Improved Temperature and Emissivity Separation Algorithm for Multispectral and Hyperspectral Sensors
Czech Academy of Sciences Publication Activity Database
Pivovarník, Marek; Khalsa, Siri Jodha Singh; Jiménez-Muñoz, J. C.; Zemek, František
2017-01-01
Roč. 55, č. 4 (2017), s. 1944-1953 ISSN 0196-2892 R&D Projects: GA MŠk(CZ) LO1415; GA MZe(CZ) QJ1610289 Institutional support: RVO:67179843 Keywords : temperature sensors * hyperspectral sensors * land surface * brightness temperature * standards Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 4.942, year: 2016
Isolating and Discriminating Overlapping Signatures in Cluttered Environments
2011-05-11
Lin-Ping Song, Douglas W. Oldenburg, Leonard R. Pasion , and Stephen D. Billings. Transient electromagnetic inversion for multiple targets. SPIE...and Remote Sensing, 39(6):1294 – 1298, 2001. ISSN 0196-2892. 33, 34 [52] L. R. Pasion and D. W. Oldenburg. A discrimination algorithm for UXO using...R. Pasion , Douglas W. Oldenburg, and Stephen D. Billings. Com- puting transient electromagnetic response of a metallic object with a spheroidal
28 CFR 0.196 - Procedures for resolving disagreements concerning mail or case assignments.
2010-07-01
... concerning mail or case assignments. 0.196 Section 0.196 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Jurisdictional Disagreements § 0.196 Procedures for resolving... assigned, the disagreement, together with a statement of the view of the unit or units involved, shall be...
NCBI nr-aa BLAST: CBRC-CINT-01-0196 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CINT-01-0196 ref|YP_676963.1| glutamyl-tRNA reductase [Cytophaga hutchinsonii ...ATCC 33406] gb|ABG57623.1| glutamyl-tRNA reductase [Cytophaga hutchinsonii ATCC 33406] YP_676963.1 0.58 22% ...
76 FR 16802 - Extension of Approval of Information Collection, OMB Control Number 1004-0196
2011-03-25
... paperwork requirements for operators and operating rights owners in the National Petroleum Reserve--Alaska... is provided for the information collection: Title: Oil and Gas Leasing: National Petroleum Reserve... Control Number: 1004-0196. Abstract: This control number covers paperwork requirements for operators and...
Czech Academy of Sciences Publication Activity Database
Hocková, Dana; Dračínský, Martin; Holý, Antonín
-, č. 15 (2010), s. 2885-2892 ISSN 1434-193X R&D Projects: GA MŠk 1M0508 Institutional research plan: CEZ:AV0Z40550506 Keywords : nucleotides * phosphonates * cross-coupling Subject RIV: CC - Organic Chemistry Impact factor: 3.206, year: 2010
Czech Academy of Sciences Publication Activity Database
Botková, Š.; Čapek, L.; Setnička, M.; Bulánek, R.; Čičmanec, P.; Kalužová, A.; Pastva, Jakub; Zukal, Arnošt
2016-01-01
Roč. 119, č. 1 (2016), s. 319-333 ISSN 1878-5190 R&D Projects: GA ČR GAP106/10/0196 Institutional support: RVO:61388955 Keywords : Ethane * UV-Vis * VOx species * Al2O3-SBA-15 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.264, year: 2016
Development of advanced biorefinery concepts using magnetically responsive materials
Czech Academy of Sciences Publication Activity Database
Šafařík, Ivo; Pospíšková, K.; Baldíková, E.; Šafaříková, Miroslava
2016-01-01
Roč. 116, SI (2016), s. 17-26 ISSN 1369-703X Institutional support: RVO:60077344 Keywords : separation * biocatalysis * immobilization * bioconversion * magnetic particles * magnetic enzymes and cells Subject RIV: GM - Food Processing Impact factor: 2.892, year: 2016
Czech Academy of Sciences Publication Activity Database
Zhang, Q.; Žďárek, Jan; Nachman, R. J.; Denlinger, D. L.
2008-01-01
Roč. 29, č. 2 (2008), s. 196-205 ISSN 0196-9781 Institutional research plan: CEZ:AV0Z40550506 Keywords : diapause hormone * neuropeptide analogs * diapause termination * pupariation * Helicoverpa zea Subject RIV: CC - Organic Chemistry Impact factor: 2.565, year: 2008
Privoi, Marite
2010-01-01
SMS-laenu lepingu olemusest ja sellega kaasnevatest tarbijakaitselistest probleemidest Eestis, direktiivi 2008/0196 (COD) kohast Euroopa Ühenduse tarbijakaitse õiguse kontekstis, direktiiviga kaasnevatest muudatustest SMS-laenu lepingute suhtes
New potent antimicrobial peptides from the venom of Polistinae wasps and their analogs
Czech Academy of Sciences Publication Activity Database
Čeřovský, Václav; Slaninová, Jiřina; Fučík, Vladimír; Hulačová, Hana; Borovičková, Lenka; Ježek, Rudolf; Bednárová, Lucie
2008-01-01
Roč. 29, č. 6 (2008), s. 992-1003 ISSN 0196-9781 Institutional research plan: CEZ:AV0Z40550506 Keywords : antimicrobial peptides * wasp venom * circular dichroism * hemolytic activity Subject RIV: CC - Organic Chemistry Impact factor: 2.565, year: 2008
The vibrational dynamics of carbon monoxide in a confined space-CO in zeolites
Czech Academy of Sciences Publication Activity Database
Nachtigallová, Dana; Bludský, Ota; Areán, C. O.; Bulánek, R.; Nachtigall, Petr
2006-01-01
Roč. 8, č. 42 (2006), s. 4849-4852 ISSN 1463-9076 R&D Projects: GA MŠk(CZ) LC512; GA ČR(CZ) GA203/06/0324 Institutional research plan: CEZ:AV0Z40550506 Keywords : vibrational dynamics * IR spectroscopy * modeling Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.892, year: 2006
Czech Academy of Sciences Publication Activity Database
Fárník, Michal; Weimann, M.; Steinbach, Ch.; Buck, U.; Borho, N.; Adler, T. B.; Suhm, M. A.
2006-01-01
Roč. 8, č. 10 (2006), s. 1148-1158 ISSN 1463-9076 Grant - others:Deutsche Forschungsgemeinschaft(DE) SFB 357; Deutsche Forschungsgemeinschaft(DE) GRK 782 Institutional research plan: CEZ:AV0Z40400503 Keywords : electron-bombardment fragmentation * methanol clusters * methanol clusters * water clusters Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.892, year: 2006
Development of advanced biorefinery concepts using magnetically responsive materials
Czech Academy of Sciences Publication Activity Database
Šafařík, Ivo; Pospišková, K.; Baldíková, E.; Šafaříková, Miroslava
2016-01-01
Roč. 116, DEC (2016), s. 17-26 ISSN 1369-703X R&D Projects: GA ČR GA13-13709S Institutional support: RVO:67179843 Keywords : saccharomyces-cerevisiae cells * solid acid catalysts * Separation * Biocatalysis * Immobilization * Bioconversion * Magnetic particles * Magnetic enzymes and cells Subject RIV: EH - Ecology, Behaviour Impact factor: 2.892, year: 2016
Low luminosity Type II supernovae - II. Pointing towards moderate mass precursors
Czech Academy of Sciences Publication Activity Database
Spiro, S.; Pastorello, A.; Pumo, M. L.; Zampieri, L.; Turatto, M.; Smartt, S. J.; Benetti, S.; Cappellaro, E.; Kawka, Adela; Vennes, Stephane
2014-01-01
Roč. 439, č. 3 (2014), s. 2873-2892 ISSN 0035-8711 Institutional support: RVO:67985815 Keywords : supernovae: general Subject RIV: BN - Astronomy , Celestial Mechanics, Astrophysics Impact factor: 5.107, year: 2014
Energy Technology Data Exchange (ETDEWEB)
Han, C. [Department of Physics, Chungbuk National University, Cheongju 361-763 (Korea, Republic of); Udalski, A.; Szymański, M. K.; Soszyński, I.; Skowron, J.; Mróz, P.; Poleski, R.; Pietrukowicz, P.; Kozłowski, S.; Ulaczyk, K.; Pawlak, M. [Warsaw University Observatory, Al. Ujazdowskie 4, 00-478 Warszawa (Poland); Gould, A.; Zhu, Wei; Fausnaugh, M.; Gaudi, B. S. [Department of Astronomy, Ohio State University, 140 W. 18th Ave., Columbus, OH 43210 (United States); Yee, J. C. [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Beichman, C. [NASA Exoplanet Science Institute, MS 100-22, California Institute of Technology, Pasadena, CA 91125 (United States); Novati, S. Calchi [Dipartimento di Fisica “E. R. Caianiello,” Uńiversitá di Salerno, Via Giovanni Paolo II, I-84084 Fisciano (Italy); Carey, S. [Spitzer Science Center, MS 220-6, California Institute of Technology, Pasadena, CA (United States); Bryden, C. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Dr., Pasadena, CA 91109 (United States); Collaboration: OGLE Collaboration; Spitzer Microlensing Team; and others
2017-01-01
In this paper, we present an analysis of the binary gravitational microlensing event OGLE-2015-BLG-0196. The event lasted for almost a year, and the light curve exhibited significant deviations from the lensing model based on the rectilinear lens-source relative motion, enabling us to measure the microlens parallax. The ground-based microlens parallax is confirmed by the data obtained from space-based microlens observations using the Spitzer telescope. By additionally measuring the angular Einstein radius from the analysis of the resolved caustic crossing, the physical parameters of the lens are determined up to the twofold degeneracy, u {sub 0} < 0 and u {sub 0} > 0, solutions caused by the well-known “ecliptic” degeneracy. It is found that the binary lens is composed of two M dwarf stars with similar masses, M {sub 1} = 0.38 ± 0.04 M {sub ⊙} (0.50 ± 0.05 M {sub ⊙}) and M {sub 2} = 0.38 ± 0.04 M {sub ⊙} (0.55 ± 0.06 M {sub ⊙}), and the distance to the lens is D {sub L} = 2.77 ± 0.23 kpc (3.30 ± 0.29 kpc). Here the physical parameters outside and inside the parentheses are for the u {sub 0} < 0 and u {sub 0} > 0 solutions, respectively.
Czech Academy of Sciences Publication Activity Database
Gäde, G.; Šimek, Petr; Marco, H. G.
2009-01-01
Roč. 30, č. 3 (2009), s. 477-482 ISSN 0196-9781 Grant - others:National Research Foundation Pretoria(ZA) FA2007021300002 Institutional research plan: CEZ:AV0Z50070508 Keywords : Arthropods * Insects * Megaloptera Subject RIV: ED - Physiology Impact factor: 2.705, year: 2009
Czech Academy of Sciences Publication Activity Database
Gäde, G.; Šimek, Petr; Marco, H. G.
2007-01-01
Roč. 28, č. 7 (2007), s. 1359-1367 ISSN 0196-9781 Grant - others:Natioanl Research Foundation(ZA) 2053396 Institutional research plan: CEZ:AV0Z50070508 Keywords : Insects * Heteroptera * Water bugs Subject RIV: ED - Physiology Impact factor: 2.368, year: 2007
Effect of OH/NCO molar ratio on properties of soy-based polyurethane networks
Czech Academy of Sciences Publication Activity Database
Petrovic, Z. S.; Zhang, W.; Zlatanic, A.; Lava, C. C.; Ilavský, Michal
2002-01-01
Roč. 10, 1/2 (2002), s. 5-12 ISSN 1566-2543 R&D Projects: GA AV ČR KSK4050111 Institutional research plan: CEZ:AV0Z4050913 Keywords : soy * polyol * polyurethane Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.196, year: 2002
Czech Academy of Sciences Publication Activity Database
Blechová, Miroslava; Nagelová, Veronika; Žáková, Lenka; Demianova, Zuzana; Železná, Blanka; Maletínská, Lenka
2013-01-01
Roč. 39, January (2013), s. 138-144 ISSN 0196-9781 R&D Projects: GA ČR GAP303/10/1368 Institutional support: RVO:61388963 Keywords : CART peptide analogs * sulfitolysis * PC12 cells * binding * food intake Subject RIV: CE - Biochemistry Impact factor: 2.614, year: 2013
Czech Academy of Sciences Publication Activity Database
Pirnik, Z.; Maixnerová, Jana; Matyšková, Resha; Koutová, Darja; Železná, Blanka; Maletínská, Lenka; Kiss, A.
2010-01-01
Roč. 31, č. 1 (2010), s. 139-144 ISSN 0196-9781 R&D Projects: GA ČR GA303/05/0614 Institutional research plan: CEZ:AV0Z40550506 Keywords : cholecystokinin * CART * hypocretin * Fos peptide Subject RIV: CE - Biochemistry Impact factor: 2.654, year: 2010
Czech Academy of Sciences Publication Activity Database
Bulánek, R.; Drobná, H.; Nachtigall, Petr; Rubeš, Miroslav; Bludský, Ota
2006-01-01
Roč. 8, č. 47 (2006), s. 5535-5542 ISSN 1463-9076 R&D Projects: GA MŠk(CZ) LC512; GA AV ČR(CZ) IAA400550613; GA ČR(CZ) GA203/06/0324 Institutional research plan: CEZ:AV0Z40550506 Keywords : vibrational dynamics * IR spectroscopy * periodic DFT Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.892, year: 2006
Czech Academy of Sciences Publication Activity Database
Mikulášková, Barbora; Zemenová, Jana; Pirník, Zdenko; Pražienková, Veronika; Bednárová, Lucie; Železná, Blanka; Maletínská, Lenka; Kuneš, Jaroslav
2016-01-01
Roč. 75, Jan (2016), s. 109-117 ISSN 0196-9781 R&D Projects: GA ČR(CZ) GA15-08679S Institutional support: RVO:61388963 Keywords : prolactin-releasing peptide * lipidization * food intake * c-Fos * pharmacokinetics * CD spectroscopy Subject RIV: CE - Biochemistry Impact factor: 2.778, year: 2016
Study of vanadium based mesoporous silicas for oxidative dehydrogenation of propane and n-butane
Czech Academy of Sciences Publication Activity Database
Bulánek, R.; Kalužová, A.; Setnička, M.; Zukal, Arnošt; Čičmanec, P.; Mayerová, Jana
2012-01-01
Roč. 179, č. 1 (2012), s. 149-158 ISSN 0920-5861 R&D Projects: GA ČR GAP106/10/0196 Institutional research plan: CEZ:AV0Z40400503 Keywords : vanadium * oxidative dehydrogenation * mesoporous silicas Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.980, year: 2012
Czech Academy of Sciences Publication Activity Database
Maixnerová, Jana; Špolcová, Andrea; Pýchová, Miroslava; Blechová, Miroslava; Elbert, Tomáš; Řezáčová, M.; Železná, Blanka; Maletínská, Lenka
2011-01-01
Roč. 32, č. 4 (2011), s. 811-817 ISSN 0196-9781 R&D Projects: GA ČR GAP303/10/1368 Institutional research plan: CEZ:AV0Z40550506 Keywords : PrRP * pituitary cell lines * food intake Subject RIV: CC - Organic Chemistry Impact factor: 2.434, year: 2011
Czech Academy of Sciences Publication Activity Database
Maletínská, Lenka; Špolcová, Andrea; Maixnerová, Jana; Blechová, Miroslava; Železná, Blanka
2011-01-01
Roč. 32, č. 9 (2011), s. 1887-1892 ISSN 0196-9781 R&D Projects: GA ČR GAP303/10/1368 Institutional research plan: CEZ:AV0Z40550506 Keywords : pituitary cells * PrRP analogs * food intake Subject RIV: CC - Organic Chemistry Impact factor: 2.434, year: 2011
Pre-listening stage and teaching listening from the adult learner’s perspective
Czech Academy of Sciences Publication Activity Database
Ždímalová, Hana; Anýžová, P.
2012-01-01
Roč. 24, č. 2 /supplementary issue/ (2012), s. 23-38 ISSN 1210-0196. [New Ways to Teaching and Learning . Hrade Králové, 14.09.2012-15.09.2012] Institutional support: RVO:68378092 Keywords : listening comprehension * listening instruction * communicative competence * pre-listening stage Subject RIV: AI - Linguistics
Czech Academy of Sciences Publication Activity Database
Palatinus, Lukáš; Correa, Cinthia Antunes; Steciuk, G.; Jacob, D.; Roussel, P.; Boullay, P.; Klementová, Mariana; Gemmi, M.; Kopeček, Jaromír; Domeneghetti, C.; Cámara, F.; Petříček, Václav
2015-01-01
Roč. 71, č. 6 (2015), 740-751 ISSN 2052-5206 R&D Projects: GA MŠk(CZ) LM2011029; GA ČR GA13-25747S; GA MŠk LO1409 Grant - others:SAFMAT(XE) CZ.2.16/3.1.00/22132; FUNBIO(XE) CZ.2.16/3.1.00/21568 Keywords : XRD * structure refinement * precession electron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.892, year: 2015
FTIR spectroscopic and computational studies on hydrogen adsorption on the zeolite Li-FER
Czech Academy of Sciences Publication Activity Database
Nachtigall, Petr; Garrone, E.; Palomino, G. T.; Delgado, M. R.; Nachtigallová, Dana; Areán, C. O.
2006-01-01
Roč. 8, č. 19 (2006), s. 2286-2292 ISSN 1463-9076 R&D Projects: GA MŠk(CZ) LC512; GA ČR(CZ) GA203/06/0324 Grant - others:UIB(ES) MAT-2005-05350; MIUR(IT) FISR2004 Institutional research plan: CEZ:AV0Z40550506 Keywords : adsorption * hydrogen storage * spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.892, year: 2006
Czech Academy of Sciences Publication Activity Database
Maixnerová, Jana; Hlaváček, Jan; Blokešová, Darja; Kowalczyk, W.; Elbert, Tomáš; Šanda, Miloslav; Blechová, Miroslava; Železná, Blanka; Slaninová, Jiřina; Maletínská, Lenka
2007-01-01
Roč. 28, č. 10 (2007), s. 1945-1953 ISSN 0196-9781 R&D Projects: GA ČR GA303/05/0614 Institutional research plan: CEZ:AV0Z40550506 Keywords : CART peptide * fragments * binding * PC12 cells Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.368, year: 2007
Czech Academy of Sciences Publication Activity Database
Gäde, G.; Šimek, Petr; Marco, H. G.
2015-01-01
Roč. 68, JUN 01 (2015), s. 43-49 ISSN 0196-9781 R&D Projects: GA ČR GA13-18509S Institutional support: RVO:60077344 Keywords : insects * pygmy grasshoppers * Tetrigidae Subject RIV: EH - Ecology, Behaviour Impact factor: 2.535, year: 2015 http://www.sciencedirect.com/science/article/pii/S0196978115000339
Czech Academy of Sciences Publication Activity Database
Gäde, G.; Marco, H. G.; Šimek, Petr; Audsley, N.; Clark, K. D.; Weaver, R. J.
2008-01-01
Roč. 29, č. 7 (2008), s. 1124-1139 ISSN 0196-9781 Grant - others:National Research Foundation, Pretoria(ZA) 2053806; National Research Foundation, Pretoria(ZA) FA2007021300002 Institutional research plan: CEZ:AV0Z50070508 Keywords : insects * neuropeptides * adipokinetic peptides Subject RIV: ED - Physiology Impact factor: 2.565, year: 2008
Czech Academy of Sciences Publication Activity Database
Mikulášková, Barbora; Zemenová, J.; Pirník, Z.; Pražienková, V.; Bednárová, L.; Železná, B.; Maletínská, L.; Kuneš, Jaroslav
2016-01-01
Roč. 75, Jan (2016), s. 109-117 ISSN 0196-9781 R&D Projects: GA ČR(CZ) GA15-08679S Institutional support: RVO:67985823 Keywords : prolactin-releasing peptide * lipidization * food intake * c-Fos * pharmacokinetics * CD spectroscopy Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 2.778, year: 2016
Czech Academy of Sciences Publication Activity Database
Sedlák, M.; Koňák, Čestmír; Dybal, Jiří
2010-01-01
Roč. 1, č. 2010 (2010), s. 87-90 ISSN 2210-2892 Institutional research plan: CEZ:AV0Z40500505 Keywords : cytosolic delivery * nanoparticle carriers * poly(ethylacrylic acid) Subject RIV: CD - Macromolecular Chemistry http://benthamopen.com/ABSTRACT/TOPROCJ-1-87
Czech Academy of Sciences Publication Activity Database
Romanyuk, Olexandr; Jiříček, Petr; Paskova, T.; Bartoš, Igor
2015-01-01
Roč. 30, č. 19 (2015), 2881-2892 ISSN 0884-2914 Grant - others:AVČR(CZ) M100101201 Institutional support: RVO:68378271 Keywords : GaN , * semipolar surfaces, * photoelectron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.579, year: 2015
Extračné postupy pre izoláciu diterpénov z uhlia
Czech Academy of Sciences Publication Activity Database
Zubrik, A.; Lovás, M.; Dolinská, S.; Hredzák, S.; Turčeková, Ĺ.; Cvačka, Josef; Vrkoslav, Vladimír
2013-01-01
Roč. 107, č. 9 (2013), s. 723-728 ISSN 0009-2770 R&D Projects: GA ČR GAP206/12/1093 Grant - others:VEGA(SK) 2/0114/13 Institutional support: RVO:61388963 Keywords : Slovak brown coal * diterpenes * supercritical fluid extraction * microwave extraction Subject RIV: CC - Organic Chemistry Impact factor: 0.196, year: 2013
Czech Academy of Sciences Publication Activity Database
Kodrík, Dalibor; Krishnan, Natraj; Habuštová, Oxana
2007-01-01
Roč. 28, č. 5, (2007), s. 974-980 ISSN 0196-9781 R&D Projects: GA ČR GA522/05/0151; GA ČR(CZ) GA522/06/1591 Institutional research plan: CEZ:AV0Z50070508 Keywords : adipokinetic hormone * oxidative stress * GMO Subject RIV: ED - Physiology Impact factor: 2.368, year: 2007
Czech Academy of Sciences Publication Activity Database
Slaninová, Jiřina; Mlsová, V.; Kroupová, H.; Alán, Lukáš; Tůmová, Tereza; Monincová, Lenka; Borovičková, Lenka; Fučík, Vladimír; Čeřovský, Václav
2012-01-01
Roč. 33, č. 1 (2012), s. 18-26 ISSN 0196-9781 R&D Projects: GA ČR GA203/08/0536 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z50110509 Keywords : antimicrobial peptides * venom * hymenoptera * cancer cells * toxicity * confocal microscopy Subject RIV: CE - Biochemistry Impact factor: 2.522, year: 2012
Czech Academy of Sciences Publication Activity Database
Doušková, Irena; Kaštánek, František; Maléterová, Ywetta; Kaštánek, P.; Doucha, Jiří; Zachleder, Vilém
2010-01-01
Roč. 51, č. 3 (2010), s. 606-611 ISSN 0196-8904 R&D Projects: GA MŠk OE 221; GA MŠk OE09025; GA AV ČR KAN400720701 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z40720504 Keywords : Stillage * biogas * microalgae Subject RIV: EE - Microbiology, Virology Impact factor: 2.054, year: 2010
Možnosti a meze intervence: František Palacký a rakouská cenzura ve 20. letech 19. století
Czech Academy of Sciences Publication Activity Database
Píša, Petr
2011-01-01
Roč. 15, - (2011), s. 91-102 ISSN 0862-2892 R&D Projects: GA ČR GAP406/10/2127 Institutional research plan: CEZ:AV0Z90560517 Keywords : censorship * Palacký, František * Vormärz period * Bohemia Subject RIV: AJ - Letters, Mass-media, Audiovision
Czech Academy of Sciences Publication Activity Database
Vácha, Robert; Jungwirth, Pavel; Chen, J.; Valsaraj, K.
2006-01-01
Roč. 8, č. 38 (2006), s. 4461-4467 ISSN 1463-9076 R&D Projects: GA MŠk(CZ) LC512; GA MŠk(CZ) ME 644 Grant - others:NSF(US) CHE0431312; NSF(US) CHE0209719; NSF(US) ATM-0355291 Institutional research plan: CEZ:AV0Z40550506 Keywords : polycyclic aromatic hydrocarbons * water surface * molecular dynamics simulations * heterogeneous atmospheric chemistry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.892, year: 2006
Biomineralizace srdečních chlopní
Czech Academy of Sciences Publication Activity Database
Coufalová, L.; Kučková, Š.; Zeman, Antonín; Šmíd, M.; Velčovská, M.; Hynek, R.
2013-01-01
Roč. 107, č. 1 (2013), s. 54-57 ISSN 0009-2770 Institutional support: RVO:68378297 Keywords : aortic stenosis * cardial tissue * peptide mapping Subject RIV: CE - Biochemistry Impact factor: 0.196, year: 2013
Czech Academy of Sciences Publication Activity Database
Zahradník, Rudolf
2013-01-01
Roč. 107, č. 10 (2013), s. 754-760 ISSN 0009-2770 Institutional support: RVO:61388955 Keywords : chemistry * carbon dioxide * energy calculation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.196, year: 2013
Use of Out-of-Hospital Ethanol Administration to Improve Outcome in Mass Methanol Outbreaks
Czech Academy of Sciences Publication Activity Database
Zakharov, S.; Pelclová, D.; Urban, P.; Navrátil, Tomáš; Nurieva, O.; Kotíková, K.; Diblík, J.; Kurcová, I.; Běláček, J.; Komarc, M.; Eddleston, M.; Hovda, K. E.
2016-01-01
Roč. 68, č. 1 (2016), s. 52-61 ISSN 0196-0644 Institutional support: RVO:61388955 Keywords : ISCHEMIA-REPERFUSION INJURY * TRAUMATIC BRAIN-INJURY * FORMATE CONCENTRATIONS Subject RIV: CG - Electrochemistry Impact factor: 4.728, year: 2016
Czech Academy of Sciences Publication Activity Database
Marco, H. G.; Šimek, Petr; Gäde, G.
2011-01-01
Roč. 32, č. 3 (2011), s. 454-460 ISSN 0196-9781 R&D Projects: GA ČR GA203/09/2014 Grant - others:National Research Foundation, Pretoria(ZA) FA2007021300002; National Research Foundation, Pretoria(ZA) IFR2008071500048 Institutional research plan: CEZ:AV0Z50070508 Keywords : Insects * Heteroptera * Laccocoris spurcus Subject RIV: ED - Physiology Impact factor: 2.434, year: 2011
Czech Academy of Sciences Publication Activity Database
Bičáková, Olga; Straka, Pavel
2016-01-01
Roč. 116, MAY 15 (2016), s. 203-213 ISSN 0196-8904 Grant - others:OPPK(XE) CZ.2.16/3.1.00/21538 Program:OPPK Institutional support: RVO:67985891 Keywords : waste tires * coal * co-pyrolysis * smokeless fuel * tar * hydrogen -rich gas Subject RIV: DM - Solid Waste and Recycling Impact factor: 5.589, year: 2016 http://www.sciencedirect.com/science/article/pii/S0196890416300991
Czech Academy of Sciences Publication Activity Database
Kozubek, Michal; Kozubek, Stanislav; Lukášová, Emilie; Bártová, Eva; Skalníková, M.; Matula, Pa.; Matula, Pe.; Jirsová, Pavla; Cafourková, Alena; Koutná, Irena
2001-01-01
Roč. 45, č. 1 (2001), s. 1-12 ISSN 0196-4763 R&D Projects: GA MŠk VS97031; GA ČR GA202/99/P008; GA AV ČR IBS5004010 Institutional research plan: CEZ:AV0Z5004920 Keywords : high-resolution cytometry * fluorescence in situ hybridization * interphase nuclei Subject RIV: BO - Biophysics Impact factor: 2.220, year: 2001
Czech Academy of Sciences Publication Activity Database
Marco, H. G.; Šimek, Petr; Clark, K. D.; Gäde, G.
2013-01-01
Roč. 41, MAR 10 (2013), s. 21-30 ISSN 0196-9781 R&D Projects: GA MZd(CZ) NT11513 Grant - others:National Research Foundation(ZA) IFR 2008071500048; National Research Foundation(ZA) FA 2007021300002 Institutional support: RVO:60077344 Keywords : insects * kissing bugs * reduviidae Subject RIV: ED - Physiology Impact factor: 2.614, year: 2013 http://www.sciencedirect.com/science/article/pii/S0196978112004433
The multiple T-maze in vivo testing of the neuroprotective effect of humanin analogues
Czech Academy of Sciences Publication Activity Database
Kunešová, G.; Hlaváček, Jan; Patočka, J.; Evangelou, A.; Zikos, C.; Benaki, D.; Paravatou-Petsotas, M.; Pelecanou, M.; Livaniou, E.; Slaninová, Jiřina
2008-01-01
Roč. 29, č. 11 (2008), s. 1982-1987 ISSN 0196-9781 R&D Projects: GA ČR GA305/03/1100; GA MŠk ME 872 Grant - others:Czech-Greek Joint Research and Technology Programme(GR) 188-gamma Institutional research plan: CEZ:AV0Z40550506 Keywords : humanin * colivelin * memory Subject RIV: CC - Organic Chemistry Impact factor: 2.565, year: 2008
Využití UV/VIS spektrofotometrie pro stanovení diklofenaku
Czech Academy of Sciences Publication Activity Database
Čapka, Lukáš; Zlámalová Gargošová, H.; Vávrová, M.; Urbánková, L.
2013-01-01
Roč. 107, č. 7 (2013), s. 550-554 ISSN 0009-2770 Institutional support: RVO:68081715 Keywords : diclofenac * UV-VIS spectrophotometry * environment * fate * pharmaceutical residues Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.196, year: 2013
PERSPEKTIVY ZÁKLADNÍHO ELEKTROCHEMICKÉHO VÝZKUMU
Czech Academy of Sciences Publication Activity Database
Heyrovský, Michael
2013-01-01
Roč. 107, č. 5 (2013), s. 395-398 ISSN 0009-2770 Institutional support: RVO:61388955 Keywords : SOLID AMALGAM ELECTRODES * MERCURY DROP ELECTRODE * CARBON ELECTRODES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.196, year: 2013
The poverty effect of remittance flows: evidence from Georgia
Czech Academy of Sciences Publication Activity Database
Uzagalieva, Ainura; Menezes, A. G.
2009-01-01
Roč. 21, č. 4 (2009), s. 453-474 ISSN 1463-1377 Institutional research plan: CEZ:AV0Z70850503 Keywords : poverty effects of emmigration * remittance flows * Gergia * computable general equilibrium model Subject RIV: AH - Economics Impact factor: 0.196, year: 2009
Czech Academy of Sciences Publication Activity Database
Kološtová, K.; Taltynov, O.; Pintérová, D.; Boubelík, M.; Raška, O.; Hozák, Pavel; Jirkovská, M.; Bobek, V.
2012-01-01
Roč. 33, č. 1 (2012), s. 68-74 ISSN 0196-0709 Institutional research plan: CEZ:AV0Z50520514 Keywords : BALB/c mouse strain * significant angiogenesis * cartilage repair * phVEGF(165) injection Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.228, year: 2012
Cyklodextriny ve světě polymerů
Czech Academy of Sciences Publication Activity Database
Horský, Jiří; Jindřich, J.
2013-01-01
Roč. 107, č. 10 (2013), s. 769-776 ISSN 0009-2770 Institutional support: RVO:61389013 Keywords : cyclodextrins * polymers * pseudopolyrotaxanes Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.196, year: 2013 http://www.chemicke-listy.cz/common/article-vol_107-issue_10-page_769.html
Czech Academy of Sciences Publication Activity Database
Setnička, M.; Čičmanec, P.; Bulánek, R.; Zukal, Arnošt; Pastva, Jakub
2013-01-01
Roč. 204, APR 2013 (2013), s. 132-139 ISSN 0920-5861 R&D Projects: GA ČR GAP106/10/0196 Institutional support: RVO:61388955 Keywords : mesoporous titanosilicate * hexagonal mesoporous structure * vanadium Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.309, year: 2013
Computer Modeling of Radiative Transfer in Hybrid-Stabilized Argon–Water Electric Arc
Czech Academy of Sciences Publication Activity Database
Jeništa, Jiří; Takana, H.; Nishiyama, H.; Křenek, Petr; Bartlová, M.; Aubrecht, V.
2011-01-01
Roč. 39, č. 11 (2011), s. 2892-2893 ISSN 0093-3813 Institutional research plan: CEZ:AV0Z20430508 Keywords : Divergence of radiation flux * hybrid-stabilized electric arc * mass flow rate * partial characteristics * radiation flux Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.174, year: 2011 http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=27
The Early Warning System and the Monti II Regulation: The Case for a Political Interpretation
Czech Academy of Sciences Publication Activity Database
Goldoni, Marco
2014-01-01
Roč. 10, č. 1 (2014), s. 90-108 ISSN 1574-0196 Institutional support: RVO:68378122 Keywords : human rights protection * proportionality * deference Subject RIV: AG - Legal Sciences Impact factor: 1.486, year: 2014 http://journals.cambridge.org/action/displayAbstract?fromPage=online&aid=9236502&fileId=S1574019614001059
Czech Academy of Sciences Publication Activity Database
Weaver, R. J.; Marco, H. G.; Šimek, Petr; Audsley, N.; Clark, K. D.; Gäde, G.
2012-01-01
Roč. 34, č. 1 (2012), s. 44-50 ISSN 0196-9781 R&D Projects: GA ČR GAP206/10/2401 Grant - others:NRF - Royal Society UK(GB) NRF GUN 63515; National Research Foundation(ZA) FA2007021300002; National Research Foundation(ZA) IFR2008071500048 Institutional research plan: CEZ:AV0Z50070508 Keywords : Insect * Sphingidae * adipokinetic hormone Subject RIV: ED - Physiology Impact factor: 2.522, year: 2012 http://www.sciencedirect.com/science/article/pii/S0196978112000307
Czech Academy of Sciences Publication Activity Database
Donátová, M.; Karban, P.; Doležel, Ivo; Ulrych, B.
2009-01-01
Roč. 85, č. 4 (2009), s. 16-18 ISSN 0033-2097 R&D Projects: GA ČR(CZ) GA102/07/0496 Institutional research plan: CEZ:AV0Z20570509 Keywords : induction heating * integrodifferential model * electromagnetic field Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.196, year: 2009
Czech Academy of Sciences Publication Activity Database
Čopíková, J.; Moravcová, J.; Wimmer, Zdeněk; Opletal, L.; Lapčík, O.; Drašar, P.
2013-01-01
Roč. 107, č. 11 (2013), s. 867-874 ISSN 0009-2770 Institutional research plan: CEZ:AV0Z50380511 Keywords : FRUCTOSE CORN SYRUP * LONG-TERM TOXICITY * NATURAL COMPOUNDS Subject RIV: GM - Food Processing Impact factor: 0.196, year: 2013 http://www.chemicke-listy.cz/docs/full/2013_11_867-874.pdf
Czech Academy of Sciences Publication Activity Database
Doležel, Ivo; Donátová, M.; Karban, P.; Ulrych, B.
2009-01-01
Roč. 85, č. 4 (2009), s. 13-15 ISSN 0033-2097 R&D Projects: GA ČR(CZ) GA102/07/0496 Institutional research plan: CEZ:AV0Z20570509 Keywords : pumps of molten metal * magnetohydrodynamic principle * nuclear reactors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.196, year: 2009
EVALUASI KEPUASAN PELANGGAN PADA JASA PERPUSTAKAAN DAN ISSN PDII-LIPI
Directory of Open Access Journals (Sweden)
Wahid Nashihuddin
2016-03-01
Full Text Available The purposes of this study are: (a determine the level of customer satisfaction in library and ISSN services; (b determine customers feedback in improving the quality of library and ISSN services. Type of data this study is quantitative. Data were collected by distributing Survei Kepuasan Masyarakat (SKM questionnaires. There are nine indicators in SKM: (1 compliance with the service requirements; (2 easy of servicing procedures; (3 the timeliness of service; (4 the suitability of the service charge; (5 product assurance services; (6 the competence of service personnel; (7 the behavior of the service personnel; (8 clear intimation of service; and (9 the handling of complaints, suggestions, and feedback of services. SKM questionnaire distributed to 60 respondents who have received services from the concierge of library and ISSN service. The data are interpreted with a frequency distribution table. Each indicator item in SKM has processed by the value/score of the class interval system. Results of this study indicated that the information service on library and ISSN are satisfactory of customer. The results based on customer survey uses nine indicators of SKM. Most respondents who become customers of the library and ISSN feel satisfied, the number of 43 respondents (71,7% said they were satisfied and 11 respondents (18,3% expressed great satisfaction with the services. If viewed from the service unit, there are 25 respondents (83,33% as a subscribers of library services and 18 respondents (60% as a ISSN customers whose are satisfied with the those services. However, despite on the results of SKM had been satisfaction, the institution must be to improve the quality system of services ongoing basis. This is done to reduce or eliminate various forms of complaints from customers.
In-vitro biologická dostupnost rizikových prvků z inhalovaného městského sedimentujícího prachu
Czech Academy of Sciences Publication Activity Database
Kašparovská, Kateřina; Száková, J.; Sysalová, J.; Tlustoš, P.; Svoboda, Petr
2013-01-01
Roč. 107, č. 4 (2013), s. 313-317 ISSN 0009-2770 Grant - others:GA ČR(CZ) GA521/09/1150 Program:GA Institutional support: RVO:67985823 Keywords : risk elements * contaminated particulate matter * inhalation * bioavailability * Hatch’s solution * Gamble’s solution Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.196, year: 2013
SIRTUINY – HISTONOVÉ DEACETYLASY OVLIVŇUJÍCÍ TRANSKRIPCI GENŮ
Czech Academy of Sciences Publication Activity Database
Dvořáková, Marcela; Přibylová, Marie; Vaněk, Tomáš
2013-01-01
Roč. 107, č. 7 (2013), s. 537-544 ISSN 0009-2770 R&D Projects: GA MŠk ME08070 Institutional research plan: CEZ:AV0Z50380511 Keywords : PANCREATIC BETA-CELLS * CALORIE RESTRICTION * ENERGY-METABOLISM Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.196, year: 2013 http://www.chemicke-listy.cz/docs/full/2013_07_537-544.pdf
Czech Academy of Sciences Publication Activity Database
Kloužková, A.; Mrázová, M.; Kohoutková, M.; Kloužek, Jaroslav
2013-01-01
Roč. 107, č. 11 (2013), s. 856-861 ISSN 0009-2770 R&D Projects: GA TA ČR TA01010844 Institutional support: RVO:67985891 Keywords : dental ceramic * leucite * coefficient of linear thermal expansion Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 0.196, year: 2013 http://chemicke-listy.cz/docs/full/2013_11_856-861.pdf
Ultravysokomolekulární polyethylen pro kloubní náhrady se zvýšenou životností
Czech Academy of Sciences Publication Activity Database
Šlouf, Miroslav; Vacková, Taťana; Nevoralová, Martina; Mikešová, Jana; Dybal, Jiří; Pilař, Jan; Zhigunov, Alexander; Kotek, Jiří; Kredatusová, Jana; Fulín, P.
2013-01-01
Roč. 107, č. 10 (2013), s. 783-790 ISSN 0009-2770 R&D Projects: GA TA ČR TA01011406; GA MZd NT12229 Institutional support: RVO:61389013 Keywords : ultrahigh molecular weight polyethylene * total joint replacements * wear Subject RIV: FI - Traumatology, Orthopedics Impact factor: 0.196, year: 2013 http://www.chemicke-listy.cz/common/article-vol_107-issue_10-page_783.html
REMEDIACE OBLASTÍ TĚŽBY URANU V ČESKÉ REPUBLICE
Czech Academy of Sciences Publication Activity Database
Petrová, Šárka; Soudek, Petr; Vaněk, Tomáš
2013-01-01
Roč. 107, č. 4 (2013), s. 283-291 ISSN 0009-2770 R&D Projects: GA MŠk(CZ) LH11048 Institutional research plan: CEZ:AV0Z50380511 Keywords : NATURAL URANIUM * RA-226 * RADIONUCLIDES Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides Impact factor: 0.196, year: 2013 http://www.chemicke-listy.cz/docs/full/2013_04_283-291.pdf
Charakterizácia tuhých disperzií liečiv v polymérnych matriciach pomocou ssNMR spektroskopie
Czech Academy of Sciences Publication Activity Database
Policianová, Olivia; Urbanová, Martina; Kobera, Libor; Brus, Jiří
2013-01-01
Roč. 107, č. 10 (2013), s. 761-768 ISSN 0009-2770 R&D Projects: GA ČR GPP106/11/P426 Institutional support: RVO:61389013 Keywords : solid-state NMR spectroscopy * increasing bioavailability * solid dispersions Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 0.196, year: 2013 http://www.chemicke-listy.cz/common/article-vol_107-issue_10-page_761.html
Reakce organolithných sloučenin s alkalickými alkoxidy, 50 let od objevu superbází
Czech Academy of Sciences Publication Activity Database
Lochmann, L.; Janata, Miroslav
2013-01-01
Roč. 107, č. 10 (2013), s. 777-782 ISSN 0009-2770 R&D Projects: GA ČR GAP106/12/0844 Institutional support: RVO:61389013 Keywords : organic compounds and alkoxides of alkali metals * lithium -heavier alkali metal exchange * superbases Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.196, year: 2013 http://www.chemicke-listy.cz/common/article-vol_107-issue_10-page_777.html
ISSN Exercise & Sport Nutrition Review: Research & Recommendations
Directory of Open Access Journals (Sweden)
Mendel Ron
2004-05-01
Full Text Available Abstract Sport nutrition is a constantly evolving field with literally thousands of research papers published annually. For this reason, keeping up to date with the literature is often difficult. This paper presents a well-referenced overview of the current state of the science related to how to optimize training through nutrition. More specifically, this article discusses: 1. how to evaluate the scientific merit of nutritional supplements; 2. general nutritional strategies to optimize performance and enhance recovery; and, 3. our current understanding of the available science behind weight gain, weight loss, and performance enhancement supplements. Our hope is that ISSN members find this review useful in their daily practice and consultation with their clients.
Role of sperm surface proteins in reproduction
Czech Academy of Sciences Publication Activity Database
Jonáková, Věra; Maňásková, Pavla; Davidová, Nina; Tichá, M.; Pěknicová, Jana
2009-01-01
Roč. 30, Supplement (2009), s. 63-64 ISSN 0196-3635. [9th International Congress of Andrology. 07.03.2009-10.03.2009, Barcelona] R&D Projects: GA MŠk(CZ) 1M06011; GA ČR(CZ) GA523/08/H064; GA ČR(CZ) GA303/06/0895 Institutional research plan: CEZ:AV0Z50520701 Keywords : boar seminal plasma proteins * spermadhesins * proteinase inhibitor * DQH * boar spermatozoa Subject RIV: CE - Biochemistry
Yttrium deposition on mesoporous TiO2: textural design and UV ...
Indian Academy of Sciences (India)
The mesoporous yttrium-doped TiO2 substrates prepared in this research work operate ... bond lengths in the nanoparticles (0.192 and 0.196 nm).18. Additionally ...... Fisicoquímica de Materiales Mesoporosos' (UAM-I CA-31. Fisicoquímica de ...
Flow and turbulence control in a boundary layer wind tunnel using passive hardware devices
Czech Academy of Sciences Publication Activity Database
Kuznetsov, Sergeii; Ribičić, Mihael; Pospíšil, Stanislav; Plut, Mihael; Trush, Arsenii; Kozmar, H.
2017-01-01
Roč. 41, č. 6 (2017), s. 643-661 ISSN 0732-8818 R&D Projects: GA ČR(CZ) GA14-12892S; GA MŠk(CZ) LO1219 Keywords : turbulent flow * atmospheric boundary layer * wind-tunnel simulation * castellated barrier wall * Counihan vortex generators * surface roughness elements * hot-wire measurements Subject RIV: JM - Building Engineering OBOR OECD: Construction engineering, Municipal and structural engineering Impact factor: 0.932, year: 2016 https://link.springer.com/article/10.1007/s40799-017-0196-z
76 FR 2892 - Proposed Subsequent Arrangement
2011-01-18
... concerns the retransfer of 2,536 g of U.S.-origin uranium (11 g U-235) and 27 g of plutonium contained in eight spent fuel rod segments from Nippon Nuclear Fuel Development Co., Ltd in Oarai-machi, Ibaraki-ken... Nippon Nuclear Fuel Development Co., Ltd, will be transferred to Studsvik Nuclear AB for: (a) Pre...
ISSN exercise & sport nutrition review: research & recommendations
2010-01-01
Sports nutrition is a constantly evolving field with hundreds of research papers published annually. For this reason, keeping up to date with the literature is often difficult. This paper is a five year update of the sports nutrition review article published as the lead paper to launch the JISSN in 2004 and presents a well-referenced overview of the current state of the science related to how to optimize training and athletic performance through nutrition. More specifically, this paper provides an overview of: 1.) The definitional category of ergogenic aids and dietary supplements; 2.) How dietary supplements are legally regulated; 3.) How to evaluate the scientific merit of nutritional supplements; 4.) General nutritional strategies to optimize performance and enhance recovery; and, 5.) An overview of our current understanding of the ergogenic value of nutrition and dietary supplementation in regards to weight gain, weight loss, and performance enhancement. Our hope is that ISSN members and individuals interested in sports nutrition find this review useful in their daily practice and consultation with their clients.
ISSN exercise & sport nutrition review: research & recommendations
Directory of Open Access Journals (Sweden)
Mendel Ron
2010-02-01
Full Text Available Abstract Sports nutrition is a constantly evolving field with hundreds of research papers published annually. For this reason, keeping up to date with the literature is often difficult. This paper is a five year update of the sports nutrition review article published as the lead paper to launch the JISSN in 2004 and presents a well-referenced overview of the current state of the science related to how to optimize training and athletic performance through nutrition. More specifically, this paper provides an overview of: 1. The definitional category of ergogenic aids and dietary supplements; 2. How dietary supplements are legally regulated; 3. How to evaluate the scientific merit of nutritional supplements; 4. General nutritional strategies to optimize performance and enhance recovery; and, 5. An overview of our current understanding of the ergogenic value of nutrition and dietary supplementation in regards to weight gain, weight loss, and performance enhancement. Our hope is that ISSN members and individuals interested in sports nutrition find this review useful in their daily practice and consultation with their clients.
Directory of Open Access Journals (Sweden)
Stanislav I. Bezzubov
2016-12-01
Full Text Available We present here synthesis and crystal structure of a neutral IrIII complex, [Ir(C19H13N22(C15H11O2]·2CH2Cl2 or [Ir(C^N2O^O]·2CH2Cl2, where C^N is 1,2-diphenyl-1H-benzimidazole and O^O is 2-benzoyl-1-phenylethenolate. The coordination sphere of the IrIII atom, located on a twofold rotation axis, is that of a slighlty distorted C2N2O2 octahedron, with the N atoms in a trans configuration. In the crystal, complex molecules assemble through weak C—H...π interactions in the range 2.699 (3–2.892 (3 Å. The solvent CH2Cl2 molecules reside in channels aligned along the a axis and are connected to the complex molecules by C—H...O interactions.
In-situ treatment of PCP contaminated soil by electrokinetics-Fenton-biodegradation process
Energy Technology Data Exchange (ETDEWEB)
Yang, G.C.C.; Chen Jenteh [Inst. of Environmental Engineering, National Sun Yat-Sen Univ., Kaohsiung (Taiwan)
2001-07-01
This laboratory investigation was conducted to evaluate the treatment efficiency of a process combining electrokinetic remediation (EK), Fenton process, and biodegradation for treating a pentachlorophenol (PCP) contaminated soil. For EK-Fenton experiments, the results have indicated that an increase of treatment time (e.g., from 10 to 15 days) would substantially increase the overall treatment (i.e., removal and destruction) efficiency of PCP. Only a limited increase of the treatment efficiency would be found if the concentration of FeSO{sub 4} was increased from 0.0196M to 0.098M. When scrap iron power was employed as the catalyst, the residual PCP concentration for soil near the anode end was found to be lower than that of 0.0196M FeSO{sub 4}. But its overall treatment efficiency was only 56.58%, which is lower than 68.34% obtained by using 0.0196M FeSO{sub 4} and 0.35% H{sub 2}O{sub 2}. When H{sub 2}O{sub 2} concentration was further increased to 3.5%, an overall treatment efficiency of 79.77% would be obtained when 0.0196M FeSO{sub 4} was used. When treated by EK-biodegradation process with phenol enrichment bacteria, the overall treatment efficiency of PCP was as low as 25.67%. If PCP contaminated soil was pre-treated by EK-Fenton process and followed by EK-biodegradation, an overall treatment efficiency of 100% was found to be achievable. (orig.)
Gene : CBRC-CINT-01-0196 [SEVENS
Lifescience Database Archive (English)
Full Text Available =Cin.15727 /len=693 0.53 30% MVVAQPFLQLVRRCQRMELDHIVLVLGNILQMVVAQPFLQLVRRCQRMELDHIVLVLGNILQMVVAQPFLQLVRRCQRMELDHI...VLVLGNILQMIVEQPFLQLVPRCQRMELDHIVPVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQPFLQLERRCQRMELDHIVLVLGNILQM...VVEQPFLQLVRRCQRMELDYIVLVLGNILQMVVEQLFLQLVQRCQRMELDHIVLVLGNILQMVVVQPFRQLVRRYQHMEQEQMEQVME ...
Defense AT&L. Volume 42, Number 3, May-June 2013
2013-06-01
dau.mil or by phone to 703-805-2892 or DSN 655-2892. Subscribe/unsubscribe/change of address: Fill out, sign, and mail the postage-free self ...database , which became the authoritative source for tracking status and reporting to the three-star NTM-A/CSTC-A com- mander, and also provided...intrinsic values, such as meaningful work, experience greater happiness than those who esteem extrinsic values like wealth, even when the differences in
Pharmacy (ISSN 2226-4787) — A Journal of Pharmacy Education and Practice
Keith A. Wilson; Yvonne Perrie
2013-01-01
Pharmacy (ISSN 2226-4787) — A journal of pharmacy education and practice is an international scientific open access journal on pharmacy education and practice, and is published by MDPI online quarterly. The practice of pharmacy is changing at an unprecedented rate as the profession moves from a focus upon preparation and supply of medicines to a clinical patient-facing role. While an understanding of the science related to medicines remains core to pharmacy education, the changes in practice ...
Lifescience Database Archive (English)
Full Text Available D09931 Drug Mibampator (USAN/INN) ... C21H30N2O4S2 D09931.gif ... Agitation/aggression associated with Alzh...eimer's disease GRIA [HSA:2890 2891 2892 2893] [KO:K05197 K05198 K05199 K05200] ... CAS: 375345-95-2 PubChem: 135626665 ChEMBL: CHEMBL1277001 LigandBox: D09931 ...
Evaluation of the performance of hydrological variables derived from GLDAS-2 and MERRA-2 in Mexico
Real-Rangel, R. A.; Pedrozo-Acuña, A.; Breña-Naranjo, J. A.
2017-12-01
Hydrological studies have found in data assimilation systems and global reanalysis of land surface variables (e.g soil moisture, streamflow) a wide range of applications, from drought monitoring to water balance and hydro-climatology variability assessment. Indeed, these hydrological data sources have led to an improvement in developing and testing monitoring and prediction systems in poorly gauged regions of the world. This work tests the accuracy and error of land surface variables (precipitation, soil moisture, runoff and temperature) derived from the data assimilation reanalysis products GLDAS-2 and MERRA-2. Validate the performance of these data platforms must be thoroughly evaluated in order to consider the error of hydrological variables (i.e., precipitation, soil moisture, runoff and temperature) derived from the reanalysis products. For such purpose, a quantitative assessment was performed at 2,892 climatological stations, 42 stream gauges and 44 soil moisture probes located in Mexico and across different climate regimes (hyper-arid to tropical humid). Results show comparisons between these gridded products against ground-based observational stations for 1979-2014. The results of this analysis display a spatial distribution of errors and accuracy over Mexico discussing differences between climates, enabling the informed use of these products.
Directory of Open Access Journals (Sweden)
Enis Nadia Md Yusof
2015-04-01
Full Text Available In the title compound, C25H26N2O2S2, the central CN2S2 atoms are almost coplanar (r.m.s. deviation = 0.0058 Å. One phenyl ring clearly lies to one side of the central plane, while the other is oriented in the plane but splayed. Despite the different relative orientations, the phenyl rings form similar dihedral angles of 64.90 (3 and 70.06 (3° with the central plane, and 63.28 (4° with each other. The benzene ring is twisted with respect to the central plane, forming a dihedral angle of 13.17 (7°. The S2C=N, N—N and N—N=C bond lengths of 1.2919 (19, 1.4037 (17 and 1.2892 (19 Å, respectively, suggest limited conjugation over these atoms; the configuration about the N—N=C bond is E. An intramolecular O—H...N hydrogen bond is noted. In the crystal, phenyl–methoxy C—H...O and phenyl–phenyl C—H...π interactions lead to supramolecular double chains parallel to the b axis. These are connected into a layer via methyl–phenyl C—H...π interactions, and layers stack along the a axis, being connected by weak π–π interactions between phenyl rings [inter-centroid distance = 3.9915 (9 Å] so that a three-dimensional architecture ensues.
Report: EPA Improved Its National Security Information Program, but Some Improvements Still Needed
Report #16-P-0196, June 2, 2016. The EPA will continue to improve its national security information program by completing information classification guides that can be used uniformly and consistently throughout the agency.
African Journals Online (AJOL)
HP4510s
Fissse en Bucy, sien Du Toit en Pienaar PER 2011 44-57. 9. Artikel 12.1(1) Criminal Code Act 1995. 10. Artikel 12.1(2) Criminal Code Act 1995. 11. Artikel 12.2 Criminal Code Act 1995. 12. Clough en Mulhern Prosecution of Corporations 139; Woolf 1997 Crim LJ 259-261; Wilkinson. 2003 Canterbury Law Review 173.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
Table 2. Therapeutic Procedures and Postoperative Recommendations of Patients who Underwent URS for ureteric stone. Procedure. Frequency. Percent. Post-operative recommendation. Frequency. Percent. None. 6. 15.8. Discharge. 24. 63.2. Only J stenting. 9. 23.7. Repeat URS. 2. 5.3. Stone extraction 19. 50. ESWL. 4.
African Journals Online (AJOL)
FIRST LADY
neighbourhood, facilities for the restoration of declining areas as well as the recreation of ... beautification of monuments and structures, and city conservation among others. .... market, convention facility and convention hotels.Zone 2 will ...
African Journals Online (AJOL)
Petra
achieved through the accommodation of diversities of all kinds, granting ..... illiteracy rates through increased and renewed adult education, an increase of TVET ... budget. Table 2 shows a constant increase of education's share of the overall.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
%), Gastritis. (12.6%) and Peptic ulcer disease (duodenal and gastric ulcers) was 6.2%. The malignant conditions (Gastric and Esophageal cancers) contributed to 2.6% . Other less frequent causes of. UGIB were Hiatus hernia (1.8), ...
Volume 7, No. 2 ISSN-2077-3420 December 2015 Determinants of ...
African Journals Online (AJOL)
Maru Shete
2015-12-02
Dec 2, 2015 ... Determinants of the Financial Performance of a Private Commercial. Bank in Ethiopia .... accounting based measures for banks' profitability analysis. ..... Habtamu (2012) argued that the principal profit- making activity of.
African Journals Online (AJOL)
esfourie
To meet this challenge it is necessary to instill skills that ... This article discusses the teaching of first-generation students and how to overcome the existing ... 2.1 Student profile ... higher education, or a student who has a sibling at university. 5.
Volume 7, No. 2 ISSN-2077-3420 December 2015 Causes of ...
African Journals Online (AJOL)
Maru Shete
2015-12-02
Dec 2, 2015 ... The debate in the construction industry on how to minimize or .... contractor, ineffective quality control by the contractor, use of unacceptable .... sample representatives of the total population to assess their view as to why.
Volume 7, No. 2 ISSN-2077-3420 December 2015 Cross-Border ...
African Journals Online (AJOL)
Maru Shete
2015-12-02
Dec 2, 2015 ... As a result, the issue of contraband is attracting the attention of both the ... contrabandists, local business people, customs and revenue authority ...... relation to the degrading moral values and order in the study area. Moreover ...
African Journals Online (AJOL)
US
Chapter 2 Constitution of the Republic of South Africa, 1996. 5 ... tional democracy. But even in ... These factors are, first, the court's exercise of constitu- .... A subsidiary constitutional statute may, in the third place, "extend protection beyond ... public involvement in the legislative and other processes of the Assembly and its.
African Journals Online (AJOL)
FIRST LADY
Okereke, Chinwe - Faculty of Education, Imo State University, Owerri. E-mail: ... students towards discovered eating. A sample of 300 ... disordered eating; they know little about the effects of disordered eating. There is a .... not eat when ill. Item 2 had a low ... consuming fast foods and trying unconventional diets. Their friends.
Volume 7, No. 2 ISSN-2077-3420 December 2015 Causes of ...
African Journals Online (AJOL)
Maru Shete
2015-12-02
Dec 2, 2015 ... project delays, poor customer handling, and unsatisfactory overall performance. The rural ... The inability to complete projects on time and within budget continues to be a chronic problem ... In the process of determining the effect of a delay on the project, the analyst .... characteristics or relationships.
African Journals Online (AJOL)
ecoetzee
change that was brought about when the sentencing court considered Section ..... the duty of the state towards children, places a powerful obligation on the state to act. .... rights of the parents in order to protect the rights of the children. 3.2 .... time of the hearing, was convicted of fraud committed over a period of two years. 80.
Volume 7, No. 2 ISSN-2077-3420 December 2015 Cross-Border ...
African Journals Online (AJOL)
Maru Shete
2015-12-02
Dec 2, 2015 ... contraband trade across the main route from Moyale (border town .... revenue and customs sector, and planned to increase the share of tax ... and social causes of cross border contraband trade have been ... youths are turning towards CBCT as a means of sedentary life and ..... However, this vicious circle.
Physicochemical and antibacterial characterization of ionocity Ag/Cu powder nanoparticles
Energy Technology Data Exchange (ETDEWEB)
Nowak, A., E-mail: ana.maria.nowak@gmail.com [A. Chełkowski Institute of Physics, University of Silesia, Uniwersytecka 4, 40-007 Katowice (Poland); Silesian Center for Education and Interdisciplinary Research, 75 Pułku Piechoty 1A, 41-500 Chorzów (Poland); Szade, J. [A. Chełkowski Institute of Physics, University of Silesia, Uniwersytecka 4, 40-007 Katowice (Poland); Silesian Center for Education and Interdisciplinary Research, 75 Pułku Piechoty 1A, 41-500 Chorzów (Poland); Talik, E. [A. Chełkowski Institute of Physics, University of Silesia, Uniwersytecka 4, 40-007 Katowice (Poland); Zubko, M. [Silesian Center for Education and Interdisciplinary Research, 75 Pułku Piechoty 1A, 41-500 Chorzów (Poland); Institute of Material Science, University of Silesia, 75 Pułku Piechoty 1a, 41-500 Chórzow (Poland); Wasilkowski, D. [Department of Biochemistry, University of Silesia, Jagiellońska 28, 40-032 Katowice (Poland); Dulski, M. [Silesian Center for Education and Interdisciplinary Research, 75 Pułku Piechoty 1A, 41-500 Chorzów (Poland); Institute of Material Science, University of Silesia, 75 Pułku Piechoty 1a, 41-500 Chórzow (Poland); Balin, K. [A. Chełkowski Institute of Physics, University of Silesia, Uniwersytecka 4, 40-007 Katowice (Poland); Silesian Center for Education and Interdisciplinary Research, 75 Pułku Piechoty 1A, 41-500 Chorzów (Poland); and others
2016-07-15
Metal ion in bimetallic nanoparticles has shown vast potential in a variety of applications. In this paper we show the results of physical and chemical investigations of powder Ag/Cu nanoparticles obtained by chemical synthesis. Transmission electron microscopy (TEM) experiment indicated the presence of bimetallic nanoparticles in the agglomerated form. The average size of silver and copper nanoparticles is 17.1(4) nm (Ag) and 28.9(2) nm (Cu) basing on the X-ray diffraction (XRD) data. X-ray photoelectron (XPS) and Raman spectroscopies revealed the existence of metallic silver and copper as well as Cu{sub 2}O and CuO being a part of the nanoparticles. Moreover, UV–Vis spectroscopy showed surface alloy of Ag and Cu while Time of Flight Secondary Ion Mass Spectroscopy (ToF-SIMS) and Energy Dispersive X-ray Spectroscopy (EDX) showed heterogeneously distributed Ag structures placed on spherical Cu nanoparticles. The tests of antibacterial activity show promising killing/inhibiting growth behaviour for Gram positive and Gram negative bacteria. - Highlights: • Ag/Cu nanoparticles were obtained in the powder form. • The average size of nanoparticles is 17.1(4) nm (Ag) and 28.9(2) nm (Cu). • Ag/Cu powder nanoparticle shows promising antibacterial properties.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
value=0.08). Conclusion: ... examination, problem-solve, arrive at a working diagnosis, and outline a plan of management 1, 2. Traditionally, clinical skills have been evaluated by means of multiple choice tests, oral examinations, progressive ...
Effect of structural defects on electronic and magnetic properties of ZrS2 monolayer
Wang, Haiyang; Zhao, Xu; Gao, Yonghui; Wang, Tianxing; Wei, Shuyi
2018-04-01
We aimed at ten configurations of vacancy defects and used the first-principles methods based on density functional theory to research electronic and magnetic properties of ZrS2 monolayer. Results show that the system of two-zirconium vacancy (V2zr) and one Zr atom + one S atom vacancy (V1Zr+1S) can induce to total spin magnetic moment of 0.245μB and 0.196μB, respectively. In addition, three and six S atoms vacancy can induce corresponding system to manifest spin magnetic moment of 0.728μB and 3.311μB, respectively. In S atom vacancy defects, vacancy defects can transform the system from semiconductor to metal, several of the Zr atoms and adjacent S atoms display antiferromagnetism coupling in three apart S atom vacancy defects. Vacancy defects can make the intrisic monolayer ZrS2 transform semiconductor into metal. These results are important for the achievement of spin devices based on ZrS2 semiconductor.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
2005-04-10
Apr 10, 2005 ... J. Gathara1, M. Galukande1, E. Kiguli-Malwadde2 ... The reason for this apparent surge is mostly speculative; presumed change in lifestyle to a .... HBD and breast cancer, cigarette smoking is documented to have an anti ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
This study was aimed at determining the pattern of gastric malignancies in Nigeria, a developing country like and ... Methods: a retrospective study utilizing case-files, histopathology reports and cancer registry data of patients who have .... which are attributed to better living conditions and dietary changes2. Conversely, in ...
ISSN 2073 ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg.
African Journals Online (AJOL)
DELL
A 12 years old girl, first in birth order was brou right clavicular area. The swelling had been not in size gradually as the patient grew up with ag medical, surgical or family history of significa injury. On examination, the patient was of avera middle of right clavicle. The skin over the lum increased with abduction of the right.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
Improper mastication from poorly fitting dentures is present in up to 50% of cases; in fact edentulous patients may be at risk due to inadequate mastication resulting in large boluses of food entering the stomach5,6. Another key element in the development of phytobezoar is gastric stasis induced by gastric surgery2,3.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
This was traumatic and done under anaesthesia and subsequently Fine Needle Biopsy (FNB) was introduced by Guthrie in the United States to diagnose cancer 2, which was later popularized by. Martin and Ellis3.FNB is the most accurate, cost effective and simplest screening test for the rapid diagnosis of breast lumps and ...
ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J.
African Journals Online (AJOL)
DELL
2ENT Unit, Department of Surgery, Lagos University Teaching Hospital. Lagos. 3ENT Department, University ... the occurrence of wax impaction among these school children. the occurrence of wax ... school performance. school performance.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J ...
African Journals Online (AJOL)
Hp 630 Dual Core
Saiful Miah and James Catto. BPH and prostate cancer risk. Indian J Urol 2014; 30(2):. 214 218. 2. De Marzo AM, Platz EA, Sutcliffe S et al. Inflammation in prostate carcinogenesis Nat Rev. Cancer 2007; 7: 256 269. 3. Dennis LK, Lynch CF, Torner JC. Epidemiologic association between prostatitis and prostate cancer.
ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J.
African Journals Online (AJOL)
DELL
One hundred and eighty-seven final year medical students completed the seven final ... best chance of survival. Health ... Ever bled. 41 subjects. Bleed - last 12 months. 27 subjects. No of times within the last 12 months 2-5 times. Nature of ...
ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J.
African Journals Online (AJOL)
DELL
aspiration Fine Needle Techniques in Cytodiagnosis of ... Kobusingye5 found a high incidence of cancer of 19.6% of nodules from histopathology reports at Mulago. ... from the surgical and medical Endocrine units as well as Breast unit. ..... was made in 48.8% of the patients while with ultrasonography it was 82.2%. Other.
MODELING SPECTRAL AND TEMPORAL MASKING IN THE HUMAN AUDITORY SYSTEM
DEFF Research Database (Denmark)
Dau, Torsten; Jepsen, Morten Løve; Ewert, Stephan D.
2007-01-01
An auditory signal processing model is presented that simulates psychoacoustical data from a large variety of experimental conditions related to spectral and temporal masking. The model is based on the modulation filterbank model by Dau et al. [J. Acoust. Soc. Am. 102, 2892-2905 (1997)] but inclu......An auditory signal processing model is presented that simulates psychoacoustical data from a large variety of experimental conditions related to spectral and temporal masking. The model is based on the modulation filterbank model by Dau et al. [J. Acoust. Soc. Am. 102, 2892-2905 (1997...... was tested in conditions of tone-in-noise masking, intensity discrimination, spectral masking with tones and narrowband noises, forward masking with (on- and off-frequency) noise- and pure-tone maskers, and amplitude modulation detection using different noise carrier bandwidths. One of the key properties...
75 FR 2892 - NASA Advisory Council; Science Committee; Meeting
2010-01-19
... NATIONAL AERONAUTICS AND SPACE ADMINISTRATION [Notice (10-003)] NASA Advisory Council; Science...: The National Aeronautics and Space Administration (NASA) announces a meeting of the Science Committee of the NASA Advisory Council (NAC). This Committee reports to the NAC. The Meeting will be held for...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
2016-08-01
Aug 1, 2016 ... Those who present later in life ( 24 36 hours after birth) have a ... Advances in neonatal care have improved survival of early ... Down syndrome (DS) (n 2), inguinal hernia (n 1), Sensorineuralhearing loss (SNHL) (n 1).
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
severe Mitral Valve Regurgitation and severe mixed Mitral Valve Disease. 1,2,3 ... syndrome which has been attributed to the loss of annulo ventricular continuity 4,5,6,7. ..... Rozich JD, Carabello BA, Usher BW, Kratz JM, Bell AE, Zile MR.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
In the United States studies have shown that at least 26 million working. Americans suffer lower back pain annually.2 with an estimated annual productivity loss of U 28 billion annually3. ... Male to Female sex ratio was 1:3. Nursing officers ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
These cancers of the bile ducts are rare: 1 2 cases/100.000 inhabitants in ... Teaching Hospital (UTH) including all patients undergoing surgery for cholangiocarcinoma. Authors ... Plain Xrays: Right lung basal infiltration, Raised rightt diaphragm;. Enlarged .... distant deposit and performed surgery was assumed palliative.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
2016-08-01
Aug 1, 2016 ... Congenital Diaphragmatic Hernia Outcomes in East frica: The Ethiopian Experience. Miliard Derbew ... One child was diagnosed with congenital pulmonary airway malformation (CPAM). In total, 10 (83.3%) of our patients were initially misdiagnosed. Only one patient .... Superficial Surgical Site infection. 2.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
A 65 year old para 3 1 known hypertensive and type II diabetic female patient ... the outline of the right kidney was clearly visualised in the appropriate position, the left kidney .... http://www.jsnm.org/files/paper/anm/ams196/ANM19 6 11.pdf. 2.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...
African Journals Online (AJOL)
Hp 630 Dual Core
tissues are separated from the fascia superficial to the underlying musculature1. This injury typically occurs following high speed trauma. The shear injury disrupts perforating vessels and lymphatics and creates a potential space that fills with blood, serosanguinous fluid, and necrotic fat2. Lesions may be missed at initial ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...
African Journals Online (AJOL)
Hp 630 Dual Core
respiratory tract infection (RTI) following endotracheal intubation relates to clinical or radiographic ... In Africa, hospital wide HAI prevalence varies between 2.5% and 14.8% in Algeria, Burkina. Faso, Senegal and ... in children in Mulago National referral hospital to be 20.7% with an associated phlebitis rate of. 17.4% on the ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...
African Journals Online (AJOL)
Hp 630 Dual Core
woman should be counselled to report at the earliest in next pregnancy to rule out ectopic gestation as delay can be disastrous for fertility and her life. References. 1. Tulandi T. Reproductive performance of women after two tubal ectopic pregnancies. ЗФЦЛО ХЦЗФЛО 1988; 50:164. 2. Adelusi B, AL Meshari A, Akande EO, ...
Nitrogen heteroaromatic cations by [2+2+2] cycloaddition
Czech Academy of Sciences Publication Activity Database
Čížková, Martina; Kolivoška, Viliam; Císařová, I.; Šaman, David; Pospíšil, Lubomír; Teplý, Filip
2011-01-01
Roč. 9, č. 2 (2011), s. 450-462 ISSN 1477-0520 R&D Projects: GA ČR GA203/09/1614; GA ČR GA203/09/0705; GA MŠk OC 140 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z40400503 Keywords : modular synthesis * N-heteroaromatic cation * [2+2+2] cycloaddition Subject RIV: CC - Organic Chemistry Impact factor: 3.696, year: 2011
Czech Academy of Sciences Publication Activity Database
Sobechko, I.; Chetverzhuk, Y.; Horak, Y.; Serheyev, V.; Kochubei, V.; Velychkivska, Nadiia
2017-01-01
Roč. 11, č. 2 (2017), s. 131-137 ISSN 1996-4196 Institutional support: RVO:61389013 Keywords : enthalpy of solution * entropy of solution * enthalpy of mixing Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science
Liking a tough teacher : Interpersonal characteristics of teaching and students’ achievement goals
Mainhard, Tim
2015-01-01
Many have claimed, but only some have shown, that the social nature of teaching and classrooms is likely to have a direct effect on students’ achievement goals. This study examined the extent to which Dutch secondary school students’ (N = 2892) achievement goals were related to the interpersonal
On the “compositional threshold“ in GeS2-Sb2S3, GeSe2-Sb2Se3 and GeS2-Bi2S3 glasses
Czech Academy of Sciences Publication Activity Database
Tichý, Ladislav; Tichá, H.
2015-01-01
Roč. 152, 15 February (2015), s. 1-3 ISSN 0254-0584 Institutional support: RVO:61389013 Keywords : chalcogenide glasses * hetero three atom linkages * eutectic compositon Subject RIV: CA - Inorganic Chemistry Impact factor: 2.101, year: 2015
October, 2009 ISSN 1994-9057 (Print) ISSN 2070-0083
African Journals Online (AJOL)
Nekky Umera
Biology, Chemistry and Economics in 2004, 2005, 2006 and 2007 were obtained. ... questions across the levels of the cognitive domain is concerned, WAEC and. NECO are ... in the process of collecting and packaging of the answer scripts. Following ... in this study, Olatunji used her own model of the levels of the cognitive.
January, 2010 ISSN 1994-9057 (Print) ISSN 2070-0083
African Journals Online (AJOL)
FIRST LADY
and Occupation. The issues raised, amongst others were promotion of non- ..... refer to social pressures that steer girls and young women towards career in traditionally ... productive resources and inadequate sharing of family responsibilities,.
January, 2010 ISSN 1994-9057 (Print) ISSN 2070-0083
African Journals Online (AJOL)
FIRST LADY
Technical and Vocational Education for a Future World of. Work (Pp ... The Nigeria's educational system during the colonial era was literal in nature and ..... Teachers at the primary school level should use the activity approach to provide for the ...
Czech Academy of Sciences Publication Activity Database
Šimková, Ludmila; Liška, F.; Ludvík, Jiří
2011-01-01
Roč. 15, č. 17 (2011), s. 2983-2995 ISSN 1385-2728 R&D Projects: GA ČR GAP206/11/0727; GA MŠk ME09002 Institutional research plan: CEZ:AV0Z40400503 Keywords : 1,1-diamino-2,2-dinitroethene * FOX-7 * DADNE Subject RIV: CG - Electrochemistry Impact factor: 3.064, year: 2011
Birnbaum, G.; Freitag, J.; Brauner, R.; König-Langlo, G.; Schulz, E.; kipfstuhl, J.; Oerter, H.; Reijmer, C.H.; Schlosser, E.; Faria, S.H.; Ries, H.; Loose, B.; Herber, A.; Duda, M. G.; Powers, J. G.; Manning, K. W.; van den Broeke, M.R.
2010-01-01
Analyses of shallow cores obtained at the European Project for Ice Coring in Antarctica (EPICA) drilling site Kohnen station (758000 S, 008040 E; 2892ma.s.l.) on the plateau of Dronning Maud Land reveal the presence of conserved snow dunes in the firn. In situ observations during three dune
1991-09-30
0196 or 413 545-0720 PI E-mail Address: krithi@nirvan.cs.umass.edu, stankovic(ocs.umass.edu Grant or Contract Title: Dependable Real - Time Systems Grant...Dependable Real - Time Systems " Grant or Contract Number: N00014-85-k-0398 L " Reporting Period: 1 Oct 87 - 30 Sep 91 , 2. Summary of Accomplishments ’ 2.1 Our...in developing a sound approach to scheduling tasks in complex real - time systems , (2) developed a real-time operating system kernel, a preliminary
Somekawa, Toshihiro; Fujita, Masayuki
2018-04-01
We examined the applicability of Raman spectroscopy as a laser remote sensing tool for monitoring CH4 in water. The Raman technique has already been used successfully for measurements of CO2 gas in water. In this paper, considering the spectral transmittance of water, third harmonics of Q-switched Nd:YAG laser at 355 nm (UV region) was used for detection of CH4 Raman signals. The Raman signal at 2892 cm-1 from CH4 dissolved in water was detected at a tail of water Raman signal.
Czech Academy of Sciences Publication Activity Database
Buixaderas, Elena; Anghel, M.; Atkinson, I.; Simon, P.; Bratan, V.; Petrescu, S.
2015-01-01
Roč. 41, 2B (2015), s. 2680-2689 ISSN 0272-8842 Institutional support: RVO:68378271 Keywords : powders * composites * spectroscopy * optical properties Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.758, year: 2015
Research Paper ISSN 0189-6016©2009
African Journals Online (AJOL)
Rats were housed in individual cages at a 12 hr light/dark cycle and received food ... MgSO4 1.3, KH2PO4 1.2, NaH2CO3 25, CaCl2 2.5, glucose 7). .... peripheral neurons similar to amphetamine (Kalix, 1992) increases in blood pressure and ...
Novel complexes of Co2+, Ni2+, and Cu2+ with N-(phosphonomethyl)aminosuccinic acid
Czech Academy of Sciences Publication Activity Database
Trunova, O. K.; Shovkova, G. V.; Gerasimchuk, A. I.; Večerníková, Eva; Bezdička, Petr; Šubrt, Jan
2014-01-01
Roč. 115, č. 1 (2014), s. 697-706 ISSN 1388-6150 Institutional support: RVO:61388980 Keywords : Carboxyphosphonate * N-(phosphonomethyl)aminosuccinic acid * Thermal decomposition Subject RIV: CA - Inorganic Chemistry Impact factor: 2.042, year: 2014
Preparation of TiO2-SiO2 composite photocatalysts for environmental applications
Czech Academy of Sciences Publication Activity Database
Paušová, Š.; Krýsa, J.; Jirkovský, Jaromír; Prevot, V.; Mailhot, G.
2014-01-01
Roč. 89, č. 8 (2014), s. 1129-1135 ISSN 0268-2575 Institutional support: RVO:61388955 Keywords : photocatalysis * TiO2/SiO2 * composite Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.349, year: 2014
Czech Academy of Sciences Publication Activity Database
Makrlík, E.; Böhm, S.; Sýkora, D.; Klepetářová, B.; Vaňura, P.; Polášek, Miroslav
2015-01-01
Roč. 642, DEC 2015 (2015), s. 39-42 ISSN 0009-2614 Grant - others:GA MŠk(CZ) 20/2015 Institutional support: RVO:61388955 Keywords : cation–π interaction * thallium cation * [2.2.2]paracyclophane Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.860, year: 2015
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
collection, storage, processing, transmission and presentation of information in multiple ... IAC uses the popular internet to provide wireless communication between .... supply from the grid (if available) and uses the “stored” energy provided by ...
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
hinged on extension services by helping farmers to identify, analyze and link with research on their production problems. They also create awareness on opportunities for improvement of farm yields leading to increased income and better standard of living (Van den ban and. Hawkins, 1998; Balantyne and Bokre, 2003).
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
aged between 41 – 50 years and their mean age was 40 years. A greater ... access to credit, agricultural information and market as well as rural ..... Utilizing Research Findings to Increase Food Production: What the mass media should do in ...
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
Agriculture is the backbone of Nigeria's economy, despite being a leading producer of oil in the African ..... book amongst other requirements of the implementing agency makes the whole process unpleasant and ... References. Adebo, S.
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
Federal College of Education Technical, Bichi, Kano State ... promises the creation of over 3.5 million jobs to young people and women across the country .... adopted to give the youth a chance to air their views, share their experiences on agriculture .... Delta Central Agricultural Zone: Challenges to agricultural extension ...
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
(iv) provision of social infrastructure to enhance living conditions in the rural villages (FRN,. 1976). However ... LG autonomy such as making direct allocation to LG without passing through state government. .... Advertisement fees. Grants on ...
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
Improving Farmers' Efficiency in Rice Production In Nigeria: The ... efficiency in agriculture and existing knowledge gap, the study was aimed to assess ... major crops grown in the State include rice, maize, millet, cowpea, groundnut and.
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
for farmers to use mobile phone effectively for extension communication, all the constraints ... Globally, traditional agricultural extension systems are in .... procurement and marketing of farm produce information were particularly perceived by.
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
Policies that encouraged that promote diversification of income sources ... employment opportunities, source of revenue to the government (tax and ... The importance of livestock cannot be over-emphasised, considering the role they play in.
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
their outputs to consumers in the open markets. Most (56%) of them used manual ... income generating opportunities are needed to support the millions of poor families who can no longer support their ... consists of four local government areas, namely Akwanga, Wamba, Kokona and Nasarawa-. Eggon with the zonal office ...
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
National Agricultural Extension Research Liaison Services (NAERGLS), ... agricultural extension, the organization is meant to serve the extension, ... farm families ratio, extension agents (EAs) training, and the likely causes of the problem.
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
respondents accessed information on Poultry management techniques and marketing during ... It creates business opportunity for entrepreneurs and provides employment. ... Idachaba (2004) advocated a focus on small-scale farmers ... challenges and risks resulting from the opening of the economies to international.
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
effects and the actions are bound to be accompanied with desirable and or ... it is being used as a tool for dealing with complexity in planning, monitoring ... or short-term project and outcomes when associated with changing status of humans in ... of approximately 30 million people as of 2005, accounting for more than 23% ...
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
management staff (head of department agriculture) and five (5) field staff from other cadres were ..... Inadequate budget allocation to agricultural departments. 3.47*. 0.724 ... Lack of quick or immediate cash return from most agricultural projects.
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
technology facilities that will enhance the dissemination of information. In Nigeria today, the ... For example, the agricultural transformation agenda (ATA) of the ... Based on the importance of mobile phone in information dissemination, this ...
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
The inefficiency of extension service in passing information to farmers is extremely difficult due to the ... It is hoped that information and communication technologies (ICTs) will provide both “new and unique ..... Revolution?”InfoDev Working ...
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
Agricultural extension in Turkey, Communication for extension Development. Introduction. Agricultural extension ... “communication for development” (C4D) strategy for addressing human dimension concerns, such as ... A Pearson. Correlation ...
Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...
African Journals Online (AJOL)
ONIKOYI
Place of the Freedom of Information Act in Promoting Agricultural. Extension under the .... information-sharing and joint decision-making. The terms ..... public opinion, to hold leaders to account and to feed into decision-making processes. This,.
Czech Academy of Sciences Publication Activity Database
Vojtíšek, P.; Rohovec, Jan
2006-01-01
Roč. 71, č. 2 (2006), s. 264-278 ISSN 0010-0765 Institutional research plan: CEZ:AV0Z30130516 Keywords : x-ray diffraction * lanthanoids * lanthanide complexes * erbium * stereochemistry Subject RIV: DD - Geochemistry Impact factor: 0.881, year: 2006
Research Paper ISSN 0189-6016©2009
African Journals Online (AJOL)
AJTCAM
They were randomized into six groups of six rats each. Food was withdrawn 24 hrs and water 2hr before the commencement of experiment (Alphin and Ward, 1967). Group 1 (control) received only indomethacin (Sigma, 60mg/kg p.o. dissolved in 5% Na2Co3); Groups 2- 4 were pretreated with Lasianthera africana extract ...
Conductivity study on GeS2-Ga2S3-AgI-Ag chalcohalide glasses
Czech Academy of Sciences Publication Activity Database
Ren, J.; Yan, Q.; Wágner, T.; Zima, Vítězslav; Frumar, M.; Frumarová, Božena; Chen, G.
2013-01-01
Roč. 114, č. 2 (2013), 023701_1-023701_5 ISSN 0021-8979 Institutional support: RVO:61389013 Keywords : chalcogenide glasses * conductivity Subject RIV: CA - Inorganic Chemistry Impact factor: 2.185, year: 2013
Fluidized Bed Incineration of Sewage Sludge in O2/N2 and O2/CO2 Atmospheres.
Czech Academy of Sciences Publication Activity Database
Moško, Jaroslav; Pohořelý, Michael; Zach, Boleslav; Svoboda, Karel; Durda, Tomáš; Jeremiáš, Michal; Šyc, Michal; Václavková, Šárka; Skoblia, S.; Beňo, Z.; Brynda, Jiří
2018-01-01
Roč. 32, č. 2 (2018), s. 2355-2365 ISSN 0887-0624 R&D Projects: GA TA ČR TE02000236 Institutional support: RVO:67985858 Keywords : carbon dioxide * chemical reactors * combustion Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use OBOR OECD: Energy and fuels Impact factor: 3.091, year: 2016
Substituent Effects Dehalogenation of Aryl Bromides with NaAlH2(OCH2CH2OCH3)2
Czech Academy of Sciences Publication Activity Database
Czakoová, Marie; Hetflejš, Jiří; Včelák, Jaroslav
2001-01-01
Roč. 72, č. 2 (2001), s. 277-287 ISSN 0133-1736 R&D Projects: GA ČR GA203/97/1173 Institutional research plan: CEZ:AV0Z4072921 Keywords : substituent effects * aryl bromides * Co-assisted debromination Subject RIV: CC - Organic Chemistry Impact factor: 0.475, year: 2001
Local theory for 2-functors on path 2-groupoids
Czech Academy of Sciences Publication Activity Database
Schreiber, Urs; Waldorf, K.
2017-01-01
Roč. 12, č. 3 (2017), s. 617-658 ISSN 2193-8407 Institutional support: RVO:67985840 Keywords : smooth paths * fundamental 2-grupoid * descent theory Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.456, year: 2016 https://link.springer.com/article/10.1007%2Fs40062-016-0140-4
2015-10-01
AWARD NUMBER: W81XWH-08-2-0196 TITLE: Reintegrating Troops with Mild Traumatic Brain Injury (mTBI) into Their Communities: Understanding the...REPORT TYPE Final 3. DATES COVERED (From - To) 4. TITLE AND SUBTITLE 5a. CONTRACT NUMBER Reintegrating troops with mild traumatic brain injury...n=6), TBI (n=12), PTSD (n=7), and dual diagnosis (TBI/PTSD) n=19. Additional comparisons were made between 28 Family /Friends matched to their SMs
Rwanda Journal ISSN 2305-2678 (Print); ISSN 2305- 5944 (Online ...
African Journals Online (AJOL)
Education
Rwanda Journal, Series B: Social Sciences, Volume 4 No 1, 2017 33. Rwanda Journal .... The print media, the political parties manifestos, the official reports ..... and of psychological alienation from taboos by which it was surrounded by the ...
Rwanda Journal ISSN 2305-2678 (Print); ISSN 2305- 5944 (Online ...
African Journals Online (AJOL)
Education
emotional organizational commitment and the job satisfaction and that association is stronger with ..... refers to the motivational aspect of the human resource management, i.e. with the release of a latent energy or the activation of a potential.
Rwanda Journal ISSN 2305-2678 (Print); ISSN 2305- 5944 (Online ...
African Journals Online (AJOL)
Education
Rwanda Journal, Series B: Social Sciences, Volume 4 No 1, 2017 62. Rwanda Journal ... constitution of men is different from that of women and that men are unable to ... share the same biological disposition driving sexual behaviors, then all could be ... gender roles (Brannon 1985; Brannon & Juni 1984), negative attitudes ...
(5), October, 2009 ISSN 1994-9057 (Print) ISSN 2070-0083
African Journals Online (AJOL)
Nekky Umera
The study investigated the feeding habit and problems of the aged people in ... sample comprised of 150 elderly men and women from various occupational groups. ... accumulated wealth and so in poor position to maintain their standard of ... between 65-70 years. Twelve percent of them were between 71-75 years. The.
Genotoxicity evaluation of two kinds of smoke-water and 3,7-dimethyl-2H-furo[2,3-c]pyran-2-one
Czech Academy of Sciences Publication Activity Database
Trinh, C.; Gevaert, L.; Kohout, Ladislav; van Staden, J.; Verschaeve, L.
2010-01-01
Roč. 30, č. 6 (2010), s. 596-602 ISSN 0260-437X Institutional research plan: CEZ:AV0Z40550506 Keywords : butenolide * smoke -water * 3,7-dimethyl-2H-furo[2,3-c]pyran-2-one * assay * seed germination Subject RIV: CC - Organic Chemistry Impact factor: 2.322, year: 2010
Measurement of radiative widths of a(2)(1320) and pi(2)(1670)
Czech Academy of Sciences Publication Activity Database
Adolph, C.; Akhunzyanov, R.; Alekseev, M.; Alexeev, G. D.; Amoroso, A.; Andrieux, V.; Anosov, V. A.; Austregisilio, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Beck, R.; Bedfer, Y.; Berlin, A.; Bernhard, J.; Bicker, K.; Bieling, J.; Birsa, R.; Bisplinghoff, J.; Bodlak, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Büchele, M.; Burtin, E.; Capozza, L.; Chiosso, M.; Chung, S.U.; Cicuttin, A.; Crespo, M.; Curiel, Q.; Dalla Torre, S.; Dasgupta, S. S.; Dasgupta, S.; Denisov, O.; Donskov, S.; Doshita, N.; Duic, V.; Dünnweber, W.; Dziewiecki, M.; Efremov, A.V.; Elia, C.; Eversheim, P.; Eyrich, W.; Faessler, M.; Ferrero, A.; Filin, A.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Fresne von Hohenesche, N.; Friedrich, J.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O.; Gerassimov, S.; Geyer, R.; Gnesi, I.; Gobbo, B.; Goertz, S.; Gorzellik, M.; Grabmüller, S.; Grasso, A.; Grube, B.; Guskov, A.; Guthörl, T.; Haas, F.; von Harrach, D.; Hahne, D.; Hashimoto, R.; Heinsius, F.; Herrmann, F.; Hinterberger, F.; Höppner, Ch.; Horikawa, N.; d'Hose, N.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jary, V.; Jasinski, P.; Joerg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G.; Khokhlov, Y.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koivuniemi, J.; Kolosov, V.; Kondo, K.; Königsmann, K.; Konorov, I.; Konstantinov, V.; Kotzinian, A.; Kouznetsov, O.; Král, Z.; Krämer, M.; Kroumchtein, Z.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R. P.; Lednev, A.; Lehmann, A.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makke, N.; Mallot, G.; Marchand, C.; Martin, A.; Marzec, J.; Matoušek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Y.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neubert, S.; Neyret, D.; Nikolaenko, V.; Nový, J.; Nowak, W. D.; Nunes, A.S.; Orlov, I.; Olshevsky, A.; Ostrick, M.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Pešek, M.; Platchkov, S.; Pochodzalla, J.; Polyakov, V.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Reicherz, G.; Rocco, E.; Rychter, A.; Rossiyskaya, N. S.; Ryabchikov, D.; Samoylenko, V.; Sandacz, A.; Sarkar, S.; Savin, I.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schlütter, T.; Schmidt, A.; Schmidt, K.; Schmiden, H.; Schönning, K.; Schopferer, S.; Schott, M.; Shevchenko, O.; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sosio, S.; Sozzi, F.; Srnka, Aleš; Steiger, L.; Stolarski, M.; Sulc, M.; Sulej, R.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Ter Wolbeek, J.; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Uhl, S.; Uman, I.; Vandenbroucke, M.; Virius, M.; Vondra, J.; Wang, L.; Weisrock, T.; Wilfert, M.; Windmolders, R.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.
2014-01-01
Roč. 50, č. 4 (2014), 79:1-19 ISSN 1434-6001 R&D Projects: GA MŠk(CZ) LO1212 Keywords : radiative width * a(2)(1320) meson * (pi2)(1670) meson * Primakoff reaction Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.736, year: 2014
The elasticity of demand for gasoline in China
International Nuclear Information System (INIS)
Lin, C.-Y. Cynthia; Zeng, Jieyin
2013-01-01
This paper estimates the price and income elasticities of demand for gasoline in China. Our estimates of the intermediate-run price elasticity of gasoline demand range between −0.497 and −0.196, and our estimates of the intermediate-run income elasticity of gasoline demand range between 1.01 and 1.05. We also extend previous studies to estimate the vehicle miles traveled (VMT) elasticity and obtain a range from −0.882 to −0.579. - highlights: • The price elasticity of demand for gasoline in China is between −0.497 and −0.196. • The income elasticity of demand for gasoline in China is between 1.01 and 1.05. • The price elasticity of demand for VMT in China is between −0.882 and −0.579
Czech Academy of Sciences Publication Activity Database
Šantavá, Eva; Vejpravová, J.; Honda, F.; Komatsubara, T.; Sechovský, V.
2007-01-01
Roč. 310, - (2007), e586-e588 ISSN 0304-8853 Institutional research plan: CEZ:AV0Z10100520 Keywords : CeT 2 Si 2 * magnetic phase transition * magnetization * specific heat Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.704, year: 2007
177, 2014. ISSN:1998-0507 Submitted
African Journals Online (AJOL)
Osondu
2013-11-26
Nov 26, 2013 ... reduced from 11.2mg/l to 4.37mg/l, Chemical Oxygen Demand ... It effectively depleted the nutrients present in the sewage, by the 4th ... that purification potential of water hyacinth is related to plants population with ... the function of bioremediation are known as ... observed that rates of N and P uptake were.
Raman spectra of TeO2-PbCl2 glasses
Czech Academy of Sciences Publication Activity Database
Ležal, Dimitrij; Bludská, Jana; Horák, J.; Sklenář, A.; Karamazov, S.; Vlček, M.
2002-01-01
Roč. 43, č. 6 (2002), s. 296-299 ISSN 0031-9090 Institutional research plan: CEZ:AV0Z4032918 Keywords : tellurite glasses * TeO2glass * model Subject RIV: CA - Inorganic Chemistry Impact factor: 0.691, year: 2002
In 3+-doped TiO 2 and TiO 2/In 2S 3 Nanocomposite for photocatalytic and stoichiometric degradations
Czech Academy of Sciences Publication Activity Database
Štengl, Václav; Opluštil, F.; Němec, T.
2012-01-01
Roč. 88, č. 2 (2012), s. 265-276 ISSN 0031-8655 R&D Projects: GA MPO FI-IM5/231 Institutional research plan: CEZ:AV0Z40320502 Keywords : WARFARE AGENTS * HOMOGENEOUS HYDROLYSIS * OPTICAL-PROPERTIES Subject RIV: CA - Inorganic Chemistry Impact factor: 2.287, year: 2012
2013-12-19
... FURTHER INFORMATION CONTACT: Austin Redington at (202) 482-1664 or Nancy Decker at (202) 482-0196, AD/CVD... determinations is now March 17, 2014, the next business day. This notice is issued and published pursuant to...
IL-2/anti-IL-2 mAb immunocomplexes: A renascence of IL-2 in cancer immunotherapy?
Czech Academy of Sciences Publication Activity Database
Tomala, Jakub; Kovář, Marek
2016-01-01
Roč. 5, č. 3 (2016), e1102829 ISSN 2162-402X R&D Projects: GA ČR GA13-12885S; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : Anti-IL-2 mAb * cancer immunotherapy * IL-2 Subject RIV: EE - Microbiology, Virology Impact factor: 7.719, year: 2016
Electrochemical investigation of 2,2-dinitroethene-1,1-diamine (FOX-7) in aqueous media
Czech Academy of Sciences Publication Activity Database
Šimková, Ludmila; Klíma, Jiří; Sazama, Petr; Ludvík, Jiří
2011-01-01
Roč. 15, č. 10 (2011), s. 2133-2139 ISSN 1432-8488 R&D Projects: GA MŠk ME09002 Institutional research plan: CEZ:AV0Z40400503 Keywords : 2,2-dinitroethene-11-diamine * FOX -7 * reduction Subject RIV: CG - Electrochemistry Impact factor: 2.131, year: 2011
Czech Academy of Sciences Publication Activity Database
Míčová, P.; Hahnová, K.; Hlaváčková, Markéta; Elsnicová, B.; Chytilová, Anna; Holzerová, Kristýna; Žurmanová, J.; Neckář, Jan; Kolář, František; Nováková, Olga; Novotný, J.
2016-01-01
Roč. 423, 1-2 (2016), s. 151-163 ISSN 0300-8177 R&D Projects: GA ČR(CZ) GA13-10267S Institutional support: RVO:67985823 Keywords : heart * hypoxia * ischemia/reperfusion * phospholipase A2 * cyclooxygenase 2 * beta-adrenoceptor * MAPK Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 2.669, year: 2016
Selective effects of H2O2 on cyanobacterial photosynthesis
Czech Academy of Sciences Publication Activity Database
Drábková, Michaela; Matthijs, H. C. P.; Admiraal, W.; Maršálek, Blahoslav
2007-01-01
Roč. 45, č. 3 (2007), s. 363-369 ISSN 0300-3604 Grant - others:-(XE) EVK2-CT-2002-57004 Institutional research plan: CEZ:AV0Z60050516 Keywords : hydrogen peroxide * cyanobacteria * photosynthesis Subject RIV: EF - Botanics Impact factor: 0.976, year: 2007
Crystallization processes in Ge2Sb2Se4Te glass
Czech Academy of Sciences Publication Activity Database
Svoboda, R.; Bezdička, Petr; Gutwirth, J.; Malek, J.
2015-01-01
Roč. 61, JAN (2015), s. 207-214 ISSN 0025-5408 Institutional support: RVO:61388980 Keywords : Chalcogenides * Glass es * Differential scanning calorimetry (DSC) * X-ray diffraction * Crystal structure Subject RIV: CA - Inorganic Chemistry Impact factor: 2.435, year: 2015
Czech Academy of Sciences Publication Activity Database
Soltani, A.; Ghari, F.; Khalaji, A.D.; Lemeski, E.T.; Fejfarová, Karla; Dušek, Michal; Shikhi, M.
2015-01-01
Roč. 139, Mar (2015), s. 271-278 ISSN 1386-1425 Grant - others:AV ČR(CZ) Praemium Academiae Keywords : Schiff base * single crystal structure analysis * DFT * Electronic properties Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.653, year: 2015
Czech Academy of Sciences Publication Activity Database
Fábry, Jan; Havlák, Lubomír; Dušek, Michal; Vaněk, Přemysl; Drahokoupil, Jan; Jurek, Karel
2014-01-01
Roč. 70, Part 2 (2014), s. 360-371 ISSN 0108-7681 R&D Projects: GA ČR(CZ) GAP204/11/0809; GA TA ČR TA01011017 Institutional support: RVO:68378271 Keywords : alkaline rare-earth sulfides * structure analysis * crystal chemistry Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.184, year: 2014
The first disease connection for Ca(v)2.2 channels
Czech Academy of Sciences Publication Activity Database
Weiss, Norbert
2015-01-01
Roč. 34, č. 3 (2015), s. 217-219 ISSN 0231-5882 R&D Projects: GA ČR GA15-13556S; GA MŠk 7AMB15FR015 Institutional support: RVO:61388963 Keywords : calcium channel * Ca(v)2.2 channel * channelopathies * myoclonus-dystonia syndrome Subject RIV: CE - Biochemistry Impact factor: 0.892, year: 2015
Optimization of CeO2-ZrO2 mixed oxide catalysts for ethyl acetate combustion
Czech Academy of Sciences Publication Activity Database
Dimitrov, M.; Ivanova, R.; Štengl, Václav; Henych, Jiří; Kovacheva, D.; Tsoncheva, T.
2015-01-01
Roč. 47, č. 1 (2015), s. 323-329 ISSN 0324-1130 Institutional support: RVO:61388980 Keywords : nanosized CeO2-ZrO2 * mixed oxide phase * ethyl acetate combustion Subject RIV: CA - Inorganic Chemistry Impact factor: 0.229, year: 2015
Czech Academy of Sciences Publication Activity Database
Valeš, V.; Poltierová Vejpravová, J.; Holý, V.; Tyrpekl, Václav; Brázda, P.; Doyle, S.
2010-01-01
Roč. 7, č. 5 (2010), s. 1399-1404 ISSN 1862-6351 Institutional research plan: CEZ:AV0Z40320502 Keywords : Fe2O3/TiO2 * nanocomposites * structure * phase transition * annealing Subject RIV: CA - Inorganic Chemistry
African Journals Online (AJOL)
FIRST LADY
Obekpa (2001) view child abuse as any condition injurious to physical or emotional health that has been ... defines it as a non-accidental injury inflicted on a child by a parent or guardian. ... potential for or has actually caused serious emotional cognitive, mental or behavioral .... Child abuse and parenting styles in. Nigerian ...
African Journals Online (AJOL)
FIRST LADY
status on voting among Americans by formally modeling the effect of partisan government on ... incentives in deciding who and what party to vote for in any general elections. ... take care of the three lower level needs before making an attempt to meet these needs. .... Priming at the polls: Can polling place location influence ...
African Journals Online (AJOL)
Administrator
core business and primary function of universities. Secondly, HEIs make a .... There is a traditional, liberal theory of the state which argues for a clear ..... interest in the matter to cloud his judgment, or if he is the same person who has reported a ...
African Journals Online (AJOL)
FIRST LADY
GSM: +2348035629290. Folarin, N. A. – Department of banking & Finance, Olabisi Onabanjo ... (1959), argue that the propagation of inflation is the result of incompatible .... The quantitative impact of monetary expansion and exchange rate.
African Journals Online (AJOL)
user
2010-06-10
Jun 10, 2010 ... THE LABOUR APPEAL COURT: COMMENTS ON KYLIE V CCMA 2010 4 SA 383 (LAC). 2011 VOLUME .... In the light of the fact that the employee was a sex worker, the CCMA Commissioner ruled that she did ..... workers are particularly vulnerable and are exposed to exploitation and vicious abuse,. 73.
African Journals Online (AJOL)
allyd
This contribution is based on research undertaken by the author in partial fulfilment of the ... Senior Lecturer, Department of Law, Faculty of. Humanities ..... approach in R v Big M Drug Mart Ltd 1985 50 CCC (3d) 1 (SCC) which was followed by.
African Journals Online (AJOL)
FIRST LADY
Indexed African Journals Online: www.ajol.info. An International ... The roles the classroom teachers would play and the challenges they would have to face in using ... implementation of computer education programme in Nigerian secondary schools. .... Computer has specially designed languages for operations. These are.
African Journals Online (AJOL)
HP4510s
4th UN Conference on LDCs Energy Services″ (Background Paper ..... Human Health, Natural Resources and Ecosystems Centre for International Sustainable ..... The adoption of the NFSD was the first step in mapping out the South African.
African Journals Online (AJOL)
FIRST LADY
within and amongst the institutions for productivity and effectiveness. Keywords: ... a project to link all federal tertiary institutions in a countrywide electronic network named ... full-time, part-time, off-campus and distance education students. ... facilities, substantial online learning resources, inadequate funds and facilities ...
African Journals Online (AJOL)
commission of gross human rights violations resulted in a gradual ... with the growth in prominence of the Zimbabwe Congress of Trade Unions (ZCTU) ...... electronic broadcasting, radio and television that in a modern society the right to.
African Journals Online (AJOL)
UNISA
The Southern African Development Community trade legal instruments compliance .... Cottier and Foltea 'Constitutional Functions of the WTO and Regional Trade ..... a prima facie case that NAFTA met the definition of an FTA under Article ...
African Journals Online (AJOL)
allyd
DETERMINING THE EFFECT (THE SOCIAL COSTS) OF EXCLUSION UNDER THE. SOUTH AFRICAN ... THE SOUTH AFRICAN EXCLUSIONARY RULE: SHOULD FACTUAL GUILT TILT ..... However, in the decision of Thint (Pty) Ltd v National Director of .... Even though the concept of "detriment" involves the making.
African Journals Online (AJOL)
A J Hamman
Because of the high level of credence it enjoys, an attorney's ... attorney's trust account as a bank account into which to deposit criminal proceeds for .... of encompassing attorneys, who head the list of accountable institutions in Schedule 1. For.
African Journals Online (AJOL)
University of the Witwatersrand
will be done by distinguishing the legal position relating to trust law from the law relating to .... imposes upon its bearer a duty to act in the best interest of the person or persons to whom the duty is owed. ..... Register of Internet sources. Cheadle ...
African Journals Online (AJOL)
FIRST LADY
The GSM subscribers on their part also face many problems, major of which is ... GSM revolution, mobile operators forced by fierce competition and market forces .... Many managers regard customers who complain in a negative light. In fact,.
African Journals Online (AJOL)
FIRST LADY
fundamental principles of Art and Design, the intellectual content of art is brought to bear on the .... The year 1915 to 1920 was a landmark in the history ..... Omotayo Aiyegbusi (b.1921-) who trained as a graphic artist in the USA and. Britain in ...
African Journals Online (AJOL)
FIRST LADY
pipe home water, electricity, medical services, regular transportation systems, among others. ... understand his position in the universe and his environment. For instance ... Control of Disease and Maintenance of Good Health: Science and ... may be prevented through early warning signals of troop or aircraft movement, air ...
African Journals Online (AJOL)
FIRST LADY
In this paper, both approaches (the aesthetic and the ethnological) are ... But, African sculptures became known in Europe only from about the end of the .... body', 'arts of the surrounding', and 'autonomous figurative arts'. It is in keeping ... The cultural diversity of the people of Africa inevitably stimulated to a diversity of art ...
African Journals Online (AJOL)
Farhana
... SA 721 (CC). 3 See for example Cullinan 2006 www.health-e.org.za. ... staff at the health care facilities, both in terms of their number and the appropriate .... tools required for efficient service delivery (personal protective equipment and ... also revealed that many clinics 'did not even have such basic supplies as soap'. 53.
African Journals Online (AJOL)
Administrator
The design of standards and the administration of discipline in general often involve an exercise .... administrative action, in order to qualify as just, must satisfy the requirements of ... with enabling legislation and with the rules of common law.
African Journals Online (AJOL)
macuser
intervened in private landlord-tenant relationships in a number of jurisdictions, ... private rental market in order to restrict rent increases and provide security of tenure. ..... 44 In 1914 only one per cent of the housing stock in Britain was council ...
African Journals Online (AJOL)
sauroa
statement of intent and resolve to overcome the burden of history but also an .... consolidated version of the Treaty and all its amendments can be accessed on ...... Financial Support for the Translation of the Content of the SADC Website into.
African Journals Online (AJOL)
FIRST LADY
The GSM subscribers on their part also face many problems, major of which is ... The primary source includes questionnaire and personal interaction. The secondary source ... Consumer/Subscriber Complaints-Implication and Consequences. Keaveney ... customs unpredictable clearance process and bad network of roads.
African Journals Online (AJOL)
Nekky Umera
study employs data from primary and secondary sources and use facility model and ... ports and foot paths); Storage facilities (Silos, Warehouse, cribs, open air .... Hospital, Ado, Dental Headquarters, Ado and Hospital Management Board.
African Journals Online (AJOL)
Camilla Pickles
(as a non-legal subject) on the one hand, and women (as legal subjects) exercising their rights to ... rights, and affect the right to terminate a pregnancy in South Africa. This is reflected ..... to working conditions, detention or armed conflict.
African Journals Online (AJOL)
Ntlamn
transformation it has brought to the development and building of a united South ... leadership in reinforcing the right to gender equality, it has done nothing more than .... left in respect of which the individual could exercise associational rights.
African Journals Online (AJOL)
mnyenti
2012-03-13
Mar 13, 2012 ... protect the rights of those likely to be affected. 4 .... geared towards the promotion of adequate social protection in the region. ..... management of SADC programmes, the implementation of decisions of SADC policy organs and .... services generally purchase a private health insurance policy or contribute ...
African Journals Online (AJOL)
Mark
4 See s A(3) of the Securities Regulation Code in Takeovers and Mergers for a .... relevance, if any, of the solvency and liquidity of the company embarking on a ..... The board must compare the value and the price with the consideration.
African Journals Online (AJOL)
m
the consideration of issues of race, gender and disability will no longer be required of ... racial spoils system" and to result in reverse discrimination. 4 ... inequalities but also to deal with existing inequalities within society - and having a.
African Journals Online (AJOL)
HP4510s
place the question is addressed how a monist or dualist approach regarding the ... humanitarian law, customary international law, and the law and practice of States. ... Law 171 et seq; Boothby 2006 Intervention 244-259; Cohn 1991 IJRL 100-111; ...... as victims because of their emotional, mental and intellectual immaturity.
African Journals Online (AJOL)
New Win User
However, the proposed commercial treatment of traditional knowledge may also have legal consequences for the parties whose transactions have to do with traditional knowledge. One of the legal consequences that always merits attention in the commercial world is the tax liability of such parties, which may be affected by ...
African Journals Online (AJOL)
hmos
paper: Prof Elizabeth Cooke (Law Commission and University of Reading, UK), who facilitated .... hastily signed into force in 2004, an election year, amidst severe criticism. 13. Given its ... Good governance in the private (corporate) and public ..... because of our country's peculiar colonial past, South Africa has a registration.
African Journals Online (AJOL)
Brimer
the context of which is a large body of jurisprudence, standard philosophy ... tension, slip, slide, perish,/Decay with imprecision, will not stay in place,/Will not stay ... fond of the dead language, Latin) and is very obviously still with us today, as is.
African Journals Online (AJOL)
UFS Campus
cellphone or Internet chatrooms, the purpose being to persuade the victim gradually ... information as a form of pressure to obtain an advantage which is not legally due to ... through false promises or other forms of deception and not by forceful ...
African Journals Online (AJOL)
FIRST LADY
evaluation feedback have on the students' performance of cognitive learning tasks in block .... re-examines his achievement in government. To evaluate ... that a student should be graded both in comparison with his own ability and in relation ...
African Journals Online (AJOL)
Louis Harms
DEMYSTIFICATION OF THE INQUISITORIAL SYSTEM ... beloved preconceptions as to how cases should be managed and trials run. Sometimes the police ... into a river. If she floats, it means that the Devil kept her floating and is on her side.
African Journals Online (AJOL)
FIRST LADY
perceptual realists. It must be ... indigenous materials to forge ahead with the creative process. There is also a .... The human figure is often treated in a stylized or .... into series of lines and mass area while using textured ground. This is.
Çelik, Selime; Kayar, Yusuf; Önem Akçakaya, Rabia; Türkyılmaz Uyar, Ece; Kalkan, Kübra; Yazısız, Veli; Aydın, Çiğdem; Yücel, Başak
2015-01-01
It is reported that eating disorders and depression are more common in patients with type 2 diabetes mellitus (T2DM). In this study, we aimed to determine the prevalence of binge eating disorder (BED) in T2DM patients and examine the correlation of BED with level of depression and glycemic control. One hundred fifty-two T2DM patients aged between 18 and 75 years (81 females, 71 males) were evaluated via a Structured Clinical Interview for DSM-IV Axis I Disorder, Clinical Version in terms of eating disorders. Disordered eating attitudes were determined using the Eating Attitudes Test (EAT) and level of depression was determined using the Beck Depression Scale. Patients who have BED and patients who do not were compared in terms of age, gender, body mass index, glycosylated hemoglobin (HbA1c) levels, depression and EAT scores. Eight of the patients included in the study (5.26%) were diagnosed with BED. In patients diagnosed with BED, depression and EAT scores were significantly high (PEAT scores and depression scores (r = +0.196, Pdisordered eating attitudes. Psychiatric treatments should be organized for patients diagnosed with BED by taking into consideration comorbid depression. Copyright © 2015 Elsevier Inc. All rights reserved.
Photocatalytic Decomposition of N2O on Ag-TiO2
Czech Academy of Sciences Publication Activity Database
Kočí, K.; Krejčíková, Simona; Šolcová, Olga; Obalová, L.
2012-01-01
Roč. 191, č. 1 (2012), s. 134-137 ISSN 0920-5861. [International Symposium on Nitrogen Oxides Emission Abatement. Zakopane, 04.09.2011-07.09.2011] R&D Projects: GA ČR GA104/09/0694 Institutional support: RVO:67985858 Keywords : photocatalytic decomposition * N2O * Ag doping * TiO2 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.980, year: 2012
Czech Academy of Sciences Publication Activity Database
Salkeld, A. J.; Reid, M. F.; Wells, J. P. R.; Sanchez-Sanz, Goar; Seijo, L.; Barandiarán, Z.
2013-01-01
Roč. 25, č. 41 (2013), 415504/1-415504/8 ISSN 0953-8984 Institutional support: RVO:61388963 Keywords : crystal-field * transitions * luminescence * lanhanides Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.223, year: 2013
Czech Academy of Sciences Publication Activity Database
Bernatová, Svatoslava; Wichterle, Ivan
2001-01-01
Roč. 189, 1-2 (2001), s. 111-118 ISSN 0378-3812 R&D Projects: GA ČR GA104/99/0136 Institutional research plan: CEZ:AV0Z4072921 Keywords : vapour-liquid equilibrium * experimental data * molar excess volume Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.217, year: 2001
Thermally Tunable Dual Emission of the d8–d8 Dimer [Pt2(μ-P2O5(BF2)2)4]4–
Czech Academy of Sciences Publication Activity Database
Hofbeck, T.; Lam, Y.; Ch.; Kalbáč, Martin; Záliš, Stanislav; Vlček, Antonín; Yersin, H.
2016-01-01
Roč. 55, č. 5 (2016), s. 2441-2449 ISSN 0020-1669 R&D Projects: GA MŠk LH13015; GA MŠk LD14129; GA MŠk LL1301 Grant - others:COST(XE) cm1202 Institutional support: RVO:61388955 Keywords : High-resolution fluorescence * phosphorescence spectra * [Pt2(μ-P2O5(BF2)2)4]4− (Pt(pop-BF2)) Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.857, year: 2016
Czech Academy of Sciences Publication Activity Database
Pavlíček, Jan; Wichterle, Ivan
2012-01-01
Roč. 45, č. 1 (2012), s. 83-89 ISSN 0021-9614 R&D Projects: GA ČR GA104/07/0444 Institutional research plan: CEZ:AV0Z40720504 Keywords : alcohol * ketone * hydrocarbon Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.297, year: 2012
The nature of hydrogen bonding in R-2(2)(8) crystal motifs - a computational exploration
Czech Academy of Sciences Publication Activity Database
Deepa, Palanisamy; Solomon, R. V.; Vedha, S. A.; Kolandaivel, P.; Venuvanalingam, P.
2014-01-01
Roč. 112, č. 24 (2014), s. 3195-3205 ISSN 0026-8976 Institutional support: RVO:61388963 Keywords : NCI plot * hydrogen bonds * R-2(2)(8) motif * organic crystals * NBO * QTAIM analysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.720, year: 2014
Notes on Velleius Book I (2, 1; 6, 1–2; 12, 7; 14, 2; 16, 5; 17, 2)
Czech Academy of Sciences Publication Activity Database
Nývlt, Pavel
-, č. 25 (2015), s. 21-27 ISSN 0567-8269 Institutional support: RVO:67985955 Keywords : Velleius Paterculus * textual criticism * Latin * Roman historiography * Greek history and the Romans * Middle East history and the Romans Subject RIV: AB - History http://www.cupress.cuni.cz/ink2_stat/index.jsp?include=AUC_clanek&id=1702&id=4701&casopis=97&zalozka=1&predkl=60
Purinergní P2X rodina a specifické vlastnosti P2X7 podtypu
Czech Academy of Sciences Publication Activity Database
Jindřichová, Marie; Zemková, Hana
2013-01-01
Roč. 62, č. 2 (2013), s. 40-46 ISSN 1210-6313 R&D Projects: GA ČR(CZ) GPP304/12/P371 Institutional support: RVO:67985823 Keywords : extracellular ATP * purinergic P2X family * P2X7 receptor * cell proliferation and apoptosis Subject RIV: ED - Physiology
2011-11-29
...-1; and Marcella Albright v. U.S. Postal Service, MSPB Docket Number DC-0752- 11-0196-I-1. Date and... Docket Number AT-0353-11-0369-I-1; and Marcella Albright v. U.S. Postal Service, MSPB Docket Number DC...
Volume 9 No. 4 2009 August 2009 1191 GENOTOXIC EFFECTS OF ...
African Journals Online (AJOL)
pollutants, three doses each of the pesticides, dithane (0.196, 0.391, 0.782 % solution) ... disease causing organisms and by acting against pests in the field and during storage ..... Mancozeb is not taken up from the soil by plants. [26].
Czech Academy of Sciences Publication Activity Database
Tomala, Jakub; Kovářová, Jiřina; Kabešová, Martina; Votavová, Petra; Chmelová, Helena; Dvořáková, Barbora; Říhová, Blanka; Kovář, Marek
2013-01-01
Roč. 8, č. 5 (2013), s. 871-876 ISSN 1554-8929 R&D Projects: GA ČR GAP301/11/0325 Institutional support: RVO:61388971 Keywords : IN-VIVO EXPANSION * IL-2 * ANTIBODY Subject RIV: CE - Biochemistry Impact factor: 5.356, year: 2013
Czech Academy of Sciences Publication Activity Database
Zídek, Z.; Kverka, Miloslav; Dusilová, Adéla; Kmoníčková, E.; Jansa, P.
2016-01-01
Roč. 57, July 1 (2016), s. 48-56 ISSN 1089-8603 Institutional support: RVO:61388971 Keywords : Pyrimidines * Nitric oxide * Prostaglandin E-2 Subject RIV: EE - Microbiology, Virology Impact factor: 4.181, year: 2016
Czech Academy of Sciences Publication Activity Database
Khalaji, A.D.; Grivani, G.; Seyyedi, M.; Fejfarová, Karla; Dušek, Michal
2013-01-01
Roč. 49, č. 1 (2013), 19-23 ISSN 0277-5387 R&D Projects: GA ČR(CZ) GAP204/11/0809 Institutional support: RVO:68378271 Keywords : zinc(II) * mercury(II) * Schiff base * single-crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.047, year: 2013
Synthesis crystal stuctrure and thermoelectric properties of the ternary skutterudite Fe2Pd2Sb12
Czech Academy of Sciences Publication Activity Database
Navrátil, Jiří; Laufek, F.; Plecháček, T.; Plášil, J.
2010-01-01
Roč. 493, 1-2 (2010), s. 50-54 ISSN 0925-8388 R&D Projects: GA ČR GA203/07/0267 Institutional research plan: CEZ:AV0Z40500505 Keywords : Fe2Pd2Sb12 * crystal structure * skutterudite Subject RIV: CA - Inorganic Chemistry Impact factor: 2.138, year: 2010
GLOBAL JOURNAL OF AGRICULTURAL SCIENCES ISSN 1596-2903
African Journals Online (AJOL)
Ada Global
Measurements of temperature, red, far red wavelength of light and the ratio red to far red were made ... Plant species within 2.5 X 2.5m2 quadrats were enumerated every two months. ... the manufacture of food for it's growth and maintenance.
Czech Academy of Sciences Publication Activity Database
Psutka, Štěpán; Wichterle, Ivan
2008-01-01
Roč. 264, 1-2 (2008) , s. 55-61 ISSN 0378-3812 R&D Projects: GA ČR(CZ) GA104/07/0444 Institutional research plan: CEZ:AV0Z40720504 Keywords : vapour–liquid equilibrium * experimental data * prediction Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.699, year: 2008
Hussein, Yousri M; Shalaby, Sally M; Nassar, Amani; Alzahrani, Saad S; Alharbi, Ayman S; Nouh, Maha
2014-07-25
To determine whether IL-4, IL-4Rα and STAT6 polymorphisms are associated with susceptibility to dermatitis in Egyptian children. We genotyped three groups of children, consisting of 106 atopic dermatitis (AD) children, 95 non-AD children, and 100 of healthy controls, for IL-4 (-590 C/T), (-33 C/T), IL-4Rα (I50V), (Q576R) and STAT6 (2964 G/A), (2892 C/T) gene polymorphisms using PCR-RFLP assay. Total serum IgE and serum IL-4 levels were detected by ELISA. There was a non-significant association of IL-4 -590 C/T, -33 C/T polymorphisms in the children with non-AD or those with AD when compared with the controls. We identified a significant association between IL-4Rα I50V, Q576R polymorphisms and dermatitis susceptibility in AD (p=0.002, dermatitis was found. Patients who were carriers of IL4 -590C, IL-4Rα I50V G, STAT6 2964 A and STAT6 2892 T had an increased risk of AD [OR and 95% CI: 3.2 (2.5-4.2), p=0.005]. Furthermore, there was no relation between each polymorphism and serum IL-4 level (p>0.05 for each) while homozygosity for the risk alleles of IL-4, IL-4Rα and STAT6 SNPs were significantly associated with increased total IgE levels in all subjects. In Egyptian children, the IL-4Rα and the STAT6 polymorphism may play a role in susceptibility to AD. In addition, gene-gene interaction between the IL-4, the IL-4Rα and the STAT6 significantly increases an individual's susceptibility to AD. Copyright © 2014 Elsevier B.V. All rights reserved.
Czech Academy of Sciences Publication Activity Database
Buixaderas, Elena; Anghel, E.M.; Petrescu, S.; Osiceanu, P.
2010-01-01
Roč. 183, č. 9 (2010), s. 2227-2235 ISSN 0022-4596 Institutional research plan: CEZ:AV0Z10100520 Keywords : Raman spectroscopy * composites * borates Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.261, year: 2010
GUI2QAD-3D: A graphical interface program for QAD-CGPIC program
International Nuclear Information System (INIS)
Subbaiah, K.V.; Sarangapani, R.
2006-01-01
GUI2QAD-3D is graphical user interface developed in Visual Basic (VB) version 6.0 to prepare input for the QAD-CGPIC program. QAD-CGPIC is a FORTRAN code that combines QAD-CGGP (RSICC-CCC-493, USA) and PICTURE [Irving, D.C., Morrison, G.W., 1970. PICTURE-an aid in debugging GEOM input data, ORNL-TM-2892] for neutron and gamma-ray shielding calculations by the point kernel method in a consistent fashion to utilize the capabilities of two independent codes. The FORTRAN code calculates fast neutron and gamma-ray penetration through various shield configurations defined by combinatorial geometry specifications. It has provision to estimate buildup factor either from Geometric Progression (GP) coefficients (ANS-6.4.3, 1990) or from Capos'. Capabilities of the FORTRAN code is extended by modifying it to handle off-centred multiple identical sources. Several standard tests of inputs are carried out to validate the modified code. The FORTRAN code executable is created with a Lahey compiler. The user interface facilitates interactive viewing of the geometry of the system with online context sensitive help. Inputs for several practical problems relating to nuclear fuel reprocessing labs are provided. The software runs on Pentium III computers under windows environment and is transmitted in one CD. The software can be obtained from Radiation Safety Information and Computational Centre (RSICC), ORNL, USA with code package identification number CCC-697
Czech Academy of Sciences Publication Activity Database
Bernatová, Svatoslava; Pavlíček, Jan; Wichterle, Ivan
2011-01-01
Roč. 307, č. 1 (2011), s. 66-71 ISSN 0378-3812 R&D Projects: GA ČR GA104/07/0444 Institutional research plan: CEZ:AV0Z40720504 Keywords : vapor-liquid equilibrium * experimental data * prediction Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.139, year: 2011
Electrochemical quantification of 2,6-diisopropylphenol (propofol)
Czech Academy of Sciences Publication Activity Database
Langmaier, Jan; Garay, F.; Kivlehan, F.; Chaum, E.; Lindner, E.
2011-01-01
Roč. 704, 1-2 (2011), s. 63-67 ISSN 0003-2670 Institutional research plan: CEZ:AV0Z40400503 Keywords : electrochemistry * 2,6-diisopropylphenol * propofol Subject RIV: CG - Electrochemistry Impact factor: 4.555, year: 2011
Research Paper ISSN: 2006-0165©2009
African Journals Online (AJOL)
altered PBP2a by latex agglutination test and β-lactamase production/hyper ... Staphylococcal cassette chromosome mec (SCCmec) (Lowy, 2003; ... resistance and the slow growth of the resistant bacteria can make detection difficult. Detection ...
Czech Academy of Sciences Publication Activity Database
Androvič, L.; Drabina, P.; Panov, I.; Frumarová, Božena; Kalendová, A.; Sedlák, M.
2014-01-01
Roč. 25, č. 9 (2014), s. 775-780 ISSN 0957-4166 Institutional support: RVO:61389013 Keywords : cooper complexes * copolymers * asymmetric Henry reaction Subject RIV: CC - Organic Chemistry Impact factor: 2.155, year: 2014
Czech Academy of Sciences Publication Activity Database
Vácha, Robert; Slavíček, Petr; Mucha, Martin; Finlayson-Pitts, B. J.; Jungwirth, Pavel
2004-01-01
Roč. 108, - (2004), s. 11573-11579 ISSN 1089-5639 R&D Projects: GA MŠk ME 644 Grant - others:US-NSF(US) 0209719; US-NSF(US) 0431512 Institutional research plan: CEZ:AV0Z4055905 Keywords : atmospherically relevant gases * air /water interface * free energy profiles Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.639, year: 2004
ISSN 2073 East Cent. Afr. j. surg.
African Journals Online (AJOL)
DELL
wounds sustained. Majority of patients (59.2%) were treated conservatively and the remaining ... The study population included all bite injury patients of all age group and gender. Data .... Teeth and claws can puncture body cavities, including ...
Czech Academy of Sciences Publication Activity Database
Plášil, Jakub; Hloušek, J.; Kasatkin, A.V.; Škoda, R.; Novák, M.; Čejka, J.
2015-01-01
Roč. 79, č. 1 (2015), s. 205-216 ISSN 0026-461X R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : geschieberite * new mineral * uranyl sulfate * crystal structure * Raman spectroscopy * Jáchymov Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.212, year: 2015
Thermokinetic behaviour of Ag-doped (GeS2)50(Sb2S3)50 glasses.
Czech Academy of Sciences Publication Activity Database
Svoboda, R.; Fraenkl, M.; Frumarová, Božena; Wágner, T.; Málek, J.
2016-01-01
Roč. 449, 1 October (2016), s. 12-19 ISSN 0022-3093 Institutional support: RVO:61389013 Keywords : DSC * Ag doping * Ge-Sb-S glass Subject RIV: CA - Inorganic Chemistry Impact factor: 2.124, year: 2016
Czech Academy of Sciences Publication Activity Database
Tsierkezos, Nikos; Philippopoulos, A. I.
2009-01-01
Roč. 362, č. 4 (2009), s. 3079-3087 ISSN 0020-1693 Grant - others:Kapodistrias Program(GR) 70/4/9277 Institutional research plan: CEZ:AV0Z40550506 Keywords : assocition constant * conductivity * cyclic voltammetry * ruthenium * quinoxaline Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.322, year: 2009
Research Paper ISSN 0189-6016©2009
African Journals Online (AJOL)
Sapogenins. Antimony chloride in concentrated hydrochloric acid. Violet. Terpenoids. Antimony chloride in chloroform. Green. Quinones. Exposure to ammonia fumes. Red, orange, yellow, brown. (Adapted from Chowdhury et al., 2008.) Table 2: % mean Inhibition zones of the extracts/drugs. Extract/ drug. % mean inhibition.
The 3,3,5,5[2H4]-4-methacrylamido-2,2,6,6-tetra([2H3]methyl)piperidin-1-yloxyl radical
Czech Academy of Sciences Publication Activity Database
Dušková, Jarmila; Labský, Jiří; Dušek, Michal; Hašek, Jindřich
2006-01-01
Roč. 62, č. 2 (2006), o811-o813 ISSN 1600-5368 R&D Projects: GA AV ČR 1ET400500402 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10100521 Keywords : structure determination * spin label * x-ray diffraction Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.567, year: 2006
Research Paper ISSN 0189-6016©2009
African Journals Online (AJOL)
2Department of Plant Science and Applied Zoology, Olabisi Onabanjo University, ... However, the effects are distinctively different, ... asthma. The caffeine present acts as a bronchodilator, expanding the bronchial air ..... and authentication of the plants and also to the anonymous reviewer for helpful ... Nutrition and Food Sci.
Amino Acid Formation Induced by High-power Laser in CO2/CO-N2-H2O Gas Mixtures
Czech Academy of Sciences Publication Activity Database
Civiš, Svatopluk; Juha, Libor; Babánková, Dagmar; Cvačka, Josef; Frank, O.; Jehlička, J.; Králiková, Božena; Krása, Josef; Kubát, Pavel; Muck, A.; Pfeifer, Miroslav; Skála, Jiří; Ullschmied, Jiří
2004-01-01
Roč. 386, 1/3 (2004), s. 169-173 ISSN 0009-2614 R&D Projects: GA MŠk LN00A100 Institutional research plan: CEZ:AV0Z4040901 Keywords : Prebiotic synthesis * organic-synthesis * spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.438, year: 2004
Research Paper ISSN 0189-6016©2009
African Journals Online (AJOL)
AJTCAM
Innocent et al.,.. Afr. J. Trad. CAM (2009) 6 (2): 163 - 167. 164 use for managing malaria infections. The current study reports the invivo activity of aqueous ethanolic extracts of the plants. Materials and Methods. Solvents. Dimethyl sulphoxide (DMSO) was purchased from Sigma (Poole, Dorset, UK), ethanol from Fisher.
Research Paper ISSN 0189-6016©2009
African Journals Online (AJOL)
Archives Internationals de pharmacodynamic et de Therapie. 210: 27-37. 21. Sharma, H., Chandola, H.M., Singh, G. and Basisht, G. (2007) Utilization of Ayurveda in Health Care: An. Approach for Prevention, Health Promotion, and Treatment of Disease. Part 2-Ayurveda in Primary Health. Care. The J. Alter. Comple. Med.
Czech Academy of Sciences Publication Activity Database
Turek, P.; Kotora, M.; Hocek, Michal; Císařová, I.
2003-01-01
Roč. 44, č. 4 (2003), s. 785-788 ISSN 0040-4039 R&D Projects: GA ČR GA203/01/0863; GA ČR GA203/00/0036; GA ČR GA203/03/0035 Institutional research plan: CEZ:AV0Z4055905 Keywords : purines * nucleosides * cycloadditions Subject RIV: CC - Organic Chemistry Impact factor: 2.326, year: 2003
Czech Academy of Sciences Publication Activity Database
Milišiunaitė, V.; Arbačiauskienė, E.; Řezníčková, Eva; Jorda, Radek; Malínková, V.; Žukauskaitė, Asta; Holzer, W.; Šačkus, A.; Kryštof, Vladimír
2018-01-01
Roč. 150, APR 25 (2018), s. 908-919 ISSN 0223-5234 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Apoptosis * G2/M cell cycle arrest * Pyrazole * Structure-activity relationships Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.519, year: 2016
Biomolecule Analogues 2-Hydroxypyridine and 2-Pyridone Base Pairing on Ice Nanoparticles
Czech Academy of Sciences Publication Activity Database
Rubovič, Peter; Pysanenko, Andriy; Lengyel, Jozef; Nachtigallová, Dana; Fárník, Michal
2016-01-01
Roč. 120, č. 27 (2016), s. 4720-4730 ISSN 1089-5639 R&D Projects: GA ČR GA14-14082S Institutional support: RVO:61388955 ; RVO:61388963 Keywords : doped nanoparticles * argon * biomolecule s Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.847, year: 2016
Research Paper ISSN 0189-6016©2008
African Journals Online (AJOL)
Prof. Adewunmi
The ethanol extracts of Syzygium aromaticum flower bud were tested for ... the anti-nociceptive activity produced significant effects (P<0.05) at all the three doses of ... induced by subplantar injection of formalin was use as the measure of acute ... The signs of toxicity were first noticed after 2-6 hours of extract administration.
Research Paper ISSN 0189-6016©2009
African Journals Online (AJOL)
further development of plant medicines for health care delivery. ... Urine test strips (UroColorTM 10) were supplied by Standard Diagnostics Inc ... mg kg-1 plant raw material mixture (7.2% w/w) and stored in a cool dry place. ..... Anaemia is the principal nutritional problem in the world and affects mostly children and pregnant.
ISSN 2073-9990 East Cent. Afr. J. surg
African Journals Online (AJOL)
Hp 630 Dual Core
Comparative analysis of one year outcomes of selective laser trabeculoplasty versus argon laser trabeculoplasty in Primary Open Angle Glaucoma patients in. Nigeria. Adeola Onakoya1,2 Olusola O. ..... assess for other secondary outcomes such as pain and inflammation between the 2 groups since this was a retrospective ...
Czech Academy of Sciences Publication Activity Database
Chanda, N.; Sarkar, B.; Fiedler, Jan; Kaim, W.; Lahari, G. K.
č. 18 (2003), s. 3550-3555 ISSN 1477-9226 R&D Projects: GA ČR GA203/03/0821; GA MŠk OC D14.20 Institutional research plan: CEZ:AV0Z4040901 Keywords : dinuclear ruthenium complexes * spectroelectrochemical properties * electron-transfer Subject RIV: CG - Electrochemistry Impact factor: 2.908, year: 2003
Czech Academy of Sciences Publication Activity Database
Nauš, Petr; Perlíková, Pavla; Pohl, Radek; Hocek, Michal
2011-01-01
Roč. 76, č. 8 (2011), s. 957-988 ISSN 0010-0765 Institutional research plan: CEZ:AV0Z40550506 Keywords : nucleosides * cross - coupling * antitumor agents * purines * 7-deazapurines * 7H-Pyrrolo[2,3d]pyrimidine * cytostatic agents Subject RIV: CC - Organic Chemistry Impact factor: 1.283, year: 2011
Vibrational Energies of LiH2+ and LiD2+in the A1sigma+ Electronic State
Czech Academy of Sciences Publication Activity Database
Kraemer, W. P.; Špirko, Vladimír
2011-01-01
Roč. 115, č. 41 (2011), s. 11313-11320 ISSN 1089-5639 Institutional research plan: CEZ:AV0Z40550506 Keywords : LiH2+ molecular ion * density of states * nearest-neighbor level spacing distribution Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.946, year: 2011
Czech Academy of Sciences Publication Activity Database
Bumba, Ladislav; Hušák, M.; Vácha, František
2004-01-01
Roč. 42, - (2004), s. 193-199 ISSN 0300-3604 R&D Projects: GA MŠk LN00A141; GA ČR GA206/03/1107 Grant - others:GA-(CZ) FRVŠ1292/2002 Keywords : PS2-LHC2 * electron microscopy analysis Subject RIV: CE - Biochemistry Impact factor: 0.734, year: 2004
The analysis of the specific heat of RFe2Si2 compounds
Czech Academy of Sciences Publication Activity Database
Svoboda, P.; Vejpravová, J.; Honda, F.; Šantavá, E.; Schneeweiss, Oldřich; Komatsubara, T.
2003-01-01
Roč. 328, 1-2 (2003), s. 139-141 ISSN 0921-4526 R&D Projects: GA ČR GA106/02/0943 Institutional research plan: CEZ:AV0Z2041904 Keywords : specific heat * magnetic properties * intermetallics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.908, year: 2003
Czech Academy of Sciences Publication Activity Database
Bodensteiner, M.; Dušek, Michal; Kubicki, M. M.; Pronold, M.; Scheer, M.; Wachter, J.; Zabel, M.
2010-01-01
Roč. 2010, č. 33 (2010), s. 5298-5303 ISSN 1434-1948 Institutional research plan: CEZ:AV0Z10100521 Keywords : phosphorus * selenium * copper * coordination modes * polymers Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.909, year: 2010
Czech Academy of Sciences Publication Activity Database
Patra, S.; Sarkar, B.; Maji, S.; Fiedler, Jan; Urbanos, F. A.; Jimenez-Aparicio, R.; Kaim, W.; Lahiri, G. K.
2006-01-01
Roč. 12, č. 2 (2006), s. 489-498 ISSN 0947-6539 R&D Projects: GA AV ČR IAA400400505; GA MŠk LC510 Institutional research plan: CEZ:AV0Z40400503 Keywords : bridging ligands * EPR spectroscopy * magnetic properties * N,O ligands * ruthenium Subject RIV: CF - Physical ; The oretical Chemistry Impact factor: 5.015, year: 2006
Some structural and optical properties of (Bi2O3)x(ZnO)60-x(B2O3)40 glasses
Czech Academy of Sciences Publication Activity Database
Tichá, H.; Kincl, Miloslav; Tichý, Ladislav
2013-01-01
Roč. 138, 2-3 (2013), s. 633-639 ISSN 0254-0584 Institutional support: RVO:61389013 Keywords : glasses * Raman spectroscopy and scattering * Fourier transform infrared spectroscopy Subject RIV: CA - Inorganic Chemistry Impact factor: 2.129, year: 2013
Czech Academy of Sciences Publication Activity Database
Majer, Pavel; Jančařík, Andrej; Krečmerová, Marcela; Tichý, Tomáš; Tenora, Lukáš; Wozniak, K.; Wu, Y.; Pommier, E.; Ferraris, D.; Rais, R.; Slusher, B. S.
2016-01-01
Roč. 59, č. 6 (2016), s. 2810-2819 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : glutamate carboxypeptidase II * glutamate * 2-PMPA * prodrug Subject RIV: CC - Organic Chemistry Impact factor: 6.259, year: 2016
Czech Academy of Sciences Publication Activity Database
Stamatopoulos, I.; Giannitsios, D.; Psycharis, V.; Raptopoulou, C. P.; Balcar, Hynek; Zukal, Arnošt; Svoboda, J.; Kyritsis, P.; Vohlídal, J.
2015-01-01
Roč. 2015, č. 18 (2015), s. 3038-3044 ISSN 1434-1948 R&D Projects: GA ČR GAP108/12/1143 Institutional support: RVO:61388955 Keywords : homogenous catalysis * heterogeneous catalysis * cross coupling Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.686, year: 2015
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
Head and Neck Cancer (H&N CA) has had a fascinating and, along with most surgery, a fairly ... Innovations utilized by George Crile: ... As the management of H&N CA advanced in the 1950s oncology and surgery began working together.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
Difficult Gallbladder Surgery, Improving Patient Outcomes Through Appropriate Surgical. Decisions. ... If the position is too close to the common bile duct, an aberrant ... M.M, a 65-years old female had a bile duct injury post open cholecystectomy. She had .... With radiologic advances, cholecystostomy can be performed as a.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
Background: A case report of stab neck presenting at Kalafong Hospital, Pretoria, South. Africa with atypical meningitis. The objective was to illustrate the challenge of diagnosing this unusual and late presentation of meningitis. Case Report: A 48 year-old male patient presented to us two days after a stab neck. He was ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
Afr. J. surg. ..... September/October 2003. 3. Hardin R, Stevenson M, Downie W, Wilson G. Assessment of clinical competence using objective ... Michael J. Griesser, Matthew C. Beran, David C. Flanigan, Michael Quackenbush, DO, Corey Van ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
Antibiotic Prescription Patterns in the Management of Open Fractures at Mulago Hospital in. Kampala. ... antibiotics and also the use of checklists to ensure patients receive all necessary medications .... There was no relationship between the.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
A case admitted in the emergency department with pain lower abdomen and anal region following ... are only limited by the capacity of their rectum, not their imagination5. A total of ... which is important in planning of the extraction program7.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
Use of a laparoscopic bag for facilitating extraction/ morcellation of the operative ... which are freely available and hence can solve the problem without extra cost ... Before inserting into the abdominal cavity, one edge of plastic bag is cut short ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
. Before specific measurement of the portal vein diameter was performed, routine scanning was done to check for the sonographic exclusion criterias. The patient was scanned in supine and right anterior oblique position with the transducer in ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
Background: Uterine rupture is an infrequent but life threatening obstetric emergency. Rupture of previously scarred uterus is often encountered especially in multiparous women, but the traumatic rupture of an unscarred primigravid uterus as presented here is a relatively rare event. We report a case of rupture of an ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
Page 69. 12. Aldemir M, Yagnur Y, Tacyildir I. The predictive factors for the necessity of operative treatment in adhesive small bowel obstruction cases. Acta Chir Belg 2004; 104; 76-80. 13. Fevang BTS, Fevang J, Lie SA, Soriede O, Svanes K, Viste A. Long-term prognosis after operation for adhesive small bowel obstruction.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
the centre for disease control (CDC 2001) in the United state of America ... for preventing injury by sharp objects involving disinfection procedures but in sub Saharan Africa .... Barnett T, Whiteside A, Aids in twenty first centaury disease And ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
vomiting and constipation. Abdominal X-rays demonstrated large bowel obstruction. At laparotomy, this patient was found to have adhesions causing sigmoid colon obstruction. Conclusion: In this paper, we demonstrate the rarity of large bowel obstruction secondary to adhesions especially in a virgin abdomen, emphasize ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
2005-04-29
Apr 29, 2005 ... in the urethra and genitourinary system of male newborns. .... surveillance and care and that even today the eventual outcome is unclear in many instances6. ... Urinary tract infection was taken as prior history of recurrent fever.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
2005-04-29
Apr 29, 2005 ... Urinary tract infection was also common, being present in 58.9% of ... vesicostomy (42.9%), initial valve ablation (51.8%) and urethral catheterization 5.3%. ... 10% of the cases and included poor stream, gross haematuria and.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
Emergency department of Bugando Medical Centre between April 2009 and March ... surgeon or senior registrar or under their supervision, in case the operative .... from the stump or blow out of appendicular stump, less chances of peritonitis ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
adnexal mass, with normal cervix, uterus and endometrium, the differential diagnosis of fallopian tube carcinoma should be kept in mind. Introduction. Primary fallopian tube carcinoma is an uncommon tumor accounting for approximately 0.14% to. 1.8% of female genital malignancies1. The first classic case was reported in ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
bacterial culturing and drug sensitivity testing. Data was .... The sample was placed in a sterile transportation/storage container. Following this ..... associated with antibiotic resistance in coliform organisms from community urinary tract infection in ... parenteral drug abuse: presentation, microbiology, and treatment. Am Surg.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
identify risk factors that contribute to complications following tracheostomies. The aim of this ... important to perform an objective audit on the complications following this important surgery. .... the model and the results have been excluded.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
underwent surgical treatment at Kigali University Teaching Hospital. ..... Melero11 in Mexico reported a similar distribution with a ... environnement, system related drawbacks, serious shortages both in personnel and resources, inadequate.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
recent introduction of ESWL in this region and the adoption of endourological stone management techniques will have their long-term impacts on this complication. All nephrectomy specimens should be subjected to histopathological examination. Open nephrectomy, which remains our local practice, is safe and unilateral ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
COSECSA/ASEA Publication East and Central African Journal of Surgery. ... Bisphosphonates are currently widely used in the treatment of osteoporosis. ... Subtrochanteric fracture, lateral cortical thickening (solid black arrows), .... Schilcher J, Aspenberg P.Incidence of stress fractures of the femoral shaft in women treated.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
Background: This study was aimed at establishing the degree of conformity with the referral system, level of pre-referral investigative evaluations and degree of diagnosis concordance between the referring centres and the referral hospital in Western region of Kenya. Methods: This was a hospital based descriptive, ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
The hematoma was evacuated and a drain inserted. On the ... measures used to prevent this complication. Rigid and flexible ... suction through endotracheal tubes in patients who cannot withstand bronchoscopy. However the use of.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
DELL
Bolger WE, Butzin CA, Parsons DS. Paranasal sinus bony anatomic variations and mucosal abnormalities: CT analysis for endoscopic sinus surgery. Laryngoscope 1991; 101(1 Pt 1):. 56-64. 23. Wang J, Bidari S, Inoue K, Yang H, Rhoton A Jr. Extensions of the sphenoid sinus: a new classification. Neurosurgery 2010; 66: ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
The infection runs a chronic course with destruction of the affected part. The diagnosis usually requires high level of suspicion followed by biopsy to confirm and they usually respond well to chemotherapy with surgery only being adjuvant for specific indication. The natural cause of tuberculous arthritis evolves over several ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
The optimal technique depends on the level of injury, the type of tissue lostdestroyed ... on its vascular pedicle And used to cover web ... dorsal arteries) were also damaged as well as the terminal radial artery feed into the deep palmar arch.
Some physical properties of (Bi2O3)x(BaO)0.5-x(B2O3)0.5 glasses
Czech Academy of Sciences Publication Activity Database
Tichý, Ladislav; Tichá, H.; Herzigová, L.; Ožďanová, J.
2011-01-01
Roč. 126, 1-2 (2011), s. 289-294 ISSN 0254-0584 Institutional research plan: CEZ:AV0Z40500505 Keywords : oxide glasses * Raman spectroscopy * optical properties Subject RIV: CA - Inorganic Chemistry Impact factor: 2.234, year: 2011
ISSN Exercise & Sport Nutrition Review: Research & Recommendations
Kreider, Richard B; Almada, Anthony L; Antonio, Jose; Broeder, Craig; Earnest, Conrad; Greenwood, Mike; Incledon, Thomas; Kalman, Douglas S; Kleiner, Susan M; Leutholtz, Brian; Lowery, Lonnie M; Mendel, Ron; Stout, Jeffrey R; Willoughby, Darryn S; Ziegenfuss, Tim N
2004-01-01
Abstract Sport nutrition is a constantly evolving field with literally thousands of research papers published annually. For this reason, keeping up to date with the literature is often difficult. This paper presents a well-referenced overview of the current state of the science related to how to optimize training through nutrition. More specifically, this article discusses: 1.) how to evaluate the scientific merit of nutritional supplements; 2.) general nutritional strategies to optimize perf...
Czech Academy of Sciences Publication Activity Database
Brázda, Petr; Kohout, J.; Bezdička, Petr; Kmjec, T.
2014-01-01
Roč. 14, č. 3 (2014), s. 1039-1046 ISSN 1528-7483 R&D Projects: GA ČR GAP204/10/0035 Institutional support: RVO:61388980 Keywords : CHEMICAL-VAPOR-DEPOSITION * OXIDE THIN-FILMS * X-RAY * GAMMA-FE2O3 NANOPARTICLES * THERMAL-DECOMPOSITION Subject RIV: CA - Inorganic Chemistry Impact factor: 4.891, year: 2014
Energy Technology Data Exchange (ETDEWEB)
Rocha, Rodrigo S.; Batistella, Cesar B.; Maciel, Maria Regina W.; Maciel Filho, Rubens [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Faculdade de Engenharia Quimica; Medina, Lilian C. [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil). Centro de Pesquisas (CENPES)
2008-07-01
For the determination of the TBP (True Boiling Point) Curve, which defines the yield of petroleum products, the ASTM D2892 method for petroleum distillation and ASTM D5236 method for vacuum distillation of heavy hydrocarbons were applied. Furthermore, from these distillations, cuts that are submitted to several analyses to determine its physical-chemical properties are obtained, and all this information generates the evaluation of petroleum. For heavy petroleum, these conventional methods have been limited, since the total distilled percentage determined for temperatures up to 565 deg C (maximum reached with ASTM D5236 method) is lower for these oils, reducing the points of the curve, limiting its information. To improve this data set for heavy oils, a methodology for the extension of TBP curve through molecular distillation was established. It was possible to reach values up to 700 deg C, representing a considerable progress for the extension of TBP curve. The objective of this work is to present the results of Extended TBP curve for a heavy petroleum and characterization carried out through the cuts and residues obtained in molecular distillation of the residue 'Zeta' 400 deg C+ (fancy name), made by ASTM D2892 method. (author)
The effects of risk preferences in mixed-strategy equilibria of 2x2 games
Czech Academy of Sciences Publication Activity Database
Engelmann, D.; Steiner, Jakub
2007-01-01
Roč. 60, č. 2 (2007), s. 381-388 ISSN 0899-8256 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : risk preferences * mixed strategy equilibria Subject RIV: AH - Economics Impact factor: 1.468, year: 2007
Ecdysteroids new role - effectors of photosynthetic enzymes (O2 production and CO2 binding)
Czech Academy of Sciences Publication Activity Database
Macek, T.; Kamlar, M.; Holá, D.; Kohout, Ladislav; Harmatha, Juraj; Kočová, M.; Uhlík, O.; Rothová, O.
2014-01-01
Roč. 108, S2 (2014), s112 ISSN 0009-2770. [Conference on Isoprenoids /22./. 07.09.2014-10.09.2014, Praha] Grant - others:GA ČR(CZ) GAP501/11/1650 Institutional support: RVO:61388963 Keywords : ecdysteroids * photosynthesis Subject RIV: CC - Organic Chemistry
Theoretical Insights into the Nature of Nickel-Carbon Dioxide Interactions in Ni(PH3)2(eta2-CO2)
Czech Academy of Sciences Publication Activity Database
Kegl, T.; Ponec, Robert; Kollar, L.
2011-01-01
Roč. 115, č. 45 (2011), s. 12463-12473 ISSN 1089-5639 R&D Projects: GA ČR GA203/09/0118 Grant - others:HSRF(HU) OTKA NK 71906; HSRF(HU) OTKA-NKTH CK 78553; RTI(HU) SROP-4.2.2/08/1/2008-2011 Institutional research plan: CEZ:AV0Z40720504 Keywords : carbon dioxide coordination to Ni * analysis of bonding interactions * density functional methods Subject RIV: CF - Physical ; The oretical Chemistry Impact factor: 2.946, year: 2011
Czech Academy of Sciences Publication Activity Database
Kaberov, Leonid; Verbraeken, B.; Hrubý, Martin; Riabtseva, Anna; Kováčik, L.; Kereiche, S.; Brus, Jiří; Štěpánek, Petr; Hoogenboom, R.; Filippov, Sergey K.
2017-01-01
Roč. 88, March (2017), s. 645-655 ISSN 0014-3057 R&D Projects: GA MŠk(CZ) LH15213; GA ČR(CZ) GA16-03156S Institutional support: RVO:61389013 Keywords : 2-oxazoline * block copolymer * fluorinated Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 3.531, year: 2016
Czech Academy of Sciences Publication Activity Database
Svobodová, Jana; Rypáček, František
2012-01-01
Roč. 48, č. 1 (2012), s. 183-190 ISSN 0014-3057 R&D Projects: GA AV ČR KJB400500904; GA ČR GAP108/11/1857; GA MŠk 1M0538 Institutional research plan: CEZ:AV0Z40500505 Keywords : poly(.gamma.-benzyl-L-glutamate) * 2,2,2-.gamma.-trichlorethyl-L-glutamate * fibres Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.562, year: 2012
Acoustic seafloor sediment classification using self-organizing feature maps
Digital Repository Service at National Institute of Oceanography (India)
Chakraborty, B.; Kaustubha, R.; Hegde, A.; Pereira, A.
formulation as developed by Charbonnier et al. [7]. Manuscript received November 2, 2000; revised June 14, 2001. This work was supported by Consejo Nacional de Ciencia y Tecnología, México. H. Hidalgo, E. Gómez-Treviño, and F. J. Esparza are with the CICESE..., Ensenada 22860, México (e-mail: hugo@cicese.mx; egomez@cicese.mx; fesparz@cicese.mx). J. L. Marroquín is with the CIMAT, Callejón Xalisco S.N. Valenciana, Gua- najuato 36240, México (e-mail: jlm@fractal.cimat.mx). Publisher Item Identifier S 0196...
Czech Academy of Sciences Publication Activity Database
Wu, R.; Nachtigall, Petr; Brutschy, B.
2004-01-01
Roč. 6, č. 3 (2004), s. 515-521 ISSN 1463-9076 R&D Projects: GA MŠk LN00A032 Institutional research plan: CEZ:AV0Z4040901 Keywords : hydrogen bonding * electronic and vibrational spectra * spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.076, year: 2004
Czech Academy of Sciences Publication Activity Database
Heller, B.; Hapke, M.; Fischer, C.; Andronova, Angelina; Starý, Ivo; Stará, Irena G.
2013-01-01
Roč. 723, Jan 1 (2013), s. 98-102 ISSN 0022-328X R&D Projects: GA AV ČR IAA400550916; GA MŠk LC512 Institutional support: RVO:61388963 Keywords : asymmetric catalysis * helicene * cycloisomerisation * alkyne Subject RIV: CC - Organic Chemistry Impact factor: 2.302, year: 2013
Czech Academy of Sciences Publication Activity Database
Drelinkiewicz, A.; Waksmundzka-Góra, A.; Sobczak, J.; Stejskal, Jaroslav
2007-01-01
Roč. 333, č. 2 (2007), s. 219-228 ISSN 0926-860X Institutional research plan: CEZ:AV0Z40500505 Keywords : 2-ethyl-9,10- anthraquinone * polyaniline * palladium catalysts Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.166, year: 2007
Reductive carboxylation and 2-hydroxyglutarate formation by wild-type IDH2 in breast carcinoma cells
Czech Academy of Sciences Publication Activity Database
Smolková, Katarína; Dvořák, Aleš; Zelenka, Jaroslav; Vítek, L.; Ježek, Petr
2015-01-01
Roč. 65, AUG 15 (2015), s. 125-133 ISSN 1357-2725 R&D Projects: GA ČR(CZ) GPP301/12/P381; GA MŠk(CZ) LF14001 Institutional support: RVO:67985823 Keywords : reductive carboxylation * NADPH-dependent isocitrate * dehydrogenase IDH2 * hypoxia * 2-hydroxyglutarate Subject RIV: FD - Oncology ; Hematology Impact factor: 3.905, year: 2015
Electronic Structure and Bonding Situation in M2O2 (M=Be,Mg,Ca) Rhombic Clusters.
Czech Academy of Sciences Publication Activity Database
Li, W.-L.; Lu, J.-B.; Zhao, L.; Ponec, Robert; Cooper, D.L.; Li, J.; Frenking, G.
Roč. 122, č. 10 ( 2018 ), s. 2816-2822 ISSN 1089-5639 Grant - others:NNSFCH(CN) 21590792; NNSFCH(CN) 21433005; NNSFCH(CN) 21703099; JPY NSF(CN) BK20170964; NTU(CN) 39837123 Institutional support: RVO:67985858 Keywords : electronic structures * M2O2n clustery * theoretical isnights Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 2.847, year: 2016
Microstructure and Properties of Plasma-Sprayed Mixture of Cr2O3 and TiO2
Czech Academy of Sciences Publication Activity Database
Ctibor, Pavel; Píš, I.; Kotlan, J.; Pala, Zdeněk; Štengl, Václav; Homola, P.
2013-01-01
Roč. 22, č. 7 (2013), s. 1163-1169 ISSN 1059-9630 Institutional support: RVO:61389021 ; RVO:61388980 Keywords : bandgap * Cr2O3 * photocatalysis * resistivity * spectroscopy * TiO2 Subject RIV: BL - Plasma and Gas Discharge Physics; CA - Inorganic Chemistry (UACH-T) Impact factor: 1.491, year: 2013 http://link.springer.com/article/10.1007%2Fs11666-013-9969-9
Czech Academy of Sciences Publication Activity Database
Goněc, T.; Straník, J.; Pesko, M.; Kos, J.; Oravec, Michal; Kralova, K.; Jampílek, J.
2017-01-01
Roč. 22, č. 7 (2017), č. článku 1199. ISSN 1420-3049 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) EF16_013/0001609 Institutional support: RVO:67179843 Keywords : alkylcarbamates * hydroxynaphthalene-carboxamides * PET inhibition * spinach chloroplasts * structure-activity relationships Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 2.861, year: 2016
Czech Academy of Sciences Publication Activity Database
Frumarová, Božena; Frumar, M.; Oswald, Jiří; Kincl, Miloslav; Parchanski, V.
2013-01-01
Roč. 134, Feb 2013 (2013), s. 558-565 ISSN 0022-2313 R&D Projects: GA MŠk(CZ) LH11101; GA ČR GA203/09/0827 Institutional support: RVO:61389013 ; RVO:68378271 Keywords : chalcogenide glasses * MID IR luminescence Subject RIV: CA - Inorganic Chemistry Impact factor: 2.367, year: 2013
Huang, Rong; Han, Jing; Tian, Sai; Cai, Rongrong; Sun, Jie; Shen, Yanjue; Wang, Shaohua
2017-02-28
People with insulin resistance and type 2 diabetes mellitus (T2DM) are at increased risks of cognitive impairment. We aimed to investigate the association of plasma ghrelin levels and ghrelin rs4684677 polymorphism with mild cognitive impairment (MCI) in T2DM patients. In addition to elevated glycosylated hemoglobin (HbA1c), fasting blood glucose (FBG) and homeostasis model assessment of insulin resistance (HOMA-IR), T2DM patients with MCI had decreased plasma ghrelin levels compared with their healthy-cognition subjects (all p ghrelin level was one of independent factors for MCI in T2DM patients (p ghrelin levels were positively associated with the scores of Montreal Cognitive Assessment (r = 0.196, p = 0.041) and Auditory Verbal Learning Test-delayed recall (r = 0.197, p = 0.040) after adjustment for HbA1c, FBG and HOMA-IR, wherein the latter represented episodic memory functions. No significant differences were found for the distributions of genotype and allele of ghrelin rs4684677 polymorphism between MCI and control group. A total of 218 T2DM patients, with 112 patients who satisfied the MCI diagnostic criteria and 106 who exhibited healthy cognition, were enrolled in this study. Demographic characteristics, clinical variables and cognitive performances were extensively assessed. Plasma ghrelin levels and ghrelin rs4684677 polymorphism were also determined. Our results suggest that decreased ghrelin levels are associated with MCI, especially with episodic memory dysfunction in T2DM populations.
Ultrafast Wiggling and Jiggling: Ir2(1,8-diisocyanomenthane)4 2+
Czech Academy of Sciences Publication Activity Database
Pižl, Martin; Hunter, B. M.; Greetham, G. M.; Towrie, M.; Záliš, Stanislav; Gray, H. B.; Vlček, Antonín
2017-01-01
Roč. 121, č. 48 (2017), s. 9275-9283 ISSN 1089-5639 R&D Projects: GA ČR GA17-01137S; GA MŠk(CZ) LTC17052 Institutional support: RVO:61388955 Keywords : Coherent oscillations * Inter-system crossings * Optical spectroscopic Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 2.847, year: 2016
Nanocrystal Growth in Thermally Treated Fe75Ni2Si8B13C2 Amorphous Alloy
Czech Academy of Sciences Publication Activity Database
Minić, Dragica M.; Blagojević, V.; Minić, Dušan M.; David, Bohumil; Pizúrová, Naděžda; Žák, Tomáš
43A, č. 9 (2012), s. 3062-3069 ISSN 1073-5623 R&D Projects: GA MŠk 1M0512 Institutional support: RVO:68081723 Keywords : Nanocrystal growth * Fe75Ni2Si8B13C2 * Amorphous alloy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.627, year: 2012
Czech Academy of Sciences Publication Activity Database
Houšková, Hana; Morávková, Lenka; Sedláková, Zuzana; Boublík, T.; Kolská, Z.
2013-01-01
Roč. 337, JAN 15 (2013), s. 156-164 ISSN 0378-3812 Grant - others:GA ČR(CZ) GAP108/10/1106 Program:GA Institutional support: RVO:67985858 Keywords : vibrating-tube densimeter * excess molar volume * Peng–Robinson equation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.241, year: 2013
Czech Academy of Sciences Publication Activity Database
Tschan, M. J.-L.; Therrien, B.; Ludvík, Jiří; Štěpnička, P.; Süss-Fink, G.
2006-01-01
Roč. 691, č. 20 (2006), s. 4304-4311 ISSN 0022-328X Institutional research plan: CEZ:AV0Z40400503 Keywords : arene ligands * electrochemistry * ferrocene derivatives Subject RIV: CG - Electrochemistry Impact factor: 2.332, year: 2006
Czech Academy of Sciences Publication Activity Database
Kalachová, Lubica; Pohl, Radek; Hocek, Michal
-, č. 1 (2009), s. 105-112 ISSN 0039-7881 R&D Projects: GA MŠk LC512 Institutional research plan: CEZ:AV0Z40550506 Keywords : nucleosides * pyrimidines * cross-coupling * bipyridine s Subject RIV: CC - Organic Chemistry Impact factor: 2.572, year: 2009
Czech Academy of Sciences Publication Activity Database
Kurosawa, S.; Shishido, T.; Suzuki, A.; Pejchal, Jan; Yokota, Y.; Yoshikawa, A.
2014-01-01
Roč. 744, Apr (2014), 30-34 ISSN 0168-9002 Institutional support: RVO:68378271 Keywords : scintillator * Ce-doped (La, Gd) 2 Si 2 O 7 * temperature dependence * APD Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.216, year: 2014
Heterotrophic fixation of CO2 in soil
Czech Academy of Sciences Publication Activity Database
Šantrůčková, Hana; Bird, M. I.; Elhottová, Dana; Novák, Jaroslav; Picek, T.; Šimek, Miloslav; Tykva, Richard
2005-01-01
Roč. 49, č. 2 (2005), s. 218-225 ISSN 0095-3628 R&D Projects: GA ČR(CZ) GA206/02/1036; GA AV ČR(CZ) IAA6066901 Institutional research plan: CEZ:AV0Z60660521 Keywords : heterotrophic fixation * CO2 * soil Subject RIV: EH - Ecology, Behaviour Impact factor: 2.674, year: 2005
Molecular characterization of Anthurium genotypes by using DNA fingerprinting and SPAR markers.
Souza Neto, J D; Soares, T C B; Motta, L B; Cabral, P D S; Silva, J A
2014-07-02
We characterized single primer amplification reaction (SPAR) molecular markers from 20 genotypes of Anthurium andraeanum Lind., including 3 from commercial varieties and 17 from 2 communities in the State of Espírito Santo, Brazil. Twenty-four SPAR, consisting of 7 random amplified polymorphic DNA and 17 inter-simple sequence repeat markers were used to estimate the genetic diversity of 20 Anthurium accessions. The set of SPAR markers generated 288 bands and showed an average polymorphism percentage of 93.39%, ranging from 71.43 to 100%. The polymorphism information content (PIC) of the random amplified polymorphic DNA primers averaged 0.364 and ranged from 0.258 to 0.490. Primer OPF 06 showed the lowest PIC, while OPAM 14 was the highest. The average PIC of the inter-simple sequence repeat primers was 0.299, with values ranging from 0.196 to 0.401. Primer UBC 845 had the lowest PIC (0.196), while primer UCB 810 had the highest (0.401). By using the complement of Jaccard's similarity index and unweighted pair group method with arithmetic mean clustering, 5 clusters were formed with a cophenetic correlation coefficient of 0.8093, indicating an acceptable clustering consistency. However, no genotype clustering patterns agreed with the morphological data. The Anthurium genotypes investigated in this study are a germplasm source for conservational research and may be used in improvement programs for this species.
Czech Academy of Sciences Publication Activity Database
Alcaide, A.; Marconi, L.; Marek, Aleš; Haym, I.; Nielsen, B.; Mollerud, S.; Jensen, M.; Conti, P.; Pickering, D. S.; Bunch, L.
2016-01-01
Roč. 7, č. 11 (2016), s. 2136-2144 ISSN 2040-2503 Institutional support: RVO:61388963 Keywords : 2,4-syn-functionalized (S)-glutamate analogs * ionotropic glutamate receptors * kainate receptor Subject RIV: CC - Organic Chemistry Impact factor: 2.608, year: 2016 http://pubs.rsc.org/en/content/articlehtml/2016/md/c6md00339g
2011-04-25
... DEPARTMENT OF HOMELAND SECURITY Coast Guard 33 CFR Part 165 [Docket No. USCG-2011-0196] RIN 1625-AA00 Safety Zone; Bay Ferry II Maritime Security Exercise; San Francisco Bay, San Francisco, CA AGENCY... Security Exercise; San Francisco Bay, San Francisco, CA. (a) Location. The limits of this safety zone...
2012-10-10
... Endangered Species Act of 1973, as amended (ESA). A 5-year review is based on the best scientific and...-2012-0196, by any of the following methods: Electronic Submissions: Submit all electronic public... ``Submit a Comment'' icon on the right of that line. Mail or hand-delivery: Angela Somma, National Marine...
Czech Academy of Sciences Publication Activity Database
Kampf, A.R.; Plášil, Jakub; Kasatkin, A.V.; Marty, J.; Čejka, J.; Lapčák, L.
2017-01-01
Roč. 81, č. 2 (2017), s. 273-285 ISSN 0026-461X R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : shumwayite * new mineral * uranyl sulfate * crystal structure * infrared and Raman spectroscopy Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 1.285, year: 2016
Czech Academy of Sciences Publication Activity Database
Balogh, J.; Nagy, Z.; Fóti, S.; Pintér, K.; Czóbel, S.; Péli, E.; Acosta, Manuel; Marek, Michal V.; Csintalan, Z.; Tuba, Z.
2007-01-01
Roč. 45, č. 2 (2007), s. 288-292 ISSN 0300-3604 Institutional research plan: CEZ:AV0Z60870520 Keywords : CO2 and H2O fluxes * leaf area index * grassland * EC Subject RIV: EH - Ecology, Behaviour Impact factor: 0.976, year: 2007
P2X receptor channels in endocrine glands
Czech Academy of Sciences Publication Activity Database
Stojilkovic, S. S.; Zemková, Hana
2013-01-01
Roč. 2, č. 4 (2013), s. 173-180 ISSN 2190-460X R&D Projects: GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:67985823 Keywords : ATP * purinergic P2X receptor channels * pituitary * endocrine glands Subject RIV: ED - Physiology
Czech Academy of Sciences Publication Activity Database
Beneš, L.; Zima, Vítězslav; Svoboda, Jan; Melánová, Klára
2005-01-01
Roč. 53, č. 1-2 (2005), s. 41-46 ISSN 0923-0750 R&D Projects: GA ČR(CZ) GA203/05/2306 Institutional research plan: CEZ:AV0Z40500505 Keywords : intercalate Subject RIV: CA - Inorganic Chemistry Impact factor: 1.020, year: 2005
Catalytic effect of Ni, Mg2Ni and Mg2NiH4 upon hydrogen desorption from MgH2
Czech Academy of Sciences Publication Activity Database
Čermák, Jiří; David, Bohumil
2011-01-01
Roč. 36, č. 21 (2011), s. 13614-13620 ISSN 0360-3199 R&D Projects: GA ČR GA106/09/0814; GA ČR(CZ) GAP108/11/0148 Institutional research plan: CEZ:AV0Z20410507 Keywords : MgH2 * Hydrogen storage * Hydrogen desorption * Catalysis Subject RIV: JG - Metallurgy Impact factor: 4.054, year: 2011
DFT and synchrotron radiation study of Eu.sup.2+./sup. doped BaAl.sub.2./sub.O.sub.4./sub..
Czech Academy of Sciences Publication Activity Database
Brito, H.F.; Felinto, M.C.F.C.; Hölsä, J.; Laamanen, T.; Lastusaari, M.; Malkamäki, M.; Novák, Pavel; Rodrigues, L.C.V.; Stefani, R.
2012-01-01
Roč. 2, č. 4 (2012), s. 420-431 ISSN 2159-3930 Institutional research plan: CEZ:AV0Z10100521 Keywords : fluorescent and luminescent materials * optical storage materials * rare- earth -doped materials * luminiscence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.616, year: 2012
PARK2 orchestrates cyclins to avoid cancer
Czech Academy of Sciences Publication Activity Database
Bartek, Jiří; Hodný, Zdeněk
2014-01-01
Roč. 46, č. 6 (2014), s. 527-528 ISSN 1061-4036 Institutional support: RVO:68378050 Keywords : PARK2 * G1/S-phase cyclin * cancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 29.352, year: 2014
Czech Academy of Sciences Publication Activity Database
Planeta, Josef; Karásek, Pavel; Roth, Michal
2015-01-01
Roč. 102, JUL (2015), s. 133-139 ISSN 0896-8446 Institutional support: RVO:68081715 Keywords : ionic liquids * supercritical fluid chromatography * partition coefficient Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.579, year: 2015
Conformational properties of biocompatible poly(2-ethyl-2-oxazoline)s in phosphate buffered saline
Czech Academy of Sciences Publication Activity Database
Gubarev, A. S.; Monnery, B. D.; Lezov, A. A.; Sedláček, Ondřej; Tsvetkov, N. V.; Hoogenboom, R.; Filippov, Sergey K.
2018-01-01
Roč. 9, č. 17 (2018), s. 2232-2237 ISSN 1759-9954 R&D Projects: GA ČR(CZ) GA17-00973S Grant - others:AV ČR(CZ) FWO-17-05 Program:Bilaterální spolupráce Institutional support: RVO:61389013 Keywords : equilibrium rigidity * poly(2-ethyl-2-oxazoline) * thermosensitivity Subject RIV: BO - Biophysics OBOR OECD: Biophysics Impact factor: 5.375, year: 2016
Czech Academy of Sciences Publication Activity Database
Bombi, G.; Lora, S.; Zancato, M.; D'Archivio, A. A.; Jeřábek, Karel; Corain, B.
2003-01-01
Roč. 194, 1-2 (2003), s. 273-281 ISSN 1381-1169 Institutional research plan: CEZ:AV0Z4072921 Keywords : palladium nanoclusters * gel-type resins * catalyst Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.264, year: 2003
ISSN 2073-9990 East Cent. Afr. J. surg
African Journals Online (AJOL)
Hp 630 Dual Core
5Islamic University in Uganda, Habib Medical School, Anatomy Department, ... 9University of Duzce, School of Medicine, Physiology Department, Turkey ... 3 Anesthesiologists, (two from DWW-Turkey and one from Uganda), 2 nurses and.
Czech Academy of Sciences Publication Activity Database
Čerňová, Miroslava; Pohl, Radek; Klepetářová, Blanka; Hocek, Michal
2012-01-01
Roč. 23, č. 9 (2012), s. 1305-1308 ISSN 0936-5214 Grant - others:GA ČR(CZ) GAP207/12/0205 Institutional support: RVO:61388963 Keywords : pyrimidines * uracil * cross - coupling * palladium Subject RIV: CC - Organic Chemistry Impact factor: 2.655, year: 2012
Surface interaction of PuO.sub.2./sub., UO.sub.2+x./sub. and UO.sub.3./sub. with water ice
Czech Academy of Sciences Publication Activity Database
Gouder, T.; Shick, Alexander; Huber, F.
2013-01-01
Roč. 56, č. 12 (2013), s. 1112-1120 ISSN 1022-5528 Institutional support: RVO:68378271 Keywords : photoemission * catalysis * surface oxidation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.220, year: 2013
P2X Receptors and Synaptic Plasticity
Czech Academy of Sciences Publication Activity Database
Pankratov, Y.; Lalo, U.; Krishtal, A.; Verkhratsky, Alexei
2009-01-01
Roč. 158, č. 1 (2009), s. 137-148 ISSN 0306-4522 Institutional research plan: CEZ:AV0Z50390512 Keywords : ATP * P2X receptors * synaptic plasticity Subject RIV: FH - Neurology Impact factor: 3.292, year: 2009
Stability for semilinear parabolic problems in L_2 and W^{1,2}
Czech Academy of Sciences Publication Activity Database
Gurevich, P.; Väth, Martin
2016-01-01
Roč. 35, č. 3 (2016), s. 333-357 ISSN 0232-2064 Institutional support: RVO:67985840 Keywords : asymptotic stability * existence * uniqueness Subject RIV: BA - General Mathematics Impact factor: 0.643, year: 2016 https://www.ems-ph.org/journals/show_abstract.php?issn=0232-2064&vol=35&iss=3&rank=5
Directory of Open Access Journals (Sweden)
Grzegorz Dutkiewicz
2010-02-01
Full Text Available In the title compound (systematic name: 1-benzyloxy-3-methyl-1-oxobutan-2-aminium chloride, C12H18NO2+·Cl−, the ester group is approximately planar, with a maximum deviation of 0.040 (2 Å from the least-squares plane, and makes a dihedral angle of 28.92 (16° with the phenyl ring. The crystal structure is organized by N—H...Cl hydrogen bonds which join the two components into a chain along the b axis. Pairs of chains arranged antiparallel are interconnected by further N—H...Cl hydrogen bonds, forming eight-membered rings. Similar packing modes have been observed in a number of amino acid ester halides with a short unit-cell parameter of ca 5.5 Å along the direction in which the chains run.
ISSN 2073-9990 East Cent Afr J Surg
African Journals Online (AJOL)
were conducted with the children's caretakers by 2 paediatric surgery ... paediatrician at the Eduardo Mondlane Medical School in Maputo, with the aid of nursing ..... Epilepsy. 1/9. 11%. Other. 5/9. 56%. Discussion. Our findings are consistent ...
Hu, D-H; Yu, S-M
2017-08-30
Some studies investigated the association between platelet-to-lymphocyte ratio (PLR) and the survival of hepatocellular carcinoma (HCC). However, the results remained inconclusive. Thus, we performed this meta-analysis. Published studies were searched in PubMed and EMBASE. The strength of association was assessed by calculating odds ratios (OR) and 95% confidence interval (CI). In total, 6 studies with 1446 HCC patients were included in this meta-analysis. HCC with higher PLR showed an increased death risk (OR = 1.59; 95%CI, 1.15-2.20; P < 0.0001). However, the heterogeneity was high (I2=89.2%). When the study by Li et al. was excluded, the heterogeneity decreased (I2=20%). Further, the result was still positive (OR = 1.70; 95%CI, 1.42-2.04; P < 0.00001). In conclusion, this meta-analysis suggested that PLR was significantly associated with the OS of HCC.
ISSN 2073-9990 East Cent. Afr. J. surg
African Journals Online (AJOL)
Hp 630 Dual Core
report the case of an 80-year old lady who presented with signs and symptoms of ... After stabilizing the patient explorative laparotomy was decided and then performed. ... cholecystectomy and fistula closure at a later date (two-stage)2, 8.
ISSN 2073-9990 East Cent. Afr. J. surg
African Journals Online (AJOL)
Valued eMachines Customer
3Department of Pathology, University of Ibadan and the University College ... osteomyelitis2 skin graft donor site3 injection sites 4,5 venous ulcers 6 scar tissue ... Lichen planus is a chronic mucocutaneous disease which presents as an itchy ...
ISSN 2073-9990 East Cent. Afr. J. surg
African Journals Online (AJOL)
Hp 630 Dual Core
2015-11-30
Nov 30, 2015 ... haematomas are associated with a skull fracture in adults but the figure is notably .... with severe disability (GOS 2) and one had a good recovery (GOS 5). .... skull fracture which is significantly lower compared to studies which.
Czech Academy of Sciences Publication Activity Database
Andreev, Alexander V.; Koyama, K.; Tereshina, Evgeniya; Prokleška, J.; Watanabe, K.
2009-01-01
Roč. 477, 1-2 (2009), s. 62-67 ISSN 0925-8388 R&D Projects: GA ČR(CZ) GA202/06/0185 Institutional research plan: CEZ:AV0Z10100520 Keywords : R 2 T 17 * Lu 2 Fe 17 * ferromagnetism * metamagnetism * magnetostriction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.135, year: 2009
Czech Academy of Sciences Publication Activity Database
Trnovcová, V.; Kubliha, M.; Labas, V.; Kadleciková, M.; Pedlíková, Jitka; Greguš, J.; Slabeyclus, J.
2012-01-01
Roč. 14, 1-2 (2012), s. 77-83 ISSN 1454-4164 Institutional research plan: CEZ:AV0Z40320502 Keywords : Tellurite/lead chloride/lead fluoride glasses * Optical absorption * Photoluminescence Subject RIV: CA - Inorganic Chemistry Impact factor: 0.516, year: 2012
Czech Academy of Sciences Publication Activity Database
Auzias, M.; Therrien, B.; Süss-Fink, G.; Štěpnička, P.; Ludvík, Jiří
2007-01-01
Roč. 692, č. 4 (2007), s. 755-760 ISSN 0022-328X Institutional research plan: CEZ:AV0Z40400503 Keywords : carbonyl ligands * carboxylato ligands * ferrocenyl substituents * diimine ligands Subject RIV: CG - Electrochemistry Impact factor: 2.168, year: 2007
Glycosylation of alpha(2)delta(1) subunit: a sweet talk with Ca(v)1.2 channels
Czech Academy of Sciences Publication Activity Database
Lazniewska, Joanna; Weiss, Norbert
2016-01-01
Roč. 35, č. 3 (2016), s. 239-242 ISSN 0231-5882 R&D Projects: GA ČR GA15-13556S; GA MŠk 7AMB15FR015 Institutional support: RVO:61388963 Keywords : calcium channel * Ca(v)1.2 channel * ancillary subunit * alpha(2)delta(1) subunit * glycosylation * trafficking Subject RIV: CE - Biochemistry Impact factor: 1.170, year: 2016
Czech Academy of Sciences Publication Activity Database
Matějová, Lenka; Kočí, K.; Reli, M.; Čapek, L.; Matějka, V.; Šolcová, Olga; Obalová, L.
2013-01-01
Roč. 285, Part B (2013), s. 688-696 ISSN 0169-4332 Grant - others:MŠk(CZ) CZ.1.05/2.1.00/03.0069; MŠk(CZ) CZ.1.07/2.3.00/30.0016; MŠk(CZ) SP2013/77; MŠk(CZ) SP2013/41 Institutional support: RVO:67985858 Keywords : gold * titania-zirconia * carbon dioxide Subject RIV: CC - Organic Chemistry Impact factor: 2.538, year: 2013
ISSN 2073-9990 East Cent. Afr. J. surg
African Journals Online (AJOL)
Hp 630 Dual Core
because of the several vital structures that traverse or reside in this relatively small area of the body.(1, 2)Trauma ... Post-operativecheck X-ray ofneck did notreveal any remnant of the foreign body. .... with inter dental wiring. The wound on the ...
Czech Academy of Sciences Publication Activity Database
Zídek, Zdeněk; Kverka, Miloslav; Dusilová, Adéla; Kmoníčková, Eva; Jansa, Petr
2016-01-01
Roč. 57, jul (2016), s. 48-56 ISSN 1089-8603 R&D Projects: GA ČR(CZ) GAP303/12/0172 Institutional support: RVO:68378041 ; RVO:61388963 Keywords : pyrimidines * nitric oxide * prostaglandin E-2 Subject RIV: FR - Pharmacology ; Medidal Chemistry; CC - Organic Chemistry (UOCHB-X) Impact factor: 4.181, year: 2016
A General Regioselective Approach to 2,4-Disubstituted Pyrimidin-5-yl C-2-Deoxyribonucleosides
Czech Academy of Sciences Publication Activity Database
Kubelka, Tomáš; Slavětínská, Lenka; Hocek, Michal
2012-01-01
Roč. 44, č. 6 (2012), s. 953-965 ISSN 0039-7881 R&D Projects: GA MŠk LC512; GA AV ČR IAA400550902 Institutional research plan: CEZ:AV0Z40550506 Keywords : nucleosides * pyrimidines * cross - coupling * Heck reaction Subject RIV: CC - Organic Chemistry Impact factor: 2.500, year: 2012
Czech Academy of Sciences Publication Activity Database
Drabik, M.; Hanuš, J.; Kousal, J.; Choukourov, A.; Biederman, H.; Slavínská, D.; Macková, Anna; Pešička, J.
2007-01-01
Roč. 4, č. 6 (2007), s. 654-663 ISSN 1612-8850 Institutional research plan: CEZ:AV0Z10480505 Keywords : composite thin films * magnetron * poly(propylene) (PP) Subject RIV: BE - Theoretical Physics Impact factor: 2.132, year: 2007
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...
African Journals Online (AJOL)
DELL
Teunissen LL, Rinkel GJE, Algra A, van Gijn J. Risk factors for subarachnoid hemorrhage. A systemic review. Stroke 1996; 27: 544-549. 22. Levine SR, Brust JC, Futrell N, Brass LM, Blake D, Fayad P, et al. A comparative study of cerebro- vascular complications of cocaine: alkaloidal versus hydrochloride. Neurology 1991 ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...
African Journals Online (AJOL)
DELL
2005-04-12
Apr 12, 2005 ... East and Central African Journal of Surgery. .... Any man who is over 40 years with a positive family history (Especially one with HPC-1 gene) warrants a ..... effects of fluid retention, venous & arterial thrombosis, cardiac toxicity, stroke. .... with insertion of an indwelling catheter or intermittent catheterization ...
ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J.
African Journals Online (AJOL)
DELL
ut also because of its negative effects on the process of recovery. Its management has, however, remained a major challenge. Numerous myths and ... challenges encountered by health providers in their service to patients. health providers in ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...
African Journals Online (AJOL)
DELL
accounting for 10-11% of global mortality and 13% of all disability adjusted life years (DALYs)1-3. Major causes of ... Effective advanced communication .... Further, the financial strain on the healthcare system is significant. .... Mock C, Lormand JD, Goosen J, Joshipura M, Peden M. Guidelines for essential trauma care.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...
African Journals Online (AJOL)
DELL
Oesophageal perforation in anterior cervical spine plating: A Case report ... systems and careful long-term follow-up in patients with anterior cervical spine plating ... used for the operative treatment of disc herniation, spondylosis, and injuries.
ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J.
African Journals Online (AJOL)
DELL
East and Central African Journal of Surgery. ... collaboration in the writing and editing of Surgical Care at the District Hospital, ... increasing availability of computers and huge developments in software technology such ... Emergency Surgery ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...
African Journals Online (AJOL)
DELL
East and Central African Journal of Surgery. ... as the 3D cone beam CT machines which reduce exposure to irradiations, .... effect is closely related to the depth of impaction and height of the body of the mandible. ... extraction based on mere speculation or expectation of a sequelae, however a joint committee on third molar.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...
African Journals Online (AJOL)
DELL
Pinder D, Hilton M. Dissection versus diathermy for tonsillectomy. Cochrane Database Syst Rev. 2001;(4):CD002211. 3. Gendy S, O'leary M, Colreavy M, Rowley H, O'Dwyer T, Blayney A. Tonsillectomy- cold dissection versus hot dissection: a prospective study. Ir Med J 2005; 98(10):243-4. 4. Leach J, Manning S, Schaefer ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...
African Journals Online (AJOL)
DELL
results of aberrant vessels angiogenesis during embryogenesis (i.e. arterial, venous, capillary, lymphatic or mixed)3. They are classified clinically by their blood flow characteristics and can be described as “high flow” or “low flow” lesions4,5. Low flow lesions are more prevalent and consist of capillary, venous, lymphatic and.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...
African Journals Online (AJOL)
DELL
Rare Occurrence: Buruli Ulcers in Gulu, Northern Uganda. A Case report .... induration or diffuse swelling in the legs and arms9,10. Because of ... fever, which may partly explain why those affected often, do not seek prompt treatment. However ...
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...
African Journals Online (AJOL)
DELL
Background: Subarachnoid haemorrhage (SAH) is a grave condition with high morbidity and mortality. ... World Federation of Neurosurgeons (WFNS) grade 1. ... Hydrocephalus was seen as a co-existing condition in 13 % .... Head CT is also the most reliable test for predicting cerebral vasospasm and poor outcome20.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...
African Journals Online (AJOL)
DELL
embryonal tumour of the kidney that may contain the 3 germ cells: the stroma cells, the .... renal pelvis anatomy is distorted, the renal vessels could be obscured and ... Sembulingam M.: Cardiac output, in Essentials of Medical physiology, ed 5.
ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J.
African Journals Online (AJOL)
DELL
clinically based on pulse, blood pressure, respiratory rate, urine output, and mental ... evaluated the published literature on this common problem, seeking ... emphasizes the role of treating uterine atony with drugs or manipulation, removing .... Bacterial contamination of stored blood is a significant risk because blood is, ...
ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J.
African Journals Online (AJOL)
DELL
unrelated to ganglion cysts and only one patient had to undergo surgical excision due to surgical excision due to ... the dorsum of foot and one each on the thenar aspect at the base of thumb, toe and popliteal fossa .... this minimally invasive, atraumatic procedure and no patient has returned with a recurrence till date .
ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J.
African Journals Online (AJOL)
DELL
cause very rarely is fungal. Five types of infected .... The patient later developed ischemic symptoms in his right leg with intermittent claudication. He had to .... Salmonella species. Few cases of aneurysm caused by Tb have been described. Our cases have presented with abdominal pain, pulsating mass and a bruit. Our first.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...
African Journals Online (AJOL)
DELL
in size, may present during adolescence. The condition is correctible though there is need for screening and early detection in children through national Health Policy interventions. Introduction. Testicular maldescent or crytorchidism is the most common anomaly of the genitalia with an incidence of approximately 1% in ...
ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J ...
African Journals Online (AJOL)
DELL
The majority (64%) of all cases were from rural area. .... Arnic et al20 on pulmonary hydatid cyst cases, chest pain (44.9%) and cough (37.6%) were the ... An analysis of hydatid cyst surgeries in patients referred to hospitals in Khorram- Abad,.
ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J ...
African Journals Online (AJOL)
DELL
Peritoneal Drains in Perforated Appendicitis without Peritonitis: A Prospective. Randomized ... of tube drainage provided (without suction) while the remaining 45 had no provided (without ..... with drains. Significance of the outcome measures.
ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J ...
African Journals Online (AJOL)
DELL
gender, mean operating time, volume of fluid collection in thyroid bed, ... appears to confer several advantages over the routine drainage method and achieves significant reduction of hospital stay, which led to a reduction in costs for the patients ... than 30 ml in 24 hours following which the patients were discharged.
Czech Academy of Sciences Publication Activity Database
Storch, Jan; Čermák, Jan; Karban, Jindřich
2007-01-01
Roč. 48, č. 38 (2007), s. 6814-6816 ISSN 0040-4039 R&D Projects: GA MŠk(CZ) LC06070 Institutional research plan: CEZ:AV0Z40720504 Keywords : aromate * cyclization * cycloizomerization Subject RIV: CC - Organic Chemistry Impact factor: 2.615, year: 2007
Highly dispersive spin excitations in the chain cuprate Li.sub.2./sub.CuO.sub.2./sub..
Czech Academy of Sciences Publication Activity Database
Lorenz, W.E.A.; Kuzian, R. O.; Drechsler, S.-L.; Stein, W.-D.; Wizent, N.; Behr, G.; Málek, Jiří; Nitzsche, U.; Rosner, H.; Hiess, A.; Schmidt, W.; Klingeler, R.; Loewenhaupt, M.; Büchner, B.
2009-01-01
Roč. 88, č. 3 (2009), 37002/p1-37002/p9 ISSN 0295-5075 Institutional research plan: CEZ:AV0Z10100520 Keywords : neutron inelastic scattering * spin waves * exact diagonalization Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.893, year: 2009
High spin states in 181Ir and backbending phenomena in the Os-Pt region
Kaczarowski, R.; Garg, U.; Funk, E. G.; Mihelich, J. W.
1992-01-01
The 169Tm(16O,4n)181Ir reaction has been employed to investigate the high spin states of 181Ir using in-beam γ spectroscopy. A well-developed system of levels built on the h9/2 subshell was identified up to a maximum spin of (41/2-). Two rotational bands built on the isomeric states with τ1/2=0.33 μs (Ex=289.2 keV) and 0.13 μs (Ex=366.2 keV), respectively, were observed. The deduced gK values of 1.19+/-0.11 and 1.50+/-0.12 indicate Nilsson assignments of 9/2-[514] and 5/2+[402], respectively, for the bandheads of these bands. A high spin (I>=19/2) isomer with τ1/2=22 ns was found at an excitation energy above 1.96 MeV. The experimental results are discussed in terms of rotational models including Coriolis coupling and providing for a stable triaxial shape of the 181Ir nucleus.
ISSN 2073-9990 East Cent Afr J Surg
African Journals Online (AJOL)
We describe a case of a 27-year-old male patient who sustained blunt abdominal trauma in a road traffic accident ... Keywords: gangrenous acalculous cholecystitis, trauma, cholecystectomy. Introduction .... The patient was reviewed as an outpatient 2 weeks after discharge, and .... laparoscopically in most cases. In patients ...
Czech Academy of Sciences Publication Activity Database
Bernatová, Svatoslava; Pavlíček, Jan; Wichterle, Ivan
2009-01-01
Roč. 278, 1-2 (2009), s. 129-134 ISSN 0378-3812 R&D Projects: GA ČR GA104/07/0444 Institutional research plan: CEZ:AV0Z40720504 Keywords : alcohol * ether * ketone Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.857, year: 2009
Ethiopian Journal of Environmental Studies & Management 7(2 ...
African Journals Online (AJOL)
Osondu
2013-03-27
Mar 27, 2013 ... Ethiopian Journal of Environmental Studies & Management 7(2): 108 – 116, 2014. ISSN:1998- ... cement factory on a sample of 126 tenements from 11 residential settlements within Ewekoro local .... health risk but aesthetics.
Czech Academy of Sciences Publication Activity Database
Majzlan, J.; Drahota, P.; Filippi, Michal; Grevel, K.-D.; Kahl, W.-A.; Plášil, J.; Boerio-Goates, J.; Woodfield, B. F.
117/118, April (2012), s. 47-56 ISSN 0304-386X Institutional research plan: CEZ:AV0Z30130516 Keywords : scorodite * ferric arsenates * formation enthalpy * entropy * solubility Subject RIV: DD - Geochemistry Impact factor: 2.169, year: 2012
Thermoresponsive nanoparticles based on poly(2-alkyl-2-oxazolines) and pluronic F127
Czech Academy of Sciences Publication Activity Database
Pánek, Jiří; Filippov, Sergey K.; Hrubý, Martin; Rabyk, Mariia; Bogomolova, Anna; Kučka, Jan; Štěpánek, Petr
2012-01-01
Roč. 33, č. 19 (2012), s. 1683-1689 ISSN 1022-1336 R&D Projects: GA ČR GA202/09/2078; GA ČR GPP207/10/P054 Grant - others:AV ČR(CZ) M200501201 Program:M Institutional research plan: CEZ:AV0Z40500505 Institutional support: RVO:61389013 Keywords : nanoparticles * pluronic F127 * poly(2-alkyl-2- oxazoline)s Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.929, year: 2012
Czech Academy of Sciences Publication Activity Database
Kováčik, J.; Grúz, Jiří; Klejdus, B.; Štork, F.; Marchiosi, R.; Ferrarese-Filho, O.
2010-01-01
Roč. 179, č. 4 (2010), s. 383-389 ISSN 0168-9452 Institutional research plan: CEZ:AV0Z50380511 Keywords : Heavy metals * Oxidative stress * Phenols Subject RIV: EF - Botanics Impact factor: 2.481, year: 2010
ISSN 2073-9990 East Cent. Afr. J. surg
African Journals Online (AJOL)
Valued eMachines Customer
proportion (Mostly 2/3rd) of injuries among male than female patients (range ... Because of the uncertainties about the quality and the absence of some data in certain ... on trauma/ injuries in the Ethiopian population for the period of 1960- August ... 18 investigated the magnitude and pattern of injuries within hospitalized.
Czech Academy of Sciences Publication Activity Database
Todorov, R.; Petkov, K.; Kincl, Miloslav; Černošková, E.; Vlček, Milan; Tichý, Ladislav
2014-01-01
Roč. 558, 2 May (2014), s. 298-305 ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : chalcogenide glasses * thin films * optical properties Subject RIV: CA - Inorganic Chemistry Impact factor: 1.759, year: 2014
Czech Academy of Sciences Publication Activity Database
Plešek, Jaromír; Grüner, Bohumír; Císařová, I.; Báča, Jiří; Selucký, P.; Rais, J.
2002-01-01
Roč. 657, 1-2 (2002), s. 59-70 ISSN 0022-328X R&D Projects: GA ČR GA104/99/1096; GA ČR GA104/01/0142; GA ČR GA203/99/M037; GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z4032918 Keywords : carboranes * metallaboranes * liquid-liquid extraction Subject RIV: CA - Inorganic Chemistry Impact factor: 1.901, year: 2002
Czech Academy of Sciences Publication Activity Database
Kaberov, Leonid; Verbraeken, B.; Riabtseva, Anna; Brus, Jiří; Štěpánek, Petr; Hoogenboom, R.; Filippov, Sergey K.
2017-01-01
Roč. 254, 20 August (2017), s. 304 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] R&D Projects: GA ČR(CZ) GC15-10527J Institutional support: RVO:61389013 Keywords : poly-2-oxazolines * triblocks * fluorinated Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry
ISSN 2073-9990 East Cent. Afr. J. surg
African Journals Online (AJOL)
Valued eMachines Customer
chose the type of anaesthesia after discussion with the surgeon before surgery. ... anesthesia was used in 273 patients in Lichtenstein group and 490 patients in the Desarda group. All those 763 (55.2%) .... The author made a search about the inguinal canal anatomy through books or publications made by stalwarts in this ...
Ethiopian Journal of Environmental Studies & Management 7(2 ...
African Journals Online (AJOL)
Osondu
2013-11-01
Nov 1, 2013 ... Ethiopian Journal of Environmental Studies & Management 7(2): 153 – 159, 2014. ISSN:1998-0507 ... and food processing industries, battery, cement, milling and ..... risks, but can provide basic information on source of water ...
T-type Ca2+ channels make your brain smarter
Czech Academy of Sciences Publication Activity Database
Weiss, Norbert
2015-01-01
Roč. 9, č. 3 (2015), s. 115-116 ISSN 1933-6950 Institutional support: RVO:61388963 Keywords : low-threshold exocytosis * calcium channel * hippocampus Subject RIV: CE - Biochemistry Impact factor: 2.008, year: 2015
Czech Academy of Sciences Publication Activity Database
Šimek, Miloslav; Elhottová, Dana; Klimeš, F.; Hopkins, D. W.
2004-01-01
Roč. 36, - (2004), s. 9-21 ISSN 0038-0717 Grant - others:NATO(XX) CRG 97/1331; Evropská unie(XE) EVK2-CT-2000-00096 Institutional research plan: CEZ:AV0Z6066911; CEZ:MSM 122200003 Keywords : emission * denitrification * denitrifying enzyme activity Subject RIV: EH - Ecology, Behaviour Impact factor: 2.234, year: 2004
GLOBAL JOURNAL OF AGRICULTURAL SCIENCES ISSN 1596-2903
African Journals Online (AJOL)
Ada Global
mean rainfall for locations in the West African Sahel will reduce yields substantially and in many cases could lead to total crop failure. The study ... roughness, and the amount of dust generation are seen as possible triggers to a .... Table 1: Coefficient of determintion (R2) for the multiple regression models. Model 1. Location.
Czech Academy of Sciences Publication Activity Database
Vlčková Živcová, Zuzana; Locs, J.; Keuper, M.; Sedlářová, I.; Chmelíčková, M.
2012-01-01
Roč. 32, č. 10 (2012), s. 2163-2172 ISSN 0955-2219 Institutional support: RVO:61388955 Keywords : casting * microstructure - final * porosity Subject RIV: CG - Electrochemistry Impact factor: 2.360, year: 2012
Microwave Photochemistry II. Photochemistry of 2-tert-butylphenol
Czech Academy of Sciences Publication Activity Database
Církva, Vladimír; Kurfürstová, Jana; Karban, Jindřich; Hájek, Milan
2004-01-01
Roč. 168, č. 3 (2004), s. 197-204 ISSN 1010-6030 R&D Projects: GA ČR GA203/02/0879 Institutional research plan: CEZ:AV0Z4072921 Keywords : microwave photochemistry * electrodeless discharge lamp * 2-tert-Butylphenol Subject RIV: CC - Organic Chemistry Impact factor: 2.235, year: 2004
Czech Academy of Sciences Publication Activity Database
Kampf, A.R.; Plášil, Jakub; Kasatkin, A.V.; Marty, J.
2015-01-01
Roč. 79, č. 3 (2015), s. 695-714 ISSN 0026-461X R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : bobcookite * wetherillite * new mineral * uranyl sulfate * crystal structure * Blue Lizard mine * Utah * USA Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.212, year: 2015
Czech Academy of Sciences Publication Activity Database
Vejpravová, J.; Kamarád, Jiří; Prchal, J.; Sechovsky, V.
2007-01-01
Roč. 76, suppl. A (2007), s. 49-50 ISSN 0031-9015 Institutional research plan: CEZ:AV0Z10100521 Keywords : pressure effect * magnetic properties * transport properties * single crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.212, year: 2007
Diameter 2 properties and convexity
Czech Academy of Sciences Publication Activity Database
Abrahamsen, T. A.; Hájek, Petr Pavel; Nygaard, O.; Talponen, J.; Troyanski, S.
2016-01-01
Roč. 232, č. 3 (2016), s. 227-242 ISSN 0039-3223 R&D Projects: GA ČR GA16-07378S Institutional support: RVO:67985840 Keywords : diameter 2 property * midpoint locally uniformly rotund * Daugavet property Subject RIV: BA - General Mathematics Impact factor: 0.535, year: 2016 https://www.impan.pl/pl/wydawnictwa/czasopisma-i-serie-wydawnicze/studia- mathematica /all/232/3/91534/diameter-2-properties-and-convexity
Czech Academy of Sciences Publication Activity Database
Baše, Tomáš; Macháček, Jan; Hájková, Zuzana; Langecker, Jens; Kennedy, John David; Carr, MJ.
2015-01-01
Roč. 798, č. 1 (2015), s. 132-140 ISSN 0022-328X R&D Projects: GA ČR GAP205/10/0348 Institutional support: RVO:61388980 Keywords : Carboranethiol * Isomerisation * Thermal Stability * Closo-dicarbadodecaboranes * Closo-dicarbadodecaborane thiol Subject RIV: CA - Inorganic Chemistry Impact factor: 2.336, year: 2015
Czech Academy of Sciences Publication Activity Database
Kampf, A.R.; Marty, J.; Nash, B.P.; Plášil, Jakub; Kasatkin, A.V.; Škoda, R.
2012-01-01
Roč. 76, č. 7 (2012), s. 2803-2817 ISSN 0026-461X Institutional research plan: CEZ:AV0Z10100521 Keywords : calciodelrioite * new mineral * crystal structure * divanadate chain * delrioite * rossite * West Sunday mine, Colorado Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.212, year: 2012
GLOBAL JOURNAL OF AGRICULTURAL SCIENCES ISSN 1596-2903
African Journals Online (AJOL)
Ada Global
'Maputo, Declaration on Agriculture and food security in. Africa'. The Declaration ... last nine (9) years of military regime and the first nine (9) years of ... For Military. (1990-1998). 2.4. 1999. 2000. 2001. 2002. 2003. 2004. 2005. 2006. 2007. 2008. 947,690.0. 701,100.0. 1,018,000.0. 1,018,200.0. 1,226,000.0. 1,377,300.00.
ISSN 2073-9990 East Cent. Afr. J. surg
African Journals Online (AJOL)
Valued eMachines Customer
especially between 5 and 7years because fusion of the distal humeral physis peaks at age six.3 There are two major types of supracondylar humerus fractures extension (95% of cases) and flexion (5% of cases)1,2. While different ..... P.J. Walmsley, H.B. Kelly, J.E. Robb, I.H. Annan, D.E. Porter. Delay increases the need for.
Czech Academy of Sciences Publication Activity Database
Campa, D.; Vodička, Pavel; Pardini, Barbara; Naccarati, Alessio; Carrai, M.; Vodičková, Ludmila; Novotný, J.; Hemminki, K.; Försti, A.; Barale, R.; Canzian, F.
2010-01-01
Roč. 11, č. 1 (2010), s. 88-93 ISSN 1471-2350 R&D Projects: GA ČR GA310/05/2626 Institutional research plan: CEZ:AV0Z50390512 Keywords : colorectal cancer * TAS2R14 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.439, year: 2010
Czech Academy of Sciences Publication Activity Database
Kumar, S.; Vinu, A.; Šubrt, Jan; Bakardjieva, Snejana; Rayalu, S.; Teraoka, Y.; Labhsetwar, N.
2012-01-01
Roč. 198, 1-SI (2012), s. 125-132 ISSN 0920-5861 R&D Projects: GA MŠk LC523 Institutional support: RVO:61388980 Keywords : Ba substituted perovskite * catalyst * honeycomb * N 2O decomposition * perovskite * praseodymium manganate Subject RIV: CA - Inorganic Chemistry Impact factor: 2.980, year: 2012
Investigation of Laser Plasma Chemistry in CO2-N-2-H2O Using O-18 Labeled Water
Czech Academy of Sciences Publication Activity Database
Ferus, Martin; Kubelík, Petr; Juha, Libor; Civiš, Svatopluk
2009-01-01
Roč. 39, 3-4 (2009), s. 245-245 ISSN 0169-6149 R&D Projects: GA MŠk LC510; GA MŠk(CZ) LC528; GA ČR GA203/06/1278; GA MŠk LA08024 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z10100523 Keywords : LIDB plasma * atmosphere * isotopes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.053, year: 2009
Czech Academy of Sciences Publication Activity Database
Domínguez-Fernández, F.; López-Sanz, J.; Pérez-Mayoral, E.; Bek, David; Martín-Aranda, R. M.; López-Peinado, A. J.; Čejka, Jiří
2009-01-01
Roč. 1, č. 2 (2009), s. 241-243 ISSN 1867-3880 R&D Projects: GA AV ČR KAN100400701 Institutional research plan: CEZ:AV0Z40400503 Keywords : quinolines * heterogeneous catalysis * basicity Subject RIV: CF - Physical ; Theoretical Chemistry
Enhanced thermoelectric performance of n-type Bi2O2Se ceramics induced by Ge doping
Czech Academy of Sciences Publication Activity Database
Ruleová, P.; Plecháček, T.; Kašparová, J.; Vlček, Milan; Beneš, L.; Lostak, P.; Drašar, Č.
2018-01-01
Roč. 47, č. 2 (2018), s. 1459-1466 ISSN 0361-5235 R&D Projects: GA ČR(CZ) GA16-07711S Institutional support: RVO:61389013 Keywords : semiconductors * chalcogenides * x-ray diffraction Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 1.579, year: 2016
Czech Academy of Sciences Publication Activity Database
Nickschick, T.; Kämpf, H.; Flechsig, C.; Mrlina, Jan; Heinicke, J.
2015-01-01
Roč. 104, č. 8 (2015), s. 2107-2129 ISSN 1437-3254 R&D Projects: GA MŠk LM2010008 Institutional support: RVO:67985530 Keywords : Eger Rift * Cheb Basin * magmatic CO2 * CO2 gas flux studies * geoelectrics * gravity Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.133, year: 2015
Using of Photochemical H2O2/UVC Decontamination Cell for Heavily Polluted Waters
Czech Academy of Sciences Publication Activity Database
Žebrák, R.; Mašín, P.; Klusoň, Petr; Krystyník, Pavel
2014-01-01
Roč. 2014, č. 2 (2014), s. 55-62 ISSN 1804-0195. [Symposium ODPADOVÉ FÓRUM 2014. Hustopeče u Brna, 23.042014-23.04.2013] R&D Projects: GA MPO(CZ) FR-TI1/065 Institutional support: RVO:67985858 Keywords : photochemical oxidation * remediation * pilot scale Subject RIV: CI - Industrial Chemistry, Chemical Engineering http://www.wasteforum.cz/
(R )-2,2'-Bis[N'-(3,5-dichlorophenyl)ureido]-1,1'-binaphthalene chloroform disolvate
Czech Academy of Sciences Publication Activity Database
Holakovský, R.; Pojarová, Michaela; Dušek, Michal; Čejka, J.; Císařová, I.
2011-01-01
Roč. 67, č. 2 (2011), o384-o385 ISSN 1600-5368 Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : crystal structure * SHELX97 * binaphthalene Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.347, year: 2011
Czech Academy of Sciences Publication Activity Database
Laufek, F.; Vymazalová, A.; Drábek, M.; Drahokoupil, Jan; Chareev, D.A.; Kristavchuk, A.V.
2010-01-01
Roč. 17, 2a (2010), k76-k77 ISSN 1211-5894 Institutional research plan: CEZ:AV0Z10100520 Keywords : x-ray * crystal structure Subject RIV: BM - Solid Matter Physics ; Magnetism http://www.xray.cz/ms/bul2010-2a/laufek.pdf
Czech Academy of Sciences Publication Activity Database
Kortus, Štěpán; Srinivasan, Ch.; Forostyak, O.; Zápotocký, Martin; Ueta, Y.; Syková, E.; Chvátal, A.; Verkhratsky, A.; Dayanithi, G.
2016-01-01
Roč. 59, č. 6 (2016), s. 289-298 ISSN 0143-4160 R&D Projects: GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:67985823 Keywords : magnocellular neurosecretory cells * voltage-gated Ca2+ channels * intracellular Ca2+ stores * Ca2+ imaging * Ca2+ oscillations Subject RIV: FH - Neurology Impact factor: 3.707, year: 2016
Czech Academy of Sciences Publication Activity Database
Pospíšilová, Aneta; Filippov, Sergey K.; Bogomolova, Anna; Turner, S.; Sedláček, Ondřej; Matushkin, Nikolai; Černochová, Zulfiya; Štěpánek, Petr; Hrubý, Martin
2014-01-01
Roč. 4, č. 106 (2014), s. 61580-61588 ISSN 2046-2069 R&D Projects: GA ČR GA13-08336S; GA MŠk(CZ) LH14079 Grant - others:AV ČR(CZ) M200501201; AV ČR(CZ) ASCR/CONICET 2012CZ006 Program:M Institutional support: RVO:61389013 Keywords : glycogen * poly(2-alkyl-2-oxazoline) * hybrid copolymer Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.840, year: 2014
Interleukin-2 Therapy of Cancer
Czech Academy of Sciences Publication Activity Database
Bubeník, Jan
2004-01-01
Roč. 50, 3-4 (2004), s. 120-130 ISSN 0015-5500 R&D Projects: GA MZd NC7148; GA ČR GA301/04/0492; GA AV ČR IAA5052203 Institutional research plan: CEZ:AV0Z5052915 Keywords : interleukin 2 * cancer therapy Subject RIV: EC - Immunology Impact factor: 0.507, year: 2004
The Neutrons for Science Facility at SPIRAL-2
Czech Academy of Sciences Publication Activity Database
Ledoux, X.; Avrigeanu, M.; Avrigeanu, V.; Bém, Pavel; Fischer, U.; Majerle, Mitja; Mrázek, Jaromír; Negoita, F.; Novák, Jan; Simakov, S. P.; Šimečková, Eva
2014-01-01
Roč. 119, MAY (2014), s. 353-356 ISSN 0090-3752 Institutional support: RVO:61389005 Keywords : SPIRAL-2 * Neutron For Science * time-of-flight Subject RIV: BG - Nuclear , Atomic and Molecular Physics, Colliders Impact factor: 4.571, year: 2014
Journal Afrika Statistika ISSN 0852-0305 Testing independence of ...
African Journals Online (AJOL)
is the matricial representation of the vector x (resp. y) relative to the canonical basis of Rp. (resp. Rq). 2.2. The test .... identifying each vector with its matrix relative to canonical basis, we can write : ̂Λn j = rj. ∑ h=1. ̂p n jĥτ n jh ... The proposed method is achieved from the following algorithm: 1. Compute X n and for j = 1, ...
Fatty Acids are Key in 4-Hydroxy-2-Nonenal-Mediated Activation of Uncoupling Proteins 1 and 2
Czech Academy of Sciences Publication Activity Database
Malingriaux, E. A.; Rupprecht, A.; Gille, L.; Jovanovic, O.; Ježek, Petr; Jabůrek, Martin; Pohl, E. E.
2013-01-01
Roč. 8, č. 10 (2013), e77786 E-ISSN 1932-6203 R&D Projects: GA ČR(CZ) GAP302/10/0346 Institutional support: RVO:67985823 Keywords : mitochondrial uncoupling proteins * 4-hydroxy-2-nonenal * fatty acids Subject RIV: EA - Cell Biology Impact factor: 3.534, year: 2013
Czech Academy of Sciences Publication Activity Database
Tepavitcharova, S.; Havlíček, D.; Matulková, I.; Rabadjieva, D.; Gergulova, R.; Plocek, Jiří; Němec, I.; Císařová, I.
2016-01-01
Roč. 1120, SEP (2016), s. 42-49 ISSN 0022-2860 Institutional support: RVO:61388980 Keywords : [Zn(gly)I2], [Zn(gly)2I2] * [Zn3(H2O)4(μ-gly)2I6] * Crystal structure * Vibrational spectra * Thermal behaviour Subject RIV: CA - Inorganic Chemistry Impact factor: 1.753, year: 2016
Czech Academy of Sciences Publication Activity Database
Kar, T.; Ponec, Robert; Sannigrahi, A. B.
2001-01-01
Roč. 105, č. 32 (2001), s. 7737-7744 ISSN 1089-5639 Institutional research plan: CEZ:AV0Z4072921 Keywords : gas-phase * cation-Pi-interactions * induced dissociation experiments Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.630, year: 2001
Czech Academy of Sciences Publication Activity Database
Chewpraditkul, W.; Sakthong, O.; Chewpraditkul, Wa.; Yawai, N.; Szczesniak, T.; Swiderski, L.; Moszynski, M.; Kurosawa, S.; Murakami, R.; Horiai, T.; Yoshikawa, A.; Nikl, Martin
2016-01-01
Roč. 92, Sep (2016), s. 49-53 ISSN 1350-4487 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : coincidence time resolution * energy resolution * (La,Gd) 2 Si 2 O 7 :Ce * Gd 2 SiO 5 :Ce * scintillation decays Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016
Czech Academy of Sciences Publication Activity Database
Henych, Jiří; Kormunda, M.; Šťastný, Martin; Janoš, P.; Vomáčka, Petr; Matoušek, J.; Štengl, Václav
2017-01-01
Roč. 144, AUG (2017), s. 26-35 ISSN 0169-1317 R&D Projects: GA MŠk(CZ) LM2015073 Institutional support: RVO:61388980 Keywords : Montmorillonite * Parathion methyl * Plasma treatment * TiO2 /CeO2 composites Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 3.101, year: 2016
Czech Academy of Sciences Publication Activity Database
Štengl, Václav; Henych, Jiří; Vomáčka, Petr; Slušná, Michaela
2013-01-01
Roč. 89, č. 5 (2013), s. 1038-1046 ISSN 0031-8655 Institutional support: RVO:61388980 Keywords : GRAPHENE OXIDE * OPTICAL-PROPERTIES * NANOPARTICLES Subject RIV: CA - Inorganic Chemistry Impact factor: 2.684, year: 2013
Obesity as a causal risk factor for deep venous thrombosis
DEFF Research Database (Denmark)
Klovaite, Jolanta; Benn, M; Nordestgaard, B G
2015-01-01
available for 87, 574 individuals of Danish descent from the adult general population. All subjects completed questionnaires and were genotyped for the FTO rs9939609 variant. MAIN OUTCOME MEASURE: First events of DVT with or without pulmonary embolism (PE). ANALYSIS: The results were assessed using Cox...... and 3.4 (2.6-4.6) in severely obese compared with normal-weight individuals. For DVT complicated by PE, corresponding hazard ratios (95% CI) were 1.2 (0.8-1.8), 2.1 (1.3-3.5) and 5.1 (2.8-9.2). FTO AA versus TT genotype was associated with a 2.4% increase in BMI with hazard ratios (95% CI) of 1.09 (0.......e. those aged >60 years and homozygous for Factor V Leiden) was 35% in obese individuals and 18% in normal-weight individuals. CONCLUSION: A strong observational association between obesity and DVT with or without PE, supported by a direct genetic association between the obesity-specific locus FTO and DVT...
Effect of Silver Doping on the TiO2 for Photocatalytic Reduction of CO2
Czech Academy of Sciences Publication Activity Database
Kočí, K.; Matějů, K.; Obalová, L.; Krejčíková, Simona; Lacný, Z.; Plachá, D.; Čapek, L.; Hospodková, Alice; Šolcová, Olga
2010-01-01
Roč. 96, 3-4 (2010), s. 239-244 ISSN 0926-3373 R&D Projects: GA ČR GD203/08/H032 Institutional research plan: CEZ:AV0Z40720504; CEZ:AV0Z10100521 Keywords : Ag doping * TiO2 * photocatalysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.749, year: 2010
Czech Academy of Sciences Publication Activity Database
Reshak, Ali H; Chen, X.; Kityk, I. V.; Auluck, S.
2008-01-01
Roč. 11, 3-4 (2008), s. 33-39 ISSN 1359-0286 Institutional research plan: CEZ:AV0Z60870520 Keywords : optical properties (linear and non-linear) Subject RIV: BO - Biophysics Impact factor: 2.976, year: 2008
Czech Academy of Sciences Publication Activity Database
Hänninen, O. O.; Lebret, E.; Ilacqua, V.; Katsouyanni, K.; Künzli, N.; Šrám, Radim; Jantunen, M.
2004-01-01
Roč. 38, - (2004), s. 6411-6423 ISSN 1352-2310 Institutional research plan: CEZ:AV0Z5039906 Keywords : Exposure * particle * EXPOLIS Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 2.562, year: 2004
Czech Academy of Sciences Publication Activity Database
Palygin, O.; Lalo, U.; Verkhratsky, Alexei; Pankratov, Y.
2010-01-01
Roč. 48, č. 4 (2010), s. 225-231 ISSN 0143-4160 R&D Projects: GA ČR GA305/08/1384 Institutional research plan: CEZ:AV0Z50390703 Keywords : Astroglia * Ca2+ signalling * NMDA receptors Subject RIV: FH - Neurology Impact factor: 3.553, year: 2010
Czech Academy of Sciences Publication Activity Database
Sabat, Nazarii; Smolen, Sabina; Nauš, Petr; Perlíková, Pavla; Cebová, M.; Poštová Slavětínská, Lenka; Hocek, Michal
2017-01-01
Roč. 49, č. 20 (2017), s. 4623-4650 ISSN 0039-7881 R&D Projects: GA ČR(CZ) GA16-00178S; GA MZd(CZ) NV15-31984A Grant - others:AV ČR(CZ) AP1501 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:61388963 Keywords : deazapurines * pyrrolo[2,3-d]pyrimidines * nucleobases * Suzuki-Miyaura cross-coupling * deprotection * demethylation Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 2.650, year: 2016
Czech Academy of Sciences Publication Activity Database
Kotlan, Jiří; Seshadri, R.C.; Sampath, S.; Ctibor, Pavel; Pala, Zdeněk; Mušálek, Radek
2015-01-01
Roč. 41, č. 9 (2015), s. 11169-11176 ISSN 0272-8842 R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : X-ray methods * Grain size * Electrical properties * Insulators * Dielectric strength Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 2.758, year: 2015 http://www.sciencedirect.com/science/article/pii/S0272884215009955#
Czech Academy of Sciences Publication Activity Database
Pisanelli, I.; Kujawa, M.; Spadiut, O.; Kittl, R.; Halada, Petr; Volc, Jindřich; Mozuch, M. D.; Kersten, P.; Haltrich, D.; Peterbauer, C.
2009-01-01
Roč. 142, č. 2 (2009), s. 97-106 ISSN 0168-1656 Institutional research plan: CEZ:AV0Z50200510 Keywords : Pyranose 2-oxidase * Phanerochaete chrysosporium * Lignocellulose degradation Subject RIV: CE - Biochemistry Impact factor: 2.881, year: 2009
Properties of the divalent-Yb compound YbAu.sub.2./sub.Si.sub.2./sub. under extreme conditions
Czech Academy of Sciences Publication Activity Database
Kaštil, Jiří; Míšek, Martin; Kamarád, Jiří; Arnold, Zdeněk; Vlášková, K.; Prchal, J.; Diviš, M.; Doležal, P.; Prokleška, J.; Valenta, J.; Fikáček, J.; Rudajevová, A.; Kriegner, D.
2017-01-01
Roč. 505, Jan (2017), s. 41-44 ISSN 0921-4526 R&D Projects: GA ČR GA15-03777S Institutional support: RVO:68378271 Keywords : YbAu 2 Si 2 * valence state * high pressure * GGA method Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.386, year: 2016
Czech Academy of Sciences Publication Activity Database
Hichri, I.; Muhovski, Y.; Clippe, A.; Žižková, Eva; Dobrev, Petre; Motyka, Václav; Lutts, S.
2016-01-01
Roč. 39, č. 1 (2016), s. 62-79 ISSN 0140-7791 R&D Projects: GA ČR(CZ) GAP506/11/0774 Institutional support: RVO:61389030 Keywords : Arabidopsis thaliana * Solanum lycopersicum * DREB2 Subject RIV: EF - Botanics Impact factor: 6.173, year: 2016
A convenient route to 2-hydroxy- and 2,15-dihydroxyhexahelicene
Czech Academy of Sciences Publication Activity Database
Teplý, Filip; Stará, Irena G.; Starý, Ivo; Kollárovič, Adrian; Luštinec, Daniel; Krausová, Zuzana; Šaman, David; Fiedler, Pavel
-, č. 25 (2007), s. 4244-4250 ISSN 1434-193X R&D Projects: GA ČR GA203/06/1792; GA MŠk LC512 Grant - others:6th Framework Programme(XE) LSHC-CT-2006-015847 Institutional research plan: CEZ:AV0Z40550506 Source of funding: R - rámcový projekt EK Keywords : alkynes * arenes * cyclotrimerisation * fused-ring systems Subject RIV: CC - Organic Chemistry Impact factor: 2.914, year: 2007
Czech Academy of Sciences Publication Activity Database
Loewenstein, T.; Nonomura, K.; Yoshida, T.; Michaelis, E.; Wöhrle, D.; Rathouský, Jiří; Wark, M.; Schlettwein, D.
2006-01-01
Roč. 153, č. 4 (2006), A699-A704 ISSN 0013-4651 Institutional research plan: CEZ:AV0Z40400503 Keywords : hybrid thin films * ZnO electrodes * photoelectrochemical performance Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.387, year: 2006
Czech Academy of Sciences Publication Activity Database
Žabka, Ján; Šimková, Ludmila; Jalový, Z.; Polášek, Miroslav
2014-01-01
Roč. 20, č. 3 (2014), s. 233-247 ISSN 1469-0667 R&D Projects: GA ČR GAP206/11/0727 Institutional support: RVO:61388955 Keywords : 2,2-dinitroethene-1,1-diamine * electrospray ionization * chemical ionization Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.000, year: 2014
Rheological properties of homogeneous and heterogeneous poly(2-hydroxyethyl methacrylate) hydrogels
Czech Academy of Sciences Publication Activity Database
Karpushkin, Evgeny; Dušková-Smrčková, Miroslava; Remmler, T.; Lapčíková, Monika; Dušek, Karel
2012-01-01
Roč. 61, č. 2 (2012), s. 328-336 ISSN 0959-8103 R&D Projects: GA AV ČR KAN200520804 Institutional research plan: CEZ:AV0Z40500505 Keywords : hydrogel * 2-hydroxyethyl methacrylate * phase separation Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.125, year: 2012
Effect of FeH-zeolite structure and Al-Lewis sites on N2O decomposition and NO/NO2-assisted reaction
Czech Academy of Sciences Publication Activity Database
Kaucký, Dalibor; Sobalík, Zdeněk; Schwarze, Michael; Vondrová, Alena; Wichterlová, Blanka
2006-01-01
Roč. 238, č. 2 (2006), s. 293-300 ISSN 0021-9517 R&D Projects: GA ČR GP104/02/D124; GA AV ČR 1ET400400413 Institutional research plan: CEZ:AV0Z40400503 Keywords : N2O decomposition * NO/NO2 assistance * Fe-zeolites * Fe-ferrierite Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.533, year: 2006
Czech Academy of Sciences Publication Activity Database
Macháček, J.; Kostka, Petr; Liška, M.; Zavadil, Jiří; Gedeon, O.
2011-01-01
Roč. 357, č. 14 (2011), s. 2562-2570 ISSN 0022-3093 R&D Projects: GA ČR GA104/08/0734; GA MPO 2A-1TP1/063 Institutional research plan: CEZ:AV0Z40320502; CEZ:AV0Z20670512 Keywords : vibrational spectrum * tellurite glass * ab initio molecular simulation Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 1.537, year: 2011
Czech Academy of Sciences Publication Activity Database
Olds, T.A.; Plášil, Jakub; Kampf, A.R.; Spano, T.; Haynes, P.; Carlson, S.M.; Burns, P.C.; Simonetti, A.; Mills, O.P.
2018-01-01
Roč. 103, č. 1 (2018), s. 143-150 ISSN 0003-004X R&D Projects: GA ČR(CZ) GA15-12653S Institutional support: RVO:68378271 Keywords : Leesite * sheet anion topology * schoepite * uranium * uraninite * crystal structure Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 2.021, year: 2016
Synthesis of nanostructured TiO2 (anatase) and TiO2(B) in ionic liquids
Czech Academy of Sciences Publication Activity Database
Mansfeldová, Věra; Lásková, Barbora; Krýsová, Hana; Zukalová, Markéta; Kavan, Ladislav
2014-01-01
Roč. 230, JUL 2014 (2014), s. 85-90 ISSN 0920-5861 R&D Projects: GA ČR GA13-07724S; GA MŠk 7E09117 Grant - others:European Commission(XE) NMP-229036 Institutional support: RVO:61388955 Keywords : TiO2(B) * ionic liquid * electrochemistry Subject RIV: CG - Electrochemistry Impact factor: 3.893, year: 2014
Misfit analysis in lamellar microstructure in NbSi.sub.2./sub./MoSi.sub.2./sub. duplex crystals
Czech Academy of Sciences Publication Activity Database
Paidar, Václav; Nakano, T.
2014-01-01
Roč. 607, Sep (2014), 48-49 ISSN 0925-8388 R&D Projects: GA ČR GAP108/12/0144 Institutional support: RVO:68378271 Keywords : intermetallic alloys and compounds * transition metal disilicides * interfaces * segregation * lattice misfit Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.999, year: 2014
Czech Academy of Sciences Publication Activity Database
Mrázek, Jan; Potel, M.; Buršík, Jiří; Mráček, A.; Kallistová, Anna; Jonášová, Šárka; Boháček, Jan; Kašík, Ivan
2015-01-01
Roč. 168, November (2015), s. 159-167 ISSN 0254-0584 Institutional support: RVO:67985882 ; RVO:68081723 ; RVO:67985831 Keywords : Ceramics * Inorganic compounds * Optical materials Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering; JG - Metallurgy (UFM-A); CB - Analytical Chemistry, Separation (GLU-S) Impact factor: 2.101, year: 2015
Czech Academy of Sciences Publication Activity Database
Chewpraditkul, W.; Sakthong, O.; Pattanaboonmee, N.; Chewpraditkul, We.; Szczesniak, T.; Swiderski, L.; Moszynski, M.; Kamada, K.; Yoshikawa, A.; Nikl, Martin
2017-01-01
Roč. 468, Jun (2017), 395–398 ISSN 0022-0248 R&D Projects: GA ČR GA16-15569S Institutional support: RVO:68378271 Keywords : Ce-doping * Czochralski method * Gd 2 YAl 2 Ga 3 O 12 :Ce * Lu 2 YAl 2 Ga 3 O 12 :Ce * luminescence * scintillator materials Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.751, year: 2016
Enzymic resolution of 2-substituted cyclohexanols through lipase-mediated esterification
Czech Academy of Sciences Publication Activity Database
Wimmer, Zdeněk; Skouridou, V.; Zarevúcka, Marie; Šaman, David; Kolisis, F. N.
2004-01-01
Roč. 15, - (2004), s. 3911-3917 ISSN 0957-4166 R&D Projects: GA MŠk ME 692 Institutional research plan: CEZ:AV0Z4055905 Keywords : enzymic resolution * 2-substituted cyclohexanols * lipase -mediated esterification Subject RIV: CC - Organic Chemistry Impact factor: 2.386, year: 2004
Levitation at 90.2 K and its applications
Czech Academy of Sciences Publication Activity Database
Muralidhar, M.; Sakai, N.; Jirsa, Miloš; Murakami, M.; Hirabayashi, I.
2008-01-01
Roč. 6, 3/4 (2008), s. 269-291 ISSN 1067-6147 Institutional research plan: CEZ:AV0Z10100520 Keywords : ternary superconductors * LREBa 2 Cu 3 O y * critical currents * vortex pinning * nanoscopic defects Subject RIV: BM - Solid Matter Physics ; Magnetism
Czech Academy of Sciences Publication Activity Database
Campa, D.; Pastore, M.; Gentiluomo, M.; Talar-Wojnarowska, R.; Kupcinskas, J.; Malecka-Panas, E.; Neoptolemos, J. P.; Niesen, W.; Vodička, Pavel; Delle Fave, G.; Bueno-de-Mesquita, H. B.; Gazouli, M.; Pacetti, P.; Di Leo, M.; Ito, H.; Klüter, H.; Souček, P.; Corbo, V.; Yamao, K.; Hosono, S.; Kaaks, R.; Vashist, Y.; Gioffreda, D.; Strobel, O.; Shimizu, Y.; Dijk, F.; Andriulli, A.; Ivanauskas, A.; Bugert, P.; Tavano, F.; Vodičková, L.; Zambon, C.F.; Lovecek, M.; Landi, S.; Key, T. J.; Boggi, U.; Pezzilli, R.; Jamroziak, K.; Mohelníková-Duchoňová, B.; Mambrini, A.; Bambi, F.; Busch, O.; Pazienza, V.; Valente, R.; Theodoropoulos, G.E.; Hackert, T.; Capurso, G.; Cavestro, G.M.; Pasquali, C.; Basso, D.; Sperti, C.; Matsuo, K.; Büchler, M.; Khaw, K. T.; Izbicki, J.; Costello, E.; Katzke, V.; Michalski, Ch.; Stepien, A.; Rizzato, C.; Canzian, F.
2016-01-01
Roč. 7, č. 35 (2016), s. 57011-57020 ISSN 1949-2553 R&D Projects: GA ČR GAP301/12/1734 Institutional support: RVO:68378041 Keywords : pancreatic cancer * CDKN2A * single nucleotide polymorphisms Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.168, year: 2016
Czech Academy of Sciences Publication Activity Database
Bakardjiev, Mario; Štíbr, Bohumil; Holub, Josef; Růžička, A.; Padělková, Z.
2012-01-01
Roč. 41, č. 23 (2012), s. 7151-7155 ISSN 1477-9226 R&D Projects: GA ČR(CZ) GAP207/11/0705 Keywords : trialkylaluminum reagens * Iron complexes * reduction * biscarborane * B10C2H12 Subject RIV: CA - Inorganic Chemistry Impact factor: 3.806, year: 2012
A Comparative Study of TiO2-supported and Bulk Co-Mn-Al Catalysts for N2O Decomposition
Czech Academy of Sciences Publication Activity Database
Karásková, K.; Chromčáková, Ž.; Študentová, S.; Matějka, V.; Jirátová, Květa; Obalová, L.
2012-01-01
Roč. 191, č. 1 (2012), s. 112-115 ISSN 0920-5861 R&D Projects: GA ČR GA106/09/1664 Institutional support: RVO:67985858 Keywords : nitrous oxide * catalytic decomposition * layered double hydroxides Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.980, year: 2012
Reactions of State-Selected Atomic Oxygen Ions O+(S-4, D-2, P-2) with Methane
Czech Academy of Sciences Publication Activity Database
de Miranda, B. C.; Romanzin, C.; Chefdeville, M.; Vuitton, V.; Žabka, Ján; Polášek, Miroslav; Alcaraz, C.
2015-01-01
Roč. 119, č. 23 (2015), s. 6082-6098 ISSN 1089-5639 R&D Projects: GA ČR(CZ) GA14-19693S; GA MŠk(CZ) LD14024 Institutional support: RVO:61388955 Keywords : CHARGE-TRANSFER REACTIONS * PHOTOELECTRON-PHOTOION COINCIDENCE * TRANSLATIONAL ENERGY-DEPENDENCE Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.883, year: 2015
Czech Academy of Sciences Publication Activity Database
Goněc, T.; Pospíšilová, Š.; Holanová, L.; Straník, J.; Černíková, A.; Pudelkova, V.; Kos, J.; Oravec, Michal; Kollár, P.; Čížek, A.; Jampílek, J.
2016-01-01
Roč. 21, č. 9 (2016), č. článku 1189. ISSN 1420-3049 R&D Projects: GA MŠk(CZ) LM2015061; GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : carbamates * hydroxynaphthalene-carboxamides * in vitro antibacterial activity * in vitro cytotoxicity assay * structure-activity relationships Subject RIV: EH - Ecology, Behaviour Impact factor: 2.861, year: 2016
Czech Academy of Sciences Publication Activity Database
Horák, Pavel; Knoll, Aleš; Dvořák, J.
2006-01-01
Roč. 47, č. 4 (2006), s. 361-364 ISSN 1234-1983 R&D Projects: GA AV ČR 1QS500450578 Institutional research plan: CEZ:AV0Z50450515 Keywords : canis familiaris * FSCN2 gene * PCR-RFLP Subject RIV: EB - Genetics ; Molecular Biology
Czech Academy of Sciences Publication Activity Database
Stork, B.; Engelke, M.; Frey, J.; Hořejší, Václav; Hamm-Baarke, A.; Schraven, B.; Kurosaki, T.; Wienands, J.
2004-01-01
Roč. 21, č. 5 (2004), s. 681-691 ISSN 1074-7613 R&D Projects: GA MŠk LN00A026 Institutional research plan: CEZ:AV0Z5052915 Keywords : NTAL * Grb2 * lymphocyte Subject RIV: EC - Immunology Impact factor: 15.448, year: 2004
AFRREV STECH, Vol. 3(2) May, 2014
African Journals Online (AJOL)
Toshiba
2014-05-07
May 7, 2014 ... ... 2014: 127-135. ISSN 2225-8612 (Print) ISSN 2227-5444 (Online) ... SECONDARY SCHOOLS: AN ALTERNATIVE ..... Ashmore, A.D. et, al (1957). Problem ... environment focus on global warning, green house effect and.
TiO2 Nanotubes Supported NiW Hydrodesulphurization Catalysts: Characterization and Activity
Czech Academy of Sciences Publication Activity Database
Palcheva, R.; Dimitrov, L.; Tyuliev, G.; Spojakina, A.; Jirátová, Květa
2013-01-01
Roč. 265, JAN 15 (2013), s. 309-313 ISSN 0169-4332 Institutional support: RVO:67985858 Keywords : nano-structured TiO2 * NiW catalysts * XPS Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.538, year: 2013
Cobalt Oxide Catalysts Supported on CeO2–TiO2 for Ethanol Oxidation and N2O Decomposition.
Czech Academy of Sciences Publication Activity Database
Jirátová, Květa; Kovanda, F.; Balabánová, Jana; Koloušek, D.; Klegová, A.; Pacultová, K.; Obalová, L.
2017-01-01
Roč. 12, č. 1 (2017), s. 121-139 ISSN 1878-5190. [Pannonian Symposium on Catalysis. Siófok, 19.09.2016-23.09.2016] R&D Projects: GA ČR GA14-13750S Institutional support: RVO:67985858 Keywords : cobalt oxide catalysts * ethanol total oxidation * N2O decomposition Subject RIV: CI - Industrial Chemistry, Chemical Engineering OBOR OECD: Chemical process engineering Impact factor: 1.264, year: 2016
Ablation of (GeS2)0.3(Sb2S3)0.7 glass with an ultra – violet nano-second laser
Czech Academy of Sciences Publication Activity Database
Knotek, P.; Návesník, J.; Černohorský, T.; Kincl, Miloslav; Vlček, Milan; Tichý, Ladislav
2015-01-01
Roč. 64, April (2015), s. 42-50 ISSN 0025-5408 Institutional support: RVO:61389013 Keywords : chalcogenides * glass * atomic force microscopy Subject RIV: CA - Inorganic Chemistry Impact factor: 2.435, year: 2015 http://www.sciencedirect.com/science/article/pii/S0025540814007843
Czech Academy of Sciences Publication Activity Database
Kamada, K.; Hishinuma, K.; Kurosawa, S.; Yamaji, A.; Shoji, Y.; Pejchal, Jan; Ohashi, Y.; Yokota, Y.; Yoshikawa, A.
2016-01-01
Roč. 34, č. 8 (2016), s. 796-801 ISSN 1002-0721 Institutional support: RVO:68378271 Keywords : eutectic * scintillator * micro-pulling down method * rare earths Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.429, year: 2016
Supercritical CO2 Extraction of Salvia officinalis L
Czech Academy of Sciences Publication Activity Database
Aleksovski, S.A.; Sovová, Helena
2007-01-01
Roč. 40, č. 2 (2007), s. 239-245 ISSN 0896-8446 R&D Projects: GA AV ČR(CZ) IAA4072102 Grant - others:GA_(MK) 40108601/0 Institutional research plan: CEZ:AV0Z40720504 Keywords : supercritical fluid extraction * essential oil * collection efficiency Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.189, year: 2007
Czech Academy of Sciences Publication Activity Database
Parker, A. E.; Jain, C.; Schoemaecker, C.; Szriftgiser, P.; Votava, Ondřej; Fittschen, Ch.
2011-01-01
Roč. 103, č. 3 (2011), s. 725-733 ISSN 0946-2171 Institutional research plan: CEZ:AV0Z40400503 Keywords : PRODUCT FORMATION * QUANTUM YIELDS * NM Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.189, year: 2011
CHARACTERIZATION OF CARBON NANOFIBERS/ ZrO 2 CERAMIC MATRIX COMPOSITE
Czech Academy of Sciences Publication Activity Database
Duszová, A.; Morgiel, J.; Bastl, Zdeněk; Mihály, J.; Dusza, J.
2013-01-01
Roč. 58, č. 2 (2013), s. 459-463 ISSN 1733-3490 Institutional support: RVO:61388955 Keywords : carbon nanofibers * nanocomposites * transmission electron microscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.763, year: 2013
Czech Academy of Sciences Publication Activity Database
Večeřa, M.; Gyepes, R.; Lamač, Martin
2017-01-01
Roč. 232, č. 3 (2017), s. 457-459 ISSN 1433-7266 R&D Projects: GA ČR(CZ) GA14-08531S Institutional support: RVO:61388955 Keywords : crystal structure * C20H27ClN2OTi * physical chemistry Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 0.152, year: 2016
Dr Jekyll and Mr Hyde: a strange case of 5-ethynyl-2 '-deoxyuridine and 5-ethynyl-2 '- deoxycytidine
Czech Academy of Sciences Publication Activity Database
Ligasová, A.; Liboska, Radek; Friedecký, D.; Mičová, K.; Adam, T.; Oždian, T.; Rosenberg, Ivan; Koberna, K.
2016-01-01
Roč. 6, č. 1 (2016), č. článku 150172. ISSN 2046-2441 R&D Projects: GA MZd NV15-31604A Institutional support: RVO:61388963 Keywords : cytidine deaminase * dCMP deaminase * 5-ethynyl-2 '-deoxyuridine * 5-ethynyl-2 '-deoxycytidine * DNA replication Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.481, year: 2016 http://rsob.royalsocietypublishing.org/content/6/1/150172
Czech Academy of Sciences Publication Activity Database
Löw, I.; Bubrin, M.; Paretzki, A.; Fiedler, Jan; Záliš, Stanislav; Kaim, W.
2017-01-01
Roč. 455, č. 2 (2017), s. 540-548 ISSN 0020-1693 R&D Projects: GA MŠk LD14129 Grant - others:COST(XE) CM1202 Institutional support: RVO:61388955 Keywords : BIAN diimine ligand * Carbonylmetal complexes * Electron transfer Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 2.002, year: 2016
Oxygen Atom Exchange between Gaseous CO2 and TiO2 Nanoclusters
Czech Academy of Sciences Publication Activity Database
Civiš, Svatopluk; Ferus, Martin; Zukalová, Markéta; Zukal, Arnošt; Kavan, Ladislav; Jordan, K. D.; Sorescu, D. C.
2015-01-01
Roč. 119, č. 7 (2015), s. 3605-3612 ISSN 1932-7447 R&D Projects: GA ČR GA13-07724S; GA ČR(CZ) GAP108/12/0814; GA MŠk(CZ) LD13060; GA MŠk LD14115 Grant - others:COST(XE) CM1104 Institutional support: RVO:61388955 Keywords : TiO2 * carbon dioxide * nanoparticles Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.509, year: 2015
Growth kinetics of racemic heptahelicene-2-carboxylic acid nanowires on calcite (104)
Czech Academy of Sciences Publication Activity Database
Einax, M.; Richter, T.; Nimmrich, M.; Rahe, P.; Stará, Irena G.; Starý, Ivo; Kühnle, A.; Maass, P.
2016-01-01
Roč. 145, č. 13 (2016), č. článku 134702. ISSN 0021-9606 Institutional support: RVO:61388963 Keywords : heptahelicene-2-carboxylic acid nanowires * nc-AFM * calcite * growth kinetics Subject RIV: CC - Organic Chemistry Impact factor: 2.965, year: 2016
Czech Academy of Sciences Publication Activity Database
Plešek, Jaromír; Grüner, Bohumír; Báča, Jiří; Fusek, Jiří; Císařová, I.
2002-01-01
Roč. 649, č. 2 (2002), s. 181-190 ISSN 0022-328X R&D Projects: GA ČR GA104/99/1096; GA ČR GA203/99/M037 Institutional research plan: CEZ:AV0Z4032918 Keywords : bis(1,2-dicarbollido)-3- cobalt (1-)ate ion * carbaboranes * metallacarboranes Subject RIV: CA - Inorganic Chemistry Impact factor: 1.901, year: 2002
Czech Academy of Sciences Publication Activity Database
Tylová, Tereza; Kameník, Zdeněk; Flieger, Miroslav; Olšovská, Jana
2011-01-01
Roč. 74, 1-2 (2011), s. 19-27 ISSN 0009-5893 R&D Projects: GA MŠk 1M06011 Institutional research plan: CEZ:AV0Z50200510 Keywords : Column liquid chromatography * Sub-2 mu m particles * Acquity BEH C18 column Subject RIV: EE - Microbiology, Virology Impact factor: 1.195, year: 2011
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...
African Journals Online (AJOL)
Hp 630 Dual Core
located deep to the hypothenar muscles with attachment to the metacarpophalangeal joint of the little finger by a fibrous band. Marginal excision of the tumour was done. .... Brand M.G., Gelberman R.H. Lipoma of the flexor digitorum superficialis causing triggering at the carpal canal and median nerve compression. J. Hand ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
Most of these complications can be prevented by patientss education on self footcare .... 161(60.1%), smoking of cigarette causes poor circulation affecting the feet 161 .... This can be explained by the fact that higher level of education might.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...
African Journals Online (AJOL)
Hp 630 Dual Core
O. Kenneth Johnson. Choma General Hospital, Choma, Zambia. Current Institution College of Medicine, University of Malawi. СФФЗХТСРЖЗРЕЗ ЦС O. Kenneth Johnson, Email: okjohnsonsj@jesuits.net. КЗ ГШЗФГЙЗ ЦЛПЗ ИСФ КЗГОЛРЙ ГИЦЗФ ПЛЖ ГРЖ ОСЩЗФ ИЗПСФГО ХКГИЦ ИФГЕЦЧФЗ ЛР ГЖЧОЦ ПЗР.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J ...
African Journals Online (AJOL)
Hp 630 Dual Core
29. Hesdorffer DC,Ghajar J, Iacono L. Predictors of compliance with the evidence based guidelines for traumatic brain injury care: a survey of United States trauma centers. J. Trauma 2002;52:1202 09. 30. Chafi S, Barnes SA, Millar D, Sobrino J, Kudyakov R, Berryman BS et al. Suboptimal compliance with evidence based ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...
African Journals Online (AJOL)
Hp 630 Dual Core
birth weight likewise the findings obtained by Homa et al6 signifying low birth weight to not be a direct risk for developing small bowel obstruction in newborns. But this observation was statistically insignificant in this study. Most of the neonates were delivered at term similar to the results obtained by another surveyor6 this ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J.
African Journals Online (AJOL)
Hp 630 Dual Core
Key words: laparoscopic, open, cholecystectomy, conversion. Introduction. Gallbladder diseases are very common disease nowadays. They comprise a large spectrum of disorders caused by alterations in bile composition and biliary function, placing a substantial burden on inpatient and outpatient resources. complicated ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J.
African Journals Online (AJOL)
Hp 630 Dual Core
genital mutilation. Many theories have suggested reasons for the ancient origin of ritual circumcision social cohesion, increased fertility, and the numbers in a tribal group in a competitive world. The threats that face us today famine, pollution, viral plagues and conflicts are largely due to overpopulation. It is true that medicine ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
palpitations and anxiety, died suddenly and postmortem examination .... and hypertension stabilized with α blocker medications before given β blockers and ... Perros P. Phaeochromocytomas presenting as acute crises after beta blockade.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J.
African Journals Online (AJOL)
Hp 630 Dual Core
Younger children are at the highest risk for accidental foreign body ... incidence has been attributed to several factors among younger children, ... Lung abscess ... cases, pulmonary infection with atelectasis in 1(1.3%) case, pulmonary infection ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J.
African Journals Online (AJOL)
Hp 630 Dual Core
Oesophageal FB poses a management challenge to the Otorhinolaryngologist and its management modalities depends ... mucosa after FB extraction, outcome of intervention, duration of hospital stay after surgical intervention, and ..... Ann Afr Med 2006; 5:52 5. 21. Muir AD, White J, McGuigan JA,McManus KG, Graham AN.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...
African Journals Online (AJOL)
Hp 630 Dual Core
compared the perioperative complication rates between ambulatory and in patient cleft lip patients in two hospitals across two countries, the United States and Austaralia Rosen et al1found a 3.3% (n 91) and 7.1% (n 14) readmission rates in the out patient and in patient of the Childrenss Hospital, Los Angeles respectively ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
injuries cause about 9 deaths for every 100,000 persons, most of whom are .... admitted in just eight months in one hospital may indicate that the incidence at ... men are usually the bread winners in most homes and therefore responsible for ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
axonal injury was strong predictor of outcome, P 0.0015 (Table 6). Table 1. .... Many authors noted that severe and moderate head injuries were dynamic processes that progress with .... Selladurai BM, Jayakumar R, Tan YY, Low HC. Outcome ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
impacted on outcome yet it was not the subject of this evaluation. .... prevalent in developing countries with low socioeconomic status like ours23, 24 ... Ajaz Ahmad Malik 27 and Wabwire15 in Turkey and Kenya in 2010 and ... perforation due to diverticular disease and cancer (16 70%) as the leading causes of peritonitis.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
Epidemiology of Burns in Patients ged 0 – 13 Years at a Paediatric Hospital in Kenya. ... morbidity, disability, and mortality for burns victims.6 Socio economic factors .... using a private vehicle (77 of 115, 70%) whilst a taxi or public transport.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
Lumbar disc degenerative Disease (LDDD) is the most common cause of low ... affected by degenerative changes, as it is a part of spine, which is subjected .... deviation, were used to summarise patient demographic and MR imaging findings.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
Countries in the Afro Asian stone belt (stretching from Egypt and Sudan, through the Middle East, India, Pakistan, Burma, Thailand, Indonesia and the Philippines) falling within the .... BJU International, 89(suppl.1): 62 68,. 2002. 10. J.U.V. Monu, Pattern of urolithiasis in Benin City, Nigeria. Journal of the national medical.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J.
African Journals Online (AJOL)
Hp 630 Dual Core
(after prostate and lung cancer in males and breast and lung cancer in females)5. ... lymph nodes for localized disease and the procedure results in cure in .... Forty seven patients received palliative treatments in the form of .... Health education.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J.
African Journals Online (AJOL)
Hp 630 Dual Core
Presentation and Pattern of Paediatric Head Injury in a Nigerian Tertiary Care Centre: ... assaults, recreational activities (sports, bicycle related injuries) and child .... The most common form of head injury encountered in our study was the mild ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...
African Journals Online (AJOL)
Hp 630 Dual Core
1Department of Surgery, Mother Kevin Post graduate medical School , Uganda Martyrs. University. .... end of collection, data was transferred to Medcalc Biomedical statistical software version .... Rodolfo et al10 in Mexico reported a similar.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
Hospital Acquired Infection (HAI) increases morbidity, mortality and ... radiographic evidence of pneumonia or bronchitis.1 A surgical site infection (SSI) often ... multiply antibiotic resistant microbes, poor laboratory backup, poor funding and non .... because in most sub Saharan hospitals the young with acute illness are the ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...
African Journals Online (AJOL)
Hp 630 Dual Core
March/April 2015 Volume 20 (1). Tumor marker CA 125 level was 96.7 U. patient was taken for staging laparotomy which revealed, around 1000cc mucinous ascites, dense adhesion of intestines with uterus, ovaries and omentum, tumor seedlings on gut, bladder, omentum, under surface of diaphragm, left ovary and uterus.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
Epidemiology of road traffic accidents: - Prospective study t a Tertiary .... such as speed and alcohol, and exacerbated by inadequate enforcement of traffic safety ..... done to increase awareness in the most important work force of the country ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
Estimates of the incidence and costs associated with handlebar related injuries in children. .... There was no evidence of peripheral blood eosinophilia. Chest radiograph was .... the United States, with a review of worldwide cases. Clinical ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
Cole, B.O Mofikoya, S.O. Giwa, O.O. Badmus. Department of Surgery, College of Medicine, University of Lagos / Lagos University Teaching. Hospital, Lagos, Nigeria. '””‡•'' †‡ …‡ –' Dr. G.O. Enweluzo, Email: enweluzog@yahoo.com ƒ…
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J ...
African Journals Online (AJOL)
Hp 630 Dual Core
COSECSA/ASEA Publication East and Central African ... the one hand on medical technology and equipment and on the other hand on the medical .... traumatic brain injury was the main cause of death amongst emergency admissions at the.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...
African Journals Online (AJOL)
Hp 630 Dual Core
amenorrhea and both had indicated single intra uterine pregnancy with anterior low lying placenta with adequate liquor volume. On examination, she was in pain though was not pale and had normal vital signs. Cardiovascular and respiratory systems did not reveal any abnormalities. Abdominal examination had.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
If MRI and CT are unavailable, plain x rays lateral view of the skull showing the cervical spine, ... Understanding the two types of basilar invagination is probably the most crucial factor in understanding the various involved management issues as their pathogenesis appears to be different in the two groups. Goel et al ...
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
and rural to urban migration result in creation of slums with crowded living conditions. .... the impact on quality of life in terms of negative cosmetic and psychosocial ... Minor surgical intervention (surgical toilet) was required in 3% of the cases.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...
African Journals Online (AJOL)
Hp 630 Dual Core
Although it is a well documented clinical entity, there are few published reports of testicular torsion in sub Saharan Africa, and accurate quantification of the incidence and clinical outcomes of testicular torsion in sub Saharan Africa remains elusive. The only previous report of testicular torsion in Ethiopia that we encountered ...