Kalelkar, M.; Karliner, I.; Kawahara, H.; Kendall, H.W.; Kim, Y.; King, M.E.; King, R.; Kofler, R.R.; Krishna, N.M.; Kroeger, R.S.; Labs, J.F.; Langston, M.; Lath, A.; Lauber, J.A.; Leith, D.W.G.; Liu, X.; Loreti, M.; Lu, A.; Lynch, H.L.; Ma, J.; Mancinelli, G.; Manly, S.; Mantovani, G.; Markiewicz, T.W.; Maruyama, T.; Massetti, R.; Masuda, H.; Mazzucato, E.; McKemey, A.K.; Meadows, B.T.; Messner, R.; Mockett, P.M.; Moffeit, K.C.; Mours, B.; Mueller, G.; Muller, D.; Nagamine, T.; Nauenberg, U.; Neal, H.; Nussbaum, M.; Ohnishi, Y.; Osborne, L.S.; Panvini, R.S.; Park, H.; Pavel, T.J.; Peruzzi, I.; Pescara, L.; Piccolo, M.; Piemontese, L.; Pieroni, E.; Pitts, K.T.; Plano, R.J.; Prepost, R.; Prescott, C.Y.; Punkar, G.D.; Quigley, J.; Ratcliff, B.N.; Reeves, T.W.; Rensing, P.E.; Rochester, L.S.; Rothberg, J.E.; Rowson, P.C.; Russell, J.J.; Saxton, O.H.; Schalk, T.
1995-01-01
The parity-violating parameters A b and A c are directly measured by the SLD experiment at the SLAC Linear Collider in e + e - collisions with polarized electrons at the Z 0 resonance. Leptons with distinctive total and transverse momenta are used to select and analyze Z 0 →bcbar events. A b and A c are extracted by forming the left-right forward-backward asymmetry in electron beam polarization and quark polar angle. From our 1993 sample of 1.8 pb --1 of Z 0 decay data with an average electron beam polarization of 63% we find A b =0.91±0.14 (stat) ±0.07 (syst) and A c =0.37±0.23 (stat) ±0.21 (syst)
Oesch, P. A.; Carollo, C. M.; Stiavelli, M.; Trenti, M.; Bergeron, L. E.; Koekemoer, A. M.; Lucas, R. A.; Pavlovsky, C. M.; Beckwith, S. V. W.; Dahlen, T.; Ferguson, H. C.; Gardner, Jonathan P.; Lilly, S. J.; Mobasher, B.; Panagia, N.
2009-01-01
We detect three (plus one less certain) z 850-dropout sources in two separate fields (Hubble Ultra Deep Field and NICP34) of our UDF05 Hubble Space Telescope Near-Infrared Camera and Multi-Object Spectrometer images. These z ~ 7 Lyman-break Galaxy (LBG) candidates allow us to constrain the Luminosity Function (LF) of the star-forming galaxy population at those epochs. By assuming a change in only M * and adopting a linear evolution in redshift, anchored to the measured values at z ~ 6, the best-fit evolution coefficient is found to be 0.43 ± 0.19 mag per unit redshift (0.36 ± 0.18, if including all four candidates), which provides a value of M *(z = 7.2) = -19.7 ± 0.3. This implies a drop in the luminosity density in LBGs by a factor of ~2-2.5 over the ~ 170 Myr that separate z ~ 6 and z ~ 7, and a steady evolution for the LBG LF out to z ~ 7, at the same rate that is observed throughout the z ~ 3-6 period. This puts a strong constraint on the star-formation histories of z ~ 6 galaxies, whose ensemble star-formation rate (SFR) density must be lower by a factor of 2 at ~ 170 Myr before the epoch at which they are observed. In particular, a large fraction of stars in the z ~ 6 LBG population must form at redshifts well above z ~ 7. The rate of ionizing photons produced by the LBG population consistently decreases with the decrease in the cosmic SFR density. Extrapolating this steady evolution of the LF out to higher redshifts, we estimate that galaxies would be able to reionize the universe by z ~ 6, provided that the faint-end slope of the z > 7 LF steepens to α ~ -1.9 and that faint galaxies with luminosities below the current detection limits contribute a substantial fraction of the required ionizing photons. This scenario, however, gives an integrated optical depth to electron scattering that is ~2σ below the Wilkinson Microwave Anisotropy Probe-5 measurement. Therefore, altogether, our results indicate that, should galaxies be the primary contributors to
Higher-order Bessel like beams with z-dependent cone angles
CSIR Research Space (South Africa)
Ismail, Y
2010-08-01
Full Text Available .64.81.22. Terms of Use: http://spiedl.org/terms Fig.5: Optical design to generate z-dependent Bessel-like beams 4. CONSIDERING A MATHEMATICAL APPROACH TO EXPLAINING Z-DEPENDENT BLB?S The stationary phase method is implemented in order to confirm... on higher-order z-dependent BLB?s [6]. 5. EXPERIMENTALLY GENERATED Z-DEPENDENT BESSEL-LIKE BEAMS From the above in can be deduced that these beams are Bessel-like hence they are so named z-dependent Bessel-like beams. These beams are produced however...