Memorandum on standards for environmental hygiene 1976

International Nuclear Information System (INIS)

1978-01-01

This report from the Dutch Ministry of Health is an advisory document on the influence of the memorandum on Standards for Environmental Hygiene 1976. It is a result of discussions between the Committee for Radiation Hygiene and the Commission for Toxicology. The environmental hygiene standards are defined and the difference between 150 standards and legal standards explained. Comments are given on the concepts that the memorandum covers and advice is given on the enforcement of such standards. This document deals with air and surface water pollution, radiation effects and toxicological standards. The difficulty in fixing maximum permissible doses for specific damaging agents is discussed. (C.F.)

IEEE standard for qualifying class IE equipment for nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1974-01-01

The Institute of Electrical and Electrical Engineers, Inc. (IEEE) standards for electrical equipment (Class IE) for nuclear power generating stations are given. The standards are to provide guidance for demonstrating and documenting the adequacy of electric equipment used in all Class IE and interface systems. Representative in containment design basis event conditions for the principal reactor types are included in the appendixes for guidance in enviromental simulation

IEEE Std 649-1980: IEEE standard for qualifying Class 1E motor control centers for nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1992-01-01

This standard describes the basic principles, requirements, and methods for qualifying Class 1E motor control centers for outside containment applications in nuclear power generating stations. Qualification of motor control centers located inside containment in a nuclear power generating station is beyond the scope of this standard. The purpose of this standard is (1) to define specific qualification requirements for Class 1E motor control centers in accordance with the more general qualification requirements of IEEE Std 323-1974, IEE Standard for Qualifying Class 1E Equipment for Nuclear Power Generating Stations; (2) to provide guidance in establishing a qualification program for demonstrating the design adequacy of Class 1E motor control centers in nuclear power generating station applications

Qualification of cables to IEEE standards 323-1974 and 383-1974

International Nuclear Information System (INIS)

Hosticka, C.; Kingsbury, E.R.; Bruhin, A.C.

1980-01-01

Wire and Cable manufacturers generally qualify products for class IE application by envelope type testing to user specifications and environmental conditions recommended by IEEE Standards 323-1974 and 383-1974. The General Electric Wire and Cable Business Department recently completed two such qualification programs. Cable constructions tested were 600V control cables and 600 V, 2kV, and 15kV power cables insulated with flame resistant mineral filled crosslinked polyethylene. The 15kV samples included taped field splices. In the second test program, the steam pressure-temperature profile included a simulated main steam line break. Test specimens were wrapped on grounded mandrels and were electrically loaded throughout the simulated LOCA tests. After completion of environmental testing, samples were subjected to the IEEE 383 simulated post-LOCA test. 6 refs

Qualification of cables to IEEE standards 323-1974 and 383-1974

International Nuclear Information System (INIS)

Hosticka, C.; Kingsbury, E.R.; Bruhin, A.C.

1980-01-01

Wire and Cable manufacturers generally qualify products for class IE application by envelope type testing to user specifications and environmental conditions recommended by IEEE Standards 323-1974 and 383-1974. The General Electric Wire and Cable Business Department recently completed two such qualification programs. Cable constructions tested were 600V control cables and 600 V, 2KV, and 15KV power cables insulated with flame resistant mineral filled crosslinked polyethylene. The 15KV samples included taped field splices. In the second test program, the steam pressure-temperature profile included a simulated main steam line break. Test specimens were wrapped on grounded mandrels and were electrically loaded throughout the simulated LOCA tests. After completion of environmental testing, samples were subjected to the IEEE 383 simulated post-LOCA test. 6 refs

Problems and solutions in application of IEEE standards at Savannah River Site, Department of Energy (DOE) nuclear facilities

International Nuclear Information System (INIS)

Lee, Y.S.; Bowers, T.L.; Chopra, B.J.; Thompson, T.T.; Zimmerman, E.W.

1993-01-01

The Department of Energy (DOE) Nuclear Material Production Facilities at the Savannah River Site (SRS) were designed, constructed, and placed into operation in the early 1950's, based on existing industry codes/standards, design criteria, analytical procedures. Since that time, DOE has developed Orders and Polices for the planning, design and construction of DOE Nuclear Reactor Facilities which invoke or reference commercial nuclear reactor codes and standards. The application of IEEE reactor design requirements such as Equipment Qualification, Seismic Qualification, Single Failure Criteria, and Separation Requirement, to non-reactor facilities has been a problem since the IEEE reactor criteria do not directly confirm to the needs of non-reactor facilities. SRS Systems Engineering is developing a methodology for the application of IEEE Standards to non-reactor facilities at SRS

The IEEE 1355 Standard. Developments, performance and application in high energy physics

International Nuclear Information System (INIS)

Haas, S.

1998-12-01

The data acquisition systems of the next generation High Energy Physics experiments at the Large Hadron Collider (LHC) at CERN will rely on high-speed point-to-point links and switching networks for their higher level trigger and event building systems. This thesis provides a detailed evaluation of the DS-Link and switch technology, which is based on the IEEE 1355 standard for Heterogeneous Interconnect (HIC). The DS-Link is a bidirectional point-to-point serial interconnect, operating at speeds up to 200 MBaud. The objective of this thesis was to study the performance of the IEEE 1355 link and switch technology and to demonstrate that switching networks using this technology would scale to meet the requirements of the High Energy Physics applications

IEEE Std 323-1983: IEEE standard for qualifying Class 1E equipment for nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1992-01-01

This standard describes the basic requirements for qualifying Class 1E equipment with interfaces that are to be used in nuclear power generating stations. The requirements presented include the principles, procedures, and methods of qualification. These qualification requirements, when met, will confirm the adequacy of the equipment design under normal, abnormal, design basis event, post design basis event, and in-service test conditions for the performance of safety function(s). The purpose of this standard is to identify requirements for the qualification of Class 1E equipment, including those interfaces whose failure could adversely affect the performance of Class 1E equipment and systems. The methods described shall be used for qualifying equipment, extending qualification, and updating qualification if the equipment is modified. Other issued IEEE standards which present qualification methods for specific equipment or components, or both, and those that deal with parts of the qualification program, may be used to supplement this standard, as applicable

Access to IEEE Electronic Library

CERN Multimedia

2007-01-01

From 2007, the CERN Library now offers readers online access to the complete IEEE Electronic Library (Institute of Electrical and Electronics Engineers). This new licence gives unlimited online access to all IEEE and IET (previously IEE) journals and proceedings as well as all current IEEE standards and selected archived ones. Some of the titles offer volumes back to 1913. This service currently represents more than 1,400,000 full-text articles! This leading engineering information resource replaces the previous service, a sub-product of the IEEE database called 'IEEE Enterprise', which offered online access to the complete collection of IEEE journals and proceedings, but with limited features. The service had become so popular that the CERN Working Group for Acquisitions recommended that the Library subscribe to the complete IEEE Electronic Library for 2007. Usage statistics for recent months showed there was a demand for the service from a large community of CERN users and we were aware that many users h...

IEEE C37.105-1987: IEEE standard for qualifying Class 1E protective relays and auxiliaries for nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1992-01-01

This standard describes the basic principles, requirements, and methods for qualifying Class 1E protective relays and auxiliaries such as test and control switches, terminal blocks, and indicating lamps for applications in nuclear power generating stations. When properly employed it can be used to demonstrate the design adequacy of such equipment under normal, abnormal, design basis event and post design basis event conditions in accordance with ANSI/IEEE Std 323-1983. When protective relays and auxiliaries are located in areas not subject to harsh environments, environmental qualification is not required. Protective relays and auxiliaries located inside primary containment in a nuclear power generating station present special conditions beyond the scope of this document. The qualification procedure presented is generic in nature. Other methods may be used at the discretion of the qualifier, provided the basic precepts of ANSI/IEEE Std 32301983 are satisfied

Fiber optics backbone for IEEE 802.3 networks

Science.gov (United States)

Shani, Ron

1990-01-01

In the last few years the IEEE 802.3 committee has developed fiber optics inter-repeater link standard called FOIRL. This standard defines the "Fiber Optics Media Access Unit" (FOMAU) which is used to connect two IEEE 802.3 repeaters that are up to 1Km apart. The IEEE 802.3 lOBaseF task force is currently standardizing a full F/O system in two directions: passive and active. The active approach is a compromise between the FOIRL (Asynchronous) approach and the Synchronous approach. As a result of this activity the IEEE 802.3 standard will define three different F/O interfaces and several devices that will not inter-operate. Such a standard will lower the credibility among the IEEE 802.3 user community, as customers will be confused amidst the many chapters and devices with no clear choice. This paper describes a method that can reduce the number of standards to two (passive and active), while proposing a solution for all the requirements of 802.3 F/O LAN. (The question of passive vs active approach will be discussed in this paper).

IEEE Std 649-1991: IEEE standard for qualifying Class 1E motor control centers for nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1993-01-01

The basic principles, requirements, and methods for qualifying Class 1E motor control centers for both harsh and mild environment applications in nuclear power generating stations are described. In addition to defining specific qualification requirements for Class 1E motor control centers and their components in accordance with the more general qualification requirements of IEEE Std 323-1983, this standard is intended to provide guidance in establishing a qualification program for demonstrating the adequacy of Class 1E motor control centers in nuclear power generating station applications

Comparison and Analysis of IEEE 344 and IEC 60980 standards for harmonization of seismic qualification of safety-related equipment

International Nuclear Information System (INIS)

Lee, Young Ok; Kim, Jong Seog; Seo, Jeong Ho; Kim, Myung Jun

2011-01-01

The seismic qualification of safety related equipment in nuclear power plants should demonstrate an equipment's ability to perform its safety function during/or after the time it is subjected to the forces resulting from one SSE. In addition, the equipment must withstand the effects of a number of OBEs, preceding the SSE. IEEE 344 and IEC 60980 present the criteria for establishing procedures demonstrating that the Class 1E equipment can meet its performance requirement during seismic events. Currently, IEEE 344 is used for regulation of nuclear power plant in the United State whereas IEC 60980 is mainly used in Europe. In particular, NPPs of France and China apply with RCC-E and GB that are domestic standards, respectively. Equipment supplier and Utility have difficulties because of different applicable standards. Equipment supplier to export S/R components/equipment to other standard area performs additional seismic qualification. For example, equipment are qualifies according to IEC 60980, RCC-E, GB although they have been qualified in accordance with IEEE 344. Also, utility to attempt power up-rate, life extension of NPP constructed under rules of RCC-E such as Ulchin NPP 1 and 2 has similar difficulties. RCC-E endorses IEC 60980 and GB is almost same as IEC 60980 except minor difference of earthquake environment definition. Therefore this paper surveys the similarities and differences between IEEE 344 and IEC 60980. In addition, this paper considers how the two sets of standards may be used in a complementary fashion to be possible using one or the other standard area

Return of IEEE Std 627 and its Value to Equipment Qualification Programs

International Nuclear Information System (INIS)

Horvath, D.A.

2012-01-01

IEEE Std 627 ''Design Qualification of Safety Systems Equipment Used in Nuclear Power Generating Stations'' was issued to more generically establish qualification requirements in the form of a high level umbrella document. Efforts on this standard began in late 1975 at the request of the IEEE Nuclear Standards Management Board. In 1977 a joint ASME/IEEE agreement established responsibility for qualification and quality assurance standards preparation. ASME accepted responsibility for Quality Assurance and IEEE for qualification. In accordance with that agreement, IEEE completed the generic qualification standard in 1980. This document provided high level approaches, criteria, guidance, and principles for qualification of both electrical and mechanical equipment that at that time appeared in no other industry standard. IEEE Std 627-1980 was later reaffirmed in 1996. In 1986, ASME's Board on Nuclear Codes and Standards directed its Committee on Qualification of Mechanical Equipment (QME) to develop a standard for qualifying mechanical equipment. This task was completed in several parts during the time frame from 1992 to 1994. Partly in response to this activity, IEEE Std 627 was withdrawn in 2002. Later although withdrawn, it was found that IEEE Std 627 was continuing to be used and referenced by many entities both in the US and other countries including in ASME's QME-1-2002 ''Qualification of Active Mechanical Equipment Used in Nuclear Power Plants'', US NRC's NUREG-0800 Standard Review Plan Section 3.11, at least one reactor vendor's Design Certification Document (DCD), several international licensing documents, and elsewhere. As a result, in 2007, the IEEE Standards Board authorized Working Group 2.10 of Subcommittee 2 (Qualification) of the Power and Energy Society's Nuclear Power Engineering Committee to resurrect and update IEEE Std 627-1980 (Reaff 1996). The result was the culmination IEEE Std 627 in 2010. This paper will report on the eight improvements made

Fir Filters Compliant with the IEEE Standard for M Class PMU

Directory of Open Access Journals (Sweden)

Duda Krzysztof

2016-12-01

Full Text Available In this paper it is shown that M class PMU (Phasor Measurement Unit reference model for phasor estimation recommended by the IEEE Standard C37.118.1 with the Amendment 1 is not compliant with the Standard. The reference filter preserves only the limits for TVE (total vector error, and exceeds FE (frequency error and RFE (rate of frequency error limits. As a remedy we propose new filters for phasor estimation for M class PMU that are fully compliant with the Standard requirements. The proposed filters are designed: 1 by the window method; 2 as flat-top windows; or as 3 optimal min-max filters. The results for all Standard compliance tests are presented, confirming good performance of the proposed filters. The proposed filters are fixed at the nominal frequency, i.e. frequency tracking and adaptive filter tuning are not required, therefore they are well suited for application in lowcost popular PMUs.

Simulasi Kinerja Jaringan Nirkabel IEEE-802.11a dan IEEE-802.11g Menggunakan NS-2

Directory of Open Access Journals (Sweden)

Helm Fitriawan

2014-03-01

Full Text Available Wireless network uses transmission media based on radio waves. This type of networks is mainly useddue to its efficiency and mobility in data exchanging. This paper reports the modeling and simulation of wirelessnetworks based on Cisco Aironet 1130ag access point devices with IEEE 802.11a and IEEE 802.11g standards. Themodeling and simulation are performed using network simulator version 2 (NS-2 that is installed on operationsystem Linux Ubuntu v.10.10. The NS-2 is commonly used and works well in numerous types of network simulation. From simulation, we obtain quality of service parameters by employing several simulation scenarios in terms ofnumber of nodes, distances, and packet data sizes. It can be concluded from simulation results that the IEEE 802.11gnetworks transfer data with better quality than those of IEEE 802.11a networks.  Furthermore, the IEEE 802.11gnetworks provide a higher throughput, with smaller amount of delay and packet loss percentage compared to thoseof IEEE 802.11a networks.

IEEE C37.82-1987: IEEE standard for the qualification of switchgear assemblies for Class 1E applications in nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1992-01-01

This document describes the methods and requirements for qualifying switchgear assemblies for indoor areas outside of the containment in nuclear power generating stations. These assemblies include (1) metal-enclosed low-voltage power circuit breaker switchgear assemblies, as defined in ANSI/IEEE C37.20.1-1987, (2) metal-clad switchgear assemblies, as defined in ANSI/IEEE C37.20.2-1987, (3) metal-enclosed bus, as defined in ANSI/IEEE C37.23-1987, and (4) metal-enclosed interrupter switchgear assemblies, as defined in ANSI/IEEE C37.20.3-1987. The purpose of this document is to provide amplification of the general requirements of ANSI/IEEE Std 323-1983 as they apply to the specific features of Class 1E switchgear assemblies. Where differences exist between this document and ANSI/IEEE Std 323-1983, this document takes precedence insofar as switchgear assemblies are concerned

IEEE standard requirements for reliability analysis in the design and operation of safety systems for nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1976-01-01

The purpose of this standard is to provide uniform, minimum acceptable requirements for the performance of reliability analyses for safety-related systems found in nuclear-power generating stations, but not to define the need for an analysis. The need for reliability analysis has been identified in other standards which expand the requirements of regulations (e.g., IEEE Std 379-1972 (ANSI N41.2-1972), ''Guide for the Application of the Single-Failure Criterion to Nuclear Power Generating Station Protection System,'' which describes the application of the single-failure criterion). IEEE Std 352-1975, ''Guide for General Principles of Reliability Analysis of Nuclear Power Generating Station Protection Systems,'' provides guidance in the application and use of reliability techniques referred to in this standard

IEEE [Institute of Electrical and Electronics Engineers] standards and nuclear software quality engineering

International Nuclear Information System (INIS)

Daughtrey, T.

1988-01-01

Significant new nuclear-specific software standards have recently been adopted under the sponsorship of the American Nuclear Society and the American Society of Mechanical Engineers. The interest of the US Nuclear Regulatory Commission has also been expressed through their issuance of NUREG/CR-4640. These efforts all indicate a growing awareness of the need for thorough, referenceable expressions of the way to build in and evaluate quality in nuclear software. A broader professional perspective can be seen in the growing number of software engineering standards sponsored by the Institute of Electrical and Electronics Engineers (IEEE) Computer Society. This family of standards represents a systematic effort to capture professional consensus on quality practices throughout the software development life cycle. The only omission-the implementation phase-is treated by accepted American National Standards Institute or de facto standards for programming languages

IEEE Std 383-1974: IEEE standard for type test of Class IE electric cables, field splices, and connections for nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1992-01-01

This standard provides direction for establishing type tests which may be used in qualifying Class 1E electric cables, field splices, and other connections for service in nuclear power generating stations. General guidelines for qualifications are given in IEEE Std 323-1974, Standard for Qualifying Class IE Electric Equipment for Nuclear Power Generating Stations. Categories of cables covered are those used for power control and instrumentation services. Though intended primarily to pertain to cable for field installation, this guide may also be used for the qualification of internal wiring of manufactured devices. This guide does not cover cables for service within the reactor vessel

Qualification test of Class 1E equipment based on IEEE323 Std 2003

International Nuclear Information System (INIS)

Kim, J. S.; Jung, S. C.; Kim, T. R.

2004-01-01

IEEE Standard for Qualifying Class 1E Equipment has been updated to 2003 edition since the issue of IEEE Std 323-1971, 1974, 1983. NRC approved the IEEE Std 323-1974 as Qualification standard of Class 1E Equipment in domestic nuclear power plant. IEEE Std 323-2003 was issued in September of 2003 and utility is waiting the approval of NRC. IEEE Std 323-2003 suggest a new qualification technique which adopts the condition monitoring. Performance of two transient during DBA test is no longer recommended in IEEE Std 323-2003. IEEE323 Std 2003 included a chapter of ''extension of Qualified life'' to make available the life extension of components during plant life extension. For the efficient control of preserving EQ in domestic nuclear power plant, IEEE323 Std 2003 is strongly recommended

Analysis of Radio communication solutions in small and isolated communities under the IEEE 802.22 standard

OpenAIRE

Arroyo Arzubi, Alejandro; Castro Lechtaler, Antonio; Foti, Antonio Roberto; Fusario, Rubén J.; García Guibout, Jorge; Sens, Lorena

2013-01-01

In recent years the use of wireless communications has increased significantly. Rural communities without cable network communication have found a solution in wireless technologies. Based on previous fieldwork, this paper analyzes software development of integration based technologies for communication equipment. It focuses on the feasibility of the IEEE 802.22 standard as a solution to the wireless problem.

Extending Service Area of IEEE 802.11 Ad Hoc Networks

Science.gov (United States)

Choi, Woo-Yong

2012-06-01

According to the current IEEE 802.11 wireless LAN standards, IEEE 802.11 ad hoc networks have the limitation that all STAs (Stations) are in the one-hop transmission range of each other. In this paper, to alleviate the limitation of IEEE 802.11 ad hoc networks we propose the efficient method for selecting the most appropriate pseudo AP (Access Point) from among the set of ad hoc STAs and extending the service area of IEEE 802.11 ad hoc networks by the pseudo AP's relaying the internal traffic of IEEE 802.11 ad hoc networks. Numerical examples show that the proposed method significantly extends the service area of IEEE 802.11 ad hoc networks.

IEEE 802.11ah: A Technology to Face the IoT Challenge.

Science.gov (United States)

Baños-Gonzalez, Victor; Afaqui, M Shahwaiz; Lopez-Aguilera, Elena; Garcia-Villegas, Eduard

2016-11-22

Since the conception of the Internet of things (IoT), a large number of promising applications and technologies have been developed, which will change different aspects in our daily life. This paper explores the key characteristics of the forthcoming IEEE 802.11ah specification. This future IEEE 802.11 standard aims to amend the IEEE 802.11 legacy specification to support IoT requirements. We present a thorough evaluation of the foregoing amendment in comparison to the most notable IEEE 802.11 standards. In addition, we expose the capabilities of future IEEE 802.11ah in supporting different IoT applications. Also, we provide a brief overview of the technology contenders that are competing to cover the IoT communications framework. Numerical results are presented showing how the future IEEE 802.11ah specification offers the features required by IoT communications, thus putting forward IEEE 802.11ah as a technology to cater the needs of the Internet of Things paradigm.

Standardized Test Results: KEEP and Control Students. 1975-1976, Technical Report #69.

Science.gov (United States)

Antill, Ellen; Speidel, Gisela E.

This report presents the results of various standardized measures administered to Kamehameha Early Education Program (KEEP) students and control students in the school year 1975-1976. In contrast to previous comparisons, KEEP employed more rigorous procedures for the selection of the control students and for the conditions of test administration.…

IEEE guide for the analysis of human reliability

International Nuclear Information System (INIS)

Dougherty, E.M. Jr.

1987-01-01

The Institute of Electrical and Electronics Engineers (IEEE) working group 7.4 of the Human Factors and Control Facilities Subcommittee of the Nuclear Power Engineering Committee (NPEC) has released its fifth draft of a Guide for General Principles of Human Action Reliability Analysis for Nuclear Power Generating Stations, for approval of NPEC. A guide is the least mandating in the IEEE hierarchy of standards. The purpose is to enhance the performance of an human reliability analysis (HRA) as a part of a probabilistic risk assessment (PRA), to assure reproducible results, and to standardize documentation. The guide does not recommend or even discuss specific techniques, which are too rapidly evolving today. Considerable maturation in the analysis of human reliability in a PRA context has taken place in recent years. The IEEE guide on this subject is an initial step toward bringing HRA out of the research and development arena into the toolbox of standard engineering practices

Practical support for Lean Six Sigma software process definition using IEEE software engineering standards

CERN Document Server

Land, Susan K; Walz, John W

2012-01-01

Practical Support for Lean Six Sigma Software Process Definition: Using IEEE Software Engineering Standards addresses the task of meeting the specific documentation requirements in support of Lean Six Sigma. This book provides a set of templates supporting the documentation required for basic software project control and management and covers the integration of these templates for their entire product development life cycle. Find detailed documentation guidance in the form of organizational policy descriptions, integrated set of deployable document templates, artifacts required in suppo

A strategy for implementation of experience based seismic equipment qualification in IEEE and ASME industry standards

International Nuclear Information System (INIS)

Adams, T.M.

1996-01-01

In the past 20 years, extensive data on the performance of mechanical and electric equipment during actual strong motion earthquakes and seismic qualification tests has been accumulated. Recognizing that an experience based approach provides a technically sound and cost effective method for the seismic qualification of some or certain equipment, the IEEE Nuclear Power Engineering Committee and the ASME Committee on Qualification of Mechanical Equipment established a Special Working Group to investigate the incorporation of experienced based methods into the industry consensus codes and standards currently used in the seismic qualification of Seismic Category Nuclear Power Plant equipment. This paper presents the strategy (course of action) which was developed by the Special Working Group for meeting this objective of incorporation of experience based seismic qualification standards used in the design and seismic qualification of seismic category nuclear power plant equipment. This strategy was recommended to both chartering organizations, the IEEE Nuclear Power Engineering Committee and the ASME Committee on Qualification of Mechanical Equipment for their consideration and implementation. The status of the review and implementation of the Special Working Group's recommended strategy by the sponsoring organization is also discussed

IEEE Std 381-1977: IEEE standard criteria for type tests of Class 1E modules used in nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1992-01-01

This document describes the basic requirements of a type test program with the objective of verifying that a module used as Class 1E equipment in a nuclear power generating station meets or exceeds its design specifications. This document is limited to class 1E modules from and including the sensor through the logic circuitry of the final actuation devices. Except for those that are part of a module, switchgear, cables, connections, motors, valve actuators, station batteries, and penetrations are not included and are covered by other IEEE documents. The purpose of this document is to supplement the procedures and requirements given in IEEE Std 323-1974 [24] for type testing Class 1E modules, thereby providing directions for establishment of a type test program which will obtain the required test data and yield the required documentation of test methods and results. This standard is structured to present to the user the principal performance characteristics and environmental parameters which must be considered in designing a type test program for any give Class 1E module. These modules range from tiny sensors to complete racks or cabinets full of equipment that may be located inside or outside containment. The Class 1E modules are required to perform their function before, during, or after, or all, any design basis event specified for the module. The vast variety of modules covered by this document precludes the listing here of specific requirements for each type test

New IEEE 11073 Standards for interoperable, networked Point-of-Care Medical Devices.

Science.gov (United States)

Kasparick, Martin; Schlichting, Stefan; Golatowski, Frank; Timmermann, Dirk

2015-08-01

Surgical procedures become more and more complex and the number of medical devices in an operating room (OR) increases continuously. Today's vendor-dependent solutions for integrated ORs are not able to handle this complexity. They can only form isolated solutions. Furthermore, high costs are a result of vendor-dependent approaches. Thus we present a service-oriented device communication for distributed medical systems that enables the integration and interconnection between medical devices among each other and to (medical) information systems, including plug-and-play functionality. This system will improve patient's safety by making technical complexity of a comprehensive integration manageable. It will be available as open standards that are part of the IEEE 11073 family of standards. The solution consists of a service-oriented communication technology, the so called Medical Devices Profile for Web Services (MDPWS), a Domain Information & Service Model, and a binding between the first two mechanisms. A proof of this concept has been done with demonstrators of real world OR devices.

IEEE 1451.2 based Smart sensor system using ADuc847

Science.gov (United States)

Sreejithlal, A.; Ajith, Jose

IEEE 1451 standard defines a standard interface for connecting transducers to microprocessor based data acquisition systems, instrumentation systems, control and field networks. Smart transducer interface module (STIM) acts as a unit which provides signal conditioning, digitization and data packet generation functions to the transducers connected to it. This paper describes the implementation of a microcontroller based smart transducer interface module based on IEEE 1451.2 standard. The module, implemented using ADuc847 microcontroller has 2 transducer channels and is programmed using Embedded C language. The Sensor system consists of a Network Controlled Application Processor (NCAP) module which controls the Smart transducer interface module (STIM) over an IEEE1451.2-RS232 bus. The NCAP module is implemented as a software module in C# language. The hardware details, control principles involved and the software implementation for the STIM are described in detail.

Introduction to IEEE Std. 7-4.3.2 Annex D -- ''Qualification of existing commercial computers''

International Nuclear Information System (INIS)

Holmstrom, K.J.

1995-01-01

On September 15th of 1993 the IEEE standards board approved IEEE Std. 7-4.3.2-1993, IEEE Standard for Digital Computers in Safety Systems of Nuclear Power Generating Stations. This paper is an introduction to Annex D of this document which concerns the commercial grade dedication of existing computers or new non-1E computers

Radio Frequency Fingerprinting Techniques Through Preamble Modification in IEEE 802.11B

Science.gov (United States)

2014-06-30

4.2.1 Wald–Wolfowitz Runs Test . . . . . . . . . . . . . . . . . . . . . . 41 4.2.2 Wald–Wolfowitz Application to SXS System . . . . . . . . . . . . 42...Station SXS Signals eXploitation System USB Universal Serial Bus xiv Acronym Definition USRP Universal Software Radio Peripheral WLAN Wireless Local...Electronics Engineers (IEEE) defines standards applicable to the IEEE 802.11 protocol, however the standard does not reach the level of specificity to dictate

IEEE No. 323, IEEE trial-use standard: General guide for qualifying Class I electric equipment for nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1992-01-01

This document describes the basic requirements for the qualification of Class I electric equipment. This is equipment which is essential to the safe shutdown and isolation of the reactor or whose failure or damage could result in significant release of radioactive material. The purpose of this document is to provide guidance for demonstrating the qualifications of electrical equipment as required in the IEEE Std 279 -- Criteria for Nuclear Power Generating Station Protection Systems, and IEEE Std 308 -- Criteria for Class 1E Electric Systems for Nuclear Power Generating Stations. The qualification methods described may be used in conjunction with the Guides for qualifying specific types of equipment, (see Foreword), for updating qualification following modifications or for qualifying equipment for which no applicable Guide exists

Path loss variation of on-body UWB channel in the frequency bands of IEEE 802.15.6 standard.

Science.gov (United States)

Goswami, Dayananda; Sarma, Kanak C; Mahanta, Anil

2016-06-01

The wireless body area network (WBAN) has gaining tremendous attention among researchers and academicians for its envisioned applications in healthcare service. Ultra wideband (UWB) radio technology is considered as excellent air interface for communication among body area network devices. Characterisation and modelling of channel parameters are utmost prerequisite for the development of reliable communication system. The path loss of on-body UWB channel for each frequency band defined in IEEE 802.15.6 standard is experimentally determined. The parameters of path loss model are statistically determined by analysing measurement data. Both the line-of-sight and non-line-of-sight channel conditions are considered in the measurement. Variations of parameter values with the size of human body are analysed along with the variation of parameter values with the surrounding environments. It is observed that the parameters of the path loss model vary with the frequency band as well as with the body size and surrounding environment. The derived parameter values are specific to the particular frequency bands of IEEE 802.15.6 standard, which will be useful for the development of efficient UWB WBAN system.

IEEE Std 730 Software Quality Assurance: Supporting CMMI-DEV v1.3, Product and Process Quality Assurance

Science.gov (United States)

2011-05-27

frameworks 4 CMMI-DEV IEEE / ISO / IEC 15288 / 12207 Quality Assurance ©2011 Walz IEEE Life Cycle Processes & Artifacts • Systems Life Cycle Processes...TAG to ISO TC 176 Quality Management • Quality: ASQ, work experience • Software: three books, consulting, work experience • Systems: Telecom & DoD...and IEEE 730 SQA need to align. The P730 IEEE standards working group has expanded the scope of the SQA process standard to align with IS 12207

Error detecting capabilities of the shortened Hamming codes adopted for error detection in IEEE Standard 802.3

Science.gov (United States)

Fujiwara, Toru; Kasami, Tadao; Lin, Shu

1989-09-01

The error-detecting capabilities of the shortened Hamming codes adopted for error detection in IEEE Standard 802.3 are investigated. These codes are also used for error detection in the data link layer of the Ethernet, a local area network. The weight distributions for various code lengths are calculated to obtain the probability of undetectable error and that of detectable error for a binary symmetric channel with bit-error rate between 0.00001 and 1/2.

47 CFR 101.141 - Microwave modulation.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 5 2010-10-01 2010-10-01 false Microwave modulation. 101.141 Section 101.141... SERVICES Technical Standards § 101.141 Microwave modulation. (a) Microwave transmitters employing digital modulation techniques and operating below 25.25 GHz (except for MVDDS stations in the 12,200-12,700 MHz band...

BER IMPROVEMENT OF WIRELESS LAN IEEE 802.11 STANDARD USING WAVELET PACKET TRANSFORMS

Directory of Open Access Journals (Sweden)

Sanjeev Kumar

2012-09-01

Full Text Available High data rates and spectral efficiency is the main requirements for wireless communication systems. Orthogonal Frequency Division Multiplexing (OFDM is a special form of multi carrier transmission used to achieve high data rates of the various WLAN standards. WLAN uses an Inverse Fast Fourier Transform (IFFT at the transmitter to modulate a high bit-rate signal onto a number of carriers and ensure orthogonality between the carriers. The FFT-OFDM has a disadvantage that it is inherently inflexible and requires a complex IFFT core. Recently, Wavelet Packet Transform is proposed as an alternate to FFT. It is a multiplexing method in which data is assigned to wavelet sub bands having different time and frequency resolutions. This paper presents a BER analysis of Fourier-based OFDM (FFT-OFDM and Wavelet Packet based OFDM (WPT-OFDM in WLAN standard (IEEE 802.11a. The performance of FFT and WPT OFDM for various modulation techniques such as PSK, DPSK and QAM for varying values of M was evaluated in AWGN Channel.

Performance of the IEEE 802.3 EPON registration scheme under high load

Science.gov (United States)

Bhatia, Swapnil P.; Bartos, Radim

2004-09-01

The proposed standard for the IEEE 802.3 Ethernet Passive Optical Network includes a random delayed transmission scheme for registration of new nodes. Although the scheme performs well on low loads, our simulation demonstrates the degraded and undesirable performance of the scheme at higher loads. We propose a simple modification to the current scheme that increases its range of operation and is compatible with the IEEE draft standard. We demonstrate the improvement in performance gained without any significant increase in registration delay.

Implicit Block ACK Scheme for IEEE 802.11 WLANs

Science.gov (United States)

Sthapit, Pranesh; Pyun, Jae-Young

2016-01-01

The throughput of IEEE 802.11 standard is significantly bounded by the associated Medium Access Control (MAC) overhead. Because of the overhead, an upper limit exists for throughput, which is bounded, including situations where data rates are extremely high. Therefore, an overhead reduction is necessary to achieve higher throughput. The IEEE 802.11e amendment introduced the block ACK mechanism, to reduce the number of control messages in MAC. Although the block ACK scheme greatly reduces overhead, further improvements are possible. In this letter, we propose an implicit block ACK method that further reduces the overhead associated with IEEE 802.11e’s block ACK scheme. The mathematical analysis results are presented for both the original protocol and the proposed scheme. A performance improvement of greater than 10% was achieved with the proposed implementation.

Performance Evaluations for IEEE 802.15.4-based IoT Smart Home Solution

Directory of Open Access Journals (Sweden)

Nga Dinh

2016-09-01

Full Text Available The Internet of Things (IoT is going to be a market-changing force for a variety of real-time applications such as e-healthcare, home automation, environmental monitoring, and industrial automation. Low power wireless communication protocols offering long lifetime and high reliability such as the IEEE 802.15.4 standard have been a key enabling technology for IoT deployments and are deployed for home automation recently. The issues of the IEEE 802.15.4 networks have moved from theory to real world deployments. The work presented herein intends to demonstrate the use of the IEEE 802.15.4 standard in recent IoT commercial products for smart home applications: the Smart Home Starter Kit. The contributions of the paper are twofold. First, the paper presents how the IEEE 802.15.4 standard is employed in Smart Home Starter Kit. In particular, network topology, network operations, and data transfer mode are investigated. Second, network performance metrics such as end-to-end (E2E delay and frame reception ratio (FRR are evaluated by experiments. In addition, the paper discusses several directions for future improvements of home automation commercial products.

Reactive GTS Allocation Protocol for Sporadic Events Using the IEEE 802.15.4

Directory of Open Access Journals (Sweden)

Mukhtar Azeem

2014-01-01

by the IEEE 802.15.4 standard. The proposed control protocol ensures that a given offline sporadic schedule can be adapted online in a timely manner such that the static periodic schedule has not been disturbed and the IEEE 802.15.4 standard compliance remains intact. The proposed protocol is simulated in OPNET. The simulation results are analyzed and presented in this paper to prove the correctness of the proposed protocol regarding the efficient real-time sporadic event delivery along with the periodic event propagation.

The IEEE Milestone event at CERN

CERN Multimedia

2005-01-01

On the initiative of its French and Swiss Sections, the IEEE has honoured CERN with an 'IEEE Milestone in the history of electricity and electronics' for the invention of the multi-wire proportional chamber in 1968. The IEEE established the Electrical Engineering Milestones programe in 1983 to honour significant achievements in the history of electrical and electronics engineering. To be designated, an achievement must be at least 25 years old, must have involved a unique solution to an engineering problem, and must have had at least regional impact. Currently there are more than  50 IEEE Milestones around the world. http://www.ieee.org/organizations/history_center/cern.html The installation and unveiling of this IEEE Milestone will provide the opportunity to emphasize the close relationship between science, technology, industry and well-being in society.  A ceremony, organised with the support of a group of IEEE members working at CERN, will be held at the CERN Globe of Science and Inn...

Comparison Of Several Methods Of Implementing A Fiber Optic IEEE 802.3 Ethernet

Science.gov (United States)

Thompson, Geoffrey O.

1987-01-01

Several different methods of implementing a fiber optic version of IEEE 802.3 10BASE LANs have been proposed as a candidate for standardization by IEEE. There have been extensive discussions as to the relative merits and features of the several systems. This paper will discuss the merits of each for this particular application on a comparative basis.

Active Channel Reservation for Coexistence Mechanism (ACROS) for IEEE 802.15.4 and IEEE 802.11

Science.gov (United States)

Shin, Soo Young; Woo, Dong Hyuk; Lee, Jong Wook; Park, Hong Seong; Kwon, Wook Hyun

In this paper, a coexistence mechanism between IEEE 802.15.4 and IEEE 802.11b, Active Channel Reservation for cOexiStence (ACROS), is proposed. The key idea underlining ACROS is to reserve the channel for IEEE 802.15.4 transmission, where IEEE 802.11 transmissions are forbidden. The request-to-send (RTS)/clear-to send (CTS) mechanism within IEEE 802.11 is used to reserve a channel. The proposed ACROS mechanism is implemented into a PC based prototype. The embedded version of ACROS is also developed to mitigate the timing drift problem in the PC-based ACROS. The efficiency of ACROS is shown using the throughput and packet error rate achieved in actual experiments.

Augmenting the Energy-Saving Impact of IEEE 802.3az via the Control Plane

OpenAIRE

Thaenchaikun , Chakadkit; Jakllari , Gentian; Paillassa , Béatrice

2015-01-01

International audience; IEEE 802.3az, the recent standard for Energy Efficient Ethernet, is one of the main contributions of the ICT industry to the global quest for energy efficiency. Energy consumption reduction is accomplished by essentially replacing the continuous IDLE of legacy IEEE 802.3 cards with a Low Power Idle. While this is an important step in the right direction, studies have shown that the energy saving with IEEE 802.3az highly depends on the traffic load and stops for link ut...

Planning of Efficient Wireless Access with IEEE 802.16 for Connecting Home Network to the Internet

Directory of Open Access Journals (Sweden)

Pichet Ritthisoonthorn

2010-01-01

Full Text Available The emergence of IEEE802.16 wireless standard technology (WiMAX has significantly increased the choice to operators for the provisioning of wireless broadband access network. WiMAX is being deployed to compliment with xDSL in underserved or lack of the broadband network area, in both developed and developing countries. Many incumbent operators in developing countries are considering the deployment of WiMAX as part of their broadband access strategy. This paper presents an efficient and simple method for planning of broadband fixed wireless access (BFWA with IEEE802.16 standard to support home connection to Internet. The study formulates the framework for planning both coverage and capacity designs. The relationship between coverage area and access rate from subscriber in each environment area is presented. The study also presents the throughput and channel capacity of IEEE802.16 in different access rates. An extensive analysis is performed and the results are applied to the real case study to demonstrate the practicality of using IEEE 802.16 for connecting home to Internet. Using empirical data and original subscriber traffic from measurement, it is shown that the BFWA with IEEE802.16 standard is a capacity limited system. The capacity of IEEE802.16 is related to different factors including frequency bandwidth, spectrum allocation, estimation of traffic per subscriber, and choice of adaptive modulation from subscriber terminal. The wireless access methods and procedures evolved in this research work and set out in this paper are shown to be well suited for planning BFWA system based on IEEE802.16 which supports broadband home to Internet connections.

IEEE 693 seismic qualification of composites for substation high-voltage equipment

Energy Technology Data Exchange (ETDEWEB)

Schiff, A.J. [Precision Measurement Instruments, Los Altos Hills, CA (United States); Kempner, L.Jr. [Bonneville Power Administration, Vancouver, BC (Canada)

2004-07-01

Standard 693-1997 of the Institute of Electrical and Electronic Engineers (IEEE) is the recommended practice for seismic design of substations. It represents a significant improvement in the way the power industry seismically qualifies substation high-voltage equipment. This paper described the use of IEEE Standard 693 for hollow-core composite insulators that are used on high-voltage transformers and demonstrated that changes are warranted. The following four failure modes associated with the composite insulator were discussed: bond degradation, bond failure, tube degradation and tube layer delamination. The authors evaluated the IEEE 693 qualification procedure of time history shake-table and static-pull tests and were concerned about acceptance criteria. It was shown that acceptance criteria are not valid for qualifying hollow-core composites and that static-pull tests are needed after the vibration qualification tests are completed. It was suggested that more research is warranted to determine if bonding at the top part of the flange can be eliminated, thereby eliminating bond degradation. The resulting increase in system damping would improve the dynamic response of the unit. 1 ref., 10 figs.

Integration of IEEE 1451 and HL7 exchanging information for patients' sensor data.

Science.gov (United States)

Kim, Wooshik; Lim, Suyoung; Ahn, Jinsoo; Nah, Jiyoung; Kim, Namhyun

2010-12-01

HL7 (Health Level 7) is a standard developed for exchanging incompatible healthcare information generated from programs or devices among heterogenous medical information systems. At present, HL7 is growing as a global standard. However, the HL7 standard does not support effective methods for treating data from various medical sensors, especially from mobile sensors. As ubiquitous systems are growing, HL7 must communicate with various medical transducers. In the area of sensor fields, IEEE 1451 is a group of standards for controlling transducers and for communicating data from/to various transducers. In this paper, we present the possibility of interoperability between the two standards, i.e., HL7 and IEEE 1451. After we present a method to integrate them and show the preliminary results of this approach.

Spectrum Hole Identification in IEEE 802.22 WRAN using Unsupervised Learning

OpenAIRE

V. Balaji; S. Anand; C.R. Hota; G. Raghurama

2016-01-01

In this paper we present a Cooperative Spectrum Sensing (CSS) algorithm for Cognitive Radios (CR) based on IEEE 802.22Wireless Regional Area Network (WRAN) standard. The core objective is to improve cooperative sensing efficiency which specifies how fast a decision can be reached in each round of cooperation (iteration) to sense an appropriate number of channels/bands (i.e. 86 channels of 7MHz bandwidth as per IEEE 802.22) within a time constraint (channel sensing time). To meet this objectiv...

2012 IEEE Vehicular Networking Conference (VNC)

NARCIS (Netherlands)

Altintas, Onur; Chen, Wai; Heijenk, Geert; Oh, Hyun Seo; Chung, Jong-Moon; Dressler, Falko; Kargl, Frank; Pau, Giovanni; Schoch, Elmar

2012-01-01

On behalf of the Organizing Committee, we would like to welcome you to the fourth edition of the IEEE Vehicular Networking Conference in Seoul, Korea. IEEE VNC is a unique conference sponsored by both IEEE Communications Society and Intelligent Transportation Systems Society. It brings together

Implementation experiences of ISO/IEEE11073 standard applied to new use cases for e-health environments.

Science.gov (United States)

Martinez, I; Escayola, J; Martinez-Espronceda, M; Serrano, L; Trigo, J D; Led, S; Garcia, J

2009-01-01

Recent advances in biomedical engineering and continuous technological innovations in last decade are promoting new challenges, especially in e-Health environments. In this context, the medical devices interoperability is one of the interest fields wherein these improvements require a standard-based design in order to achieve homogeneous solutions. Furthermore, the spreading of wearable devices, oriented to the paradigm of patient environment and supported by wireless technologies as Bluetooth or ZigBee, is bringing new medical use cases based on Ambient Assisted Living, home monitoring of elderly, heart failure, chronic, under palliative care or patients who have undergone surgery, urgencies and emergencies, or even fitness auto-control and health follow-up. In this paper, several implementation experiences based on ISO/IEEE11073 standard are detailed. These evolved e-Health services can improve the quality of the patient's care, increase the user's interaction, and assure these e-Health applications to be fully compatible with global telemedicine systems.

Recommendations for CAMAC Serial Highway drivers and LAM Graders for the SCC-L2 Serial Crate Controller

International Nuclear Information System (INIS)

1978-01-01

The functional requirements of Drivers for the CAMAC Serial Highway defined in IEEE Standard 595-1976 are described. The description is independent of the implementation, and in particular no assumption is made about the boundary between hardware and software within the Driver. Topics covered are the user interface, the supporting system services required, demand handling, and a detailed discussion of the message analysis for various levels of error recovery. An appendix describes the recommended features of LAM Graders for use with the Serial Crate Controller Type L2 of IEEE Std 595-1976

Study of Allocation Guaranteed Time Slot Wireless Body Area Networks Based on IEEE 802.15.4

Science.gov (United States)

Yundra, E.; Harsono, G. D.

2018-04-01

This paper aims to determine the size of the Guaranteed Time Slot (GTS) on the super frame structure required for each sensor as well as to know the performance of the GTS resized system compared to the GTS standard on IEEE 802.15.4. This article proposes a scheme to improve IEEE 802.15.4 medium access control, called allocation Guaranteed Time Slot (ALGATIS). ALGATIS is expected to effectively allocate guaranteed time slot to the requested sensors, it adjusts the length of the slot in super frame duration based on the length of the packet data. This article presents a simulation experiment of IEEE 802.15.4, especially for star network, to predict the throughput of networks and average energy consumption. The simulation experiments show that the performance of ALGATIS is better than that of IEEE 802.15.4 standard in term of the throughput of networks and average energy consumption

A versatile trigger and synchronization module with IEEE1588 capabilities and EPICS support

International Nuclear Information System (INIS)

Lopez, J.M.; Ruiz, M.; Borrego, J.; Arcas, G. de; Barrera, E.; Vega, J.

2010-01-01

Event timing and synchronization are two key aspects to improve in the implementation of distributed data acquisition (dDAQ) systems such as the ones used in fusion experiments. It is also of great importance the integration of dDAQ in control and measurement networks. This paper analyzes the applicability of the IEEE1588 and EPICS standards to solve these problems, and presents a hardware module implementation based in both of them that allow adding these functionalities to any DAQ. The IEEE1588 standard facilitates the integration of event timing and synchronization mechanisms in distributed data acquisition systems based on IEEE 803.3 (Ethernet). An optimal implementation of such system requires the use of network interface devices which include specific hardware resources devoted to the IEE1588 functionalities. Unfortunately, this is not the approach followed in most of the large number of applications available nowadays. Therefore, most solutions are based in software and use standard hardware network interfaces. This paper presents the development of a hardware module (GI2E) with IEEE1588 capabilities which includes USB, RS232, RS485 and CAN interfaces. This permits to integrate any DAQ element that uses these interfaces in dDAQ systems in an efficient and simple way. The module has been developed with Motorola's Coldfire MCF5234 processor and National Semiconductors's PHY DP83640T, providing it with the possibility to implement the PTP protocol of IEEE1588 by hardware, and therefore increasing its performance over other implementations based in software. To facilitate the integration of the dDAQ system in control and measurement networks the module includes a basic Input/Output Controller (IOC) functionality of the Experimental Physics and Industrial Control System (EPICS) architecture. The paper discusses the implementation details of this module and presents its applications in advanced dDAQ applications in the fusion community.

Delay Analysis of GTS Bridging between IEEE 802.15.4 and IEEE 802.11 Networks for Healthcare Applications

Science.gov (United States)

Mišić, Jelena; (Sherman) Shen, Xuemin

2009-01-01

We consider interconnection of IEEE 802.15.4 beacon-enabled network cluster with IEEE 802.11b network. This scenario is important in healthcare applications where IEEE 802.15.4 nodes comprise patient's body area network (BAN) and are involved in sensing some health-related data. BAN nodes have very short communication range in order to avoid harming patient's health and save energy. Sensed data needs to be transmitted to an access point in the ward room using wireless technology with higher transmission range and rate such as IEEE 802.11b. We model the interconnected network where IEEE 802.15.4-based BAN operates in guaranteed time slot (GTS) mode, and IEEE 802.11b part of the bridge conveys GTS superframe to the 802.11b access point. We then analyze the network delays. Performance analysis is performed using EKG traffic from continuous telemetry, and we discuss the delays of communication due the increasing number of patients. PMID:19107184

Delay Analysis of GTS Bridging between IEEE 802.15.4 and IEEE 802.11 Networks for Healthcare Applications.

Science.gov (United States)

Misić, Jelena; Sherman Shen, Xuemin

2009-01-01

We consider interconnection of IEEE 802.15.4 beacon-enabled network cluster with IEEE 802.11b network. This scenario is important in healthcare applications where IEEE 802.15.4 nodes comprise patient's body area network (BAN) and are involved in sensing some health-related data. BAN nodes have very short communication range in order to avoid harming patient's health and save energy. Sensed data needs to be transmitted to an access point in the ward room using wireless technology with higher transmission range and rate such as IEEE 802.11b. We model the interconnected network where IEEE 802.15.4-based BAN operates in guaranteed time slot (GTS) mode, and IEEE 802.11b part of the bridge conveys GTS superframe to the 802.11b access point. We then analyze the network delays. Performance analysis is performed using EKG traffic from continuous telemetry, and we discuss the delays of communication due the increasing number of patients.

The Exploration of Network Coding in IEEE 802.15.4 Networks

Directory of Open Access Journals (Sweden)

Deze Zeng

2011-01-01

communication protocol should be energy efficient. The IEEE 802.15.4 is designed as a standard protocol for low power, low data rate, low complexity, and short range connections in WPANs. The standard supports allocating several numbers of collision-free guarantee time slots (GTSs within a superframe for some time-critical transmissions. Recently, COPE was proposed as a promising network coding architecture to essentially improve the throughput of wireless networks. In this paper, we exploit the network coding technique at coordinators to improve energy efficiency of the WPAN. Some related practical issues, such as GTS allocation and multicast, are also discussed in order to exploit the network coding opportunities efficiently. Since the coding opportunities are mostly exploited, our proposal achieves both higher energy efficiency and throughput performance than the original IEEE 802.15.4.

A coexistence model of IEEE 802.15.4 and IEEE 802.1 lbIg

NARCIS (Netherlands)

Yuan, Wei; Wang, Xiangyu; Linnartz, J.P.M.G.

2007-01-01

IEEE 802.15.4 was developed to meet the needs for low-rate wireless communication. However, due to its low power, IEEE 802.15.4 is potentially vulnerable to interference by other wireless technologies having much higher power and working in the same industrial, scientific, and medical (ISM) band

Throughput and delay analysis of IEEE 802.15.6-based CSMA/CA protocol.

Science.gov (United States)

Ullah, Sana; Chen, Min; Kwak, Kyung Sup

2012-12-01

The IEEE 802.15.6 is a new communication standard on Wireless Body Area Network (WBAN) that focuses on a variety of medical, Consumer Electronics (CE) and entertainment applications. In this paper, the throughput and delay performance of the IEEE 802.15.6 is presented. Numerical formulas are derived to determine the maximum throughput and minimum delay limits of the IEEE 802.15.6 for an ideal channel with no transmission errors. These limits are derived for different frequency bands and data rates. Our analysis is validated by extensive simulations using a custom C+ + simulator. Based on analytical and simulation results, useful conclusions are derived for network provisioning and packet size optimization for different applications.

The IEEE-SA patent policy update under the lens of EU competition law

NARCIS (Netherlands)

Kanevskaia, Olia; Zingales, Nicolo

2016-01-01

In 2015, the Institute of Electrical and Electronics Engineers (IEEE) Standardization Association made some controversial changes to its patent policy. The changes include a recommended method of calculation of FRAND royalty rates, and a request to members holding a standard essential patent (SEP)

Strategies for Optimal MAC Parameters Tuning in IEEE 802.15.6 Wearable Wireless Sensor Networks.

Science.gov (United States)

Alam, Muhammad Mahtab; Ben Hamida, Elyes

2015-09-01

Wireless body area networks (WBAN) has penetrated immensely in revolutionizing the classical heath-care system. Recently, number of WBAN applications has emerged which introduce potential limits to existing solutions. In particular, IEEE 802.15.6 standard has provided great flexibility, provisions and capabilities to deal emerging applications. In this paper, we investigate the application-specific throughput analysis by fine-tuning the physical (PHY) and medium access control (MAC) parameters of the IEEE 802.15.6 standard. Based on PHY characterizations in narrow band, at the MAC layer, carrier sense multiple access collision avoidance (CSMA/CA) and scheduled access protocols are extensively analyzed. It is concluded that, IEEE 802.15.6 standard can satisfy most of the WBANs applications throughput requirements by maximum achieving 680 Kbps. However, those emerging applications which require high quality audio or video transmissions, standard is not able to meet their constraints. Moreover, delay, energy efficiency and successful packet reception are considered as key performance metrics for comparing the MAC protocols. CSMA/CA protocol provides the best results to meet the delay constraints of medical and non-medical WBAN applications. Whereas, the scheduled access approach, performs very well both in energy efficiency and packet reception ratio.

0011-0030.Data Representation amp Computer Arithmetic6 IEEE ...

Indian Academy of Sciences (India)

Home; public; Volumes; reso; 021; 01; 0011-0030.Data Representation amp Computer Arithmetic6 IEEE Standard Double Precision FormatIn.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News.

An Authentication and Key Management Mechanism for Resource Constrained Devices in IEEE 802.11-based IoT Access Networks

OpenAIRE

Kim, Ki-Wook; Han, Youn-Hee; Min, Sung-Gi

2017-01-01

Many Internet of Things (IoT) services utilize an IoT access network to connect small devices with remote servers. They can share an access network with standard communication technology, such as IEEE 802.11ah. However, an authentication and key management (AKM) mechanism for resource constrained IoT devices using IEEE 802.11ah has not been proposed as yet. We therefore propose a new AKM mechanism for an IoT access network, which is based on IEEE 802.11 key management with the IEEE 802.1X aut...

Basic security measures for IEEE 802.11 wireless networks

OpenAIRE

Sarmiento, Oscar P.; Guerrero, Fabio G.; Rey Argote, David

2008-01-01

This article presents a tutorial/discussion of three commonly-used IEEE 802.11 wireless network security standards: WEP, WPA and WPA2. A detailed analysis of the RC4 algorithm supporting WEP is presented, including its vulnerabilities. The WPA and WPA2 encryption protocols’ most relevant aspects and technical characteristics are reviewed for a comparative analysis of the three standards in terms of the security they provide. Special attention has been paid to WEP encryption by using an educat...

On IEEE 802.15.6 IR-UWB receivers - simulations for DBPSK modulation.

Science.gov (United States)

Niemelä, Ville; Hämäläinen, Matti; Iinatti, Jari

2013-01-01

In 2002, Federal Communications Commission (FCC) was the first in defining regulations for ultra wideband (UWB) communications followed by Europe and Japan some years later. Focusing on impulse radio (IR) UWB, in 2007 was the time for the first published standard targeting in personal area networks, released by the IEEE. The second IEEE released standard including UWB definitions is targeted for wireless body area networks (WBAN) and was published in 2012. As the wireless communications has been and will be passing through almost any levels in society, the natural step with WBAN is using it in different medical, healthcare and wellbeing applications. The arguments for these are related to the modern lifestyle, in which people have increasingly more free time and are more interested in taking care of their health and wellbeing. Another challenge is the population composition, i.e., aging in developed countries which call for new solutions and procedures, particularly from cost wise. In this paper, we are evaluating UWB receivers based on the IEEE 802.15.6 physical layer definitions and capable of detecting differentially encoded modulation. The evaluation is performed using two different WBAN channel models.

Interoperability in digital electrocardiography: harmonization of ISO/IEEE x73-PHD and SCP-ECG.

Science.gov (United States)

Trigo, Jesús D; Chiarugi, Franco; Alesanco, Alvaro; Martínez-Espronceda, Miguel; Serrano, Luis; Chronaki, Catherine E; Escayola, Javier; Martínez, Ignacio; García, José

2010-11-01

The ISO/IEEE 11073 (x73) family of standards is a reference frame for medical device interoperability. A draft for an ECG device specialization (ISO/IEEE 11073-10406-d02) has already been presented to the Personal Health Device (PHD) Working Group, and the Standard Communications Protocol for Computer-Assisted ElectroCardioGraphy (SCP-ECG) Standard for short-term diagnostic ECGs (EN1064:2005+A1:2007) has recently been approved as part of the x73 family (ISO 11073-91064:2009). These factors suggest the coordinated use of these two standards in foreseeable telecardiology environments, and hence the need to harmonize them. Such harmonization is the subject of this paper. Thus, a mapping of the mandatory attributes defined in the second draft of the ISO/IEEE 11073-10406-d02 and the minimum SCP-ECG fields is presented, and various other capabilities of the SCP-ECG Standard (such as the messaging part) are also analyzed from an x73-PHD point of view. As a result, this paper addresses and analyzes the implications of some inconsistencies in the coordinated use of these two standards. Finally, a proof-of-concept implementation of the draft x73-PHD ECG device specialization is presented, along with the conversion from x73-PHD to SCP-ECG. This paper, therefore, provides recommendations for future implementations of telecardiology systems that are compliant with both x73-PHD and SCP-ECG.

Performance comparison of IEEE 802.11g and IEEE 802.11n in the presence of interference from 802.15.4 networks

OpenAIRE

Masood, Syed Haani

2013-01-01

In this paper we compare the packet error rate (PER) and maximum throughput of IEEE 802.11n and IEEE 802.11g under interference from IEEE 802.15.4 by using MATLAB to simulate the IEEE PHY for 802.11n and 802.11g networks.

Spectrum Hole Identification in IEEE 802.22 WRAN using Unsupervised Learning

Directory of Open Access Journals (Sweden)

V. Balaji

2016-01-01

Full Text Available In this paper we present a Cooperative Spectrum Sensing (CSS algorithm for Cognitive Radios (CR based on IEEE 802.22Wireless Regional Area Network (WRAN standard. The core objective is to improve cooperative sensing efficiency which specifies how fast a decision can be reached in each round of cooperation (iteration to sense an appropriate number of channels/bands (i.e. 86 channels of 7MHz bandwidth as per IEEE 802.22 within a time constraint (channel sensing time. To meet this objective, we have developed CSS algorithm using unsupervised K-means clustering classification approach. The received energy level of each Secondary User (SU is considered as the parameter for determining channel availability. The performance of proposed algorithm is quantified in terms of detection accuracy, training and classification delay time. Further, the detection accuracy of our proposed scheme meets the requirement of IEEE 802.22 WRAN with the target probability of falsealrm as 0.1. All the simulations are carried out using Matlab tool.

IEEE 802.11 Wireless LANs: Performance Analysis and Protocol Refinement

Directory of Open Access Journals (Sweden)

Chatzimisios P.

2005-01-01

Full Text Available The IEEE 802.11 protocol is emerging as a widely used standard and has become the most mature technology for wireless local area networks (WLANs. In this paper, we focus on the tuning of the IEEE 802.11 protocol parameters taking into consideration, in addition to throughput efficiency, performance metrics such as the average packet delay, the probability of a packet being discarded when it reaches the maximum retransmission limit, the average time to drop a packet, and the packet interarrival time. We present an analysis, which has been validated by simulation that is based on a Markov chain model commonly used in the literature. We further study the improvement on these performance metrics by employing suitable protocol parameters according to the specific communication needs of the IEEE 802.11 protocol for both basic access and RTS/CTS access schemes. We show that the use of a higher initial contention window size does not considerably degrade performance in small networks and performs significantly better in any other scenario. Moreover, we conclude that the combination of a lower maximum contention window size and a higher retry limit considerably improves performance. Results indicate that the appropriate adjustment of the protocol parameters enhances performance and improves the services that the IEEE 802.11 protocol provides to various communication applications.

DoS detection in IEEE 802.11 with the presence of hidden nodes

Directory of Open Access Journals (Sweden)

Joseph Soryal

2014-07-01

Full Text Available The paper presents a novel technique to detect Denial of Service (DoS attacks applied by misbehaving nodes in wireless networks with the presence of hidden nodes employing the widely used IEEE 802.11 Distributed Coordination Function (DCF protocols described in the IEEE standard [1]. Attacker nodes alter the IEEE 802.11 DCF firmware to illicitly capture the channel via elevating the probability of the average number of packets transmitted successfully using up the bandwidth share of the innocent nodes that follow the protocol standards. We obtained the theoretical network throughput by solving two-dimensional Markov Chain model as described by Bianchi [2], and Liu and Saadawi [3] to determine the channel capacity. We validated the results obtained via the theoretical computations with the results obtained by OPNET simulator [4] to define the baseline for the average attainable throughput in the channel under standard conditions where all nodes follow the standards. The main goal of the DoS attacker is to prevent the innocent nodes from accessing the channel and by capturing the channel’s bandwidth. In addition, the attacker strives to appear as an innocent node that follows the standards. The protocol resides in every node to enable each node to police other nodes in its immediate wireless coverage area. All innocent nodes are able to detect and identify the DoS attacker in its wireless coverage area. We applied the protocol to two Physical Layer technologies: Direct Sequence Spread Spectrum (DSSS and Frequency Hopping Spread Spectrum (FHSS and the results are presented to validate the algorithm.

DoS detection in IEEE 802.11 with the presence of hidden nodes.

Science.gov (United States)

Soryal, Joseph; Liu, Xijie; Saadawi, Tarek

2014-07-01

The paper presents a novel technique to detect Denial of Service (DoS) attacks applied by misbehaving nodes in wireless networks with the presence of hidden nodes employing the widely used IEEE 802.11 Distributed Coordination Function (DCF) protocols described in the IEEE standard [1]. Attacker nodes alter the IEEE 802.11 DCF firmware to illicitly capture the channel via elevating the probability of the average number of packets transmitted successfully using up the bandwidth share of the innocent nodes that follow the protocol standards. We obtained the theoretical network throughput by solving two-dimensional Markov Chain model as described by Bianchi [2], and Liu and Saadawi [3] to determine the channel capacity. We validated the results obtained via the theoretical computations with the results obtained by OPNET simulator [4] to define the baseline for the average attainable throughput in the channel under standard conditions where all nodes follow the standards. The main goal of the DoS attacker is to prevent the innocent nodes from accessing the channel and by capturing the channel's bandwidth. In addition, the attacker strives to appear as an innocent node that follows the standards. The protocol resides in every node to enable each node to police other nodes in its immediate wireless coverage area. All innocent nodes are able to detect and identify the DoS attacker in its wireless coverage area. We applied the protocol to two Physical Layer technologies: Direct Sequence Spread Spectrum (DSSS) and Frequency Hopping Spread Spectrum (FHSS) and the results are presented to validate the algorithm.

A Comprehensive Taxonomy and Analysis of IEEE 802.15.4 Attacks

Directory of Open Access Journals (Sweden)

Yasmin M. Amin

2016-01-01

Full Text Available The IEEE 802.15.4 standard has been established as the dominant enabling technology for Wireless Sensor Networks (WSNs. With the proliferation of security-sensitive applications involving WSNs, WSN security has become a topic of great significance. In comparison with traditional wired and wireless networks, WSNs possess additional vulnerabilities which present opportunities for attackers to launch novel and more complicated attacks against such networks. For this reason, a thorough investigation of attacks against WSNs is required. This paper provides a single unified survey that dissects all IEEE 802.15.4 PHY and MAC layer attacks known to date. While the majority of existing references investigate the motive and behavior of each attack separately, this survey classifies the attacks according to clear metrics within the paper and addresses the interrelationships and differences between the attacks following their classification. The authors’ opinions and comments regarding the placement of the attacks within the defined classifications are also provided. A comparative analysis between the classified attacks is then performed with respect to a set of defined evaluation criteria. The first half of this paper addresses attacks on the IEEE 802.15.4 PHY layer, whereas the second half of the paper addresses IEEE 802.15.4 MAC layer attacks.

Evaluation of the Effects of Hidden Node Problems in IEEE 802.15.7 Uplink Performance.

Science.gov (United States)

Ley-Bosch, Carlos; Alonso-González, Itziar; Sánchez-Rodríguez, David; Ramírez-Casañas, Carlos

2016-02-06

In the last few years, the increasing use of LEDs in illumination systems has been conducted due to the emergence of Visible Light Communication (VLC) technologies, in which data communication is performed by transmitting through the visible band of the electromagnetic spectrum. In 2011, the Institute of Electrical and Electronics Engineers (IEEE) published the IEEE 802.15.7 standard for Wireless Personal Area Networks based on VLC. Due to limitations in the coverage of the transmitted signal, wireless networks can suffer from the hidden node problems, when there are nodes in the network whose transmissions are not detected by other nodes. This problem can cause an important degradation in communications when they are made by means of the Carrier Sense Multiple Access with Collision Avoidance (CSMA/CA) access control method, which is used in IEEE 802.15.7 This research work evaluates the effects of the hidden node problem in the performance of the IEEE 802.15.7 standard We implement a simulator and analyze VLC performance in terms of parameters like end-to-end goodput and message loss rate. As part of this research work, a solution to the hidden node problem is proposed, based on the use of idle patterns defined in the standard. Idle patterns are sent by the network coordinator node to communicate to the other nodes that there is an ongoing transmission. The validity of the proposed solution is demonstrated with simulation results.

IEEE International Symposium on Biomedical Imaging.

Science.gov (United States)

2017-01-01

The IEEE International Symposium on Biomedical Imaging (ISBI) is a scientific conference dedicated to mathematical, algorithmic, and computational aspects of biological and biomedical imaging, across all scales of observation. It fosters knowledge transfer among different imaging communities and contributes to an integrative approach to biomedical imaging. ISBI is a joint initiative from the IEEE Signal Processing Society (SPS) and the IEEE Engineering in Medicine and Biology Society (EMBS). The 2018 meeting will include tutorials, and a scientific program composed of plenary talks, invited special sessions, challenges, as well as oral and poster presentations of peer-reviewed papers. High-quality papers are requested containing original contributions to the topics of interest including image formation and reconstruction, computational and statistical image processing and analysis, dynamic imaging, visualization, image quality assessment, and physical, biological, and statistical modeling. Accepted 4-page regular papers will be published in the symposium proceedings published by IEEE and included in IEEE Xplore. To encourage attendance by a broader audience of imaging scientists and offer additional presentation opportunities, ISBI 2018 will continue to have a second track featuring posters selected from 1-page abstract submissions without subsequent archival publication.

Design Optimization of Cyber-Physical Distributed Systems using IEEE Time-sensitive Networks (TSN)

DEFF Research Database (Denmark)

Pop, Paul; Lander Raagaard, Michael; Craciunas, Silviu S.

2016-01-01

to the optimization of distributed cyber-physical systems using real-time Ethernet for communication. Then, we formulate two novel optimization problems related to the scheduling and routing of TT and AVB traffic in TSN. Thus, we consider that we know the topology of the network as well as the set of TT and AVB flows......In this paper we are interested in safety-critical real-time applications implemented on distributed architectures supporting the Time-SensitiveNetworking (TSN) standard. The ongoing standardization of TSN is an IEEE effort to bring deterministic real-time capabilities into the IEEE 802.1 Ethernet...... standard supporting safety-critical systems and guaranteed Quality-of-Service. TSN will support Time-Triggered (TT) communication based on schedule tables, Audio-Video-Bridging (AVB) flows with bounded end-to-end latency as well as Best-Effort messages. We first present a survey of research related...

FPGA implementation cost and performance evaluation of IEEE 802.11 protocol encryption security schemes

Science.gov (United States)

Sklavos, N.; Selimis, G.; Koufopavlou, O.

2005-01-01

The explosive growth of internet and consumer demand for mobility has fuelled the exponential growth of wireless communications and networks. Mobile users want access to services and information, from both internet and personal devices, from a range of locations without the use of a cable medium. IEEE 802.11 is one of the most widely used wireless standards of our days. The amount of access and mobility into wireless networks requires a security infrastructure that protects communication within that network. The security of this protocol is based on the wired equivalent privacy (WEP) scheme. Currently, all the IEEE 802.11 market products support WEP. But recently, the 802.11i working group introduced the advanced encryption standard (AES), as the security scheme for the future IEEE 802.11 applications. In this paper, the hardware integrations of WEP and AES are studied. A field programmable gate array (FPGA) device has been used as the hardware implementation platform, for a fair comparison between the two security schemes. Measurements for the FPGA implementation cost, operating frequency, power consumption and performance are given.

FPGA implementation cost and performance evaluation of IEEE 802.11 protocol encryption security schemes

International Nuclear Information System (INIS)

Sklavos, N; Selimis, G; Koufopavlou, O

2005-01-01

The explosive growth of internet and consumer demand for mobility has fuelled the exponential growth of wireless communications and networks. Mobile users want access to services and information, from both internet and personal devices, from a range of locations without the use of a cable medium. IEEE 802.11 is one of the most widely used wireless standards of our days. The amount of access and mobility into wireless networks requires a security infrastructure that protects communication within that network. The security of this protocol is based on the wired equivalent privacy (WEP) scheme. Currently, all the IEEE 802.11 market products support WEP. But recently, the 802.11i working group introduced the advanced encryption standard (AES), as the security scheme for the future IEEE 802.11 applications. In this paper, the hardware integrations of WEP and AES are studied. A field programmable gate array (FPGA) device has been used as the hardware implementation platform, for a fair comparison between the two security schemes. Measurements for the FPGA implementation cost, operating frequency, power consumption and performance are given

Determination of safety distance limits for a human near a cellular base station antenna, adopting the IEEE standard or ICNIRP guidelines.

Science.gov (United States)

Cooper, Justin; Marx, Bernd; Buhl, Johannes; Hombach, Volker

2002-09-01

This paper investigates the minimum distance for a human body in the near field of a cellular telephone base station antenna for which there is compliance with the IEEE or ICNIRP threshold values for radio frequency electromagnetic energy absorption in the human body. First, local maximum specific absorption rates (SARs), measured and averaged over volumes equivalent to 1 and to 10 g tissue within the trunk region of a physical, liquid filled shell phantom facing and irradiated by a typical GSM 900 base station antenna, were compared to corresponding calculated SAR values. The calculation used a homogeneous Visible Human body model in front of a simulated base station antenna of the same type. Both real and simulated base station antennas operated at 935 MHz. Antenna-body distances were between 1 and 65 cm. The agreement between measurements and calculations was excellent. This gave confidence in the subsequent calculated SAR values for the heterogeneous Visible Human model, for which each tissue was assigned the currently accepted values for permittivity and conductivity at 935 MHz. Calculated SAR values within the trunk of the body were found to be about double those for the homogeneous case. When the IEEE standard and the ICNIRP guidelines are both to be complied with, the local SAR averaged over 1 g tissue was found to be the determining parameter. Emitted power values from the antenna that produced the maximum SAR value over 1 g specified in the IEEE standard at the base station are less than those needed to reach the ICNIRP threshold specified for the local SAR averaged over 10 g. For the GSM base station antenna investigated here operating at 935 MHz with 40 W emitted power, the model indicates that the human body should not be closer to the antenna than 18 cm for controlled environment exposure, or about 95 cm for uncontrolled environment exposure. These safe distance limits are for SARs averaged over 1 g tissue. The corresponding safety distance limits

IEEE 802.3 Fiber Optic Inter-Repeater Link

Science.gov (United States)

Tarrant, Peter J.

1987-01-01

This paper describes the implementation of a fiber optic inter-repeater link (FOIRL), used for connecting two remote copper segments of an IEEE 802.3 local area network. The rationale for the design, the signalling used and the collision detection mechanism is discussed. The evolution of the draft international standard for the FOIRL and the concurrence amongst various manufacturers is also presented. Finally some examples of typical applications, highlighting the ease of installation, are given.

Device interoperability and authentication for telemedical appliance based on the ISO/IEEE 11073 Personal Health Device (PHD) Standards.

Science.gov (United States)

Caranguian, Luther Paul R; Pancho-Festin, Susan; Sison, Luis G

2012-01-01

In this study, we focused on the interoperability and authentication of medical devices in the context of telemedical systems. A recent standard called the ISO/IEEE 11073 Personal Health Device (X73-PHD) Standards addresses the device interoperability problem by defining common protocols for agent (medical device) and manager (appliance) interface. The X73-PHD standard however has not addressed security and authentication of medical devices which is important in establishing integrity of a telemedical system. We have designed and implemented a security policy within the X73-PHD standards. The policy will enable device authentication using Asymmetric-Key Cryptography and the RSA algorithm as the digital signature scheme. We used two approaches for performing the digital signatures: direct software implementation and use of embedded security modules (ESM). The two approaches were evaluated and compared in terms of execution time and memory requirement. For the standard 2048-bit RSA, ESM calculates digital signatures only 12% of the total time for the direct implementation. Moreover, analysis shows that ESM offers more security advantage such as secure storage of keys compared to using direct implementation. Interoperability with other systems was verified by testing the system with LNI Healthlink, a manager software that implements the X73-PHD standard. Lastly, security analysis was done and the system's response to common attacks on authentication systems was analyzed and several measures were implemented to protect the system against them.

Throughput analysis of the IEEE 802.4 token bus standard under heavy load

Science.gov (United States)

Pang, Joseph; Tobagi, Fouad

1987-01-01

It has become clear in the last few years that there is a trend towards integrated digital services. Parallel to the development of public Integrated Services Digital Network (ISDN) is service integration in the local area (e.g., a campus, a building, an aircraft). The types of services to be integrated depend very much on the specific local environment. However, applications tend to generate data traffic belonging to one of two classes. According to IEEE 802.4 terminology, the first major class of traffic is termed synchronous, such as packetized voice and data generated from other applications with real-time constraints, and the second class is called asynchronous which includes most computer data traffic such as file transfer or facsimile. The IEEE 802.4 token bus protocol which was designed to support both synchronous and asynchronous traffic is examined. The protocol is basically a timer-controlled token bus access scheme. By a suitable choice of the design parameters, it can be shown that access delay is bounded for synchronous traffic. As well, the bandwidth allocated to asynchronous traffic can be controlled. A throughput analysis of the protocol under heavy load with constant channel occupation of synchronous traffic and constant token-passing times is presented.

Proceedings of IEEE Machine Learning for Signal Processing Workshop XVI

DEFF Research Database (Denmark)

Larsen, Jan

These proceedings contains refereed papers presented at the sixteenth IEEE Workshop on Machine Learning for Signal Processing (MLSP'2006), held in Maynooth, Co. Kildare, Ireland, September 6-8, 2006. This is a continuation of the IEEE Workshops on Neural Networks for Signal Processing (NNSP......). The name of the Technical Committee, hence of the Workshop, was changed to Machine Learning for Signal Processing in September 2003 to better reflect the areas represented by the Technical Committee. The conference is organized by the Machine Learning for Signal Processing Technical Committee...... the same standard as the printed version and facilitates the reading and searching of the papers. The field of machine learning has matured considerably in both methodology and real-world application domains and has become particularly important for solution of problems in signal processing. As reflected...

Evaluation of H.264/AVC over IEEE 802.11p vehicular networks

Science.gov (United States)

Rozas-Ramallal, Ismael; Fernández-Caramés, Tiago M.; Dapena, Adriana; García-Naya, José Antonio

2013-12-01

The capacity of vehicular networks to offer non-safety services, like infotainment applications or the exchange of multimedia information between vehicles, have attracted a great deal of attention to the field of Intelligent Transport Systems (ITS). In particular, in this article we focus our attention on IEEE 802.11p which defines enhancements to IEEE 802.11 required to support ITS applications. We present an FPGA-based testbed developed to evaluate H.264/AVC (Advanced Video Coding) video transmission over vehicular networks. The testbed covers some of the most common situations in vehicle-to-vehicle and roadside-to-vehicle communications and it is highly flexible, allowing the performance evaluation of different vehicular standard configurations. We also show several experimental results to illustrate the quality obtained when H.264/AVC encoded video is transmitted over IEEE 802.11p networks. The quality is measured considering two important parameters: the percentage of recovered group of pictures and the frame quality. In order to improve performance, we propose to substitute the convolutional channel encoder used in IEEE 802.11p for a low-density parity-check code encoder. In addition, we suggest a simple strategy to decide the optimum number of iterations needed to decode each packet received.

IEEE recommended practices for seismic qualification of Class 1E equipment for nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1975-01-01

The IEEE has developed this document to provide direction for developing programs to seismically qualify Class 1E equipment for nuclear power generating stations. It supplements IEEE Std 323-1974, IEEE Standard for Qualifying Class 1E Equipment for Nuclear Power Generating Stations, which describes the basic requirements for equipment qualification. The Class 1E equipment to be qualified by produres or standards established by this document are of many forms, characteristics, and materials; therefore, the document presents many acceptable methods with the intent of permitting the user to make a judicious selection from among the various options. In making such a selection, the user should choose those that best meet a particular equipment's requirements. Further, in using this document as a specification for the purchase of equipment, the many options should also be recognized and the document invoked accordingly. It is recommended that the need for specific standards for the seismic qualifiction of particular kinds of equipment be evaluated by those responsible for such documents and that consideration be given to the application of particular methods from these documents which are most suitable

Coexistence of IEEE 802.11b/g WLANs and IEEE 802.15.4 WSNs : Modeling and Protocol Enhancements

NARCIS (Netherlands)

Yuan, W.

2011-01-01

As an emerging short-range wireless technology, IEEE 802.15.4/ZigBee Wireless Sensor Networks (WSNs) are increasingly used in the fields of home control, industrial control, consumer electronics, energy management, building automation, telecom services, personal healthcare, etc. IEEE

Design of handoff procedures for broadband wireless access IEEE 802.16 based networks

Directory of Open Access Journals (Sweden)

V. Rangel–Licea

2008-01-01

Full Text Available IEEE 802.16 is a protocol for fixed broad band wire less access that is currently trying to add mobility among mobile users in the standard. However, mobility adds some technical barriers that should be solved first, this is the case of HO "handoff" (change of connection between two base stations "BS" by a mobile user. In this paper, the problem of HO in IEEE 802.16 is approached try ing to maintain the quality of service (QoS of mobile users. A mechanism for changing connection during HO is pre sented. A simulation model based on OPNET MODELER1 was developed to evaluate the performance of the proposed HO mechanism. Finally, this paper demonstrates that it is possible to implement a seam less HO mech a nism over IEEE 802.16 even for users with de manding applications such as voice over IP.

Researching the roots of IEEE Region 8

NARCIS (Netherlands)

Bastiaans, M.J.

2013-01-01

This paper describes the preliminary steps towards the foundation and the early history of IRE Region 9 / IEEE Region 8. The information has been gathered mainly from the archives of the IEEE Benelux Section.

Validation of IEEE P1547.1 Interconnection Test Procedures: ASCO 7000 Soft Load Transfer System

Energy Technology Data Exchange (ETDEWEB)

Kroposki, B.; Englebretson, S.; Pink, C.; Daley, J.; Siciliano, R.; Hinton, D.

2003-09-01

This report presents the preliminary results of testing the ASCO 7000 Soft Load Transfer System according to IEEE P1547.1 procedures. The ASCO system interconnects synchronous generators with the electric power system and provides monitoring and control for the generator and grid connection through extensive protective functions. The purpose of this testing is to evaluate and give feedback on the contents of IEEE Draft Standard P1547.1 Conformance Tests Procedures for Equipment Interconnecting Distributed Resources With Electric Power Systems.

IEEE 8023 ethernet, current status and future prospects at the LHC

CERN Document Server

Dobinson, Robert W; Haas, S; Martin, B; Le Vine, M J; Saka, F

2000-01-01

The status of the IEEE 802.3 standard is reviewed and prospects for the future, including the new 10 Gigabit version of Ethernet, are discussed. The relevance of Ethernet for experiments at the CERN Large Hadron Collider is considered, with emphasis on on-line applications and areas which are technically challenging. 8 Refs.

Comparison between IEEE and CIGRE Thermal Behaviour Standards and Measured Temperature on a 132-kV Overhead Power Line

Directory of Open Access Journals (Sweden)

Alberto Arroyo

2015-12-01

Full Text Available This paper presents the steady and dynamic thermal balances of an overhead power line proposed by CIGRE (Technical Brochure 601, 2014 and IEEE (Std.738, 2012 standards. The estimated temperatures calculated by the standards are compared with the averaged conductor temperature obtained every 8 min during a year. The conductor is a LA 280 Hawk type, used in a 132-kV overhead line. The steady and dynamic state comparison shows that the number of cases with deviations to conductor temperatures higher than 5 ∘ C decreases from around 20% to 15% when the dynamic analysis is used. As some of the most critical variables are magnitude and direction of the wind speed, ambient temperature and solar radiation, their influence on the conductor temperature is studied. Both standards give similar results with slight differences due to the different way to calculate the solar radiation and convection. Considering the wind, both standards provide better results for the estimated conductor temperature as the wind speed increases and the angle with the line is closer to 90 ∘ . In addition, if the theoretical radiation is replaced by that measured with the pyranometer, the number of samples with deviations higher than 5 ∘ C is reduced from around 15% to 5%.

Performance Analysis of IEEE 802.15.6 CSMA/CA Protocol for WBAN Medical Scenario through DTMC Model.

Science.gov (United States)

Kumar, Vivek; Gupta, Bharat

2016-12-01

The newly drafted IEEE 802.15.6 standard for Wireless Body Area Networks (WBAN) has been concentrating on a numerous medical and non-medical applications. Such short range wireless communication standard offers ultra-low power consumption with variable data rates from few Kbps to Mbps in, on or around the proximity of the human body. In this paper, the performance analysis of carrier sense multiple access with collision avoidance (CSMA/CA) scheme based on IEEE 802.15.6 standard in terms of throughput, reliability, clear channel assessment (CCA) failure probability, packet drop probability, and end-to-end delay has been presented. We have developed a discrete-time Markov chain (DTMC) to significantly evaluate the performances of IEEE 802.15.6 CSMA/CA under non-ideal channel condition having saturated traffic condition including node wait time and service time. We also visualize that, as soon as the payload length increases the CCA failure probability increases, which results in lower node's reliability. Also, we have calculated the end-to-end delay in order to prioritize the node wait time cause by backoff and retransmission. The user priority (UP) wise DTMC analysis has been performed to show the importance of the standard especially for medical scenario.

PERFORMANCE STUDY OF DISTRIBUTED COORDINATION FUNCTION OVER IEEE 802.11A PHYSICAL LAYER

Directory of Open Access Journals (Sweden)

S. SELVAKENEDDY

2006-06-01

Full Text Available IEEE 802.11a is one of the latest standards to be released by the IEEE Project 802 for wireless LANs. It has specified an additional physical layer (PHY to support higher data rates, and is termed as the orthogonal frequency division multiplexing (OFDM. In order to exploit its benefits, one of the medium access control (MAC protocols specified in the IEEE 802.11 specification is called distributed coordination function (DCF. DCF is a carrier sense multiple access with collision avoidance (CSMA/CA scheme with slotted binary exponential backoff. The frames can be transmitted using the basic access scheme or the RTS/CTS scheme in DCF. It was demonstrated previously that the RTS/CTS mechanism works well in most scenarios for the previously specified PHYs. In this work, a simple simulator is developed to verify the scalability of the RTS/CTS mechanism over OFDM PHY, which supports much higher data rates.

Definition and specification for PACS. A checklist based on the standard ''IEEE Recommended Practice for Software Requirements Specifications''

International Nuclear Information System (INIS)

Koenig, H.; Klose, K.J.

1999-01-01

Problem: The formulation of requirements is necessary to control the goals of a PACS project. Furthermore, in this way, the scope of functionality necessary to support radiological working processes becomes clear. Method: Definitions of requirements and specification are formulated independently of systems according to the IEEE standard 'Recommended Practice for Software Requirements Specifications'. Definitions are given in the Request for Information, specifications in the Request for Proposal. Functional and non-functional requirements are distinguished. The solutions are rated with respect to scope, appropriateness and quality of implementation. Results: A PACS checklist was created according to the methods described above. It is published on the homepage of the 'Arbeitsgemeinschaft Informationstechnologie' (AGIT) within the 'Deutsche Roentgengesellschaft' (DRG) (http://www.uni-marburg.de/mzr.agit). Conclusion: The checklist provides a discussion forum which should contribute to an agreement on accepted basic PACS functionalities. (orig.) [de

IEEE 802.3 Ethernet, Current Status and Future Prospects at the LHC

CERN Document Server

Dobinson, Robert W; Haas, S W; Martin, B; Le Vine, M J; Saka, F

2000-01-01

The status of the IEEE 802.3 standard is reviewed and prospects for the future, including the new 10 Gigabit version of Ethernet, are discussed. The relevance of Ethernet for experiments at the CERN Large Hadron Collider is considered, with emphasis on on-line applications and areas which are technically challenging.

Energy-aware path selection metric for IEEE 802.11s wireless mesh networking

CSIR Research Space (South Africa)

Mhlanga, MM

2009-01-01

Full Text Available The IEEE 802.11s working group has commenced activities, which would lead to the development of a standard for wireless mesh networks (WMNs). The draft of 802.11s introduces a new path selection metric called airtime link metric. However...

Energy-aware path selection metric for IEEE 802.11s wireless mesh networking

CSIR Research Space (South Africa)

Mhlanga, MM

2009-08-01

Full Text Available The IEEE 802.11s working group has commenced activities, which would lead to the development of a standard for wireless mesh networks (WMNs). The draft of 802.11s introduces a new path selection metric called airtime link metric. However...

A Novel Prioritization Scheme to Improve QoS in IEEE 802.11e Networks

Directory of Open Access Journals (Sweden)

Navid Tadayon

2010-01-01

Full Text Available IEEE 802.11 WLAN utilizes a distributed function at its MAC layer, namely, DCF to access the wireless medium. Due to its distributed nature, DCF is able to guarantee working stability in a wireless medium while maintaining the assembling and maintenance cost in a low level. However, DCF is inefficient in dealing with real-time traffics due to its incapability on providing QoS. IEEE 802.11e was introduced as a supplementary standard to cope with this problem. This standard introduces an Enhanced Distributed Coordination Function (EDCF that works based on diff-Serve model and can serve multiple classes of traffics (by using different prioritizations schemes. With the emergence of new time-sensitive applications, EDCF has proved to be yet inefficient in dealing with these kinds of traffics because it could not provide network with well-differentiated QoS. In this study, we propose a novel prioritization scheme to improve QoS level in IEEE 802.11e network. In this scheme, we replace Uniform PDF with Gamma PDF, which has salient differentiating properties. We investigate the suitability and superiority of this scheme on furnishing network with well-differentiated QoS using probabilistic analysis. We strengthen our claims by extensive simulation runs.

IEEE standard criteria for type tests of class 1E modules used in nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1977-01-01

The Institute of Electrical and Electronics Engineers has generated this document to provide direction for type testing Class 1E modules and obtaining specific type test data. It supplements IEEE Std 323-1974, Standard for Qualifying Class 1E Equipment for Nuclear Power Generating Stations, which describes the basic requirements for Class 1E equipment qualification. Adherence to this document alone may not suffice for assuring public health and safety because it is the integrated performance of the structures, the fluid systems, the electrical systems, the instrumentation systems of the station, and in particular, the plant protection system of which these modules are a part that prevents accidents or limits the consequences of accidents. Each applicant to the Nuclear Regulatory Commission for a license to operate a nuclear power generating station has the responsibility to assure himself and others that this document, if used, is pertinent to his application and that the integrated performance of his station is adequate

Annual environmental monitoring report: calendar year 1976

International Nuclear Information System (INIS)

Farmer, B.M.; Robinson, B.; Carfagno, D.G.

1977-01-01

The local environment surrounding Mound Laboratory was monitored for tritium and plutonium-238 released by Mound Laboratory. The results are reported for calendar year 1976. The environmental parameters analyzed included air, water, foodstuffs, and silt. The average concentrations of plutonium-238 and tritium were within the stringent standards for radioactive species adopted by the U.S. Energy Research and Development Administration. Data concerning nonradioactive species in air and water are also presented and compared to federal, state, and local standards, where applicable. Although there are no specific standards (RCG) for plutonium-238 and tritium in foodstuffs, the concentrations found, if compared to the water standard, are also a small fraction of the RCG. In addition, there is no evidence of other than minimal reentrainment of radioactive species from silt. Mound Laboratory has undertaken a comprehensive program to bring water supplies into compliance with new U.S. EPA drinking water standards which will be effective June 24, 1977. Mound Laboratory has been granted a National Pollutant Discharge Ellimination System permit. Analyses during 1976 indicate compliance with permit conditions. All results indicated that Mound effluent streams have no significant effect on the Great Miami River and certainly do not cause Ohio Stream Standards to be exceeded. These data demonstrate compliance with various current regulatory agency standards and that the operation of Mound Laboratory has a negligible effect on the environment

An Improved Cross-Layering Design for IPv6 Fast Handover with IEEE 802.16m Entry Before Break Handover

Science.gov (United States)

Kim, Ronny Yongho; Jung, Inuk; Kim, Young Yong

IEEE 802.16m is an advanced air interface standard which is under development for IMT-Advanced systems, known as 4G systems. IEEE 802.16m is designed to provide a high data rate and a Quality of Service (QoS) level in order to meet user service requirements, and is especially suitable for mobilized environments. There are several factors that have great impact on such requirements. As one of the major factors, we mainly focus on latency issues. In IEEE 802.16m, an enhanced layer 2 handover scheme, described as Entry Before Break (EBB) was proposed and adopted to reduce handover latency. EBB provides significant handover interruption time reduction with respect to the legacy IEEE 802.16 handover scheme. Fast handovers for mobile IPv6 (FMIPv6) was standardized by Internet Engineering Task Force (IETF) in order to provide reduced handover interruption time from IP layer perspective. Since FMIPv6 utilizes link layer triggers to reduce handover latency, it is very critical to jointly design FMIPv6 with its underlying link layer protocol. However, FMIPv6 based on new handover scheme, EBB has not been proposed. In this paper, we propose an improved cross-layering design for FMIPv6 based on the IEEE 802.16m EBB handover. In comparison with the conventional FMIPv6 based on the legacy IEEE 802.16 network, the overall handover interruption time can be significantly reduced by employing the proposed design. Benefits of this improvement on latency reduction for mobile user applications are thoroughly investigated with both numerical analysis and simulation on various IP applications.

Simultaneous transmission of the IEEE 802.11 radio signal and optical Gbit Ethernet over the multimode fiber link

Science.gov (United States)

Maksymiuk, L.; Podziewski, A.

2015-09-01

In the paper we present a successful joint transmission of the IEEE 802.11 signal and an optical Gbit Ethernet over a multimode fiber based link. Most importantly, the multiplexation of both signals was performed in the optical domain. Due to the utilization of the multimode fiber the OBI noise was avoided and both channels were able to operate at the same wavelength. We prove that potential RoF link for IEEE 802.11 signal distribution may be used to additionally transmit other signals as Gbit Ethernet and therefore utilize the fiber infrastructure installed more effectively. The qualities of both the IEEE 802.11 and Ethernet transmissions fulfilled the requirements imposed by appropriate standards.

A pseudo differential Gm—C complex filter with frequency tuning for IEEE802.15.4 applications

Science.gov (United States)

Xin, Cheng; Lungui, Zhong; Haigang, Yang; Fei, Liu; Tongqiang, Gao

2011-07-01

This paper presents a CMOS Gm—C complex filter for a low-IF receiver of the IEEE 802.15.4 standard. A pseudo differential OTA with reconfigurable common mode feedback and common mode feed-forward is proposed as well as the frequency tuning method based on a relaxation oscillator. A detailed analysis of non-ideality of the OTA and the frequency tuning method is elaborated. The analysis and measurement results have shown that the center frequency of the complex filter could be tuned accurately. The chip was fabricated in a standard 0.35 μm CMOS process, with a single 3.3 V power supply. The filter consumes 2.1mA current, has a measured in-band group delay ripple of less than 0.16 μs and an IRR larger than 28 dB at 2 MHz apart, which could meet the requirements oftheIEEE802.15.4 standard.

Study on Additional Carrier Sensing for IEEE 802.15.4 Wireless Sensor Networks

Directory of Open Access Journals (Sweden)

Bih-Hwang Lee

2010-06-01

Full Text Available Wireless sensor networks based on the IEEE 802.15.4 standard are able to achieve low-power transmissions in the guise of low-rate and short-distance wireless personal area networks (WPANs. The slotted carrier sense multiple access with collision avoidance (CSMA/CA is used for contention mechanism. Sensor nodes perform a backoff process as soon as the clear channel assessment (CCA detects a busy channel. In doing so they may neglect the implicit information of the failed CCA detection and further cause the redundant sensing. The blind backoff process in the slotted CSMA/CA will cause lower channel utilization. This paper proposes an additional carrier sensing (ACS algorithm based on IEEE 802.15.4 to enhance the carrier sensing mechanism for the original slotted CSMA/CA. An analytical Markov chain model is developed to evaluate the performance of the ACS algorithm. Both analytical and simulation results show that the proposed algorithm performs better than IEEE 802.15.4, which in turn significantly improves throughput, average medium access control (MAC delay and power consumption of CCA detection.

Study on additional carrier sensing for IEEE 802.15.4 wireless sensor networks.

Science.gov (United States)

Lee, Bih-Hwang; Lai, Ruei-Lung; Wu, Huai-Kuei; Wong, Chi-Ming

2010-01-01

Wireless sensor networks based on the IEEE 802.15.4 standard are able to achieve low-power transmissions in the guise of low-rate and short-distance wireless personal area networks (WPANs). The slotted carrier sense multiple access with collision avoidance (CSMA/CA) is used for contention mechanism. Sensor nodes perform a backoff process as soon as the clear channel assessment (CCA) detects a busy channel. In doing so they may neglect the implicit information of the failed CCA detection and further cause the redundant sensing. The blind backoff process in the slotted CSMA/CA will cause lower channel utilization. This paper proposes an additional carrier sensing (ACS) algorithm based on IEEE 802.15.4 to enhance the carrier sensing mechanism for the original slotted CSMA/CA. An analytical Markov chain model is developed to evaluate the performance of the ACS algorithm. Both analytical and simulation results show that the proposed algorithm performs better than IEEE 802.15.4, which in turn significantly improves throughput, average medium access control (MAC) delay and power consumption of CCA detection.

IEEE Std 382-1980: IEEE standard for qualification of safety-related valve actuators

International Nuclear Information System (INIS)

Anon.

1992-01-01

This standard describes the qualification of all types of power-driven valve actuators, including damper actuators, for safety-related functions in nuclear power generating stations. This standard may also be used to separately qualify actuator components. This standard establishes the minimum requirements for, and guidance regarding, the methods and procedures for qualification of all safety-related functions of power-driven valve actuators

Comparison and Analysis of ISO/IEEE 11073, IHE PCD-01, and HL7 FHIR Messages for Personal Health Devices.

Science.gov (United States)

Lee, Sungkee; Do, Hyoungho

2018-01-01

Increasing use of medical devices outside of healthcare facilities inevitably requires connectivity and interoperability between medical devices and healthcare information systems. To this end, standards have been developed and used to provide interoperability between personal health devices (PHDs) and external systems. ISO/IEEE 11073 standards and IHE PCD-01 standard messages have been used the most in the exchange of observation data of health devices. Recently, transmitting observation data using the HL7 FHIR standard has been devised in the name of DoF (Devices on FHIR) and adopted very fast. We compare and analyze these standards and suggest that which standard will work best at the different environments of device usage. We generated each message/resource of the three standards for observed vital signs from blood pressure monitor and thermometer. Then, the size, the contents, and the exchange processes of these messages are compared and analyzed. ISO/IEEE 11073 standard message has the smallest data size, but it has no ability to contain the key information, patient information. On the other hand, PCD-01 messages and FHIR standards have the fields for patient information. HL7 DoF standards provide reusing of information unit known as resource, and it is relatively easy to parse DoF messages since it uses widely known XML and JSON. ISO/IEEE 11073 standards are suitable for devices having very small computing power. IHE PCD-01 and HL7 DoF messages can be used for the devices that need to be connected to hospital information systems that require patient information. When information reuse is frequent, DoF is advantageous over PCD-01.

The scalable coherent interface, IEEE P1596

International Nuclear Information System (INIS)

Gustavson, D.B.

1990-01-01

IEEE P1596, the scalable coherent interface (formerly known as SuperBus) is based on experience gained while developing Fastbus (ANSI/IEEE 960--1986, IEC 935), Futurebus (IEEE P896.x) and other modern 32-bit buses. SCI goals include a minimum bandwidth of 1 GByte/sec per processor in multiprocessor systems with thousands of processors; efficient support of a coherent distributed-cache image of distributed shared memory; support for repeaters which interface to existing or future buses; and support for inexpensive small rings as well as for general switched interconnections like Banyan, Omega, or crossbar networks. This paper presents a summary of current directions, reports the status of the work in progress, and suggests some applications in data acquisition and physics

IEEE 845 - a proposed guideline for use of human factors in design and retrofit design of nuclear power plants

International Nuclear Information System (INIS)

Schurman, D.L.

1987-01-01

This paper describes the development and content of the Institute of Electrical and Electronics Engineers (IEEE) Standard 845. This guide was developed by Working Group 7.2 of Subcommittee 7 of the Nuclear Power Engineering Committee of the Power Engineering Society of the IEEE. The guide has been approved by the Nuclear Power Engineering Committee (NPEC) and is now in the standards development and approval process. The guide is the first standards action approved by the NPEC of IEEE and is presented here to obtain wider peer response to its content. The guide provides a systematic framework for selection of human factors techniques and for the use of those techniques. The guide also provides a list of commonly used human factors techniques, along with a commentary about cost, ease of use, and other characteristics of each of the techniques. The guide is written with the project engineer and design engineer in mind. Thus, the guide attempts to provide a basis for the systematic selection of human factors techniques for various purposes and guidance regarding which of these techniques is likely to require the assistance of a human factors expert to apply

An Authentication and Key Management Mechanism for Resource Constrained Devices in IEEE 802.11-based IoT Access Networks

Directory of Open Access Journals (Sweden)

Ki-Wook Kim

2017-09-01

Full Text Available Many Internet of Things (IoT services utilize an IoT access network to connect small devices with remote servers. They can share an access network with standard communication technology, such as IEEE 802.11ah. However, an authentication and key management (AKM mechanism for resource constrained IoT devices using IEEE 802.11ah has not been proposed as yet. We therefore propose a new AKM mechanism for an IoT access network, which is based on IEEE 802.11 key management with the IEEE 802.1X authentication mechanism. The proposed AKM mechanism does not require any pre-configured security information between the access network domain and the IoT service domain. It considers the resource constraints of IoT devices, allowing IoT devices to delegate the burden of AKM processes to a powerful agent. The agent has sufficient power to support various authentication methods for the access point, and it performs cryptographic functions for the IoT devices. Performance analysis shows that the proposed mechanism greatly reduces computation costs, network costs, and memory usage of the resource-constrained IoT device as compared to the existing IEEE 802.11 Key Management with the IEEE 802.1X authentication mechanism.

An Authentication and Key Management Mechanism for Resource Constrained Devices in IEEE 802.11-based IoT Access Networks.

Science.gov (United States)

Kim, Ki-Wook; Han, Youn-Hee; Min, Sung-Gi

2017-09-21

Many Internet of Things (IoT) services utilize an IoT access network to connect small devices with remote servers. They can share an access network with standard communication technology, such as IEEE 802.11ah. However, an authentication and key management (AKM) mechanism for resource constrained IoT devices using IEEE 802.11ah has not been proposed as yet. We therefore propose a new AKM mechanism for an IoT access network, which is based on IEEE 802.11 key management with the IEEE 802.1X authentication mechanism. The proposed AKM mechanism does not require any pre-configured security information between the access network domain and the IoT service domain. It considers the resource constraints of IoT devices, allowing IoT devices to delegate the burden of AKM processes to a powerful agent. The agent has sufficient power to support various authentication methods for the access point, and it performs cryptographic functions for the IoT devices. Performance analysis shows that the proposed mechanism greatly reduces computation costs, network costs, and memory usage of the resource-constrained IoT device as compared to the existing IEEE 802.11 Key Management with the IEEE 802.1X authentication mechanism.

Experimental video signals distribution MMF network based on IEEE 802.11 standard

Science.gov (United States)

Kowalczyk, Marcin; Maksymiuk, Lukasz; Siuzdak, Jerzy

2014-11-01

The article was focused on presentation the achievements in a scope of experimental research on transmission of digital video streams in the frame of specially realized for this purpose ROF (Radio over Fiber) network. Its construction was based on the merge of wireless IEEE 802.11 network, popularly referred as Wi-Fi, with a passive optical network PON based on multimode fibers MMF. The proposed approach can constitute interesting proposal in area of solutions in the scope of the systems monitoring extensive, within which is required covering of a large area with ensuring of a relatively high degree of immunity on the interferences transmitted signals from video IP cameras to the monitoring center and a high configuration flexibility (easily change the deployment of cameras) of such network.

A pseudo differential Gm-C complex filter with frequency tuning for IEEE802.15.4 applications

International Nuclear Information System (INIS)

Cheng Xin; Yang Haigang; Liu Fei; Gao Tongqiang; Zhong Lungui

2011-01-01

This paper presents a CMOS G m -C complex filter for a low-IF receiver of the IEEE 802.15.4 standard. A pseudo differential OTA with reconfigurable common mode feedback and common mode feed-forward is proposed as well as the frequency tuning method based on a relaxation oscillator. A detailed analysis of non-ideality of the OTA and the frequency tuning method is elaborated. The analysis and measurement results have shown that the center frequency of the complex filter could be tuned accurately. The chip was fabricated in a standard 0.35 μm CMOS process, with a single 3.3 V power supply. The filter consumes 2.1mA current, has a measured in-band group delay ripple of less than 0.16 μs and an IRR larger than 28 dB at 2 MHz apart, which could meet the requirements oftheIEEE802.15.4 standard. (semiconductor integrated circuits)

Extended device profiles and testing procedures for the approval process of integrated medical devices using the IEEE 11073 communication standard.

Science.gov (United States)

Janß, Armin; Thorn, Johannes; Schmitz, Malte; Mildner, Alexander; Dell'Anna-Pudlik, Jasmin; Leucker, Martin; Radermacher, Klaus

2018-02-23

Nowadays, only closed and proprietary integrated operating room systems (IORS) from big manufacturers are available on the market. Hence, the interconnection of components from third-party vendors is only possible with increased time and costs. In the context of the German Federal Ministry of Education and Research (BMBF)-funded project OR.NET (2012-2016), the open integration of medical devices from different manufacturers was addressed. An integrated operating theater based on the open communication standard IEEE 11073 shall give clinical operators the opportunity to choose medical devices independently of the manufacturer. This approach would be advantageous especially for hospital operators and small- and medium-sized enterprises (SME) of medical devices. Actual standards and concepts regarding technical feasibility and the approval process do not cope with the requirements for a modular integration of medical devices in the operating room (OR), based on an open communication standard. Therefore, innovative approval strategies and corresponding certification and test procedures, which cover actual legal and normative standards, have to be developed in order to support the future risk management and the usability engineering process of open integrated medical devices in the OR. The use of standardized device and service profiles and a three-step testing procedure, including conformity, interoperability and integration tests are described in this paper and shall support the manufacturers to integrate their medical devices without disclosing the medical devices' risk analysis and related confidential expertise or proprietary information.

Proceedings of IEEE Machine Learning for Signal Processing Workshop XV

DEFF Research Database (Denmark)

Larsen, Jan

These proceedings contains refereed papers presented at the Fifteenth IEEE Workshop on Machine Learning for Signal Processing (MLSP’2005), held in Mystic, Connecticut, USA, September 28-30, 2005. This is a continuation of the IEEE Workshops on Neural Networks for Signal Processing (NNSP) organized...... by the NNSP Technical Committee of the IEEE Signal Processing Society. The name of the Technical Committee, hence of the Workshop, was changed to Machine Learning for Signal Processing in September 2003 to better reflect the areas represented by the Technical Committee. The conference is organized...... by the Machine Learning for Signal Processing Technical Committee with sponsorship of the IEEE Signal Processing Society. Following the practice started two years ago, the bound volume of the proceedings is going to be published by IEEE following the Workshop, and we are pleased to offer to conference attendees...

A Security Solution for IEEE 802.11's Ad-hoc Mode:Password-Authentication and Group Diffie-Hellman Key Exchange

Energy Technology Data Exchange (ETDEWEB)

Emmanuel, Bresson; Olivier, Chevassut; David, Pointcheval

2005-10-01

The IEEE 802 standards ease the deployment of networkinginfrastructures and enable employers to accesscorporate networks whiletraveling. These standards provide two modes of communication calledinfrastructure and ad-hoc modes. A security solution for the IEEE802.11's infrastructure mode took several years to reach maturity andfirmware are still been upgraded, yet a solution for the ad-hoc modeneeds to be specified. The present paper is a first attempt in thisdirection. It leverages the latest developments in the area ofpassword-based authentication and (group) Diffie-Hellman key exchange todevelop a provably-secure key-exchange protocol for IEEE 802.11's ad-hocmode. The protocol allows users to securely join and leave the wirelessgroup at time, accommodates either a single-shared password orpairwise-shared passwords among the group members, or at least with acentral server; achieves security against dictionary attacks in theideal-hash model (i.e. random-oracles). This is, to the best of ourknowledge, the first such protocol to appear in the cryptographicliterature.

A PROPOSED NOVEL ARCHITECTURE OF EC CONTROL SYSTEM USING IEEE 802.11n NETWORK AT ITER-INDIA GYROTRON TEST FACILITY

Directory of Open Access Journals (Sweden)

Deepak Mandge

2017-06-01

Full Text Available IEEE 802.11 Wi-Fi networks are increasingly becoming popular for its use in industrial applications. With the availability of recent amendments to IEEE 802.11 series of standards, particularly IEEE 802.11n, the adoption of Wi-Fi networks for process automation is gaining more focus and importance. The installation of Wireless networks naturally provides reduction in cable and its maintenance related costs, provides increased flexibility and mobility to enhance performance of industrial control system. The IEEE 802.11n supports parameterization that can be set for particular industrial applications and hence it has addressed to the aspects of timeliness and criticality to some extent. This paper proposes the use of IEEE 802.11n network to interconnect field instruments with Siemens PLC controller in harsh EMI/EMC environment. An application example is shown where the alternate control system architecture is developed in which non-critical and non-safety signals are communicated over Wi-Fi. While, for critical and safety signals, traditional hardwired signals methods can be implemented.

Performance Evaluation of Beacon-Enabled Mode for IEEE 802.15.4 Wireless Sensor Network

Directory of Open Access Journals (Sweden)

M. Udin Harun Al Rasyid

2013-12-01

Full Text Available IEEE 802.15.5 standard support structure of star and peer-to-peer network formation. Strating from these, the cluster tree network can be built as a special case of peer-to-peer network to increse coverage area. In this paper, we provide an performance evaluation of beacon- enabled mode for IEEE 802.15.4 wireless sensor network on star and cluster topology in order to get the maximum result to apply the appropriate topology model as needed. We conduct analysis on each topology model by using the numbers of nodes from 10 nodes to 100 nodes to analyze throughput, delay, energy consumption, and probability success packet by using NS2 simulator. The simulation results show that the throughput and the probability of success packet of cluster topology are higher than that of star topology, and the energy consumption of cluster topology is lesser than that of star topology. However, cluster topology increases the delay more than star topology. Keywords: IEEE 802.15.4, wireless sensor network, beacon-enabled mode, topology, csma/ca

Group-Orthogonal Code-Division Multiplex: A Physical-Layer Enhancement for IEEE 802.11n Networks

Directory of Open Access Journals (Sweden)

Felip Riera-Palou

2010-01-01

Full Text Available The new standard for wireless local area networks (WLANs, named IEEE 802.11n, has been recently released. This new norm builds upon and remains compatible with the previous WLANs standards IEEE 802.11a/g while it is able to achieve transmission rates of up to 600 Mbps. These increased data rates are mainly a consequence of two important new features: (1 multiple antenna technology at transmission and reception, and (2 optional doubling of the system bandwidth thanks to the availability of an additional 20 MHz band. This paper proposes the use of Group-Orthogonal Code Division Multiplex (GO-CDM as a means to improve the performance of the 802.11n standard by further exploiting the inherent frequency diversity. It is explained why GO-CDM synergistically matches with the two aforementioned new features and the performance gains it can offer under different configurations is illustrated. Furthermore, the effects that group-orthogonal has on key implementation issues such as channel estimation, carrier frequency offset, and peak-to-average power ratio (PAPR are also considered.

1976 environmental monitoring report

International Nuclear Information System (INIS)

Naidu, J.R.

1977-04-01

The environmental levels of radioactivity and other environmental pollutants found in the vicinity of Brookhaven National Laboratory during 1976 are summarized. As an aid in the interpretation of the data, the amounts of radioactivity and other pollutants released in airborne and liquid effluents from Laboratory facilities to the environment are also indicated. The environmental data includes external radiation levels; radioactive air particulates; tritium and iodine concentrations; the amounts and concentrations of radioactivity in precipitation; the amounts and concentrations of radioactivity in and the quality of the stream into which liquid effluents are released; the concentrations of radioactivity in sediments and biota from the stream; the concentrations of radioactivity in and the quality of ground waters underlying the Laboratory; and concentrations of radioactivity in milk, grass, and soil samples obtained in the vicinity of the Laboratory. The external radiation level for 1976 at the north boundary of the Laboratory attributable to an ecology forest irradiation source was 74.4 mrem, or 14 percent of the applicable Radiation Protection Standard

Design of Pulse Oximeter with WiFi Connectivity and Interoperability with Standard HL7 and IEEE 11073-10404:2008

Directory of Open Access Journals (Sweden)

Víctor Ochoa

2014-12-01

Full Text Available Given that health is so relevant for global productivity and competitiveness, and that the Information and Communications Technology (ICTs play an important role in all of the productivity factors, this work makes use of the ICTs in health matters proposing the to use a WiFi oximeter. This article describes the operating principles of a Pulse Oximeter (PO which is an opto-electronic non-invasive medical instrument capable of measuring changes in heart rate (HR and SpO2 at the fingertip and its upgrade to the standards; HL7 and IEEE 11073-10404:2008, its design, and its validation against the three existing devices. Variables (SpO2%, Ppm and Temperature were compared, and its performance and impact were discussed the addition of the WiFi technology allows a better communication between devices, causing a greater impact in global competiveness.

Analysis and Enhancement of IEEE 802.15.4e DSME Beacon Scheduling Model

Directory of Open Access Journals (Sweden)

Kwang-il Hwang

2014-01-01

Full Text Available In order to construct a successful Internet of things (IoT, reliable network construction and maintenance in a sensor domain should be supported. However, IEEE 802.15.4, which is the most representative wireless standard for IoT, still has problems in constructing a large-scale sensor network, such as beacon collision. To overcome some problems in IEEE 802.15.4, the 15.4e task group proposed various different modes of operation. Particularly, the IEEE 802.15.4e deterministic and synchronous multichannel extension (DSME mode presents a novel scheduling model to solve beacon collision problems. However, the DSME model specified in the 15.4e draft does not present a concrete design model but a conceptual abstract model. Therefore, in this paper we introduce a DSME beacon scheduling model and present a concrete design model. Furthermore, validity and performance of DSME are evaluated through experiments. Based on experiment results, we analyze the problems and limitations of DSME, present solutions step by step, and finally propose an enhanced DSME beacon scheduling model. Through additional experiments, we prove the performance superiority of enhanced DSME.

9 CFR 319.141 - Fresh pork sausage.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Fresh pork sausage. 319.141 Section... AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION DEFINITIONS AND STANDARDS OF IDENTITY OR COMPOSITION Sausage Generally: Fresh...

IEEE Prize for Lucio Rossi

CERN Multimedia

IEEE Council on Superconductivity

2007-01-01

Lucio Rossi receives his prize from John Spargo, Chairman of the IEEE Council on Superconductivity (left), and Martin Nisenoff, Chairman of the Council on Superconductivity's Awards Committee (right).

Proceedings IEEE Visualization Conference and IEEE Information Visualization Conference (VIS'07 and INFOVIS'07, Sacramento CA, USA, October 28-November 1, 2007)

NARCIS (Netherlands)

Chen, M.; Hansen, C.; North, C.; Pang, A.; Wijk, van J.J.

2007-01-01

These are the proceedings of the IEEE Visualization Conference 2007 (Vis 2007) and the IEEE Information Visualization Conference 2007 (InfoVis 2007) held during October 28 to November 1, 2007 in Sacramento, California. The power of using computing technology to create useful, effective imagery for

IEEE standard for type test of class 1E electric cables, field splices, and connections for nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1974-01-01

The Institute of Electrical and Electronics Engineers has generated this document to provide guidance for developing a program to type test cables, field splices, and connections and obtain specific type test data. It supplements IEEE Std 323-1974 Standard for Qualifying Class IE Equipment for Nuclear Power Generating Stations, which describes basic requirements for equipment qualification. It is the integrated performance of the structures, fluid systems, the electrical systems, the instrumentation systems of the station, and in particular, the plant protection system, that limits the consequences of accidents. Seismic effects on installed cable systems are not within the scope of this document. Section 2 of this guide is an example of type tests. It is the purpose of this guide to deal with cable and connections; however, at the time of issue, detailed examples of tests for connections were not available

The evolution of IRRR nuclear standards from the single failure criterion and their impact on system design

International Nuclear Information System (INIS)

Clark, D.H.

1978-01-01

One of the first industry standards developed in the United States to meet regulatory agency criteria for the design and installation of nuclear power plant control and instrumentation systems was prepared by the Institute of Electrical and Electronics Engineers, Inc., abbreviated IEEE. This was IEEE Std. 279, first issued in 1968. It was subsequently revised and reissued as IEEE Std. 279-1971 ''IEEE Standard: Criteria for Protection Systems for Nuclear Power Generating Stations''. Not only has the implementation of this standard had a tremendous impact on nuclear power plant design in the United States, it has been the base document from which subsequent IEEE nuclear standards have been developed. Three major concepts which are addressed by IEEE 279, and which have had a major impact upon control and instrumentation systems in nuclear power plants are the following : 1) Single failure criterion. 2) Equipment qualification. 3) Channel independence. Each of these concepts has resulted in the development of subsequent IEEE Nuclear Standards. The impact of some of these on control and instrumentation systems are discussed. (author)

Basic security measures for IEEE 802.11 wireless networks

Directory of Open Access Journals (Sweden)

Oscar P. Sarmiento

2008-05-01

Full Text Available This article presents a tutorial/discussion of three commonly-used IEEE 802.11 wireless network security standards: WEP, WPA and WPA2. A detailed analysis of the RC4 algorithm supporting WEP is presented, including its vulnera-bilities. The WPA and WPA2 encryption protocols’ most relevant aspects and technical characteristics are reviewed for a comparative analysis of the three standards in terms of the security they provide. Special attention has been paid to WEP encryption by using an educational simulation tool written in C++ Builder for facilitating the unders-tanding of this protocol at academic level. Two practical cases of wireless security configurations using Cisco net-working equipment are also presented: configuring and enabling WPA-Personal and WPA2-Personal (these being security options used by TKIP and AES, respectively.

CERN receives prestigious Milestone recognition from IEEE

CERN Multimedia

2005-01-01

The Nobel prize winner Georges Charpak and W. Cleon Anderson, IEEE President, unveil the Milestone bronze plaques. At a ceremony on 26 September at the Globe of Science and Innovation, Mr W. Cleon Anderson, President of the Institute of Electrical and Electronics Engineers (IEEE) formally dedicated Milestone plaques recognising the invention of electronic particle detectors at CERN. The plaque were unveiled by Mr Anderson and Georges Charpak, the Nobel-prize winning inventor of wire chamber technology at CERN in 1968. The IEEE is the world's largest professional association dedicated to the advancement of technology with 365,000 individual members in over 150 countries. Established in 1983, there are currently over 60 Milestones around the world. They honour momentous achievements in the history of electrical and electronics engineering, such as the landing of the first transatlantic cable, code breaking at Bletchley Park during World War II, and the development of the Japanese Bullet train, the Tokaido Shin...

A distributed scheme to manage the dynamic coexistence of IEEE 802.15.4-based health-monitoring WBANs.

Science.gov (United States)

Deylami, Mohammad N; Jovanov, Emil

2014-01-01

The overlap of transmission ranges between wireless networks as a result of mobility is referred to as dynamic coexistence. The interference caused by coexistence may significantly affect the performance of wireless body area networks (WBANs) where reliability is particularly critical for health monitoring applications. In this paper, we analytically study the effects of dynamic coexistence on the operation of IEEE 802.15.4-based health monitoring WBANs. The current IEEE 802.15.4 standard lacks mechanisms for effectively managing the coexistence of mobile WBANs. Considering the specific characteristics and requirements of health monitoring WBANs, we propose the dynamic coexistence management (DCM) mechanism to make IEEE 802.15.4-based WBANs able to detect and mitigate the harmful effects of coexistence. We assess the effectiveness of this scheme using extensive OPNET simulations. Our results indicate that DCM improves the successful transmission rates of dynamically coexisting WBANs by 20%-25% for typical medical monitoring applications.

Cross-Layer Measurement on an IEEE 802.11g Wireless Network Supporting MPEG-2 Video Streaming Applications in the Presence of Interference

Directory of Open Access Journals (Sweden)

Alessandro Sona

2010-01-01

Full Text Available The performance of wireless local area networks supporting video streaming applications, based on MPEG-2 video codec, in the presence of interference is here dealt with. IEEE 802.11g standard wireless networks, that do not support QoS in according with IEEE 802.11e standard, are, in particular, accounted for and Bluetooth signals, additive white Gaussian noise, and competitive data traffic are considered as sources of interference. The goal is twofold: from one side, experimentally assessing and correlating the values that some performance metrics assume at the same time at different layers of an IEEE 802.11g WLAN delivering video streaming in the presence of in-channel interference; from the other side, deducing helpful and practical hints for designers and technicians, in order to efficiently assess and enhance the performance of an IEEE 802.11g WLAN supporting video streaming in some suitable setup conditions and in the presence of interference. To this purpose, an experimental analysis is planned following a cross-layer measurement approach, and a proper testbed within a semianechoic chamber is used. Valuable results are obtained in terms of signal-to-interference ratio, packet loss ratio, jitter, video quality, and interference data rate; helpful hints for designers and technicians are finally gained.

A Novel IEEE 802.15.4e DSME MAC for Wireless Sensor Networks.

Science.gov (United States)

Sahoo, Prasan Kumar; Pattanaik, Sudhir Ranjan; Wu, Shih-Lin

2017-01-16

IEEE 802.15.4e standard proposes Deterministic and Synchronous Multichannel Extension (DSME) mode for wireless sensor networks (WSNs) to support industrial, commercial and health care applications. In this paper, a new channel access scheme and beacon scheduling schemes are designed for the IEEE 802.15.4e enabled WSNs in star topology to reduce the network discovery time and energy consumption. In addition, a new dynamic guaranteed retransmission slot allocation scheme is designed for devices with the failure Guaranteed Time Slot (GTS) transmission to reduce the retransmission delay. To evaluate our schemes, analytical models are designed to analyze the performance of WSNs in terms of reliability, delay, throughput and energy consumption. Our schemes are validated with simulation and analytical results and are observed that simulation results well match with the analytical one. The evaluated results of our designed schemes can improve the reliability, throughput, delay, and energy consumptions significantly.

Spectrum-efficient multi-channel design for coexisting IEEE 802.15.4 networks: A stochastic geometry approach

KAUST Repository

Elsawy, Hesham

2014-07-01

For networks with random topologies (e.g., wireless ad-hoc and sensor networks) and dynamically varying channel gains, choosing the long term operating parameters that optimize the network performance metrics is very challenging. In this paper, we use stochastic geometry analysis to develop a novel framework to design spectrum-efficient multi-channel random wireless networks based on the IEEE 802.15.4 standard. The proposed framework maximizes both spatial and time domain frequency utilization under channel gain uncertainties to minimize the number of frequency channels required to accommodate a certain population of coexisting IEEE 802.15.4 networks. The performance metrics are the outage probability and the self admission failure probability. We relax the single channel assumption that has been used traditionally in the stochastic geometry analysis. We show that the intensity of the admitted networks does not increase linearly with the number of channels and the rate of increase of the intensity of the admitted networks decreases with the number of channels. By using graph theory, we obtain the minimum required number of channels to accommodate a certain intensity of coexisting networks under a self admission failure probability constraint. To this end, we design a superframe structure for the coexisting IEEE 802.15.4 networks and a method for time-domain interference alignment. © 2002-2012 IEEE.

Direct maternal deaths in Norway 1976-1995

DEFF Research Database (Denmark)

Andersgaard, Alice Beate; Langhoff-Roos, J.; Oian, P.

2008-01-01

AIMS: To report direct maternal mortality ratio (MMR) in Norway between 1976 and 1995 including a description of the underlying complications in pregnancy, the causes of death and assessment of standard of care. METHODS: The maternal deaths were identified through the Cause of Death Registry......, Statistics Norway, and Medical Birth Registry of Norway. We requested copies of the hospital case records and the maternal death autopsies. The direct maternal deaths were classified on the basis underlying causes and assessed for substandard care according to the guidelines at the time of death...... and preventability provided optimal conditions and up to date guidelines. RESULTS: In the period 1976-1995 we identified 61 direct maternal deaths in Norway. The direct MMR was 5.5/100,000 births. Sufficient information was available for analysis in 51 of these cases. Six deaths occurred in early pregnancy. Among...

CSIR Annual report 1976

CSIR Research Space (South Africa)

CSIR

1976-01-01

Full Text Available stream_source_info Annual Report_1976.pdf.txt stream_content_type text/plain stream_size 75 Content-Encoding ISO-8859-1 stream_name Annual Report_1976.pdf.txt Content-Type text/plain; charset=ISO-8859-1 ...

Dresden 1 Plutonium Recycle Program report, January 1, 1976--June 30, 1976

International Nuclear Information System (INIS)

Wan, M.Y.

1977-01-01

This report on the Dresden 1 Plutonium Recycle Demonstration Program covers the period from January 1, 1976 through June 30, 1976. Included are a summary of reactor operations, power and exposure histories for each mixed-oxide assembly, and the plans and schedule for the remainder of the program

IEEE Prize for Lucio Rossi

CERN Multimedia

2007-01-01

Lucio Rossi receives his prize from John Spargo, Chairman of the IEEE Council on Superconductivity (left), and Martin Nisenoff, Chairman of the Council on Superconductivity’s Awards Committee (right). (Photo: IEEE Council on Superconductivity)With the magnets installed in the tunnel and work on the interconnections almost completed, Lucio Rossi has reaped the rewards of fifteen years of work. And yet, when the physicist from Milan arrived to take charge of the group responsible for the superconducting magnets in 2001, success seemed far from assured. Endowed with surprising levels of energy, Lucio Rossi, together with his team, ensured that production of these highly complex magnets got underway. Today, that achievement earns them the recognition not only of CERN but also of the international superconducting community. It is for this achievement that Lucio Rossi was awarded the prize by the IEEE’s (Institute of Electrical an...

IEEE Conference Publications in Libraries.

Science.gov (United States)

Johnson, Karl E.

1984-01-01

Conclusions of surveys (63 libraries, OCLC database, University of Rhode Island users) assessing handling of Institute of Electrical and Electronics Engineers (IEEE) conference publications indicate that most libraries fully catalog these publications using LC cataloging, and library patrons frequently require series access to publications. Eight…

IEEE International Workshop on Machine Learning for Signal Processing: Preface

DEFF Research Database (Denmark)

Tao, Jianhua

The 21st IEEE International Workshop on Machine Learning for Signal Processing will be held in Beijing, China, on September 18–21, 2011. The workshop series is the major annual technical event of the IEEE Signal Processing Society's Technical Committee on Machine Learning for Signal Processing...

A Fair Cooperative MAC Protocol in IEEE 802.11 WLAN

Directory of Open Access Journals (Sweden)

Seyed Davoud Mousavi

2018-05-01

Full Text Available Cooperative communication techniques have recently enabled wireless technologies to overcome their challenges. The main objective of these techniques is to improve resource allocation. In this paper, we propose a new protocol in medium access control (MAC of the IEEE 802.11 standard. In our new protocol, which is called Fair Cooperative MAC (FC-MAC, every relay node participates in cooperation proportionally to its provided cooperation gain. This technique improves network resource allocation by exploiting the potential capacity of all relay candidates. Simulation results demonstrate that the FC-MAC protocol presents better performance in terms of throughput, fairness, and network lifetime.

EU-US standards harmonization task group report : status of ITS communication standards.

Science.gov (United States)

2012-11-01

Harmonization Task Groups 1 and 3 (HTG1 and 3) were established by the EU-US International Standards Harmonization Working Group to attempt to harmonize standards (including ISO, CEN, ETSI, IEEE) on security (HTG1) and communications protocols (HTG3)...

40 CFR 141.700 - General requirements.

Science.gov (United States)

2010-07-01

... described in §§ 141.721 through 141.722. (7) Systems must address significant deficiencies identified in... 40 Protection of Environment 22 2010-07-01 2010-07-01 false General requirements. 141.700 Section 141.700 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS...

Stable isotope sales: Mound Laboratory customer and shipment summaries, FY 1976 and FY 1976A

International Nuclear Information System (INIS)

Ruwe, A.H. Jr.

1977-01-01

A listing is given of Mound Laboratory's sales of stable isotopes of noble gases, carbon, oxygen, nitrogen, chlorine, and sulfur for fiscal years 1976 and 1976A (the period July 1, 1975 through September 30, 1976). Purchasers are listed alphabetically and are divided into domestic and foreign groups. A cross-reference index by location is included for domestic customers. Cross-reference listings by isotope purchased are included for all customers

Low-cost RAU with Optical Power Supply Used in a Hybrid RoF IEEE 802.11 Network

Science.gov (United States)

Kowalczyk, M.; Siuzdak, J.

2014-09-01

The paper presents design and implementation of a low-cost RAU (Remote Antenna Unit) device. It was designed to work in a hybrid Wi-Fi/optical network based on the IEEE 802.11b/g standard. An unique feature of the device is the possibility of optical power supply.

42 CFR 423.1976 - Judicial review.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Judicial review. 423.1976 Section 423.1976 Public...) MEDICARE PROGRAM VOLUNTARY MEDICARE PRESCRIPTION DRUG BENEFIT Reopening, ALJ Hearings, MAC review, and Judicial Review § 423.1976 Judicial review. (a) Review of ALJ's decision. The enrollee may request judicial...

Biometric identity management for standard mobile medical networks.

Science.gov (United States)

Egner, Alexandru; Soceanu, Alexandru; Moldoveanu, Florica

2012-01-01

The explosion of healthcare costs over the last decade has prompted the ICT industry to respond with solutions for reducing costs while improving healthcare quality. The ISO/IEEE 11073 family of standards recently released is the first step towards interoperability of mobile medical devices used in patient environments. The standards do not, however, tackle security problems, such as identity management, or the secure exchange of medical data. This paper proposes an enhancement of the ISO/IEEE 11073-20601 protocol with an identity management system based on biometry. The paper describes a novel biometric-based authentication process, together with the biometric key generation algorithm. The proposed extension of the ISO/IEEE 11073-20601 is also presented.

IEEE prize awarded to CERN PhD student

CERN Multimedia

2006-01-01

Rafael Ballabriga Suñe is the recipient of the 2006 Institute of Electrical and Electronics Engineers, Inc. (IEEE) Nuclear and Plasma Sciences Society (NPSS)'s Student Paper Award. Ballabriga's winning paper reported on a prototype chip, which belongs to a new generation of single photon counting hybrid pixel detector readout chips - Medipix3. The award was presented by the deputy programme chair Vince Cianciolo (left) at the IEEE Nuclear Science Symposium held in San Diego on 29 October to 4 November.

Stable isotope sales: Mound Laboratory customer and shipment summaries, FY 1976 and FY 1976A

Energy Technology Data Exchange (ETDEWEB)

Ruwe, A.H. Jr. (comp.)

1977-06-06

A listing is given of Mound Laboratory's sales of stable isotopes of noble gases, carbon, oxygen, nitrogen, chlorine, and sulfur for fiscal years 1976 and 1976A (the period July 1, 1975 through September 30, 1976). Purchasers are listed alphabetically and are divided into domestic and foreign groups. A cross-reference index by location is included for domestic customers. Cross-reference listings by isotope purchased are included for all customers.

18 CFR 284.141 - Applicability.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Applicability. 284.141 Section 284.141 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Certain Sales by Intrastate Pipelines § 284.141 Applicability. This subpart implements section 311(b) of...

40 CFR 141.89 - Analytical methods.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods. 141.89 Section 141...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Control of Lead and Copper § 141.89 Analytical methods. (a... shall be conducted with the methods in § 141.23(k)(1). (1) Analyses for alkalinity, calcium...

Performance Analysis of IEEE 802.11 DCF and IEEE 802.11e EDCA in Non-saturation Condition

Science.gov (United States)

Kim, Tae Ok; Kim, Kyung Jae; Choi, Bong Dae

We analyze the MAC performance of the IEEE 802.11 DCF and 802.11e EDCA in non-saturation condition where device does not have packets to transmit sometimes. We assume that a flow is not generated while the previous flow is in service and the number of packets in a flow is geometrically distributed. In this paper, we take into account the feature of non-saturation condition in standards: possibility of transmission performed without preceding backoff procedure for the first packet arriving at the idle station. Our approach is to model a stochastic behavior of one station as a discrete time Markov chain. We obtain four performance measures: normalized channel throughput, average packet HoL (head of line) delay, expected time to complete transmission of a flow and packet loss probability. Our results can be used for admission control to find the optimal number of stations with some constraints on these measures.

10 CFR 63.141 - Scope.

Science.gov (United States)

2010-01-01

... 10 Energy 2 2010-01-01 2010-01-01 false Scope. 63.141 Section 63.141 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC REPOSITORY AT YUCCA MOUNTAIN, NEVADA Quality Assurance § 63.141 Scope. As used in this part, quality assurance comprises all those...

EU-US standards harmonization task group report : feedback to standards development organizations - security

Science.gov (United States)

2012-11-12

Harmonization Task Groups 1 and 3 (HTG1 and 3) were established by the EU-US International Standards Harmonization Working Group to attempt to harmonize standards (including ISO, CEN, ETSI, IEEE) on security (HTG1) and communications protocols (HTG3)...

Revisión del estado del arte deIR-Ultra-Wideband y simulación de la respuesta impulsiva del canal IEEE802.15.4a Review of the state of art of IR-Ultra-Wideband and simulation of Impulse Responce of the IEEE 802.15.4a channel

Directory of Open Access Journals (Sweden)

Julio Suárez Páez

2010-06-01

Full Text Available Este artículo realiza una revisión del estado del arte de la tecnología basada en canales de Banda Ultra Ancha (UWB, Ultra–Wideband enfocándose en su regulación, estandarización, aplicaciones básicas, modelo de canal IEEE 802.15.4a y simulación de la respuesta impulsiva de este tipo de canal. También se pretende introducir al lector en las tecnologías basadas en canales IR–UWB y en los parámetros para el modelamiento y simulación del canal UWB IEEE 802.15.4a.This paper reviews the state of the art of the technology based in channels of Ultra Wide band (UWB Ultra–Wideband focusing on its regulation, standardization, basic applications, IEEE 802.15.4a channel model and simulation of the impulsive response of this type of channel. Also, it aims to introduce the reader to the technologies based on IR–UWB channels and the parameters for modeling and simulation of IEEE 802.15.4a UWB channel.

Architectural and Functional Design and Evaluation of E-Learning VUIS Based on the Proposed IEEE LTSA Reference Model.

Science.gov (United States)

O'Droma, Mairtin S.; Ganchev, Ivan; McDonnell, Fergal

2003-01-01

Presents a comparative analysis from the Institute of Electrical and Electronics Engineers (IEEE) Learning Technology Standards Committee's (LTSC) of the architectural and functional design of e-learning delivery platforms and applications, e-learning course authoring tools, and learning management systems (LMSs), with a view of assessing how…

Oil statistics 1976: supply and disposal

Energy Technology Data Exchange (ETDEWEB)

1976-01-01

Summary tables are included for the period 1960 to 1976. The detailed tables for 1976 cover production, supply and disposal; supply and disposal by product; imports by sources; imports from member countries; exports by destination; exports to member countries; consumption by end-use sectors; and supply and disposal of finished products by country (1975 and 1976). (DLC)

Interoperable End-to-End Remote Patient Monitoring Platform Based on IEEE 11073 PHD and ZigBee Health Care Profile.

Science.gov (United States)

Clarke, Malcolm; de Folter, Joost; Verma, Vivek; Gokalp, Hulya

2018-05-01

This paper describes the implementation of an end-to-end remote monitoring platform based on the IEEE 11073 standards for personal health devices (PHD). It provides an overview of the concepts and approaches and describes how the standard has been optimized for small devices with limited resources of processor, memory, and power that use short-range wireless technology. It explains aspects of IEEE 11073, including the domain information model, state model, and nomenclature, and how these support its plug-and-play architecture. It shows how these aspects underpin a much larger ecosystem of interoperable devices and systems that include IHE PCD-01, HL7, and BlueTooth LE medical devices, and the relationship to the Continua Guidelines, advocating the adoption of data standards and nomenclature to support semantic interoperability between health and ambient assisted living in future platforms. The paper further describes the adaptions that have been made in order to implement the standard on the ZigBee Health Care Profile and the experiences of implementing an end-to-end platform that has been deployed to frail elderly patients with chronic disease(s) and patients with diabetes.

A standard digital data busing system for use with nim modules

International Nuclear Information System (INIS)

Kirsten, F.A.

1984-01-01

A NIM Committee working group has recently completed a specification that defines a standard digital bus for use with NIM modules. The standard bus is based on the General Purpose Instrumentation Bus of IEEE Standard 488. It incorporates a subset of the codes and conventions for the GPIB given in IEEE Standard 728. The standard bus definition also includes specifications for additional features and provisions that are special to the NIM application. The most prominent of these is the set of mnemonics defined for information transfer

IEEE Conference Record - Abstracts. 1997 IEEE International Conference on Plasma Science, 19 - 22 May 1997 San Diego, California

National Research Council Canada - National Science Library

Hyman, Julius

1997-01-01

This 360 page softbound publication includes the following major sections. An invitation to ICOPS'97, Catamaran Resort Hotel Floor Pinas, Officers of the IEEE Nuclear and Plasma Sciences Society, Conference Information...

A Green Media Access Method for IEEE 802.15.6 Wireless Body Area Network.

Science.gov (United States)

Jacob, Anil K; Jacob, Lillykutty

2017-09-30

It is of utmost importance to conserve battery energy to the maximum possible extent in WBAN nodes while collecting and transferring medical data. The IEEE 802.15.6 WBAN standard does not specify any method to conserve energy. This paper focuses on a method to conserve energy in IEEE 802.15.6 WBAN nodes when using CSMA/CA, while simultaneously restricting data delivery delay to the required value as specified in medical applications. The technique is to allow the nodes to sleep all the times except for receiving beacons and for transmitting data frames whenever a data frame enters an empty buffer. The energy consumed by the nodes and the average latency of data frame for periodical arrival of data are found out analytically. The analytical results are validated and also the proposed method is compared with other energy conserving schemes, using Castalia simulation studies. The proposed method shows superior performance in both device lifetime and latency of emergency medical data.

EU-US standards harmonization task group report : feedback to ITS standards development organizations communications.

Science.gov (United States)

2012-11-01

Harmonization Task Groups 1 and 3 (HTG1 and 3) were established by the EU-US International Standards Harmonization Working Group to attempt to harmonize standards (including ISO, CEN, ETSI, IEEE) on security (HTG1) and communications protocols (HTG3)...

Relevant Standards

Indian Academy of Sciences (India)

.86: Ethernet over LAPS. Standard in China and India. G.7041: Generic Framing Procedure (GFP). Supports Ethernet as well as other data formats (e.g., Fibre Channel); Protocol of ... IEEE 802.3x for flow control of incoming Ethernet data ...

Technical publications by JAERI staff from January 1976 to December 1976

International Nuclear Information System (INIS)

1977-11-01

Approximately 400 journal articles, papers at meetings, reports and books are given, which have been published by personnel of JAERI from January 1976 to December 1976. The contents for each entry include the title, language in which it is written, author(s), and journal name or origin. They are presented in INIS subject categories. The indexes are both by authors and report number. A list of the patents, originating at JAERI, including both Japanese and other patents, is also given. (auth.)

Implementation of IEEE-1588 timing and synchronization for ATCA control and data acquisition systems

International Nuclear Information System (INIS)

Correia, Miguel; Sousa, Jorge; Combo, Álvaro; Rodrigues, António P.; Carvalho, Bernardo B.; Batista, António J.N.; Gonçalves, Bruno; Correia, Carlos M.B.A.; Varandas, Carlos A.F.

2012-01-01

Highlights: ► IEEE-1588 over Ethernet protocol is implemented for the synchronization of all clock signals of an ATCA AMC carrier module. ► The ATCA hardware consists of an AMC quad-carrier main-board with PCI Express switching. ► IEEE-1588 is to be implemented on a Virtex-6 FPGA. ► Timing signals on the ATX-AMC4-PTP are managed and routed by a crosspoint-switch implemented on a Virtex-6 FPGA. ► Each clock signal source may be independently located (on each of the AMC cards, RTM or ATCA backplane). - Abstract: Control and data acquisition (C and DA) systems for Fusion experiments are required to provide accurate timing and synchronization (T and S) signals to all of its components. IPFN adopted PICMG's Advanced Telecommunications Computing Architecture (ATCA) industry standard to develop C and DA instrumentation. ATCA was chosen not only for its high throughput characteristics but also for its high availability (HA) features which become of greater importance in steady-state operation scenarios. However, the specified ATCA clock and synchronization interface may be too limited for the timing and synchronization needs in advanced Physics experiments. Upcoming specification extensions, developed by the “xTCA for Physics” workgroups, will contemplate, among others, a complementary timing specification, developed by the PICMG xTCA for Physics IO, Timing and Synchronization Technical Committee. The IEEE-1588 Precision Time Protocol (PTP) over Ethernet is one of the protocols, proposed by the Committee, aiming for precise synchronization of clocks in measurement and control systems, based on low jitter and slave-to-slave skew criteria. The paper presents an implementation of IEEE-1588 over Ethernet, in an ATCA hardware platform. The ATCA hardware consists of an Advanced Mezzanine Card (AMC) quad-carrier front board with PCI Express switching. IEEE-1588 is to be implemented on a Virtex-6 FPGA. Ethernet connectivity with the remote master clock is located on

14 CFR 141.25 - Business office and operations base.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Business office and operations base. 141.25... operations base. (a) Each holder of a pilot school or a provisional pilot school certificate must maintain a... or the operations base, each certificate holder must notify the FAA Flight Standards District Office...

Annual report 1976

International Nuclear Information System (INIS)

1976-01-01

By a new agreement the research and training programme on Controlled Thermonuclear Fusion and Plasma Physics of the Institute for Electromagnetic Field Theory at Chalmers University of Technology, Goeteborg, became associated with the Euratom Fusion programme. The planned research activity in Goeteborg which is mainly on plasma theory is summarized. A number of theoretical investigations carried out by members of the institute during 1976 is briefly reviewed. Participation in conferences and visits to research institutes by members of the institute are outlined. Publications and reports during 1976 are listed. (B.R.H.)

Energy Harvesting - Wireless Sensor Networks for Indoors Applications Using IEEE 802.11

DEFF Research Database (Denmark)

Fafoutis, Xenofon; Sørensen, Thomas; Madsen, Jan

2014-01-01

The paper investigates the feasibility of using IEEE 802.11 in energy harvesting low-power sensing applications. The investigation is based on a prototype carbon dioxide sensor node that is powered by artificial indoors light. The wireless communication module of the sensor node is based on the RTX......4100 module. RTX4100 incorporates a wireless protocol that duty-cycles the radio while being compatible with IEEE 802.11 access points. The presented experiments demonstrate sustainable operation but indicate a trade-off between the benefits of using IEEE 802.11 in energy harvesting applications...

Dicty_cDB: VHI141 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG

Improving Energy Efficiency in Idle Listening of IEEE 802.11 WLANs

Directory of Open Access Journals (Sweden)

Muhammad Adnan

2016-01-01

Full Text Available This paper aims to improve energy efficiency of IEEE 802.11 wireless local area networks (WLANs by effectively dealing with idle listening (IL, which is required for channel sensing and is unavoidable in a contention-based channel access mechanism. Firstly, we show that IL is a dominant source of energy drain in WLANs and it cannot be effectively alleviated by the power saving mechanism proposed in the IEEE 802.11 standard. To solve this problem, we propose an energy-efficient mechanism that combines three schemes in a systematic way: downclocking, frame aggregation, and contention window adjustment. The downclocking scheme lets a station remain in a semisleep state when overhearing frames destined to neighbor stations, whereby the station consumes the minimal energy without impairing channel access capability. As well as decreasing the channel access overhead, the frame aggregation scheme prolongs the period of semisleep time. Moreover, by controlling the size of contention window based on the number of stations, the proposed mechanism decreases unnecessary IL time due to collision and retransmission. By deriving an analysis model and performing extensive simulations, we confirm that the proposed mechanism significantly improves the energy efficiency and throughput, by up to 2.8 and 1.8 times, respectively, compared to the conventional power saving mechanisms.

Introduction to the special issue on the 2011 Joint IEEE International Frequency Control Symposium and European Frequency and Time Forum.

Science.gov (United States)

Burt, Eric; Gill, Patrick

2012-03-01

The 8 invited and 17 contributed papers in this special issue focus on the following topical areas covered at the 2011 Joint IEEE International Frequency Control Symposium and European Frequency and Time Forum, held in San Francisco, California: 1) Materials and Resonators; 2) Oscillators, Synthesizers, and Noise; 3) Microwave Frequency Standards; 4) Sensors and Transducers; 5) Timekeeping and Time and Frequency Transfer; and 6) Optical Frequency Standards.

40 CFR 141.76 - Recycle provisions.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Recycle provisions. 141.76 Section 141...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.76 Recycle provisions. (a... recycle spent filter backwash water, thickener supernatant, or liquids from dewatering processes must meet...

An Asynchronous IEEE Floating-Point Arithmetic Unit

Directory of Open Access Journals (Sweden)

Joel R. Noche

2007-12-01

Full Text Available An asynchronous floating-point arithmetic unit is designed and tested at the transistor level usingCadence software. It uses CMOS (complementary metal oxide semiconductor and DCVS (differentialcascode voltage switch logic in a 0.35 µm process using a 3.3 V supply voltage, with dual-rail data andsingle-rail control signals using four-phase handshaking.Using 17,085 transistors, the unit handles single-precision (32-bit addition/subtraction, multiplication,division, and remainder using the IEEE 754-1985 Standard for Binary Floating-Point Arithmetic, withrounding and other operations to be handled by separate hardware or software. Division and remainderare done using a restoring subtractive algorithm; multiplication uses an additive algorithm. Exceptionsare noted by flags (and not trap handlers and the output is in single-precision.Previous work on asynchronous floating-point arithmetic units have mostly focused on single operationssuch as division. This is the first work to the authors' knowledge that can perform floating-point addition,multiplication, division, and remainder using a common datapath.

CERN receives prestigious Milestone recognition from IEEE

CERN Multimedia

2005-01-01

At a ceremony at CERN, Mr W. Cleon Anderson, President of the Institute of Electrical and Electronics Engineers (IEEE) formally a Milestone plaque in recognition of the invention of electronic particle detectors at CERN

0011-0030.How to make an abstract in IEEE Format for ...

Indian Academy of Sciences (India)

Home; public; Volumes; reso; 021; 01; 0011-0030.How to make an abstract in IEEE Format for AvishkarMulticultural Night in IEEE R10 Student Congress 2009Performances.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook ...

Development and results of a test program to demonstrate compliance with IEEE STD 384 and R.G. 1.75 electrical separation requirements

International Nuclear Information System (INIS)

Eckert, G.P.; Heneberry, E.F.; Walker, F.P.; Konkus, J.F.

1987-01-01

The IEEE Std 384-1974, entitled ''Criteria for Separation of Class 1E Equipment and Circuits,'' contains criteria to ensure the independence of redundant Class 1E equipment when designing electrical systems in nuclear plants. The NRC, in R.G. 1.75 Rev. 2, 1978, endorses, with comments, IEEE-384, as the means of achieving independence. One method given in IEEE-384, is that of maintaining a specified separation between components; another method utilizes a combination of separation and barriers. The standard also allows alternative methods to be used when justified by test-based analyses. This paper is a report of a test program undertaken to provide a basis for analysis in the development of alternative methods of achieving separation. The test parameters developed and used, and the results obtained, should prove useful in determining alternative methods of complying with R.G. 1.75 requirements

40 CFR 141.70 - General requirements.

Science.gov (United States)

2010-07-01

...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.70 General requirements. (a... regulations establish criteria under which filtration is required as a treatment technique for public water... filtration requirements in § 141.73 and the disinfection requirements in § 141.72(b). (c) Each public water...

14 CFR 141.23 - Advertising limitations.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Advertising limitations. 141.23 Section 141...) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS General § 141.23 Advertising limitations. (a) The... certificate may not advertise that the school is certificated unless it clearly differentiates between courses...

Reidentification of Ebola Virus E718 and ME as Ebola Virus/H.sapiens-tc/COD/1976/Yambuku-Ecran.

Science.gov (United States)

Kuhn, Jens H; Lofts, Loreen L; Kugelman, Jeffrey R; Smither, Sophie J; Lever, Mark S; van der Groen, Guido; Johnson, Karl M; Radoshitzky, Sheli R; Bavari, Sina; Jahrling, Peter B; Towner, Jonathan S; Nichol, Stuart T; Palacios, Gustavo

2014-11-20

Ebola virus (EBOV) was discovered in 1976 around Yambuku, Zaire. A lack of nomenclature standards resulted in a variety of designations for each isolate, leading to confusion in the literature and databases. We sequenced the genome of isolate E718/ME/Ecran and unified the various designations under Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Ecran. Copyright © 2014 Kuhn et al.

14 CFR 141.91 - Satellite bases.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Satellite bases. 141.91 Section 141.91... OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Operating Rules § 141.91 Satellite bases. The holder of a... assistant chief instructor is designated for each satellite base, and that assistant chief instructor is...

22 CFR 141.5 - Compliance information.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compliance information. 141.5 Section 141.5... DEPARTMENT OF STATE-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 141.5 Compliance information... such information, as a responsible Departmental official or his designee may determine to be necessary...

19 CFR 141.88 - Computed value.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Computed value. 141.88 Section 141.88 Customs... (CONTINUED) ENTRY OF MERCHANDISE Invoices § 141.88 Computed value. When the port director determines that information as to computed value is necessary in the appraisement of any class or kind of merchandise, he...

14 CFR 1264.141 - Judicial review.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1264.141 Section 1264.141... PENALTIES ACT OF 1986 § 1264.141 Judicial review. Section 3805 of Title 31, United States Code, authorizes judicial review by an appropriate United States District Court of a final decision of the authority head...

25 CFR 141.16 - Price marking.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Price marking. 141.16 Section 141.16 Indians BUREAU OF... AND ZUNI RESERVATIONS General Business Practices § 141.16 Price marking. The price of each article... visible to the customer and that affords the customer a reasonable opportunity to learn the price of the...

IEEE 802154 and ZigBee as enabling technologies for low-power wireless systems with quality-of-service constraints

CERN Document Server

Tennina, Stefano; Daidone, Roberta; Alves, Mário; Jurčík, Petr; Severino, Ricardo; Tiloca, Marco; Hauer, Jan-Hinrich; Pereira, Nuno; Dini, Gianluca; Bouroche, Mélanie; Tovar, Eduardo

2013-01-01

This book outlines the most important characteristics of IEEE 802.15.4 and ZigBee and how they can be used to engineer Wireless Sensor Network (WSN) systems and applications, with a particular focus on Quality-of-Service (QoS) aspects. It starts by providing a snapshot of the most relevant features of these two protocols, identifying some gaps in the standard specifications. Then it describes several state-of-the-art open-source implementations, models and tools that have been designed by the authors and have been widely used by the international community. The book also outlines the fundamental performance limits of IEEE 802.15.4/ZigBee networks, based on well-sustained analytical, simulation and experimental models, including how to dimension such networks to optimize delay/energy trade-offs.

Compliance and Functional Testing of IEEE 1451.1 for NCAP-to-NCAP Communications in a Sensor Network

Science.gov (United States)

Figueroa, Jorge; Gurkan, Deniz; Yuan, X.; Benhaddou, D.; Liu, H.; Singla, A.; Franzl, R.; Ma, H.; Bhatt, S.; Morris, J.;

Attacks on IEEE 802.11 wireless networks

Directory of Open Access Journals (Sweden)

Dejan Milan Tepšić

2013-06-01

Full Text Available Security of wireless computer networks was initially secured with the WEP security protocol, which relies on the RC4 encryption algorithm and the CRC algorithm to check the integrity. The basic problems of the WEP are a short initialization vector, unsafe data integrity checking, using a common key, the lack of mechanisms for management and exchange of keys, the lack of protection from the endless insertion of the same package into the network, the lack of authentication of access points and the like. The consequences of these failures are easy attacks against the WEP network, namely their complete insecurity. Therefore, the work began on the IEEE 802.11i protocol, which should radically improve the security of wireless networks. Since the development of a protocol lasted, the WPA standard was released to offset the security gap caused by the WEP. The WPA also relies on RC4 and CRC algorithms, but brings temporary keys and the MIC algorithm for data integrity. The 802.1X authentication was introduced and common keys are no longer needed, since it is possible to use an authentication server. The length of the initialization vector was increased and the vector is obtained based on the packet serial number, in order to prevent the insertion of the same packet into the network. The weakness of the WPA security mechanism is the use of a common key. WPA2 (802.11i later appeared. Unlike the WPA mechanism that worked on old devices with the replacement of software, WPA2 requires new network devices that can perform AES encryption. AES replaces the RC4 algorithm and delivers much greater security. Data integrity is protected by encryption. Despite progress, there are still weaknesses in wireless networks. Attacks for denial of service are possible as well as spoofing package headers attacks. For now, it is not advisable to use wireless networks in environments where unreliability and unavailability are not tolerated. Introduction In the entire history of

Solar-geophysical data number 389. Part I. Prompt reports. Data for December 1976--November 1976

International Nuclear Information System (INIS)

Leighton, H.

1977-01-01

This prompt report provides December 1976 and November 1976 data on alert periods, daily solar indices, solar flares, solar radio waves, solar wind measurements, solar x-ray radiation, coronal holes, and inferred IP magnetic field polarities for December. It also provides data on daily solar activity center, sudden ionospheric disturbances, solar radio waves, cosmic rays, geomagnetic indices and radio propagation indices for November

14 CFR 141.93 - Enrollment.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Enrollment. 141.93 Section 141.93 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) SCHOOLS AND... limitations and simulated emergency landing instructions; and (x) A description of and instructions regarding...

36 CFR 406.141-406.148 - [Reserved

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.141-406.148 Section 406.141-406.148 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.141-406.148 [Reserved] ...

44 CFR 206.141 - Disaster unemployment assistance.

Science.gov (United States)

2010-10-01

... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Disaster unemployment assistance. 206.141 Section 206.141 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... § 206.141 Disaster unemployment assistance. The authority to implement the disaster unemployment...

Atomic Energy Board, twentieth annual report, 1976

International Nuclear Information System (INIS)

1977-01-01

Progress is reported on the following: nuclear materials, nuclear power, application of radioisotopes and radiation, health and safety, and fundamental studies undertaken in the fields of physics, chemistry, metallurgy, medicine and geology during 1976. The supporting activities of the computer services, engineering services, waste disposal plant, instrumentation section, research reactor and analytical services are given for 1976. The report contains a bibliography of publications published by staff members and bursars during 1976

25 CFR 141.48 - Translation of disclosure statements.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Translation of disclosure statements. 141.48 Section 141.48 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS... Translation of disclosure statements. Disclosure required by §§ 141.46 and 141.47 shall be made in writing...

Performance Analysis of the IEEE 802.11p Multichannel MAC Protocol in Vehicular Ad Hoc Networks.

Science.gov (United States)

Song, Caixia

2017-12-12

Vehicular Ad Hoc Networks (VANETs) employ multichannel to provide a variety of safety and non-safety applications, based on the IEEE 802.11p and IEEE 1609.4 protocols. The safety applications require timely and reliable transmissions, while the non-safety applications require efficient and high throughput. In the IEEE 1609.4 protocol, operating interval is divided into alternating Control Channel (CCH) interval and Service Channel (SCH) interval with an identical length. During the CCH interval, nodes transmit safety-related messages and control messages, and Enhanced Distributed Channel Access (EDCA) mechanism is employed to allow four Access Categories (ACs) within a station with different priorities according to their criticality for the vehicle's safety. During the SCH interval, the non-safety massages are transmitted. An analytical model is proposed in this paper to evaluate performance, reliability and efficiency of the IEEE 802.11p and IEEE 1609.4 protocols. The proposed model improves the existing work by taking serval aspects and the character of multichannel switching into design consideration. Extensive performance evaluations based on analysis and simulation help to validate the accuracy of the proposed model and analyze the capabilities and limitations of the IEEE 802.11p and IEEE 1609.4 protocols, and enhancement suggestions are given.

Mathematical Analysis of EDCA's Performance on the Control Channel of an IEEE 802.11p WAVE Vehicular Network

Directory of Open Access Journals (Sweden)

Hussein T. Mouftah

2010-01-01

Full Text Available Wireless networks for vehicular environments are gaining increasing importance due to their ability to provide a means for stations on the roadside and radio units on board of vehicles to communicate and share safety-related information, thus reducing the probability of accidents and increasing the efficiency of the transportation system. With this goal in mind, the IEEE is currently developing the Wireless Access in Vehicular Environments (WAVE IEEE 802.11p standard. WAVE devices use the IEEE 802.11's Enhanced Distributed Channel Access (EDCA MAC protocol to compete for the transmission medium. This work proposes an analytical tool to evaluate the performance of EDCA under the specific conditions of the so-called control channel (CCH of a WAVE environment, including the particular EDCA parameter values and the fact that all safety-critical data frames are broadcasted. The protocol is modeled using Markov chains and results related to throughput, frame-error rate, buffer occupancy and delay are obtained under different traffic-load conditions. The main analysis is performed assuming that the CCH works continuously, and then an explanation is given as to the considerations that are needed to account for the fact that activity on the CCH is intermittent.

The latitude distribution of cosmic rays at sea level during 1976

International Nuclear Information System (INIS)

Potgieter, M.S.

1978-12-01

During the 1976 period of maximum intensity of cosmic rays a latitude survey was carried out at sea level with two neutron monitors and a neutron moderated detector on board the S.A. Huguenot of Safmarine. The survey lasted for eleven months from December 1975 to November 1976 and a cutoff rigidity range from 1,8 GV (New York) to 17 GV (Singapore) was covered. The second neutron monitor was designed to be more effective and less sensitive than the standard 1NM64 for the roll and pitch of a ship. A theoretical simulation model was used to compare the characteristics of the two neutron monitors and was finally compared with experimental results. The data recorded during visits to various harbours at specific cutoff rigidities were used to determine a attenuation coefficient for both monitors. The data were corrected for variations in the primary cosmic ray spectrum by using a modulations function characteristic of a period of normal modulation. The data were normalised to the relative counting rate of four reference monitor stations during October 1976. A polynomial regression analysis was used to find the best fit to the experimental data for both monitors. The differential response functions were there-upon calculated and compared. Finally the data were corrected for temperature dependence because of the constribution of muons to the counting rate of a neutron monitor. The long term correction coefficients which were used proved to be satisfactory. The difference between the temperature corrected and uncorrected response functions turned out to be less than 0,5% at 1 GV. A comparison of the 1965 and 1976 latitude distributions showed that the 1976 cosmic ray spectrum was softer compared to the previous maximum in 1965 and about the same as in 1954

KEK annual report, 1976

International Nuclear Information System (INIS)

1977-01-01

With its proton synchrotron attaining its design energy 8 GeV in March 1976, the National Laboratory for High Energy Physics (KEK) held a celemony celebrating the completion on April 24. In December the same year, protons could be accelerated to 11.8 GeV, thereby confirming the KEK 12 GeV PS. Studies in the future intersecting storage accelerator complex TRISTAN are also in progress. Activities of the Laboratory from April 1976 to March 1977 are described: Accelerator Department, Physics Department, Scientific and Technical Service Department, and Administration. (Mori, K.)

Defending IEEE 802.11-Based Networks Against Denial Of Service Attacks

National Research Council Canada - National Science Library

Tan, Boon

2003-01-01

...) attacks targeting its management and media access protocols Computer simulation models have proven to be effective tools in the study of cause and effect in numerous fields This thesis involved the design and implementation of a IEEE 8O2.11-based simulation model using OMNeT++, to investigate the effects of different types of DoS attacks on a IEEE 8O2.11 network, and the effectiveness of corresponding countermeasures.

5 CFR 185.141 - Stay pending appeal.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Stay pending appeal. 185.141 Section 185.141 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.141 Stay pending appeal. (a) An initial decision is stayed automatically pending...

45 CFR 2490.141-2490.148 - [Reserved

Science.gov (United States)

2010-10-01

... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.141-2490.148 Section 2490.141-2490.148 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.141-2490.148 [Reserved] ...

Performance analysis of the IEEE 802.16e power management for the initiations of awakening

Institute of Scientific and Technical Information of China (English)

无

2007-01-01

To increase battery life in IEEE 802.16e systems, it is essential to efficiently manage energy in mobile stations. The sleep-mode operation in power management helps to increase the life of a station by saving energy consumption. In power management, there are two important performance metrics: energy consumption and the response delay of awakening medium access control (MAC) service data unit (SDU). While in a base station (BS) initiation of awakening, the two performance metrics should be simultaneously considered, in a mobile subscriber station (MSS) initiation of awakening, the response delay is not considered because it is self-operational. There performance metrics are affected by the minimum sleep interval (Tmin), the maximum sleep interval (Tmax), and the average interarrival time of awakening MAC SDUs (TI) during sleep-mode operation. Therefore, it is imperative to evaluate the two initiations of awakening depending on TI. To reach a fuller understanding of the performance, this paper shows an analytical mode and simulations results for the standard sleep-mode operation in the IEEE 802.16e MAC.

Editorial for IEEE Transactions on Power Electronics

DEFF Research Database (Denmark)

Blaabjerg, Frede

2007-01-01

Our IEEE transactions on power electronics has had some very positive progress these past years under the leadership of Dr. Daan van Wyk. Papers have been processed efficiently both in review time and publication time. This success has spread throughout the whole power electronics community which...

25 CFR 141.59 - Customer complaint procedures.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Customer complaint procedures. 141.59 Section 141.59... THE NAVAJO, HOPI AND ZUNI RESERVATIONS Enforcement Powers, Procedures and Remedies § 141.59 Customer complaint procedures. (a) Any customer of a licensee may file a complaint with the Commissioner alleging...

Annual environmental monitoring report, January--December 1976

International Nuclear Information System (INIS)

1977-05-01

Environmental monitoring results continue to demonstrate that, except for penetrating radiation, environmental radiological impact due to SLAC operation is not distinguishable from natural environmental sources. During 1976 the maximum neutron dose near the site boundary was 3.4 mrem. This represents about 3.4% of the annual dose from natural sources at this elevation and 0.68% of the technical standard of 500 mrem per person annually. There have been no measurable increases in radioactivity in ground water attributable to SLAC operations. Airborne radioactivity released from SLAC also continues to make only a negligible environmental impact and result in a site boundary annual dose of less than 0.01 mrem, which represents less than 0.01% of the annual dose from the natural radiation environment and about 0.002% of the technical standard

Proceedings of the IEEE International Workshop on Safety of Systems (1st) held in Monterey, California on 15-16 Mar 2007

Science.gov (United States)

2007-03-01

assurance that span safety, security and other aspects of dependability, such as ISO /IEC 15026, and safety standards such as AOP 52 and MIL-STD-882...needed/finished skill  Human Resources Role-based/Right-fit  Software Acquisition Management IEEE 12207 as baseline  No requirements management  No

28 CFR 39.141-39.148 - [Reserved

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.141-39.148 Section 39.141-39.148 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.141-39.148 [Reserved] ...

19 CFR 141.43 - Delegation to subagents.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Delegation to subagents. 141.43 Section 141.43 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ENTRY OF MERCHANDISE Powers of Attorney § 141.43 Delegation to subagents. (a) Resident...

Annual report 1976

International Nuclear Information System (INIS)

1977-01-01

This annual report is the fifth issued in English from the Tandem Accelerator Laboratory in Uppsala since research was started in November 1970. It covers work performed during the calendar year 1976 and updates information given in earlier annual reports with regard to laboratory facilities such as computer configuration and layout of the experimental area. The descriptions of the research projects are also in general more detailed than usual and may sometime contain results obtained before 1976 in order to avoid too many references to earlier annual reports. It has, for instance, been thought of interest to make the sections on the study of beam foil excitation of atoms and on the measurements of nuclear deformations by the REPREC method quite extensive. (Auth.)

49 CFR 28.141-28.148 - [Reserved

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.141-28.148 Section 28.141-28.148 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.141-28.148 [Reserved] ...

18 CFR 141.500 - Cash management programs.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Cash management... OF 1978 STATEMENTS AND REPORTS (SCHEDULES) § 141.500 Cash management programs. Public utilities and... and § 141.1 or § 141.2 of this title that participate in cash management programs must file these...

Simple Adaptive Single Differential Coherence Detection of BPSK Signals in IEEE 802.15.4 Wireless Sensor Networks.

Science.gov (United States)

Zhang, Gaoyuan; Wen, Hong; Wang, Longye; Xie, Ping; Song, Liang; Tang, Jie; Liao, Runfa

2017-12-26

In this paper, we propose an adaptive single differential coherent detection (SDCD) scheme for the binary phase shift keying (BPSK) signals in IEEE 802.15.4 Wireless Sensor Networks (WSNs). In particular, the residual carrier frequency offset effect (CFOE) for differential detection is adaptively estimated, with only linear operation, according to the changing channel conditions. It was found that the carrier frequency offset (CFO) and chip signal-to-noise ratio (SNR) conditions do not need a priori knowledge. This partly benefits from that the combination of the trigonometric approximation sin - 1 ( x ) ≈ x and a useful assumption, namely, the asymptotic or high chip SNR, is considered for simplification of the full estimation scheme. Simulation results demonstrate that the proposed algorithm can achieve an accurate estimation and the detection performance can completely meet the requirement of the IEEE 802.15.4 standard, although with a little loss of reliability and robustness as compared with the conventional optimal single-symbol detector.

7 CFR 1.41 - Service of process.

Science.gov (United States)

2010-01-01

... 7 Agriculture 1 2010-01-01 2010-01-01 false Service of process. 1.41 Section 1.41 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Judicial Proceedings § 1.41 Service of... of the General Counsel, in order that service of process may be made. In the event an officer of the...

IEEE Std 317-1972: IEEE standard for electric penetration assemblies in containment structures for nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1992-01-01

This standard prescribes the mechanical, electrical, and test requirements for the design, construction, and installation of electric penetration assemblies in containment structures for stationary nuclear power generating stations. The electric conductor and insulation characteristics of external circuits which connect to penetration assemblies are beyond the scope of these criteria. If there should be any conflict between this standard and those documents referenced herein, this standard shall take precedence over the referenced documents

Environmental radioactivity in Greenland in 1976

International Nuclear Information System (INIS)

Aarkrog, A.; Lippert, J.

1977-07-01

Measurements of fall-out radioactivity in Greenland in 1976 are reported. Strontium-90 (and Caesium-137 in most cases) was determined in samples of precipitation, sea water, vegetation, animals, and drinking water. Estimates are given of the mean contents of 90 Sr and 137 Cs in the human diet in Greenland in 1976. (author)

26 CFR 1.141-13 - Refunding issues.

Science.gov (United States)

2010-04-01

... management contract and takes over the operation of the facility. In 2009, C issues bonds to refund the 1999... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Refunding issues. 1.141-13 Section 1.141-13...) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-13 Refunding issues...

Improving the communication reliability of body sensor networks based on the IEEE 802.15.4 protocol.

Science.gov (United States)

Gomes, Diogo; Afonso, José A

2014-03-01

Body sensor networks (BSNs) enable continuous monitoring of patients anywhere, with minimum constraints to daily life activities. Although the IEEE 802.15.4 and ZigBee(®) (ZigBee Alliance, San Ramon, CA) standards were mainly developed for use in wireless sensors network (WSN) applications, they are also widely used in BSN applications because of device characteristics such as low power, low cost, and small form factor. However, compared with WSNs, BSNs present some very distinctive characteristics in terms of traffic and mobility patterns, heterogeneity of the nodes, and quality of service requirements. This article evaluates the suitability of the carrier sense multiple access-collision avoidance protocol, used by the IEEE 802.15.4 and ZigBee standards, for data-intensive BSN applications, through the execution of experimental tests in different evaluation scenarios, in order to take into account the effects of contention, clock drift, and hidden nodes on the communication reliability. Results show that the delivery ratio may decrease substantially during transitory periods, which can last for several minutes, to a minimum of 90% with retransmissions and 13% without retransmissions. This article also proposes and evaluates the performance of the BSN contention avoidance mechanism, which was designed to solve the identified reliability problems. This mechanism was able to restore the delivery ratio to 100% even in the scenario without retransmissions.

A versatile electrical penetration design qualified to IEEE Std. 317-1983

International Nuclear Information System (INIS)

Lankenau, W.; Wetherill, T.M.

1994-01-01

Although worldwide demand for new construction of nuclear power stations has been on a decline, the available opportunities for the design and construction of qualified electrical penetrations continues to offer challenges, requiring a highly versatile design. Versatility is necessary in order to meet unique customer requirements within the constraints of a design basis qualified to IEEE Std. 317-1983. This paper summarizes such a versatile electrical penetration designed, built and tested to IEEE Std. 317-1983. The principal features are described including major materials of construction. Some of the design constraints such as sealing requirements, and conductor density (including numerical example) are discussed. The requirements for qualification testing of the penetration assembly to IEEE Std. 317-1983 are delineated in a general sense, and some typical test ranges for preconditioning, radiation exposure, and LOCA are provided. The paper concludes by describing ways in which this versatile design has been adapted to meet unique customer requirements in a variety of nuclear power plants

An Extended IEEE 118-Bus Test System With High Renewable Penetration

Energy Technology Data Exchange (ETDEWEB)

Pena, Ivonne; Martinez-Anido, Carlo Brancucci; Hodge, Bri-Mathias

2018-01-01

This article describes a new publicly available version of the IEEE 118-bus test system, named NREL-118. The database is based on the transmission representation (buses and lines) of the IEEE 118-bus test system, with a reconfigured generation representation using three regions of the US Western Interconnection from the latest Western Electricity Coordination Council (WECC) 2024 Common Case [1]. Time-synchronous hourly load, wind, and solar time series are provided for over one year (8784 hours). The public database presented and described in this manuscript will allow researchers to model a test power system using detailed transmission, generation, load, wind, and solar data. This database includes key additional features that add to the current IEEE 118-bus test model, such as: the inclusion of 10 generation technologies with different heat rate functions, minimum stable levels and ramping rates, GHG emissions rates, regulation and contingency reserves, and hourly time series data for one full year for load, wind and solar generation.

The radiological testing of consumer products 1976-1978

International Nuclear Information System (INIS)

Wilkins, B.T.; Dixon, D.W.

1979-02-01

The National Radiological Protection Board's source testing laboratory has been operational since 1976. In the intervening period the types of consumer product which have received most attention have been ionisation chamber smoke detectors and liquid crystal digital watches containing gaseous tritium light sources; the results obtained on these two types of device are the main subject of this report. The report also traces the development of the practical appraisal of these devices by the Board and describes the part played by the test results in the evolution of national and international standards. (author)

21 CFR 146.141 - Canned orange juice.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned orange juice. 146.141 Section 146.141 Food... Beverages § 146.141 Canned orange juice. (a) Canned orange juice is the food prepared from orange juice as specified in § 146.135 or frozen orange juice as specified in § 146.137, or a combination of both, to which...

Guest editors' introduction : Highlights from IEEE Pacific Visualization

NARCIS (Netherlands)

Wijk, van J.J.; North, S.; Shen, H.-W.

2010-01-01

This article looks briefly at four articles based on papers from the 2010 IEEE Pacific Visualization Symposium. These articles, which strongly focus on visual design and applications, cover a range of applications in scientific visualization, information visualization, and graph visualization,

Implementation of DoS attack and mitigation strategies in IEEE 802.11b/g WLAN

Science.gov (United States)

Deng, Julia; Meng, Ke; Xiao, Yang; Xu, Roger

2010-04-01

IEEE 802.11 wireless Local Area Network (WLAN) becomes very prevalent nowadays. Either as a simple range extender for a home wired Ethernet interface, or as a wireless deployment throughout an enterprise, WLAN provides mobility, convenience, and low cost. However, an IEEE 802.11b/g wireless network uses the frequency of unlicensed 2.4GHz, which makes the network unsafe and more vulnerable than traditional Ethernet networks. As a result, anyone who is familiar with wireless network may initiate a Denial of Service (DoS) attack to influence the common communication of the network or even make it crash. In this paper, we present our studies on the DoS attacks and mitigation strategies for IEEE 802.11b/g WLANs and describe some initial implementations using IEEE 802.11b/g wireless devices.

THE INFLUENCE OF MAC BUFFER ON THE CONTENTION-BASED ACCESS SCHEME WITH BURSTING OPTION FOR IEEE 802.11E WIRELESS NETWORKS

Directory of Open Access Journals (Sweden)

S. SELVAKENNEDY

2006-12-01

Full Text Available Wireless LANs are increasingly being used for inelastic applications. Currently, there is little support for quality of service in the IEEE 802.11 MAC protocol, and IEEE task group E has defined the 802.11e MAC extension. Enhanced distributed channel access (EDCA is a contention-based scheme of the 802.11e standard. To allow a station to transmit more than one frame from a single contention, an optional feature known as controlled frame-bursting (CFB is introduced in the standard. In this paper, we initially performed an average analysis to determine a suitable burst duration limit. Then, a detailed evaluation and comparison of the EDCA protocol with the CFB option is carried out through simulation to quantify its performance gain. The impact of the MAC transmit buffer size is also incorporated. Accordingly, we have proposed a suitable approach to guide the configuration of the burst duration limit. It is demonstrated that an optimized CFB configuration allows the MAC protocol to achieve 30% more capacity than the basic EDCA scheme.

International standards for optical wireless communications: state-of-the-art and future directions

Science.gov (United States)

Marciniak, Marian

2017-10-01

As the number of active OWC installations is growing fast, the standards for compatibility of co-existing neighbouring systems are being developed. The paper addresses the Laser Safety (IEC standards), ITU-T Study Group 15 standards (G.640 Co-location longitudinally compatible interfaces for free space optical systems), ITU-Radiocommunication Sector standards (P.1817-1 Propagation data required for the design of terrestrial free-space optical links), and the IEEE Work in Progress - standardization activity on Visible Light Communications. International standards of FSO communications have been reviewed and discussed. ITU, IEC, and IEEE International standards for Free-Space Optical links have been reviewed. The system reliability and availability as well as security issues will be addressed as well in the talk.

INCLUSIÓN DE CORRELACIONES TEMPORALES CON DEPENDENCIA A LARGO PLAZO Y PATRONES AUTOSIMILARES EN MODELOS DE REDES IEEE 802.3 INCLUSION OF LONG-RANGE-DEPENDENT TEMPORARY CORRELATIONS AND SELF-SIMILAR PATTERNS IN IEEE 802.3 NETWORKS MODELS

Directory of Open Access Journals (Sweden)

Ginno Millán Naveas

2010-04-01

Full Text Available En este trabajo se presentan los fundamentos de un proyecto de investigación sobre el modelado de redes de computadoras con mecanismo de control de acceso al medio, según el estándar IEEE 802.3-2005, empleando los postulados de la teoría de conjuntos autosimilares para establecer el nivel de impacto que poseen las correlaciones temporales con dependencia de largo alcance sobre el rendimiento de tales redes. Se postula una nueva forma de estimar grados de autosimilaridad basada en una variación del estimador de Whittle.The foundation of a research project about a model of computer networks with media access control mechanism based on the IEEE standard 802.3-2005 is presented. The model draws from the theory of self-similar sets for establishing the impact level that the long-range-dependent temporary correlations have on the performance of such networks. A new method for the estimation of self-similar levels based on a variation of the Whittle estimator is postulated.

Distribution and Translocation of 141Ce (III) in Horseradish

Science.gov (United States)

Guo, Xiaoshan; Zhou, Qing; Lu, Tianhong; Fang, Min; Huang, Xiaohua

2007-01-01

Background and Aims Rare earth elements (REEs) are used in agriculture and a large amount of them contaminate the environment and enter foods. The distribution and translocation of 141Ce (III) in horseradish was investigated in order to help understand the biochemical behaviour and toxic mechanism of REEs in plants. Method The distribution and translocation of 141Ce (III) in horseradish were investigated using autoradiography, liquid scintillation counting (LSC) and electron microscopic autoradiography (EMARG) techniques. The contents of 141Ce (III) and nutrient elements were analysed using an inductively coupled plasma-atomic emission spectrometer (ICP-AES). Results The results from autoradiography and LSC indicated that 141Ce (III) could be absorbed by horseradish and transferred from the leaf to the leaf-stalk and then to the root. The content of 141Ce (III) in different parts of horseradish was as follows: root > leaf-stalk > leaf. The uptake rates of 141Ce (III) in horseradish changed with the different organs and time. The content of 141Ce (III) in developing leaves was greater than that in mature leaves. The results from EMARG indicated that 141Ce (III) could penetrate through the cell membrane and enter the mesophyll cells, being present in both extra- and intra-cellular deposits. The contents of macronutrients in horseradish were decreased by 141Ce (III) treatment. Conclusions 141Ce (III) can be absorbed and transferred between organs of horseradish with time, and the distribution was found to be different at different growth stages. 141Ce (III) can enter the mesophyll cells via apoplast and symplast channels or via plasmodesmata. 141Ce (III) can disturb the metabolism of macronutrients in horseradish. PMID:17921527

40 CFR 141.155 - Report delivery and recordkeeping.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Report delivery and recordkeeping. 141.155 Section 141.155 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Consumer Confidence Reports § 141.155...

Enhancing MAC performance of DCF protocol for IEEE 802.11 wireless LANs

Science.gov (United States)

Choi, Woo-Yong

2017-01-01

The DCF (Distributed Coordination Function) is the basic MAC (Medium Access Control) protocol of IEEE 802.11 wireless LANs and compatible with various IEEE 802.11 PHY extensions. The performance of the DCF degrades exponentially as the number of nodes participating in the DCF transmission procedure increases. To deal with this problem, we propose a simple, however efficient modification of the DCF by which the performance of the DCF is greatly enhanced.

An IEEE 802.3 Compatible Real Time Medium Access Control with Length-based Priority

Institute of Scientific and Technical Information of China (English)

无

2006-01-01

A new medium access control method is proposed over the predominant Ethernet broadcast channel. Taking advantages of intrinsic variable length characteristic of standard Ethernet frame, message-oriented dynamic priority mechanism is established. Prioritized medium access control operates under a so-called block mode in event of collisions.High priority messages have a chance to preempt block status incurred by low priority ones. By this means, the new MAC provides a conditional deterministic real time performance beyond a statistical one. Experiments demonstrate effectiveness and attractiveness of the proposed scheme. Moreover, this new MAC is completely compatible with IEEE802.3.

Resource management framework for QoS scheduling in IEEE 802.16 WiMAX networks

DEFF Research Database (Denmark)

Wang, Hua; Dittmann, Lars

2009-01-01

IEEE 802.16, also known as WiMAX, has received much attention recently for its capability to support multiple types of applications with diverse Quality-of-Service (QoS) requirements. Beyond what the standard has defined, radio resource management (RRM) still remains an open issue, which plays...... an important role in QoS provisioning for different types of services. In this chapter, we propose a downlink resource management framework for QoS scheduling in OFDMA based WiMAX systems. Our framework consists of a dynamic resource allocation (DRA) module and a connection admission control (CAC) module...

Downlink resource management for QoS scheduling in IEEE 802.16 WiMAX networks

DEFF Research Database (Denmark)

Wang, Hua; Dittmann, Lars

2010-01-01

IEEE 802.16, also known as WiMAX, has received much attention recently for its capability to support multiple types of applications with diverse Quality-of-Service (QoS) requirements. Beyond what the standard has defined, radio resource management (RRM) still remains an open issue, which plays...... an important role in QoS provisioning for different types of services. In this paper, we propose a downlink resource management framework for QoS scheduling in OFDMA based WiMAX systems. Our framework consists of a dynamic resource allocation (DRA) module and a connection admission control (CAC) module. A two...

[Definition and specification requirements for PAC-systems (picture archiving and communication system). A performance index with reference to the standard "IEEE Recommended Practice for Software Requirement Specifications"].

Science.gov (United States)

König, H; Klose, K J

1999-04-01

The formulation of requirements is necessary to control the goals of a PACS project. Furthermore, in this way, the scope of functionality necessary to support radiological working processes becomes clear. Definitions of requirements and specification are formulated independently of systems according to the IEEE standard "Recommended Practice for Software Requirements Specifications". Definitions are given in the Request for Information, specifications in the Request for Proposal. Functional and non-functional requirements are distinguished. The solutions are rated with respect to scope, appropriateness and quality of implementation. A PACS checklist was created according to the methods described above. It is published on the homepage of the "Arbeitsgemeinschaft Informationstechnologie" (AGIT) within the "Deutsche Röntgengesellschaft" (DRG) (http://www.uni-marburg.de/mzr/agit). The checklist provides a discussion forum which should contribute to an agreement on accepted basic PACS functionalities.

40 CFR 141.172 - Disinfection profiling and benchmarking.

Science.gov (United States)

2010-07-01

... benchmarking. 141.172 Section 141.172 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Disinfection-Systems Serving 10,000 or More People § 141.172 Disinfection profiling and benchmarking. (a... sanitary surveys conducted by the State. (c) Disinfection benchmarking. (1) Any system required to develop...

40 CFR 141.101 - Use of bottled water.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Use of bottled water. 141.101 Section 141.101 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Use of Non-Centralized Treatment Devices § 141.101...

Software Quality Assurance and Controls Standard

Science.gov (United States)

2010-04-27

dassurance a wor pro uc s an processes comply with predefined provisions and plans. • According to International Standard (IS) 12207 – of the 44...from document (plan) focus to process focus – Alignment with framework standard IS 12207 software life cycle (SLC) processes with exact...Books and P blications IEEE Software and Systems Engineering curriculum ABET u Certified Software Development Professional Standards ISO /IEC

An SNMP-based solution to enable remote ISO/IEEE 11073 technical management.

Science.gov (United States)

Lasierra, Nelia; Alesanco, Alvaro; García, José

2012-07-01

This paper presents the design and implementation of an architecture based on the integration of simple network management protocol version 3 (SNMPv3) and the standard ISO/IEEE 11073 (X73) to manage technical information in home-based telemonitoring scenarios. This architecture includes the development of an SNMPv3-proxyX73 agent which comprises a management information base (MIB) module adapted to X73. In the proposed scenario, medical devices (MDs) send information to a concentrator device [designated as compute engine (CE)] using the X73 standard. This information together with extra information collected in the CE is stored in the developed MIB. Finally, the information collected is available for remote access via SNMP connection. Moreover, alarms and events can be configured by an external manager in order to provide warnings of irregularities in the MDs' technical performance evaluation. This proposed SNMPv3 agent provides a solution to integrate and unify technical device management in home-based telemonitoring scenarios fully adapted to X73.

Performance Evaluation of IEEE 802.11ah Networks With High-Throughput Bidirectional Traffic.

Science.gov (United States)

Šljivo, Amina; Kerkhove, Dwight; Tian, Le; Famaey, Jeroen; Munteanu, Adrian; Moerman, Ingrid; Hoebeke, Jeroen; De Poorter, Eli

2018-01-23

So far, existing sub-GHz wireless communication technologies focused on low-bandwidth, long-range communication with large numbers of constrained devices. Although these characteristics are fine for many Internet of Things (IoT) applications, more demanding application requirements could not be met and legacy Internet technologies such as Transmission Control Protocol/Internet Protocol (TCP/IP) could not be used. This has changed with the advent of the new IEEE 802.11ah Wi-Fi standard, which is much more suitable for reliable bidirectional communication and high-throughput applications over a wide area (up to 1 km). The standard offers great possibilities for network performance optimization through a number of physical- and link-layer configurable features. However, given that the optimal configuration parameters depend on traffic patterns, the standard does not dictate how to determine them. Such a large number of configuration options can lead to sub-optimal or even incorrect configurations. Therefore, we investigated how two key mechanisms, Restricted Access Window (RAW) grouping and Traffic Indication Map (TIM) segmentation, influence scalability, throughput, latency and energy efficiency in the presence of bidirectional TCP/IP traffic. We considered both high-throughput video streaming traffic and large-scale reliable sensing traffic and investigated TCP behavior in both scenarios when the link layer introduces long delays. This article presents the relations between attainable throughput per station and attainable number of stations, as well as the influence of RAW, TIM and TCP parameters on both. We found that up to 20 continuously streaming IP-cameras can be reliably connected via IEEE 802.11ah with a maximum average data rate of 160 kbps, whereas 10 IP-cameras can achieve average data rates of up to 255 kbps over 200 m. Up to 6960 stations transmitting every 60 s can be connected over 1 km with no lost packets. The presented results enable the fine tuning

Environmental surveillance at Los Alamos during 1976

International Nuclear Information System (INIS)

1977-04-01

This report documents the environmental monitoring program at the Los Alamos Scientific Laboratory (LASL) in 1976. Data are presented for concentrations of radioactivity measured in air, ground and surface waters, sediments, soils, and foodstuffs, and are compared with relevant U.S. Energy Research and Development Administration guides and/or data from other reporting periods. Levels of external penetrating radiation measured in the LASL environs are given. The average whole-body radiation dose to residents of Los Alamos County resulting from LASL operations is calculated. Chemical qualities of surface and ground waters in the LASL environs have been determined and compared to applicable standards. Results of related environmental studies are summarized

Development of a quantitative risk standard

International Nuclear Information System (INIS)

Temme, M.I.

1982-01-01

IEEE Working Group SC-5.4 is developing a quantitative risk standard for LWR plant design and operation. The paper describes the Working Group's conclusions on significant issues, including the scope of the standard, the need to define the process (i.e., PRA calculation) for meeting risk criteria, the need for PRA quality requirements and the importance of distinguishing standards from goals. The paper also describes the Working Group's approach to writing this standard

9 CFR 3.141 - Terminal facilities.

Science.gov (United States)

2010-01-01

... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Terminal facilities. 3.141 Section 3.141 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

40 CFR 141.704 - Analytical methods.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods. 141.704 Section... Monitoring Requirements § 141.704 Analytical methods. (a) Cryptosporidium. Systems must analyze for Cryptosporidium using Method 1623: Cryptosporidium and Giardia in Water by Filtration/IMS/FA, 2005, United States...

17 CFR 141.8 - Procedures for salary offset.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Procedures for salary offset. 141.8 Section 141.8 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION SALARY OFFSET § 141.8 Procedures for salary offset. (a) Deductions to liquidate an employee's debt will be by...

20 CFR 1001.141 - Functions of DVOP staff.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Functions of DVOP staff. 1001.141 Section 1001.141 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING... Veterans Outreach Program (DVOP) § 1001.141 Functions of DVOP staff. Each DVOP specialist shall carry out...

Annual report, 1975-1976

International Nuclear Information System (INIS)

1977-02-01

This report presents the activities of the Philippine Atomic Energy Commission for fiscal year 1975-1976. One of the highlights of activities was the first Philippine Nuclear Congress held from 7-9 December 1976 at the PICC (Philippine International Convention Center). Also presented is the National Atomic Energy Plan which includes nuclear research and development covering: food supply; energy and water resources; engineering and industry; medicine; public health and nutrition; improvement of the human environment; basic objective research; and radiological surveillance of the environment. Mentioned too, are the nuclear services offered, nuclear education, nuclear regulations and safety, public acceptance of atomic energy, PAEC technical assistance program, international affairs, and staff support services

2011 IEEE Vehicular Networking Conference (VNC): Demo Summaries

NARCIS (Netherlands)

Altintas, O.; Chen, W.; Heijenk, Geert; Dressler, F.; Ekici, E.; Kargl, Frank; Shigeno, H.; Dietzel, Stefan

2011-01-01

Foreword For the first time in its history, IEEE VNC has included this year’s demonstrations in its program. Demonstrations play an important role to expose the research community to practical aspects of research and to foster cross-fertilization among researchers both in academia and in industry.

An Adaptive Medium Access Parameter Prediction Scheme for IEEE 802.11 Real-Time Applications

Directory of Open Access Journals (Sweden)

Estefanía Coronado

2017-01-01

Full Text Available Multimedia communications have experienced an unprecedented growth due mainly to the increase in the content quality and the emergence of smart devices. The demand for these contents is tending towards wireless technologies. However, these transmissions are quite sensitive to network delays. Therefore, ensuring an optimum QoS level becomes of great importance. The IEEE 802.11e amendment was released to address the lack of QoS capabilities in the original IEEE 802.11 standard. Accordingly, the Enhanced Distributed Channel Access (EDCA function was introduced, allowing it to differentiate traffic streams through a group of Medium Access Control (MAC parameters. Although EDCA recommends a default configuration for these parameters, it has been proved that it is not optimum in many scenarios. In this work a dynamic prediction scheme for these parameters is presented. This approach ensures an appropriate traffic differentiation while maintaining compatibility with the stations without QoS support. As the APs are the only devices that use this algorithm, no changes are required to current network cards. The results show improvements in both voice and video transmissions, as well as in the QoS level of the network that the proposal achieves with regard to EDCA.

Beamforming transmission in IEEE 802.11ac under time-varying channels.

Science.gov (United States)

Yu, Heejung; Kim, Taejoon

2014-01-01

The IEEE 802.11ac wireless local area network (WLAN) standard has adopted beamforming (BF) schemes to improve spectral efficiency and throughput with multiple antennas. To design the transmit beam, a channel sounding process to feedback channel state information (CSI) is required. Due to sounding overhead, throughput increases with the amount of transmit data under static channels. Under practical channel conditions with mobility, however, the mismatch between the transmit beam and the channel at transmission time causes performance loss when transmission duration after channel sounding is too long. When the fading rate, payload size, and operating signal-to-noise ratio are given, the optimal transmission duration (i.e., packet length) can be determined to maximize throughput. The relationship between packet length and throughput is also investigated for single-user and multiuser BF modes.

IEEE prize awarded to CERN PhD student

CERN Multimedia

2006-01-01

Rafael Ballabriga Suñe (right) receives the Student Paper Award. Rafael Ballabriga Suñe is the recipient of the 2006 Institute of Electrical and Electronics Engineers, Inc. (IEEE) Nuclear and Plasma Sciences Society (NPSS)'s Student Paper Award. Ballabriga's winning paper reported on a prototype chip, which belongs to a new generation of single photon counting hybrid pixel detector readout chips - Medipix3. The NPSS established this award in 2005 to encourage outstanding student contributions and greater student participation as principle or sole authors of papers. The prizes were presented at the IEEE Nuclear Science Symposium held in San Diego on 29 October to 4 November. The prototype chip was designed by Ballabriga based on ideas generated within the CERN Medipix team - part of the PH Microelectronics group. It could be used in various fields in the future, including medical imaging, neutron imaging, electron microscopy, radiation monitoring and other applications in high-energy physics. The novel aspe...

19 CFR 141.41 - Surety on Customs bonds.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Surety on Customs bonds. 141.41 Section 141.41 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ENTRY OF MERCHANDISE Powers of Attorney § 141.41 Surety on Customs bonds. Powers of...

25 CFR 141.55 - Price monitoring and control.

Science.gov (United States)

2010-04-01

... be made a survey of the prices of flour, sugar, fresh eggs, lard, coffee, ground beef, bread, cheese... 25 Indians 1 2010-04-01 2010-04-01 false Price monitoring and control. 141.55 Section 141.55... THE NAVAJO, HOPI AND ZUNI RESERVATIONS Enforcement Powers, Procedures and Remedies § 141.55 Price...

VARNOST BREZŽIČNIH OMREŽIJ PO STANDARDU IEEE 802.11

OpenAIRE

Štumberger, Matej

2013-01-01

Diplomska naloga se osredotoča na problem varovanja brezžičnih omrežij, zasnovanih po standardu IEEE 802.11. Opisano je združenje IEEE in njihova specifikacija standardov z oznako 802, prav tako pa so opisani tudi standardi, protokoli in tehnike varovanja in zaščite omrežij, ki delujejo po tej specifikaciji. Predstavljeno je tudi trenutno stanje varnosti brezžičnih omrežij na področju mesta Ptuj, opisani in prikazani pa so tudi različni pristopi za zlorabo brezžičnih omrežij, skupaj s program...

International Conference on Grey Systems and intelligent Services (IEEE GSIS 2009)

CERN Document Server

Liu, Sifeng; Advances in Grey Systems Research

2010-01-01

This book contains contributions by some of the leading researchers in the area of grey systems theory and applications. All the papers included in this volume are selected from the contributions physically presented at the 2009 IEEE International Conference on Grey Systems and Intelligent Services, November 11 – 12, 2009, Nanjing, Jiangsu, People’s Republic of China. This event was jointly sponsored by IEEE Systems, Man, and Cybernetics Society, Natural Science Foundation of China, and Grey Systems Society of China. Additionally, Nanjing University of Aeronautics and Astronautics also invested heavily in this event with its direct and indirect financial and administrative supports.

Segmentized Clear Channel Assessment for IEEE 802.15.4 Networks.

Science.gov (United States)

Son, Kyou Jung; Hong, Sung Hyeuck; Moon, Seong-Pil; Chang, Tae Gyu; Cho, Hanjin

2016-06-03

This paper proposed segmentized clear channel assessment (CCA) which increases the performance of IEEE 802.15.4 networks by improving carrier sense multiple access with collision avoidance (CSMA/CA). Improving CSMA/CA is important because the low-power consumption feature and throughput performance of IEEE 802.15.4 are greatly affected by CSMA/CA behavior. To improve the performance of CSMA/CA, this paper focused on increasing the chance to transmit a packet by assessing precise channel status. The previous method used in CCA, which is employed by CSMA/CA, assesses the channel by measuring the energy level of the channel. However, this method shows limited channel assessing behavior, which comes from simple threshold dependent channel busy evaluation. The proposed method solves this limited channel decision problem by dividing CCA into two groups. Two groups of CCA compare their energy levels to get precise channel status. To evaluate the performance of the segmentized CCA method, a Markov chain model has been developed. The validation of analytic results is confirmed by comparing them with simulation results. Additionally, simulation results show the proposed method is improving a maximum 8.76% of throughput and decreasing a maximum 3.9% of the average number of CCAs per packet transmission than the IEEE 802.15.4 CCA method.

Real-time-service-based Distributed Scheduling Scheme for IEEE 802.16j Networks

OpenAIRE

Kuo-Feng Huang; Shih-Jung Wu

2013-01-01

Supporting Quality of Service (QoS) guarantees for diverse multimedia services is the primary concern for IEEE802.16j networks. A scheduling scheme that satisfies the QoS requirements has become more important for wireless communications. We proposed an adaptive nontransparent-based distributed scheduling scheme (ANDS) for IEEE 802.16j networks. ANDS comprises three major components: Priority Assignment, Resource Allocation, Preserved Bandwidth Adjustment. Different service-type connections p...

Application of IEEE 1588 to the real-time control system of accelerator

International Nuclear Information System (INIS)

Ma Mingchao; Chen Jianfeng; Shen Liren; Jiang Geyang

2014-01-01

Background: Time synchronization is one of the core technology of realizing the real-time control of accelerator under the distributed control system architecture. The ordinary crystal frequency deviation of IEEE 1588 causes low synchronous accuracy, which doesn't meet the needs of high precision synchronization. Purpose: This paper proposes an algorithm to improve the synchronization precision caused by the crystal frequency deviation. Methods: According to the basic principle of IEEE 1588 time synchronization, a dynamic frequency compensation (DFC) algorithm module was designed and a test platform was built to verify the feasibility and practicability of the algorithm. The influence of the synchronous cycle and delay jitter of the switch on the synchronization accuracy were analyzed. Results: Experimental results showed the great precision improvement of synchronization after using DFC algorithm. Conclusion: Low synchronous accuracy caused by the crystal frequency deviation can be improved by using DFC algorithm implemented for precision time protocol (PTP) of IEEE 1588. (authors)

40 CFR 141.621 - Routine monitoring.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Routine monitoring. 141.621 Section....621 Routine monitoring. (a) Monitoring. (1) If you submitted an IDSE report, you must begin monitoring..., you must monitor at the location(s) and dates identified in your monitoring plan in § 141.132(f...

Ra reactor operation plan for 1976 - Annex 6; Prilog 6 - Plan rada reaktora RA za 1976. godinu

Energy Technology Data Exchange (ETDEWEB)

Martinc, R [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

1976-01-15

Contrary to previous years the RA reactor operation plan for 1976 is conditioned by more uncertainties than ever for the following reasons. It is planned for February to repair the components in order to eliminate the consequences of leaking from the vertical experimental channel VK-4 which happened in december 1975. Apart from this, measurements related to transfer of the core to highly enriched fuel under minimum power are foreseen to be performed in February. In April, it would be indispensable to locate the point of He gas leaking and its prevention. Core transfer to highly enriched fuel is planned for April for testing of the fuel elements under operating conditions and step by step increase of the power density up to the nominal power. Complete plan for core transfer would be available by the end of February 1976. It is planned to make-up for the mentioned delays from May-December 1976. [Serbo-Croat] Za razliku od prethodnih godina izrada plana rada reaktora RA za 1976. godinu vezana je za mnogo vise neizvesnosti nego ikada ranije iz sledecih razloga. U februaru se vrsi remont opreme i uklanjanja posledica procurivanja vertikalnog eksperimentalog kanala VK-4, koje se dogodilo decembra 1975. Sem toga u februaru se vrse merenja na minimalnim snagama u sklopu priprema za prelazak na novo gorivo. U aprilu ce biti neophodno lociranje mesta gde istice He gas kao i otklanjanje uzroka ovog curenja. Planirano je da se u aprilu ubaci novo gorivo u jezgro u cilju testiranja pod radnim uslovima uz postepeno povecanje snage do nominalne. Planirano je da se smanjeni obim rada usled navedenih uslova nadoknadi u potpunosti u periodu maj-decembar 1976.

NRCN publications in 1976

International Nuclear Information System (INIS)

Kuznietz, M.; Wiener, U.; Israeli, O.

1977-04-01

The front-pages of 35 works, written by employees of the Nuclear Research Center - Negev, and published in 1976 by the Publishing Department of its Scientific and Technical Information Service, as publications in the NRCN series or in the NRCN(ER), NRCN(ML), and NRCN(TN) sub-series, are presented. The front-pages include the respective NRCN serial or sub-serial number, title, authors, date of publication, and abstract (and date of receipt, if substantially preceding the date of publication) in the original language (Hebrew or English). The front-page translations (into English or Hebrew), if published, are also included. Various data, concerning the NRCN publications in 1976, are given as well as alphabetical lists of authors (in Hebrew and Latin transliteration)

ILL. Annual report 1976

International Nuclear Information System (INIS)

In 1976 the three major functions of ILL continued to be generally satisfactorily performed (provision of neutron beams at the high flux reactor, development of advanced instrumentation, establishment of a forum). The implementation of the programme of measurements approved by the Scientific Council was again given absolute priority. This report gives a survey of the state of the experimental facilities at ILL and the scientific work carried out in 1976, and of the main technical and administrative activities of the Institute Chapters correspond to the various colleges (theory, fundamental and nuclear physics, excitations, structures liquid, gases and amorphous materials, impurities, structural biology and chemistry), reactor operation and instrument support services, computing services... A second volume of this report contains more detailed descriptions of the individual experiments

High spin states of 141Pm

Science.gov (United States)

Bhattacharyya, Sarmishtha; Chanda, Somen; Bhattacharjee, Tumpa; Basu, Swapan Kumar; Bhowmik, R. K.; Muralithar, S.; Singh, R. P.; Ghugre, S. S.

2004-01-01

The high spin states in the N=80 odd- A141Pm nucleus have been investigated by in-beam γ-spectroscopic techniques following the reaction 133Cs( 12C, 4n) 141Pm at E=65 MeV using a modest γ detector array, consisting of seven Compton-suppressed high purity germanium detectors and a multiplicity ball of 14 bismuth germanate elements. Thirty new γ rays have been assigned to 141Pm on the basis of γ-ray singles and γγ-coincidence data. The level scheme of 141Pm has been extended upto an excitation energy of 5.2 MeV and spin {35}/{2}ℏ and 16 new levels have been proposed. Spin-parity assignments for most of the newly proposed levels have been made on the basis of the deduced directional correlation orientation ratios for strong transitions. The meanlives of a few excited states have been determined from the pulsed beam- γγ coincidence data using the generalised centroid-shift method. The level structure is discussed in the light of known systematics of neighbouring N=80 isotonic nuclei.

National standards for the nuclear industry

International Nuclear Information System (INIS)

Laing, W.R.; Corbin, L.T.

1981-01-01

Standards needs for the nuclear industry are being met by a number of voluntary organizations, such as ANS, ASTM, AWS, ASME, and IEEE. The American National Standards Institute (ANSI) coordinates these activities and approves completed standards as American National Standards. ASTM has two all-nuclear committees, E-10 and C-26. A C-26 subcommittee, Test Methods, has been active in writing analytical chemistry standards for twelve years. Thirteen have been approved as ANSI standards and others are ready for ballot. Work is continuing in all areas of the nuclear fuel cycle

Annual colloquium 1976 of the project nuclear safety

International Nuclear Information System (INIS)

1976-11-01

The present report gives the full text of the nine papers read during the annual colloquium 1976 of the Project Nuclear Safety at Karlsruhe Nuclear Research Centre, in which the main activities and findings of the project in 1976 are contained. (RW) [de

Interoperability of medical device information and the clinical applications: an HL7 RMIM based on the ISO/IEEE 11073 DIM.

Science.gov (United States)

Yuksel, Mustafa; Dogac, Asuman

2011-07-01

Medical devices are essential to the practice of modern healthcare services. Their benefits will increase if clinical software applications can seamlessly acquire the medical device data. The need to represent medical device observations in a format that can be consumable by clinical applications has already been recognized by the industry. Yet, the solutions proposed involve bilateral mappings from the ISO/IEEE 11073 Domain Information Model (DIM) to specific message or document standards. Considering that there are many different types of clinical applications such as the electronic health record and the personal health record systems, the clinical workflows, and the clinical decision support systems each conforming to different standard interfaces, detailing a mapping mechanism for every one of them introduces significant work and, thus, limits the potential health benefits of medical devices. In this paper, to facilitate the interoperability of clinical applications and the medical device data, we use the ISO/IEEE 11073 DIM to derive an HL7 v3 Refined Message Information Model (RMIM) of the medical device domain from the HL7 v3 Reference Information Mode (RIM). This makes it possible to trace the medical device data back to a standard common denominator, that is, HL7 v3 RIM from which all the other medical domains under HL7 v3 are derived. Hence, once the medical device data are obtained in the RMIM format, it can easily be transformed into HL7-based standard interfaces through XML transformations because these interfaces all have their building blocks from the same RIM. To demonstrate this, we provide the mappings from the developed RMIM to some of the widely used HL7 v3-based standard interfaces.

Open-source implementation of an ad-hoc IEEE802.11a/g/p software-defined radio on low-power and low-cost general purpose processors

Directory of Open Access Journals (Sweden)

S. Ciccia

2017-12-01

Full Text Available This work proposes a low-cost and low-power software-defined radio open-source platform with IEEE 802.11 a/g/p wireless communication capability. A state-of-the-art version of the IEEE 802.11 a/g/p software for GNU Radio (a free and open-source software development framework is available online, but we show here that its computational complexity prevents operations in low-power general purpose processors, even at throughputs below the standard. We therefore propose an evolution of this software that achieves a faster and lighter IEEE 802.11 a/g/p transmitter and receiver, suitable for low-power general purpose processors, for which GNU Radio provides very limited support; we discuss and describe the software radio processing structuring that is necessary to achieve the goal, providing a review of signal processing techniques. In particular, we emphasize the advanced reduced-instruction set (RISC machine (ARM study case, for which we also optimize some of the processing libraries. The presented software will remain open-source.

Synchronous ethernet and IEEE 1588 in telecoms next generation synchronization networks

CERN Document Server

2013-01-01

This book addresses the multiple technical aspects of the distribution of synchronization in new generation telecommunication networks, focusing in particular on synchronous Ethernet and IEEE1588 technologies. Many packet network engineers struggle with understanding the challenges that precise synchronization distribution can impose on networks. The usual “why”, “when” and particularly “how” can cause problems for many engineers. In parallel to this, some other markets have identical synchronization requirements, but with their own design requirements, generating further questions. This book attempts to respond to the different questions by providing background technical information. Invaluable information on state of-the-art packet network synchronization and timing architectures is provided, as well as an unbiased view on the synchronization technologies that have been internationally standardized over recent years, with the aim of providing the average reader (who is not skilled in the art) wi...

Fault-Tolerant Topology and Routing Synthesis for IEEE Time-Sensitive Networking

DEFF Research Database (Denmark)

Gavrilut, Voica Maria; Zarrin, Bahram; Pop, Paul

2017-01-01

of the applications are satisffied. We propose three approaches to solve this optimization problem: (1) a heuristic solution, (2) a Greedy Randomized Adaptive Search Procedure (GRASP) metaheuristic, and (3) a Constraint Programmingbased model. The approaches are evaluated on several test cases, including a test case......Time-Sensitive Networking (TSN) is a set of IEEE standards that extend Ethernet for safety-critical and real-time applications. TSN is envisioned to be widely used in several applications areas, from industrial automation to in-vehicle networking. A TSN network is composed of end systems...... interconnected by physical links and bridges (switches). The data in TSN is exchanged via streams. We address safety-critical real-time systems, and we consider that the streams use the Urgency-Based Scheduler (UBS) traffic-type, suitable for hard real-time traffic. We are interested in determining a fault...

40 CFR 141.42 - Special monitoring for corrosivity characteristics.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Special monitoring for corrosivity characteristics. 141.42 Section 141.42 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Regulations and Prohibition on Lead Use § 141.42 Special monitoring for corrosivity characteristics. (a)-(c...

A Multi-Channel Spectrum Sensing Fusion Mechanism for Cognitive Radio Networks: Design and Application to IEEE 802.22 WRANs

OpenAIRE

Tadayon, Navid; Aissa, Sonia

2016-01-01

The IEEE 802.22 is a new cognitive radio standard that is aimed at extending wireless outreach to rural areas. Known as wireless regional area networks, and designed based on the not-to-interfere spectrum sharing model, WRANs are channelized and centrally-controlled networks working on the under-utilized UHF/VHF TV bands to establish communication with remote users, so-called customer premises equipment (CPEs). Despite the importance of reliable and interference-free operation in these freque...

Capacity Evaluation for IEEE 802.16e Mobile WiMAX

Directory of Open Access Journals (Sweden)

Chakchai So-In

2010-01-01

Full Text Available We present a simple analytical method for capacity evaluation of IEEE 802.16e Mobile WiMAX networks. Various overheads that impact the capacity are explained and methods to reduce these overheads are also presented. The advantage of a simple model is that the effect of each decision and sensitivity to various parameters can be seen easily. We illustrate the model by estimating the capacity for three sample applications—Mobile TV, VoIP, and data. The analysis process helps explain various features of IEEE 802.16e Mobile WiMAX. It is shown that proper use of overhead reducing mechanisms and proper scheduling can make an order of magnitude difference in performance. This capacity evaluation method can also be used for validation of simulation models.

Self-Coexistence among IEEE 802.22 Networks: Distributed Allocation of Power and Channel

OpenAIRE

Sayef Azad Sakin; Md. Abdur Razzaque; Mohammad Mehedi Hassan; Atif Alamri; Nguyen H. Tran; Giancarlo Fortino

2017-01-01

Ensuring self-coexistence among IEEE 802.22 networks is a challenging problem owing to opportunistic access of incumbent-free radio resources by users in co-located networks. In this study, we propose a fully-distributed non-cooperative approach to ensure self-coexistence in downlink channels of IEEE 802.22 networks. We formulate the self-coexistence problem as a mixed-integer non-linear optimization problem for maximizing the network data rate, which is an NP-hard one. This work explores a s...

14 CFR 141.11 - Pilot school ratings.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot school ratings. 141.11 Section 141.11 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) SCHOOLS AND... rating course. (x) Aircraft type rating course. (2) Special preparation courses. (Appendix K). (i) Pilot...

IEEE 802.11e (EDCA analysis in the presence of hidden stations

Directory of Open Access Journals (Sweden)

Xijie Liu

2011-07-01

Full Text Available The key contribution of this paper is the combined analytical analysis of both saturated and non-saturated throughput of IEEE 802.11e networks in the presence of hidden stations. This approach is an extension to earlier works by other authors which provided Markov chain analysis to the IEEE 802.11 family under various assumptions. Our approach also modifies earlier expressions for the probability that a station transmits a packet in a vulnerable period. The numerical results provide the impact of the access categories on the channel throughput. Various throughput results under different mechanisms are presented.

IKO Annual Report 1976

International Nuclear Information System (INIS)

1977-01-01

The IKO Annual Report of 1976 relates their progress in different projects and project fields. The fields covered include electron scattering, pion and muon physics, theory, radio- and nuclear chemistry, technical department, MEA, nuclear reactions and nuclear spectroscopy

14 CFR 121.141 - Airplane flight manual.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane flight manual. 121.141 Section 121... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Manual Requirements § 121.141 Airplane flight manual. (a) Each certificate holder shall keep a current approved airplane flight manual for each type of...

37 CFR 1.41 - Applicant for patent.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Applicant for patent. 1.41 Section 1.41 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Who May Apply for A...

Annual report, 1976-1977

International Nuclear Information System (INIS)

1977-01-01

Company activities 1976-77 are described. Financial losses were incurred in marketing reactors and industrial products. Nuclear power in Ontario made compensatory savings over fossil-fired capacity. Numerous research topics and company concerns are touched upon. (E.C.B.)

Amchitka radiobiological program progress report, January 1976--December 1976

International Nuclear Information System (INIS)

Nelson, V.A.; Seymour, A.H.

1977-05-01

The Amchitka Radiobiological Program is a continuing program to collect biological and environmental samples for radiometric analyses. Results of analyses for samples collected during 1976 include gamma-emitting radionuclides in air filters, freshwater, birds, lichens, marine algae, marine invertebrates, fish, aufwuchs, and freshwater moss and plants; 90 Sr in rats, birds, and soil; 239 240 Pu in sand, soil, marine algae and fish; and tritium ( 3 H) in seawater, freshwater, and biological organisms

Water physics and chemistry data from bottle casts from the BLUE FIN from 1976-02-26 to 1976-05-26 (NODC Accession 7800050)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Water physics and chemistry data were collected from bottle casts from the BLUE FIN from 26 February 1976 to 26 May 1976. Data were submitted by the Skidaway...

IEEE 1394/firewire a low cost, high speed, digital serial bus

Energy Technology Data Exchange (ETDEWEB)

Gaunt, R.

1997-05-01

Does the world need yet another 1/0 bus standard? If you need fast and cheap serial video communication, then the answer is yes. As technology advances, so too must data transport mechanisms advance. You can`t expect RS-232 to support real-time digital video, and if you can`t afford expensive professional serial video interfaces, (such as Sony`s Serial Digital Interface), Firewire may be a good solution. IEEE 1394, or commonly known as Firewire, is a general purpose serial bus that meets many of the 1/0 needs of today`s video and multimedia developers. For those of you who only read the first paragraph, here`s Firewire in a nutshell: It provides a guaranteed transfer rate of 10OMbps or 20OMbps of digital data (such as video direct from camera to computer), over an inexpensive, non-proprietary serial bus. Here is a list of its features.

Eleanor McElwee and the Formation of IEEE PCS

Science.gov (United States)

Malone, Edward A.

2015-01-01

This article examines the historical professional project that created the Institute of Radio Engineers' Professional Group on Engineering Writing an Speech (IRE PGEWS)--now called the Institute of Electrical and Electronics Engineers' Professional Communication Society (IEEE PCS)--and recounts the group's early history in detail. It also traces…

Higher Education Prices and Price Indexes. 1976 Supplement.

Science.gov (United States)

Halstead, Kent D.

The 1976 supplement presents higher education price index data for fiscal years 1971 through 1976. The basic study, "Higher Education Prices and Price Indexes" (ED 123 996) presents complete descriptions of the indexes together with index values and price data for fiscal years 1961 through 1974. Indexes are presented for research and development,…

Tree value conversion standards revisited

Science.gov (United States)

Paul S. DeBald; Martin E. Dale; Martin E. Dale

1991-01-01

Updated tree value conversion standards (TVCS) are presented for 12 important hardwood species of the oak-hickory forest. These updated standards-developed for each species by butt-log grade, merchantable height, and diameter at breast height-reflect the changes in lumber prices and in conversion costs which have occurred since 1976 when the original TVCS were...

Regulatory Barriers Blocking Standardization of Interoperability

OpenAIRE

Zhong, Daidi; Kirwan, Michael J; Duan, Xiaolian

2013-01-01

Developing and implementing a set of personal health device interoperability standards is key to cultivating a healthy global industry ecosystem. The standardization organizations, including the Institute of Electrical and Electronics Engineers 11073 Personal Health Device Workgroup (IEEE 11073-PHD WG) and Continua Health Alliance, are striving for this purpose. However, factors like the medial device regulation, health policy, and market reality have placed non-technical barriers over the ad...

IEEE 802.15.4 MAC with GTS transmission for heterogeneous devices with application to wheelchair body-area sensor networks.

Science.gov (United States)

Shrestha, Bharat; Hossain, Ekram; Camorlinga, Sergio

2011-09-01

In wireless personal area networks, such as wireless body-area sensor networks, stations or devices have different bandwidth requirements and, thus, create heterogeneous traffics. For such networks, the IEEE 802.15.4 medium access control (MAC) can be used in the beacon-enabled mode, which supports guaranteed time slot (GTS) allocation for time-critical data transmissions. This paper presents a general discrete-time Markov chain model for the IEEE 802.15.4-based networks taking into account the slotted carrier sense multiple access with collision avoidance and GTS transmission phenomena together in the heterogeneous traffic scenario and under nonsaturated condition. For this purpose, the standard GTS allocation scheme is modified. For each non-identical device, the Markov model is solved and the average service time and the service utilization factor are analyzed in the non-saturated mode. The analysis is validated by simulations using network simulator version 2.33. Also, the model is enhanced with a wireless propagation model and the performance of the MAC is evaluated in a wheelchair body-area sensor network scenario.

Static and Dynamic 4-Way Handshake Solutions to Avoid Denial of Service Attack in Wi-Fi Protected Access and IEEE 802.11i

Directory of Open Access Journals (Sweden)

De Rango Floriano

2006-01-01

Full Text Available This paper focuses on WPA and IEEE 802.11i protocols that represent two important solutions in the wireless environment. Scenarios where it is possible to produce a DoS attack and DoS flooding attacks are outlined. The last phase of the authentication process, represented by the 4-way handshake procedure, is shown to be unsafe from DoS attack. This can produce the undesired effect of memory exhaustion if a flooding DoS attack is conducted. In order to avoid DoS attack without increasing the complexity of wireless mobile devices too much and without changing through some further control fields of the frame structure of wireless security protocols, a solution is found and an extension of WPA and IEEE 802.11 is proposed. A protocol extension with three "static" variants and with a resource-aware dynamic approach is considered. The three enhancements to the standard protocols are achieved through some simple changes on the client side and they are robust against DoS and DoS flooding attack. Advantages introduced by the proposal are validated by simulation campaigns and simulation parameters such as attempted attacks, successful attacks, and CPU load, while the algorithm execution time is evaluated. Simulation results show how the three static solutions avoid memory exhaustion and present a good performance in terms of CPU load and execution time in comparison with the standard WPA and IEEE 802.11i protocols. However, if the mobile device presents different resource availability in terms of CPU and memory or if resource availability significantly changes in time, a dynamic approach that is able to switch among three different modalities could be more suitable.

40 CFR 141.62 - Maximum contaminant levels for inorganic contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels for inorganic contaminants. 141.62 Section 141.62 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Water Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.62 Maximum...

Uranium exploration expenditures in 1976 and plans for 1977--78

International Nuclear Information System (INIS)

1977-05-01

A survey of actual and planned uranium exploration activities was made by the Grand Junction Office of the U.S. Energy Research and Development Administration as part of an overall program to evaluate future supplies of nuclear fuel. The survey covered: land acquired in 1976 for exploration and cost of acquisition; 1976 surface drilling footage and cost; all other exploration expenditures in 1976; estimates of 1977-78 exploration activities and costs; exploration for non-sandstone deposits; exploration in non-established areas; foreign uranium exploration expenditures by U.S. companies; foreign participation in exploration activities in the United States; aerial radiometric exploration activities in the United States, 1972-76; and solution-mining production drilling during 1976. Data from the replies of 108 companies are compiled

40 CFR 141.61 - Maximum contaminant levels for organic contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels for organic contaminants. 141.61 Section 141.61 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.61 Maximum contaminant...

An analytical model for the performance analysis of concurrent transmission in IEEE 802.15.4.

Science.gov (United States)

Gezer, Cengiz; Zanella, Alberto; Verdone, Roberto

2014-03-20

Interference is a serious cause of performance degradation for IEEE802.15.4 devices. The effect of concurrent transmissions in IEEE 802.15.4 has been generally investigated by means of simulation or experimental activities. In this paper, a mathematical framework for the derivation of chip, symbol and packet error probability of a typical IEEE 802.15.4 receiver in the presence of interference is proposed. Both non-coherent and coherent demodulation schemes are considered by our model under the assumption of the absence of thermal noise. Simulation results are also added to assess the validity of the mathematical framework when the effect of thermal noise cannot be neglected. Numerical results show that the proposed analysis is in agreement with the measurement results on the literature under realistic working conditions.

12 CFR 410.141-410.148 - [Reserved

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.141-410.148 Section 410.141-410.148 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...

EU-US standards harmonization task group report : stakeholder engagement and comment resolution.

Science.gov (United States)

2012-11-01

Harmonization Task Groups 1 and 3 (HTG1 and 3) were established by the EU-US International Standards Harmonization Working Group to attempt to harmonize standards (including ISO, CEN, ETSI, IEEE) on security (HTG1) and communications protocols (HTG3)...

Annotated Tsunami bibliography: 1962-1976

International Nuclear Information System (INIS)

Pararas-Carayannis, G.; Dong, B.; Farmer, R.

1982-08-01

This compilation contains annotated citations to nearly 3000 tsunami-related publications from 1962 to 1976 in English and several other languages. The foreign-language citations have English titles and abstracts

Annual report, 1976

International Nuclear Information System (INIS)

A financial report for 1976 is presented. A boom in uranium sales is tempered by the necessity for safeguards agreements and setbacks in reactor construction schedules. The company is active in Saskatchewan, anticipating additional uranium discoveries in the Athabasca region. A uranium refinery designed around UF 6 production is planned for Port Granby, Ont. Exploration is proceeding throughout Canada. (E.C.B.)

Datablock: hd141

Indian Academy of Sciences (India)

2016-01-15

Jan 15, 2016 ... checkCIF/PLATON page 2 http://checkcif.iucr.org/cgibin/checkcif_hkl.pl. 1/3. checkCIF (basic structural check) running. checkCIF/PLATON (basic structural check). Structure factors have been supplied for datablock(s) hd141. THIS REPORT IS FOR GUIDANCE ONLY. IF USED AS PART OF A REVIEW.

IEEE P1596, a scalable coherent interface for GigaByte/sec multiprocessor applications

International Nuclear Information System (INIS)

Gustavson, D.B.

1988-11-01

IEEE P1596, the Scalable Coherent Interface (formerly known as SuperBus) is based on experience gained during the development of Fastbus (IEEE 960), Futurebus (IEEE 896.1) and other modern 32-bit buses. SCI goals include a minimum bandwidth of 1 GByte/sec per processor; efficient support of a coherent distributed-cache image of shared memory; and support for segmentation, bus repeaters and general switched interconnections like Banyan, Omega, or full crossbar networks. To achieve these ambitious goals, SCI must sacrifice the immediate handshake characteristic of the present generation of buses in favor of a packet-like split-cycle protocol. Wire-ORs, broadcasts, and even ordinary passive bus structures are to be avoided. However, a lower performance (1 GByte/sec per backplane instead of per processor) implementation using a register insertion ring architecture on a passive ''backplane'' appears to be possible using the same interface as for the more costly switch networks. This paper presents a summary of current directions, and reports the status of the work in progress

40 CFR 141.171 - Criteria for avoiding filtration.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Criteria for avoiding filtration. 141.171 Section 141.171 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection...

40 CFR 141.400 - General requirements and applicability.

Science.gov (United States)

2010-07-01

... system with fecally contaminated source water or with significant deficiencies subject to the treatment... 40 Protection of Environment 22 2010-07-01 2010-07-01 false General requirements and applicability. 141.400 Section 141.400 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER...

Environmental radioactivity in the Faroes in 1976

International Nuclear Information System (INIS)

Aarkrog, A.; Lippert, J.

1977-07-01

Measurements of fall-out radioactivity in the Faroes in 1976 are presented. Strontium-90 (and 137 Cs in most cases) was determined in regularly collected samples of precipitation, grass, milk, fish, sea water, bread, and drinking water. In addition, analyses were made of spot samples of lamb, sea birds, potatoes, sea plants, vegetables, eggs, and human bone. Estimates are given of the mean contents of 90 Sr and 137 Cs in the human diet in the Faroes in 1976. (author)

Education and Dictatorship in Argentina 1976-1983

OpenAIRE

Kaufmann, Carolina

2000-01-01

Este artículo señala aspectos generales del autodenominado “Proceso” acaecido en Argentina (1976-1983). Se ofrecen evidencias de censura e imposición autoritaria en el sistema educativo. Asimismo, se explicitan elementos constitutivos de la educación personalizada perennialista y de la pedagogía de los valores que fue adoptada durante aquellos años. This article indicates general aspects of the self-styled "Process" occurred in Argentina (1976-1983). Evidence of censorship and authoritar...

Research report 1975/1976

International Nuclear Information System (INIS)

Rogers, M.D.; Lakey, J.R.A.

1976-09-01

The activities of the Royal Naval College, Greenwich, Department of Nuclear Science and Technology, during 1975/1976 are reported under sections entitled: general; radiation physics and technology; environmental studies; chemistry and materials; engineering research; computing; the Jason Research and Training Reactor; personal research interest. (U.K.)

25 CFR 141.27 - Trade in imitation Indian crafts prohibited.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Trade in imitation Indian crafts prohibited. 141.27 Section 141.27 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.27 Trade in imitation...

Council directive of 1 June 1976 laying down the revised basic safety standards for the health protection of the general public and workers against the dangers of ionizing radiation

International Nuclear Information System (INIS)

1977-01-01

As provided for in the Euratom Treaty, and in particular Article 30 thereof, basic standards for the protection of the health of workers and the general public against the dangers arising from ionizing radiations, must be established to enable each Member State in accordance with Article 33 of the Euratom Treaty to lay down provisions by legislation, regulation or administrative action to ensure compliance with each standards, to take the necessary measures with regard to teaching, education and vocational training and to make these provisions in harmony with the provisions applicable in this field in the other Member States. On 2 February 1959, the Council has adopted a directive establishing basic safety standards. These were modified partially by the directives of 5 March 1962 and 27 October 1966. The present edition reproduces the complete text of the directive amending the basic safety standards for the health protection of the population and work against the dangers of ionizing radiation adopted by the Council on 31 May 1976. These new standards take into consideration the increasing scientific knowledge in the fields of radiological protection and radiobiology and the practical experience of applying these directives in national laws

Availability of thermal power plants 1976-1985

International Nuclear Information System (INIS)

Nitsch, D.; Schmitz, H.

1986-01-01

This assessment is the 15th annual assessment since 1970. It covers the decade 1976 to 1985 and contains the availability figures for 395 power stations in Germany and abroad with an output of about 93,750 MW and 3,642 years of power station operation. The availability figures of fossil fired units, combined units (plant with combined gas/steam circuit), nuclear power stations and gas turbine plants are given, which are classified according to unit size, fuel, type of construction, age and method of use. The German plants are covered separately. All output figures are gross figures (output at the generator terminals). For comparison purposes, apart for the results of 1985, the annual values determined since 1976 and the mean values for the decade 1976-1985 are given. The non-availability is divided into faults and planned outages since 1978. Availability figures for the years 1970 to 1975 can be found in the VGB assessment 'Availability of thermal power plants 1970-1981'. (orig./GL) [de

Activity report 1976

International Nuclear Information System (INIS)

Ananthakrishna, G.; Ramanathan, N.; Rodriguez, P.; Shankar Singh, R.; Venkataraman, S.

1978-11-01

The research and development activities of the Reactor Research Centre, Kalpakkam, during 1976 are reported. The main thrust of the R and D activities is directed towards the FBTR Project and they deal with the various aspects of the project such as reactor physics, reactor design, fuel handling, reactor instrumentation, reactor operation, reactor construction, reactor safety, reactor materials, reactor chemistry and fuel reprocessing. (M.G.B.)

The scalable coherent interface, IEEE P1596, status and possible applications to data acquisition and physics

International Nuclear Information System (INIS)

Gustavson, D.B.

1990-01-01

IEEE P1596, the Scalable Coherent Interface (formerly known as SuperBus) is based on experience gained while developing Fastbus (ANSI/IEEE 960-1986, IEC 935), Futurebus (IEEE P896.x) and other modern 32-bit buses. SCI goals include a minimum bandwidth of 1 GByte/sec per processor in multiprocessor systems with thousands of processors; efficient support of a coherent distributed-cache image of distributed shared memory; support for repeaters which interface to existing or future buses; and support for inexpensive small rings as well as for general switched interconnections like Banyan, Omega, or crossbar networks. This paper presents a summary of current directions, reports the status of the work in progress, and suggests some applications in data acquisition and physics. 7 refs

Defending IEEE 802.11-Based Networks Against Denial Of Service Attacks

National Research Council Canada - National Science Library

Tan, Boon

2003-01-01

The convenience of IEEE 8O2.11-based wireless access networks has led to widespread deployment in the consumer, industrial and military sectors However, this use is predicated on an implicit assumption of confidentiality...

Spectrophotometry of Comet West 1976 VI

International Nuclear Information System (INIS)

Rozenbush, V.K.

1986-01-01

Spectra obtained for the coma, nuclear fragments A and D, and tail of Comet West 1976 VI on April 1, 2 and 7, 1976 are noted to encompass coma spectra which differed from those of the nuclear fragments, which exhibited a strong continuum with superimposed emissions that included a stronger CO(+)-band system than that of the coma. A detailed comparison between fragment spectra has revealed great differences in both quasi-simultaneously obtained and five-day-separated cases. The relative intensities of different CO(+) bands are compared to the theoretical ones, and the abundances of CO(+) ions corresponding to different vibrational transitions are determined relative to that of CN. 24 references

IEEE Std 101-1987: IEEE guide for the statistical analysis of thermal life test data

International Nuclear Information System (INIS)

Anon.

1992-01-01

This revision of IEEE Std 101-1972 describes statistical analyses for data from thermally accelerated aging tests. It explains the basis and use of statistical calculations for an engineer or scientist. Accelerated test procedures usually call for a number of specimens to be aged at each of several temperatures appreciably above normal operating temperatures. High temperatures are chosen to produce specimen failures (according to specified failure criteria) in typically one week to one year. The test objective is to determine the dependence of median life on temperature from the data, and to estimate, by extrapolation, the median life to be expected at service temperature. This guide presents methods for analyzing such data and for comparing test data on different materials

40 CFR 141.25 - Analytical methods for radioactivity.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods for radioactivity... § 141.25 Analytical methods for radioactivity. (a) Analysis for the following contaminants shall be conducted to determine compliance with § 141.66 (radioactivity) in accordance with the methods in the...

21 CFR 150.141 - Artificially sweetened fruit jelly.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Artificially sweetened fruit jelly. 150.141 Section 150.141 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... locust bean gum), guar gum, gum karaya, gum tragacanth, algin (sodium alginate), sodium...

Statistical Modeling of Natural Backgrounds in Hyperspectral LWIR Data

Science.gov (United States)

2016-09-06

IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing 7(6), 2337–2350 (2014). [4] Manolakis, D., Rossacci, M., Zhang, D... IEEE Signal Processing Magazine 31(1), 24–33 (2014). [2] Manolakis, D., Golowich, S., and DiPietro, R., “Long-wave infrared hyperspectral remote ... sensing of chemical clouds: A focus on signal processing approaches,” IEEE Signal Processing Magazine 31(4), 120–141 (2014). [3] Truslow, E.,

The tree identify protocol of IEEE 1394 in uCRL

NARCIS (Netherlands)

C. Shankland; M.B. van der Zwaag

1998-01-01

textabstractWe specify the tree identify protocol of the IEEE 1394 high performance serial multimedia bus at three different levels of detail using $mu$CRL. We use the cones and foci verification technique of Groote and Springintveld to show that the descriptions are equivalent under branching

40 CFR 141.41 - Special monitoring for sodium.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Special monitoring for sodium. 141.41... and Prohibition on Lead Use § 141.41 Special monitoring for sodium. (a) Suppliers of water for... distribution system for the determination of sodium concentration levels; samples must be collected and...

40 CFR 141.134 - Reporting and recordkeeping requirements.

Science.gov (United States)

2010-07-01

... meeting the criterion in § 141.135(a)(2)(vi). (vi) The running annual average of source water alkalinity for systems meeting the criterion in § 141.135(a)(2)(iii) and of treated water alkalinity for systems...) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Disinfectant Residuals...

ARC Researchers at IEEE 2015 Vehicle Power and Propulsion Conference

Science.gov (United States)

Contacts Researchers News & Events Event Calendar Annual Program Review Research Seminars Press Room Event Archives ARC Researchers at the IEEE 2015 Vehicle Power and Propulsion Conference (October 19-22 Ballroom B P-SS4-2 Comparison of SOFC and PEM Fuel Cell Hybrid Power Management Strategies for Mobile

7 CFR 58.141 - Alternate quality control program.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Alternate quality control program. 58.141 Section 58... Service 1 Quality Specifications for Raw Milk § 58.141 Alternate quality control program. When a plant has in operation an acceptable quality program, at the producer level, which is approved by the...

25 CFR 141.14 - Trade in livestock restricted.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Trade in livestock restricted. 141.14 Section 141.14... livestock restricted. (a) No person other than an enrolled member of the tribe or any association... livestock from tribal members without a special permit issued by the Commissioner. (b) The Commissioner...

Open Standards for Sensor Information Processing

Energy Technology Data Exchange (ETDEWEB)

Pouchard, Line Catherine [ORNL; Poole, Stephen W [ORNL; Lothian, Josh [ORNL

2009-07-01

This document explores sensor standards, sensor data models, and computer sensor software in order to determine the specifications and data representation best suited for analyzing and monitoring computer system health using embedded sensor data. We review IEEE 1451, OGC Sensor Model Language and Transducer Model Language (TML), lm-sensors and Intelligent Platform Management Inititative (IPMI).

Receiving more than data - a signal model, theory and implementation of a cognitive IEEE 802.15.4 receiver

Directory of Open Access Journals (Sweden)

Tim Esemann

2016-09-01

Full Text Available Standard medium access schemes sense the channel immediately prior transmission, but are blind during the transmission. Therefore, standard transceivers have limited cognitive capabilities which are important for operation in heterogeneous radio environments. Specifically, mobile interferers move gradually into the reception range before actually causing collisions. These gradual interferences cannot yet be detected, and upcoming collisions cannot be predicted. We present a theoretical analysis of the received and demodulated signal. This analysis and the derived signal model verifies that the received signal contains more than transmitted data exclusively. Enhanced signal processing extracts signal components of an interference at the receiver and enables advanced interference detection to provide information about approaching mobile interferers. Our theoretical analysis is evaluated by simulations and experiments with an IEEE 802.15.4 transmitter and an extended cognitive receiver.

A Fast MAC-Layer Handover for an IEEE 802.16e-Based WMAN

Science.gov (United States)

Ray, Sayan K.; Pawlikowski, Krzysztof; Sirisena, Harsha

We propose a modification of the IEEE 802.16e hard handover (HHO) procedure, which significantly reduces the handover latency constraint of the original HHO procedure in IEEE 802.16e networks. It allows a better handling of the delay-sensitive traffic by avoiding unnecessary time-consuming scanning and synchronization activity as well as simplifies the network re-entry procedure. With the help of the backhaul network, it reduces the number of control messages in the original handover policy, making the handover latency acceptable also for real-time streaming traffic. Preliminary performance evaluation studies show that the modified handover procedure is able to reduce the total handover latency by about 50%.

Radioactive materials released from nuclear power plants (1976)

International Nuclear Information System (INIS)

Decker, T.R.

1978-11-01

Releases of radioactive materials in airborne and liquid effluents from commercial light water reactors during 1976 have been compiled and reported. Data on solid waste shipments as well as selected operating information have been included. This report supplements earlier annual reports issued by the former Atomic Energy Commission and the Nuclear Regulatory Commission. The 1976 release data are compared with previous year releases in tabular form. Data covering specific radionuclides are summarized

Environmental monitoring report: Sandia Laboratories, 1976

International Nuclear Information System (INIS)

Simmons, T.N.

1977-04-01

Water and vegetation are monitored to determine Sandia Laboratories impact on the surrounding environment. Nonradioactive pollutants released are reported. Radioactive effluents are also reported and their person-rem contribution to the Albuquerque population is calculated. The environmental monitoring for calendar year 1976 shows that concentrations of radioactive materials in the Albuquerque area are typical of natural background for the area. An exception is a single onsite location where slightly abnormal uranium concentrations are expected. An estimated 0.044 person-rem Albuquerque area (80 km radius) population dose commitment results from calculated Sandia Laboratories releases. Over the same area 57,000 person-rem is accumulated from natural background. There were no measurable offsite radioactive effluent releases in CY 1976

40 CFR 141.63 - Maximum contaminant levels (MCLs) for microbiological contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels (MCLs) for microbiological contaminants. 141.63 Section 141.63 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Water Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.63 Maximum...

40 CFR 141.403 - Treatment technique requirements for ground water systems.

Science.gov (United States)

2010-07-01

... ground water systems. 141.403 Section 141.403 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Ground Water Rule § 141... customer as follows: (i) Chemical disinfection—(A) Ground water systems serving greater than 3,300 people...

Homeland Security Affairs Journal, Supplement - 2012: IEEE 2011 Conference on Technology for Homeland Security: Best Papers

OpenAIRE

2012-01-01

Homeland Security Affairs is the peer-reviewed online journal of the Naval Postgraduate School Center for Homeland Defense and Security (CHDS), providing a forum to propose and debate strategies, policies, and organizational arrangements to strengthen U.S. homeland security. The instructors, participants, alumni, and partners of CHDS represent the leading subject matter experts and practitioners in the field of homeland security. IEEE Supplement 2012. Supplement: IEEE 2011 Conference on Te...

Turbidity, SOLAR RADIATION - ATMOSPHERIC and other data from ISLAS ORCADAS in the North Atlantic Ocean from 1976-11-03 to 1976-12-18 (NCEI Accession 8100429)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This entry contains bottle cast data, collected by ISLAS ORCADAS SHIP (cruise 11) between November 3, 1976 to December 18, 1976, in the North Atlantic Ocean. This...

Four Days...Oslo 1976

Science.gov (United States)

Education and Culture, 1977

1977-01-01

Summarizes the four main themes dealt with at the Oslo Conference in 1976: the challenge to cultural policy in a changing society, cultural policy as an instrument for improving the quality of life, support and encouragement of artistic creation and cultural cooperation. Also considers four secondary themes: culture and the child, migrant workers,…

PLF annual report 1976

International Nuclear Information System (INIS)

1976-01-01

After an introduction on organisation, tasks and development of the Project Group for Laser Research (PLF), the departments 'Laser plasmas and high-power laser development', 'Laser chemistry' and 'Laser spectroscopy' report on results and plans in connection with their subjects of research. A list of all publications during 1976 concludes the report. (GG) [de

IEEE 1588 Time Synchronization Board in MTCA.4 Form Factor

Science.gov (United States)

Jabłoński, G.; Makowski, D.; Mielczarek, A.; Orlikowski, M.; Perek, P.; Napieralski, A.; Makijarvi, P.; Simrock, S.

2015-06-01

Distributed data acquisition and control systems in large-scale scientific experiments, like e.g. ITER, require time synchronization with nanosecond precision. A protocol commonly used for that purpose is the Precise Timing Protocol (PTP), also known as IEEE 1588 standard. It uses the standard Ethernet signalling and protocols and allows obtaining timing accuracy of the order of tens of nanoseconds. The MTCA.4 is gradually becoming the platform of choice for building such systems. Currently there is no commercially available implementation of the PTP receiver on that platform. In this paper, we present a module in the MTCA.4 form factor supporting this standard. The module may be used as a timing receiver providing reference clocks in an MTCA.4 chassis, generating a Pulse Per Second (PPS) signal and allowing generation of triggers and timestamping of events on 8 configurable backplane lines and two front panel connectors. The module is based on the Xilinx Spartan 6 FPGA and thermally stabilized Voltage Controlled Oscillator controlled by the digital-to-analog converter. The board supports standalone operation, without the support from the host operating system, as the entire control algorithm is run on a Microblaze CPU implemented in the FPGA. The software support for the card includes the low-level API in the form of Linux driver, user-mode library, high-level API: ITER Nominal Device Support and EPICS IOC. The device has been tested in the ITER timing distribution network (TCN) with three cascaded PTP-enabled Hirschmann switches and a GPS reference clock source. An RMS synchronization accuracy, measured by direct comparison of the PPS signals, better than 20 ns has been obtained.

DPhPE activities during 1976

International Nuclear Information System (INIS)

1977-06-01

This annual report gives a short summary of experiments in progress and of approved proposals of experiments to be performed by the Elementary Particle Physics department of Saclay, and also publication lists and informations about the Department activities during 1976 [fr

List of publications, 1976 - 1981

International Nuclear Information System (INIS)

1981-12-01

The scientific and technical publications of Atomic Energy of Canada Ltd. - reports, reprints of journal articles, and presentations to conferences - issued from April 1976 to March 1981 are listed under ten subject categories, and author and report number indexes are provided

Fine Structure in Proton Emission from the Deformed 141g.sHo and 141mHo

International Nuclear Information System (INIS)

Karny, M.; Rykaczewski, Krzysztof Piotr; Grzywacz, R.; Batchelder, J.C.; Bingham, C.R.; Goodin, C. T.; Gross, Carl J.; Hamilton, J.H.; Korgul, A.; Krolas, W.; Liddick, S. N.; Li, K.; Maier, Karl; Mazzocchi, C.; Piechaczek, A.; Shapira, Dan; Simpson, D.; Tantawy, M.N.; Winger, J.A.; Yu, Chang-Hong; Zganjar, E. F.

2007-01-01

Fine structure in proton emission from the deformed states 141g.s Ho (T 1/2 = 4.1 ms) and 141 mHo (T 1/2 = 7.4 (micro)s) has been discovered at Oak Ridge by detecting fusion evaporation residues with the Recoil Mass Spectrometer, Si-detectors and digital signal processing electronics. The branching ratios to the first 2 + excited state in 140 Dy were measured to be I p g.s. (2 + ) = 0.9±0.1% and I p m (2 + ) = 1.7±0.5%. A comparison of the available calculations to the experimental values calls for further development of the theoretical models

Editorial for the IEEE Transactions on Power Electronics, January 2009

DEFF Research Database (Denmark)

Blaabjerg, Frede

2009-01-01

I am entering the fourth year as the Editor in Chief of the IEEE TRANSACTIONS ON POWER ELECTRONICS. A position like this becomes more and more important for the technical field as publishing in a peer-reviewed highly ranked journal has influence on the industrial and academic career. It is a way...

A global standardization trend for high-speed client and line side transceivers

Science.gov (United States)

Isono, Hideki

2015-03-01

Seeing the recent vast data increase in information industry, IT society will move into the new era of Zettabyte in a few years. Under these circumstances, high-speed and high-capacity optical communication systems have been deployed in the industry. Especially high speed optical transceivers are key devices to realize high-speed systems, and the practical development is accelerated. In order to develop these leading edge products timely, the global standard criteria are strongly required in the industry. Based on these backgrounds, the forum standardization bodies such as OIF PLLWG/ IEEE802.3 are energetically creating the de-fact standards. With regard to 100G/400G standardization activities, IEEE802.3 leads the client side, and OIF PLL-WG leads the line side, and both of them play important roles in the industry. In the previous Photonics West conferences, the activities of these standardization bodies till 2013 were reported. In 2014, the discussions of 400G client side transceiver projects have made some progress in IEEE802.3, whose baseline technologies are about to be fixed. Also 100G transceiver projects for metro applications in the line side, whose target profile is CFP2 form factor, have been discussed in OIF PLL-WG. In this paper, these high-end standardization topics are introduced and the future products direction is also discussed from the technical point of view. In order to realize these small form factor and cost effective transceivers, the device integration technologies, the low power device/electrical circuit technologies, and the development of high speed electrical interface such as 25G/50G are key factors.

An IEEE 802.11 EDCA Model with Support for Analysing Networks with Misbehaving Nodes

Directory of Open Access Journals (Sweden)

Szott Szymon

2010-01-01

Full Text Available We present a novel model of IEEE 802.11 EDCA with support for analysing networks with misbehaving nodes. In particular, we consider backoff misbehaviour. Firstly, we verify the model by extensive simulation analysis and by comparing it to three other IEEE 802.11 models. The results show that our model behaves satisfactorily and outperforms other widely acknowledged models. Secondly, a comparison with simulation results in several scenarios with misbehaving nodes proves that our model performs correctly for these scenarios. The proposed model can, therefore, be considered as an original contribution to the area of EDCA models and backoff misbehaviour.

An Enhanced Reservation-Based MAC Protocol for IEEE 802.15.4 Networks

Science.gov (United States)

Afonso, José A.; Silva, Helder D.; Macedo, Pedro; Rocha, Luis A.

2011-01-01

The IEEE 802.15.4 Medium Access Control (MAC) protocol is an enabling standard for wireless sensor networks. In order to support applications requiring dedicated bandwidth or bounded delay, it provides a reservation-based scheme named Guaranteed Time Slot (GTS). However, the GTS scheme presents some drawbacks, such as inefficient bandwidth utilization and support to a maximum of only seven devices. This paper presents eLPRT (enhanced Low Power Real Time), a new reservation-based MAC protocol that introduces several performance enhancing features in comparison to the GTS scheme. This MAC protocol builds on top of LPRT (Low Power Real Time) and includes various mechanisms designed to increase data transmission reliability against channel errors, improve bandwidth utilization and increase the number of supported devices. A motion capture system based on inertial and magnetic sensors has been used to validate the protocol. The effectiveness of the performance enhancements introduced by each of the new features is demonstrated through the provision of both simulation and experimental results. PMID:22163826

40 CFR 141.13 - Maximum contaminant levels for turbidity.

Science.gov (United States)

2010-07-01

... turbidity. 141.13 Section 141.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Maximum contaminant levels for turbidity. The maximum contaminant levels for turbidity are applicable to... part. The maximum contaminant levels for turbidity in drinking water, measured at a representative...

Transient Stability Improvement of IEEE 9 Bus System Using Power World Simulator

Directory of Open Access Journals (Sweden)

Kaur Ramandeep

2016-01-01

Full Text Available The improvement of transient stability of power system was one of the most challenging research areas in power engineer.The main aim of this paper was transient stability analysis and improvement of IEEE 9 bus system. These studies were computed using POWER WORLD SIMULATOR. The IEEE 9 bus system was modelled in power world simulator and load flow studies were performed to determine pre-fault conditions in the system using Newton-Raphson method. The transient stability analysis was carried out using Runga method during three-phase balanced fault. For the improvement transient stability, the general methods adopted were fast acting exciters, FACT devices and addition of parallel transmission line. These techniques play an important role in improving the transient stability, increasing transmission capacity and damping low frequency oscillations.

Reconfigurable radio systems network architectures and standards

CERN Document Server

Iacobucci, Maria Stella

2013-01-01

This timely book provides a standards-based view of the development, evolution, techniques and potential future scenarios for the deployment of reconfigurable radio systems.  After an introduction to radiomobile and radio systems deployed in the access network, the book describes cognitive radio concepts and capabilities, which are the basis for reconfigurable radio systems.  The self-organizing network features introduced in 3GPP standards are discussed and IEEE 802.22, the first standard based on cognitive radio, is described. Then the ETSI reconfigurable radio systems functional ar

Implementation of a wireless ECG acquisition SoC for IEEE 802.15.4 (ZigBee) applications.

Science.gov (United States)

Wang, Liang-Hung; Chen, Tsung-Yen; Lin, Kuang-Hao; Fang, Qiang; Lee, Shuenn-Yuh

2015-01-01

This paper presents a wireless biosignal acquisition system-on-a-chip (WBSA-SoC) specialized for electrocardiogram (ECG) monitoring. The proposed system consists of three subsystems, namely, 1) the ECG acquisition node, 2) the protocol for standard IEEE 802.15.4 ZigBee system, and 3) the RF transmitter circuits. The ZigBee protocol is adopted for wireless communication to achieve high integration, applicability, and portability. A fully integrated CMOS RF front end containing a quadrature voltage-controlled oscillator and a 2.4-GHz low-IF (i.e., zero-IF) transmitter is employed to transmit ECG signals through wireless communication. The low-power WBSA-SoC is implemented by the TSMC 0.18-μm standard CMOS process. An ARM-based displayer with FPGA demodulation and an RF receiver with analog-to-digital mixed-mode circuits are constructed as verification platform to demonstrate the wireless ECG acquisition system. Measurement results on the human body show that the proposed SoC can effectively acquire ECG signals.

CSMA/CCA: A Modified CSMA/CA Protocol Mitigating the Fairness Problem for IEEE 802.11 DCF

Directory of Open Access Journals (Sweden)

Wang Xin

2006-01-01

Full Text Available Carrier sense multiple access with collision avoidance (CSMA/CA has been adopted by the IEEE 802.11 standards for wireless local area networks (WLANs. Using a distributed coordination function (DCF, the CSMA/CA protocol reduces collisions and improves the overall throughput. To mitigate fairness issues arising with CSMA/CA, we develop a modified version that we term CSMA with copying collision avoidance (CSMA/CCA. A station in CSMA/CCA contends for the shared wireless medium by employing a binary exponential backoff similar to CSMA/CA. Different from CSMA/CA, CSMA/CCA copies the contention window (CW size piggybacked in the MAC header of an overheard data frame within its basic service set (BSS and updates its backoff counter according to the new CW size. Simulations carried out in several WLAN configurations illustrate that CSMA/CCA improves fairness relative to CSMA/CA and offers considerable advantages for deployment in the 802.11-standard-based WLANs.

Annual report 1976

International Nuclear Information System (INIS)

1977-02-01

In part 1, the annual report informs of the organizational and administrative development of the Bundesanstalt, in its 2nd part it presents a survey of scientific activities in 1976, examinations carried out, measuring devices and operational equipment given permission to, and cooperation in national and international bodies. The 3rd part contains scientific summaries of activities published and not published, which were either concluded in the year under review or which came to some interim results. (orig.) [de

Status report of an experimental dairy herd maintained on the Nevada Test Site, 1 January 1976 through 31 December 1976

International Nuclear Information System (INIS)

Daley, E.M.

1978-04-01

The Environmental Monitoring and Support Laboratory-Las Vegas, U.S. Environmental Protection Agency, maintains an experimental dairy herd and farm facility in Area 15 of the Nevada Test Site for the U.S. Energy Research and Development Administration. This status report covers the period from January 1, 1976, through December 31, 1976. Improvements, changes, and additions made to the facilities, production and reproduction statistics for individual cows and the herd, the veterinary medicine practices employed, and summaries of the metabolism studies that involved the dairy herd are covered in this report

Research report 1976. Pt. 2

International Nuclear Information System (INIS)

1976-01-01

The research report describes the work of the faculties of Bochum university in 1976, the so-called 'overlapping institutes' and the special research sectors 'biological signal reception and processing', ('Bionach'), 'plasma physics Bochum/Juelich', and the institute for development research and policies. (HK) [de

Research report 1976. Pt. 1

International Nuclear Information System (INIS)

1976-01-01

The research report describes the work of the faculties of Bochum university in 1976, the so-called 'overlapping institutes' and the special research sectors 'biological signal reception and processing', ('Bionach'), 'plasma physics Bochum/Juelich', and the insitute for development research and policies. (HK) [de

26 CFR 1.141-6 - Allocation and accounting rules.

Science.gov (United States)

2010-04-01

... 1.141-6 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-6.... Thus, allocations generally may be made using any reasonable, consistently applied accounting method...

Ra reactor operation plan for 1976 - Annex 6

International Nuclear Information System (INIS)

Martinc, R.

1976-01-01

Contrary to previous years the RA reactor operation plan for 1976 is conditioned by more uncertainties than ever for the following reasons. It is planned for February to repair the components in order to eliminate the consequences of leaking from the vertical experimental channel VK-4 which happened in december 1975. Apart from this, measurements related to transfer of the core to highly enriched fuel under minimum power are foreseen to be performed in February. In April, it would be indispensable to locate the point of He gas leaking and its prevention. Core transfer to highly enriched fuel is planned for April for testing of the fuel elements under operating conditions and step by step increase of the power density up to the nominal power. Complete plan for core transfer would be available by the end of February 1976. It is planned to make-up for the mentioned delays from May-December 1976 [sr

40 CFR 141.205 - Content of the public notice.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Content of the public notice. 141.205 Section 141.205 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS..., especially those who may not have received this notice directly (for example, people in apartments, nursing...

IEEE 802.11-Based Wireless Sensor System for Vibration Measurement

Directory of Open Access Journals (Sweden)

Yutaka Uchimura

2010-01-01

Full Text Available Network-based wireless sensing has become an important area of research and various new applications for remote sensing are expected to emerge. One of the promising applications is structural health monitoring of building or civil engineering structure and it often requires vibration measurement. For the vibration measurement via wireless network, time synchronization is indispensable. In this paper, we introduce a newly developed time synchronized wireless sensor network system. The system employs IEEE 802.11 standard-based TSF-counter and sends the measured data with the counter value. TSF based synchronization enables consistency on common clock among different wireless nodes. We consider the scale effect on synchronization accuracy and evaluated the effect by taking beacon collisions into account. The scalability issue by numerical simulations is also studied. This paper also introduces a newly developed wireless sensing system and the hardware and software specifications are introduced. The experiments were conducted in a reinforced concrete building to evaluate synchronization accuracy. The developed system was also applied for a vibration measurement of a 22-story steel structured high rise building. The experimental results showed that the system performed more than sufficiently.

Analysis Of Impact Of Various Parameters On BER Performance For IEEE 802.11b

Directory of Open Access Journals (Sweden)

Nilesh B. Kalani

2015-08-01

Full Text Available Abstract This paper discusses about IEEE 802.11b simulation model implemented using LabVIEW software and its analyses for impact on bit error rate BER for different parameters as channel type channel number data transmission rate and packet size. Audio file is being transmitted processed and analyzed using the model for various parameters. This paper gives analysis of BER verses ESN0 for various parameter like data rate packet size and communication channel for the IEEE 802.11b simulation model generated using LabVIEW. It is proved that BER can be optimized by tweaking different parameters of wireless communication system.

Diseño y verificación de un amplificador para IEEE802.16

OpenAIRE

Lloret Arjona, Patricia

2005-01-01

Hace más de 6 años se empezó a gestar el IEEE802.16, un estándar para una nueva tecnología inalámbrica de banda ancha. El primer capítulo consiste en una introducción sobre este estándar, su evolución, las diferentes versiones que han ido apareciendo y las características principales de cada una de ellas, seguido de un pequeño comentario sobre su faceta comercial, WiMAX. El IEEE802.16 está empezando a tener relevancia, de modo que se decidió realizar un amplificador capaz de...

The Liberalization of Canadian Immigration Policy (1945-1976

Directory of Open Access Journals (Sweden)

Mariia Burtseva

2017-07-01

Full Text Available Immigration policy has played a key role in Canadian history since the second half of 19th century. Certainly, immigration legislation was a major element of it. Some of the most important reforms in Canadian immigration policy took place in the first decades after the Second World War. This was a time of multiple legislative reforms conducted by the Canadian government, but in general, the immigration regulations introduced during that period started the process of liberalization in this area. The Immigration Act of 1976 played a key role in building up the new liberal strategy of Canadian immigration. The pre-reform period is also important because it helps to understand the evolution process from discrimi¬native legislation to liberal policy. Therefore, the focus of this study is on the development of Canadian immigration policy from 1945 to 1976. The present research examines the main preconditions for the adoption of the 1976 Immigration Act. It analyses legislation regulations, which paved the ground for post-war Canadian immigration policy, with a particular emphasis on regula-tions enacted from 1945 to 1976. This article provides an overview of Canadian immigration policy in post-war period. It also identifies successive documents that proved particularly influential for Canadian immigration policy at the time. The findings of this research point to a variety of causes for the legislation changes, from foreign and domestic policy to economy policy.

Service differentiated and adaptive CSMA/CA over IEEE 802.15.4 for Cyber-Physical Systems.

Science.gov (United States)

Xia, Feng; Li, Jie; Hao, Ruonan; Kong, Xiangjie; Gao, Ruixia

2013-01-01

Cyber-Physical Systems (CPS) that collect, exchange, manage information, and coordinate actions are an integral part of the Smart Grid. In addition, Quality of Service (QoS) provisioning in CPS, especially in the wireless sensor/actuator networks, plays an essential role in Smart Grid applications. IEEE 802.15.4, which is one of the most widely used communication protocols in this area, still needs to be improved to meet multiple QoS requirements. This is because IEEE 802.15.4 slotted Carrier Sense Multiple Access/Collision Avoidance (CSMA/CA) employs static parameter configuration without supporting differentiated services and network self-adaptivity. To address this issue, this paper proposes a priority-based Service Differentiated and Adaptive CSMA/CA (SDA-CSMA/CA) algorithm to provide differentiated QoS for various Smart Grid applications as well as dynamically initialize backoff exponent according to traffic conditions. Simulation results demonstrate that the proposed SDA-CSMA/CA scheme significantly outperforms the IEEE 802.15.4 slotted CSMA/CA in terms of effective data rate, packet loss rate, and average delay.

IEEE Std 382-1985: IEEE standard for qualification of actuators for power operated valve assemblies with safety-related functions for nuclear power plants

International Nuclear Information System (INIS)

Anon.

1992-01-01

This standard describes the qualification of all types of power-driven valve actuators, including damper actuators, for safety-related functions in nuclear power generating stations. This standard may also be used to separately qualify actuator components. This standard establishes the minimum requirements for, and guidance regarding, the methods and procedures for qualification of power-driven valve actuators with safety-related functions Part I describes the qualification process. Part II describes the standard qualification cases and their environmental parameters for the usual locations of safety-related equipment in a nuclear generating station. Part III describes the qualification tests outlined in 6.3.3

Outdoor Long-Range WLANs : A Lesson for IEEE 802.11ah

NARCIS (Netherlands)

Aust, Stefan; Venkatesha Prasad, R.; Niemegeers, Ignas G M M

2015-01-01

Several service applications have been reported by many who proposed the use of wireless LANs (WLANs) over a wide variety of outdoor deployments. In particular, the upcoming IEEE 802.11ah WLAN protocol will enable a longer transmission range between WLAN access points (APs) and stations (STAs) up to

Adaptive threshold control for auto-rate fallback algorithm in IEEE 802.11 multi-rate WLANs

Science.gov (United States)

Wu, Qilin; Lu, Yang; Zhu, Xiaolin; Ge, Fangzhen

2012-03-01

The IEEE 802.11 standard supports multiple rates for data transmission in the physical layer. Nowadays, to improve network performance, a rate adaptation scheme called auto-rate fallback (ARF) is widely adopted in practice. However, ARF scheme suffers performance degradation in multiple contending nodes environments. In this article, we propose a novel rate adaptation scheme called ARF with adaptive threshold control. In multiple contending nodes environment, the proposed scheme can effectively mitigate the frame collision effect on rate adaptation decision by adaptively adjusting rate-up and rate-down threshold according to the current collision level. Simulation results show that the proposed scheme can achieve significantly higher throughput than the other existing rate adaptation schemes. Furthermore, the simulation results also demonstrate that the proposed scheme can effectively respond to the varying channel condition.

Annual progress report 1976

International Nuclear Information System (INIS)

This report of the Nuclear Sciences Institute at Grenoble gives a general survey of the scientific and technical work done in 1976. The research areas are: nuclear reactions, gamma spectrometry, polarized neutrons, intermediate energy physics, theoretical physics, accelerators and technical means, the experimental physics at the cyclotron being essentially concerned with three fields: γ spectrometry, giant resonances, mechanisms of heavy ion induced reactions [fr

GSF - annual report 1976

International Nuclear Information System (INIS)

1976-01-01

The annual report of the GSF for 1976 describes in brief contributions and surveys the activities of the institutes for biology, microbiology, radiation botany, biochemistry, hematology, medical data processing, ecological chemistry, radiation protection, radiohydrometry, underground disposal, as well as the activities of associated departments and activities of the special departments for algae R+D, for toxicology, for coherent optics and of the physical-technical department. (HK) [de

Performance Analysis of Non-saturated IEEE 802.11 DCF Networks

Science.gov (United States)

Zhai, Linbo; Zhang, Xiaomin; Xie, Gang

This letter presents a model with queueing theory to analyze the performance of non-saturated IEEE 802.11 DCF networks. We use the closed queueing network model and derive an approximate representation of throughput which can reveal the relationship between the throughput and the total offered load under finite traffic load conditions. The accuracy of the model is verified by extensive simulations.

40 CFR 141.72 - Disinfection.

Science.gov (United States)

2010-07-01

... PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.72 Disinfection. A public water... the direct influence of surface water and provides filtration treatment must provide disinfection...) Disinfection requirements for public water systems which provide filtration. Each public water system that...

19 CFR 141.1 - Liability of importer for duties.

Science.gov (United States)

2010-04-01

... Customs by the broker. (c) Claim against estate of importer. The claim of the Government for unpaid duties... 19 Customs Duties 2 2010-04-01 2010-04-01 false Liability of importer for duties. 141.1 Section 141.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT...

Annual report 1976

International Nuclear Information System (INIS)

1976-01-01

The report gives a review on: 1) The research activities in 1976 in the fields of high-β-Plasmas, low-β-plasmas, tokamaks, plasma theory, plasma-wall interactions, informatics, relativistic plasmas and fusion technology; b) the activities of the central technical systems, c) the organisational structure of the IPP Garching, d) the commercial management, administration and general services, e) The safety organisation, f) Public relation activities, g) Publications and conference reports, h) Present projects of the IPP Garching on the Universities of Stuttgart and Munich. (GG) [de

Zooplankton, temperature, salinity, and nutrients data from bottle and net casts in the Flores Sea from the SAMUDERA from 12 December 1976 to 24 December 1976 (NODC Accession 0000673)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Zooplankton, phytoplankton, nutrients, and other data were collected from bottle and net casts from the SUMUDERA from 12 December 1976 to 24 December 1976....

Zooplankton, temperature, salinity, and nutrients data from bottle and net casts in the Flores Sea from the SAMUDERA from 14 July 1976 to 26 July 1976 (NODC Accession 0000672)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Zooplankton, phytoplankton, nutrients, and other data were collected using bottles and nets from the SAMUDERA from 14 July 1976 to 26 July 1976 . Zooplankton data...

40 CFR 141.801 - Definitions.

Science.gov (United States)

2010-07-01

... aircraft that supply water for human consumption to passengers or crew. Aircraft water system operations... distribution and consumption without further treatment, except as treatment necessary to maintain water quality...). (40 CFR 141.2) Human consumption means drinking, bathing, showering, hand washing, teeth brushing...

Non-natives: 141 scientists object

NARCIS (Netherlands)

Simberloff, D.; Van der Putten, W.H.

2011-01-01

Supplementary information to: Non-natives: 141 scientists object Full list of co-signatories to a Correspondence published in Nature 475, 36 (2011); doi: 10.1038/475036a. Daniel Simberloff University of Tennessee, Knoxville, Tennessee, USA. dsimberloff@utk.edu Jake Alexander Institute of Integrative

A Cross-Layer Key Management Scheme for MIPv6 Fast Handover over IEEE 802.11 Wireless LAN

Directory of Open Access Journals (Sweden)

Chang-Seop Park

2015-01-01

Full Text Available A new key management and security scheme is proposed to integrate Layer Two (L2 and Layer Three (L3 keys for secure and fast Mobile IPv6 handover over IEEE 802.11 Wireless Local Area Network (WLAN. Unlike the original IEEE 802.11-based Mobile IPv6 Fast Handover (FMIPv6 that requires time-consuming IEEE 802.1x-based Extensible Authentication Protocol (EAP authentication on each L3 handover, the newly proposed key management and security scheme requires only one 802.1x-EAP regardless of how many L3 handovers occur. Therefore, the proposed scheme reduces the handover latency that results from a lengthy 802.1x-based EAP. The proposed key management and security scheme is extensively analyzed in terms of security and performance, and the proposed security scheme is shown to be more secure than those that were previously proposed.

2011 IEEE Visualization Contest Winner: Visualizing Unsteady Vortical Behavior of a Centrifugal Pump

KAUST Repository

Otto, Mathias; Kuhn, Alexander; Engelke, Wito; Theisel, Holger

2012-01-01

In the 2011 IEEE Visualization Contest, the dataset represented a high-resolution simulation of a centrifugal pump operating below optimal speed. The goal was to find suitable visualization techniques to identify regions of rotating stall

17th IEEE NPSS Real Time Conference – RT-2010

CERN Multimedia

Carlos Varandas

2010-01-01

Congress Centre of “Instituto Superior Técnico”, Lisboa, Portugal, 24-28 May, 2010 ABSTRACT SUBMISSION OPEN Abstract Submission Deadline: March 1st, 2010 Dear Sir/Madam, We are pleased to announce that abstract submission for the 17th IEEE NPSS Real Time Conference is now open on our web site. The deadline for submitting an abstract is 1st March 2010. Full conference details General Chairman

40 CFR 141.401 - Sanitary surveys for ground water systems.

Science.gov (United States)

2010-07-01

... systems. 141.401 Section 141.401 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... an evaluation of the applicable components listed in paragraphs (c)(1) through (8) of this section... facilities, and controls, (6) Monitoring, reporting, and data verification, (7) System management and...

40 CFR 141.73 - Filtration.

Science.gov (United States)

2010-07-01

... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.73 Filtration. A public water system that uses a surface water source or a ground water source under the direct influence of surface water...

Progress report. July-September 1976 (5)

International Nuclear Information System (INIS)

1976-10-01

Objectives and various units activities of NRC from July to September 1976 are described. Furthermore departments reports are accompanied by the name of those who are closely involved with the scientific and technical works. A list of publications is given

Progress report. January-March 1976 (3)

International Nuclear Information System (INIS)

1976-04-01

Objectives and various units activities of NRC from January to March 1976 are described. Furthermore departments reports are accompanied by the name of those who are closely involved with the scientific and technical works. A list of publications is included

TCP Performance in Multi-Polling Game Theory-Based IEEE 802.11 Networks

Directory of Open Access Journals (Sweden)

Cuzanauskas Tomas

2016-12-01

Full Text Available Easy usage and integration with various applications made IEEE 802.11 one of the most used technologies these days, both at home and business premises. Over the years, there have been many additional improvements to the 802.11 standards. Nevertheless, the algorithms and Media Access Control (MAC layer methods are almost the same as in previous Wi-Fi versions. In this paper, a set of methods to improve the total system capacity is proposed – such as efficient transmit power management based on Game Theory with a custom wireless medium protocol. The transmit power management and wireless medium protocol is verified by both simulation and real application scenarios. The results conclude that the capacity of the proposed wireless medium protocol is overall 20 percent higher than the standard 802.11 wireless medium access protocols. Additional TCP Acknowledgment filtering, which was tested together with the proposed wireless medium access protocol, can provide up to 10-percent-higher TCP throughput in high-density scenarios, especially for asymmetrical traffic cases. The conducted research suggests that efficient power management could result in lighter transmit power allocation rules that are currently set by the local regulators for current Wi-Fi devices. Thus, better propagation characteristics and wireless medium management would lead to an overall higher wireless system capacity.

Incorporating antenna beamswitching technique into drivers for IEEE802.11 WLAN devices

CSIR Research Space (South Africa)

Mofolo, M

2015-11-23

Full Text Available the beamswitching technique for switched parasitic array (SPA) and electronically steerable parasitic array radiator (ESPAR) antennas in the drivers for IEEE802.11 WLAN devices. The modifications of the open source drivers (ath5k and ath9k) to enable real...

Real-Time Station Grouping under Dynamic Traffic for IEEE 802.11ah.

Science.gov (United States)

Tian, Le; Khorov, Evgeny; Latré, Steven; Famaey, Jeroen

2017-07-04

IEEE 802.11ah, marketed as Wi-Fi HaLow, extends Wi-Fi to the sub-1 GHz spectrum. Through a number of physical layer (PHY) and media access control (MAC) optimizations, it aims to bring greatly increased range, energy-efficiency, and scalability. This makes 802.11ah the perfect candidate for providing connectivity to Internet of Things (IoT) devices. One of these new features, referred to as the Restricted Access Window (RAW), focuses on improving scalability in highly dense deployments. RAW divides stations into groups and reduces contention and collisions by only allowing channel access to one group at a time. However, the standard does not dictate how to determine the optimal RAW grouping parameters. The optimal parameters depend on the current network conditions, and it has been shown that incorrect configuration severely impacts throughput, latency and energy efficiency. In this paper, we propose a traffic-adaptive RAW optimization algorithm (TAROA) to adapt the RAW parameters in real time based on the current traffic conditions, optimized for sensor networks in which each sensor transmits packets with a certain (predictable) frequency and may change the transmission frequency over time. The TAROA algorithm is executed at each target beacon transmission time (TBTT), and it first estimates the packet transmission interval of each station only based on packet transmission information obtained by access point (AP) during the last beacon interval. Then, TAROA determines the RAW parameters and assigns stations to RAW slots based on this estimated transmission frequency. The simulation results show that, compared to enhanced distributed channel access/distributed coordination function (EDCA/DCF), the TAROA algorithm can highly improve the performance of IEEE 802.11ah dense networks in terms of throughput, especially when hidden nodes exist, although it does not always achieve better latency performance. This paper contributes with a practical approach to optimizing

Hardware Timestamping for an Image Acquisition System Based on FlexRIO and IEEE 1588 v2 Standard

Science.gov (United States)

Esquembri, S.; Sanz, D.; Barrera, E.; Ruiz, M.; Bustos, A.; Vega, J.; Castro, R.

2016-02-01

Current fusion devices usually implement distributed acquisition systems for the multiple diagnostics of their experiments. However, each diagnostic is composed by hundreds or even thousands of signals, including images from the vessel interior. These signals and images must be correctly timestamped, because all the information will be analyzed to identify plasma behavior using temporal correlations. For acquisition devices without synchronization mechanisms the timestamp is given by another device with timing capabilities when signaled by the first device. Later, each data should be related with its timestamp, usually via software. This critical action is unfeasible for software applications when sampling rates are high. In order to solve this problem this paper presents the implementation of an image acquisition system with real-time hardware timestamping mechanism. This is synchronized with a master clock using the IEEE 1588 v2 Precision Time Protocol (PTP). Synchronization, image acquisition and processing, and timestamping mechanisms are implemented using Field Programmable Gate Array (FPGA) and a timing card -PTP v2 synchronized. The system has been validated using a camera simulator streaming videos from fusion databases. The developed architecture is fully compatible with ITER Fast Controllers and has been integrated with EPICS to control and monitor the whole system.

An improved IEEE 802.11 protocol for reliable data transmission in power distribution fault diagnosis

Energy Technology Data Exchange (ETDEWEB)

Campoccia, F.; Di Silvestre, M.L.; Sanseverino, E.R.; Zizzo, G. [Palermo Univ., Palermo (Italy)

2010-10-15

In power systems, on-line transmission between local units and the central unit can be done by means of power line communications or wireless technology. During an electrical fault, the reliability of the distribution system depends on the security of the timely protective and restorative actions on the network. This paper focused on the WiFi system because of its economy and ease of installation. However, WiFi systems are typically managed by the IEEE 802.11 protocol, which is not reliable in terms of security in data communication. In WiFi networks, data is divided into packets and sent in succession to reduce errors within the radio channel. The IEEE 802.11 protocol has high probability for loss of packets or delay in their transmission. In order to ensure the reliability of data transmission times between two terminal units connected by WiFi stations, a new protocol was derived by modifying the IEEE 802.11. The improvements of the new protocol were highlighted and its capability for the diagnostic service was verified. The modified protocol eliminates the danger of collisions between packets and optimizes the transmission time for sending information. 6 refs., 7 tabs., 8 figs.

Zooplankton around Marion and Prince Edward Islands; 24 March 1976 to 25 November 1976 (NODC Accession 0000940)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Samples of zooplankton taken at 12 stations around Marion and Prince Edward Islands (47oS - 35oE) in March 1976 from the 'Marion-Dufresne' and at 2 stations in the...

40 CFR 141.173 - Filtration.

Science.gov (United States)

2010-07-01

... PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection-Systems Serving 10,000 or More People § 141.173 Filtration. A public water system subject to the requirements of this subpart that does... treatment, direct filtration, slow sand filtration, or diatomaceous earth filtration. A public water system...

Field-programmable gate array implementation of an all-digital IEEE 802.15.4-compliant transceiver

Science.gov (United States)

Cornetta, Gianluca; Touhafi, Abdellah; Santos, David J.; Vázquez, José M.

2010-12-01

An architecture for a low-cost, low-complexity digital transceiver is presented in this article. The proposed architecture targets the IEEE 802.15.4 standard for short-range wireless personal area networks and has been implemented as a synthesisable VHDL register transfer level description. The system has been evaluated and tested using a Xilinx 90 nm Virtex-4 field-programmable gate array as the target technology. Bit error rate (BER) and error vector magnitude (EVM) have been used as the figures of merit for modem performance. Simulations show that the recommended minimum BER is achieved at E b/N 0 = 8.7 dB, whereas the EVM is 19.5%. The implemented device occupies 10% of the target FPGA and has a normalised maximum power consumption of 44 mW in transmit mode and 53 mW in receiver mode.

Catalogue of standards at the Safety Analysis department library, the first of March 1987

International Nuclear Information System (INIS)

1987-01-01

This report is a compilation of ANS and ANSI/ANS, ANSI/ASME american standards, Regulatory guides (Power Reactor Division), IEEE standards, to which are added ANSI american standards, AFNOR french standards, all of them being updated until to day. This computed compilation is divided into three parts: 1) main descriptor categories; 2) list of american standards in chronological order, list of AFNOR french standards, list of Regulatory guides in numerical order. 3) list of descriptors in alphabetic order [fr

IEEE Conference Record of 1976 Twelfth Modulator Symposium, New York City, 4-5 February 1976.

Science.gov (United States)

1976-01-01

volt, 7 ampere compactness, no standby power, and competitive economi - rms, thyristor in a TO-S can) was also considered. cally. Correspondence with...VI V, J* t2 OA WN.T18 MM EGMLS WMPL MW .TAE Fts Puuu 2B - GeEMTinn nP CLOSEY WACED PULSE BY A SHAM. SCRTNAEY IIIs~ 2 T Sv1 cAi 4.-JI j 1f -W J1YL’ LJ

BOB-RED queue management for IEEE 802.15.4 wireless sensor networks

Directory of Open Access Journals (Sweden)

Wu Jean-Lien

2011-01-01

Full Text Available Abstract Multimedia services over resource constrained wireless sensor networks (WSNs face a performance bottleneck issue from the gateway node to the sink node. Therefore, the queue management at the gateway node is crucial for diversified messages conveyed from the front nodes to the sink node. In this article, beacon order-based random early detection (BOB-RED queue management is proposed. BOB-RED is a dynamic adaptation scheme based on adjusting beacon interval and superframe duration in the IEEE 802.15.4 MAC superframe accompanied with RED queue management scheme to increase the transmission efficiency of multimedia over WSNs. We focus on the performance improvement upon different traffic loads over WSNs. Evaluation metrics include end-to-end delay, packet delivery ratio, and energy consumption in IEEE 802.15.4 beacon enabled mode. Simulation results show that BOB-RED can effectively decrease end-to-end delay and energy consumption compared to the DropTail scheme.

Report on safety related occurrences and reactor trips July 1, 1976-December 31, 1976

International Nuclear Information System (INIS)

Andermo, L.

1977-04-01

This is a systematically arranged report on all reported safety related occurrences and reactor trips in Swedish nuclear power plants in operation during July 1, 1976 to December 31, 1976 inclusive. The facilities involved are Oskarshamn 1 and 2, Ringhals 1 and 2 and Barsebaeck 1. During this period of the 6 months 37 safety related occurrences and 34 reactor trips have been reported to the Nuclear Power Inspectorate. As earlier experiences have shown it is to the greatest extent the conventional components which bring about the safety related occurrences or occurrences leading to outages or power reductions. However, the component errors discovered in the safety related systems have not affected the function of their redundant systems and other diverse systems have not been involved. Therefore the reactor safety has been satisfactory. The fact that even small deviations from prescribed operation results in automatic and safe shut down of the reactor, does not always imply a conflict with operational availability. The number of reactor trips are almost as low as during the last period, which is a drastic reduction compared to earlier time periods. The greatest outages are caused by occurrences without safety significance.(author)

40 CFR 141.560 - Is my system subject to individual filter turbidity requirements?

Science.gov (United States)

2010-07-01

... filter turbidity requirements? 141.560 Section 141.560 Protection of Environment ENVIRONMENTAL PROTECTION... Filtration and Disinfection-Systems Serving Fewer Than 10,000 People Individual Filter Turbidity Requirements § 141.560 Is my system subject to individual filter turbidity requirements? If your system is a subpart...

Hybrid Polling Method for Direct Link Communication for IEEE 802.11 Wireless LANs

Directory of Open Access Journals (Sweden)

Woo-Yong Choi

2008-10-01

Full Text Available The direct link communication between STAtions (STAs is one of the techniques to improve the MAC performance of IEEE 802.11 infrastructure networks. For the efficient direct link communication, in the literature, the simultaneous polling method was proposed to allow the multiple direct data communication to be performed simultaneously. However, the efficiency of the simultaneous polling method is affected by the interference condition. To alleviate the problem of the lower polling efficiency with the larger interference range, the hybrid polling method is proposed for the direct link communication between STAs in IEEE 802.11 infrastructure networks. By the proposed polling method, we can integrate the sequential and simultaneous polling methods properly according to the interference condition. Numerical examples are also presented to show the medium access control (MAC performance improvement by the proposed polling method.

40 CFR 141.170 - General requirements.

Science.gov (United States)

2010-07-01

... recontamination by surface water runoff and a point downstream before or at the first customer for filtered...) Compliance with the profiling and benchmark requirements under the provisions of § 141.172. (b) A public...

Progress report. April-June 1976 (4)

International Nuclear Information System (INIS)

1976-07-01

Objectives and various units activities of NRC from April to June 1976 are described. Furthermore departments reports are accompanied by the name of those who are closely involved with the scientific and technical works. A list of publications and new staff members is given

European Organization for Nuclear Research annual report 1976

International Nuclear Information System (INIS)

1977-01-01

The 1976 CERN annual report begins with a brief history of the organization and description of the organizational structure. A description of the CERN accelerators is given and CERN scientific activities are reviewed. The main body of the report comprises reports from the eleven main divisions, and administrative divisions such as personnel and finance. The reports from the scientific divisions contain descriptions of, and data from, present research and plans for long term development. The appendices contain a list of CERN publications for 1976, a list of lectures and seminars held, a list of training programmes undertaken and a list of scientific conferences and schools held. (B.D.)

IEEE 802.11 ECG monitoring system.

Science.gov (United States)

Tejero-Calado, Juan; Lopez-Casado, Carmen; Bernal-Martin, Antonio; Lopez-Gomez, Miguel; Romero-Romero, Marco; Quesada, Guillermo; Lorca, Julio; Rivas, Ramon

2005-01-01

New wireless technologies make possible the implementation of high level integration wireless devices which allow the replacement of traditional large wired monitoring devices. This kind of devices favours at-home hospitalization, reducing the affluence to sanitary assistance centers to make routine controls. This fact causes a really favourable social impact, especially for elder people, rural-zone inhabitant, chronic patients and handicapped people. Furthermore, it offers new functionalities to physicians and will reduce the sanitary cost. Among these functionalities, biomedical signals can be sent to other devices (screen, PDA, PC...) or processing centers, without restricting the patients' mobility. The aim of this project is the development and implementation of a reduced size multi-channel electrocardiograph based on IEEE 802.11, which allows wireless monitoring of patients, and the insertion of the information into the TCP/IP Hospital network.

Rapid Prototyping of Standard Compliant Visible Light Communications System

OpenAIRE

Gavrincea, Ciprian; Baranda, Jorge; Henarejos, Pol

2014-01-01

This article describes the implementation of a prototype visible light communications system based on the IEEE 802.15.7 standard using low-cost commercial off-the-shelf analog devices. The aim of this article is to show that this standard provides a framework that could promote the introduction of applications into the market. Thus, these specifications could be further developed, reducing the gap between the industry and research communities. The implemented prototype makes use of software d...

Studi Perencanaan Koordinasi Proteksi Mempertimbangkan Busur Api Pada Sistem Kelistrikan PT. Semen Indonesia Aceh Menggunakan Standar IEEE 1584-2002

Directory of Open Access Journals (Sweden)

Dhimas Oktavian Andryana

2017-03-01

Full Text Available PT. Semen Indonesia pabrik Aceh merupakan perusahaan patungan (joint venture company antara PT. Semen Indonesia (Persero bersama PT. Samana Citra Agung. Total daya listrik yang dibutuhkan sebesar 85.8 MW dengan sistem kelistrikan pada sistem tegangan rendah dan menengah. Guna menjaga kontinuitas daya listrik, diperlukan koordinasi proteksi untuk meminimalisir dampak yang ditimbulkan ketika terjadi gangguan. Salah satu dampak yang ditimbulkan adalah adanya busur api (arc flash. Namun demikian, energi yang dihasilkan oleh busur api setelah dilakukan koordinasi proteksi perlu dipertimbangkan agar tidak melampaui standard yang diizinkan. Analisa busur api dilakukan dengan menggunakan perhitungan standar IEEE 1584-2002. Setelah dilakukan beberapa analisa didapatkan bahwa beberapa daerah di PT. Semen Indonesia pabrik Aceh memiliki nilai insiden energi diatas kategori 4, sehingga diperlukan tambahan peralatan berupa rele differensial sebagai pengaman utama agar nilai insiden energi busur api bisa dikategorikan sesuai standard NFPA 70E.

25 CFR 141.36 - Maximum finance charges on pawn transactions.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Maximum finance charges on pawn transactions. 141.36... PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS Pawnbroker Practices § 141.36 Maximum finance charges on pawn transactions. No pawnbroker may impose an annual finance charge greater than twenty-four percent...

Activity report 1976

International Nuclear Information System (INIS)

Drent, W.; Delande, E.

1977-07-01

The principal activities of Eurochemic plant in the fields of reprocessing and the closing-down program are presented in this report that covers the period 1 January to 31 December 1976. Works in the plant are closely related to the decontamination of the process cells and the completation of the bituminization plant and storage facility. The solidification processes for the high-level liquid waste have been definied and the negotiations in view of setting up an international R and D program for the embedding of solidified high-level waste into metal patrices have been pursued. (A.F.)

Annual report 1976

International Nuclear Information System (INIS)

1977-06-01

The first ECN activities give not only the financial figures, but in each chapter the background of progress, research and development in 1976. The chapters are: Energy Study Centre with an enlargement of an Office Energy Research Projects, nuclear power stations, the DeBeNeLux Project, nuclear fuel cycle, non-nuclear energy systems, i.e. superconductivity, windpower, magnetohydronamics, energy storage, non-energetic applications of nuclear fission, environmental research, utilization of the Petten research reactors, radiation protection, computer centre organization, radioactive waste disposal, public relations, documentary information, education, man-power and external relations. A list of ECN-publications is included

Annual report 1976

International Nuclear Information System (INIS)

Lindh, U.; Sundberg, O.

1977-01-01

The Gustaf Werner Institute (GWI) annual report for the year 1976 presents in a condensed form the scientific activities in the disciplines High Energy Physics and Physical Biology at Uppsala University. The activities in High Energy Physics fall into three domains: Research with the local accelerator, participation in collaborations at international centers and work on the rebuilding of the Uppsala synchrocyclotron. A major subject of research in Physical Biology is control of growth and differentiation, as reflected in the kinetics of biochemical reactions or in the behaviour of healthy or malignant cells at various levels of organization. (Auth.)

26 CFR 1.381(c)(14)-1 - Dividend carryover to personal holding company.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Dividend carryover to personal holding company. 1.381(c)(14)-1 Section 1.381(c)(14)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(14)-1...

25 CFR 141.57 - Procedures to cancel liability on bond.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Procedures to cancel liability on bond. 141.57 Section 141.57 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS... Procedures to cancel liability on bond. (a) Any surety who wishes to be relieved from liability arising on a...

40 CFR 141.86 - Monitoring requirements for lead and copper in tap water.

Science.gov (United States)

2010-07-01

... copper in tap water. 141.86 Section 141.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... § 141.86 Monitoring requirements for lead and copper in tap water. (a) Sample site location. (1) By the... the water system can collect the number of lead and copper tap samples required in paragraph (c) of...

A network architecture for precision formation flying using the IEEE 802.11 MAC Protocol

Science.gov (United States)

Clare, Loren P.; Gao, Jay L.; Jennings, Esther H.; Okino, Clayton

2005-01-01

Precision Formation Flying missions involve the tracking and maintenance of spacecraft in a desired geometric formation. The strong coupling of spacecraft in formation flying control requires inter-spacecraft communication to exchange information. In this paper, we present a network architecture that supports PFF control, from the initial random deployment phase to the final formation. We show that a suitable MAC layer for the application protocol is IEEE's 802.11 MAC protocol. IEEE 802.11 MAC has two modes of operations: DCF and PCF. We show that DCF is suitable for the initial deployment phase while switching to PCF when the spacecraft are in formation improves jitter and throughput. We also consider the effect of routing on protocol performance and suggest when it is profitable to turn off route discovery to achieve better network performance.

2011 IEEE Visualization Contest Winner: Visualizing Unsteady Vortical Behavior of a Centrifugal Pump

KAUST Repository

Otto, Mathias

2012-09-01

In the 2011 IEEE Visualization Contest, the dataset represented a high-resolution simulation of a centrifugal pump operating below optimal speed. The goal was to find suitable visualization techniques to identify regions of rotating stall that impede the pump\\'s effectiveness. The winning entry split analysis of the pump into three parts based on the pump\\'s functional behavior. It then applied local and integration-based methods to communicate the unsteady flow behavior in different regions of the dataset. This research formed the basis for a comparison of common vortex extractors and more recent methods. In particular, integration-based methods (separation measures, accumulated scalar fields, particle path lines, and advection textures) are well suited to capture the complex time-dependent flow behavior. This video (http://youtu.be/ oD7QuabY0oU) shows simulations of unsteady flow in a centrifugal pump. © 2012 IEEE.

Current meter data from moored current meter casts in the Puget Sound as part of the Mesa Puget Sound/PSERP project, 1976-02-13 to 1976-05-01 (NODC Accession 7601638)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Current meter data were collected using moored current meter casts in the Puget Sound from February 13, 1976 to May 1, 1976. Data were submitted by Pacific Marine...

The 1976 Tangshan earthquake

Science.gov (United States)

Fang, Wang

1979-01-01

The Tangshan earthquake of 1976 was one of the largest earthquakes in recent years. It occurred on July 28 at 3:42 a.m, Beijing (Peking) local time, and had magnitude 7.8, focal depth of 15 kilometers, and an epicentral intensity of XI on the New Chinese Seismic Intensity Scale; it caused serious damage and loss of life in this densely populated industrial city. Now, with the help of people from all over China, the city of Tangshan is being rebuild. 

Molecular cloning and expression analysis of a zebrafish novel zinc finger protein gene rnf141

Directory of Open Access Journals (Sweden)

Wenqian Deng

2009-01-01

Full Text Available ZNF230 is a novel zinc finger gene cloned by our laboratory. In order to understand the potential functions of this gene in vertebrate development, we cloned the zebrafish orthologue of human ZNF230, named rnf141. The cDNA fragment of rnf141 was obtained by rapid amplification of cDNA ends (RACE. The open reading frame (ORF encodes a polypeptide of 222 amino acids which shares 75.65% identity with the human ZNF230. RT-PCR analysis in zebrafish embryo and adult tissues revealed that rnf141 transcripts are maternally derived and that rnf141 mRNA has a broad distribution. Zygotic rnf141 message is strongly localized in the central nervous system, as shown by whole-mount in situ hybridization. Knockdown and over expression of rnf141 can induce abnormal phenotypes, including abnormal development of brain, as well as yolk sac and axis extendsion. Marker gene analysis showed that rnf141 may play a role in normal dorsoventral patterning of zebrafish embryos, suggesting that rnf141 may have a broad function during early development of vertebrates.

An Improved Approach for RSSI-Based only Calibration-Free Real-Time Indoor Localization on IEEE 802.11 and 802.15.4 Wireless Networks

Directory of Open Access Journals (Sweden)

Marco Passafiume

2017-03-01

Full Text Available Assuming a reliable and responsive spatial contextualization service is a must-have in IEEE 802.11 and 802.15.4 wireless networks, a suitable approach consists of the implementation of localization capabilities, as an additional application layer to the communication protocol stack. Considering the applicative scenario where satellite-based positioning applications are denied, such as indoor environments, and excluding data packet arrivals time measurements due to lack of time resolution, received signal strength indicator (RSSI measurements, obtained according to IEEE 802.11 and 802.15.4 data access technologies, are the unique data sources suitable for indoor geo-referencing using COTS devices. In the existing literature, many RSSI based localization systems are introduced and experimentally validated, nevertheless they require periodic calibrations and significant information fusion from different sensors that dramatically decrease overall systems reliability and their effective availability. This motivates the work presented in this paper, which introduces an approach for an RSSI-based calibration-free and real-time indoor localization. While switched-beam array-based hardware (compliant with IEEE 802.15.4 router functionality has already been presented by the author, the focus of this paper is the creation of an algorithmic layer for use with the pre-existing hardware capable to enable full localization and data contextualization over a standard 802.15.4 wireless sensor network using only RSSI information without the need of lengthy offline calibration phase. System validation reports the localization results in a typical indoor site, where the system has shown high accuracy, leading to a sub-metrical overall mean error and an almost 100% site coverage within 1 m localization error.

An Improved Approach for RSSI-Based only Calibration-Free Real-Time Indoor Localization on IEEE 802.11 and 802.15.4 Wireless Networks.

Science.gov (United States)

Passafiume, Marco; Maddio, Stefano; Cidronali, Alessandro

2017-03-29

Assuming a reliable and responsive spatial contextualization service is a must-have in IEEE 802.11 and 802.15.4 wireless networks, a suitable approach consists of the implementation of localization capabilities, as an additional application layer to the communication protocol stack. Considering the applicative scenario where satellite-based positioning applications are denied, such as indoor environments, and excluding data packet arrivals time measurements due to lack of time resolution, received signal strength indicator (RSSI) measurements, obtained according to IEEE 802.11 and 802.15.4 data access technologies, are the unique data sources suitable for indoor geo-referencing using COTS devices. In the existing literature, many RSSI based localization systems are introduced and experimentally validated, nevertheless they require periodic calibrations and significant information fusion from different sensors that dramatically decrease overall systems reliability and their effective availability. This motivates the work presented in this paper, which introduces an approach for an RSSI-based calibration-free and real-time indoor localization. While switched-beam array-based hardware (compliant with IEEE 802.15.4 router functionality) has already been presented by the author, the focus of this paper is the creation of an algorithmic layer for use with the pre-existing hardware capable to enable full localization and data contextualization over a standard 802.15.4 wireless sensor network using only RSSI information without the need of lengthy offline calibration phase. System validation reports the localization results in a typical indoor site, where the system has shown high accuracy, leading to a sub-metrical overall mean error and an almost 100% site coverage within 1 m localization error.

26 CFR 1.141-3 - Definition of private business use.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Definition of private business use. 1.141-3...-3 Definition of private business use. (a) General rule—(1) In general. The private business use test relates to the use of the proceeds of an issue. The 10 percent private business use test of section 141(b...

Evaluasi Kinerja Layanan IPTV pada Jaringan Testbed WiMAX Berbasis Standar IEEE 802.16-2004

Directory of Open Access Journals (Sweden)

Prasetiyono Hari Mukti

2015-09-01

Full Text Available In this paper, a performance evaluation for IPTV Services over WiMAX testbed based on IEEE Standard 802.16-2004 will be described. The performance of the proposed system is evaluated in terms of delay, jitter, throughput and packet loss. Service performance evaluations are conducted on network topology of point-to-point in the variation of background traffic with different scheduling types. Background traffic is injected into the system to give the sense that the proposed system has variation traffic load. Scheduling type which are used in this paper are Best Effort (BE, Non-Real-Time Polling Service (nrtPS, Real-Time Polling Service (rtPS and Unsolicited Grant Service (UGS. The expemerintal results of IPTV service performance over the testbed network show that the maximum average of delay, jitter, packet loss and jitter are 16.581 ms, 58.515 ms, 0.67 Mbps dan 10.96%, respectively.

Herman D. Stein (USA), President 1968 - 1976

OpenAIRE

Kendall, Katherine A.

2008-01-01

Herman Stein, President of the International Association of Schools of Social Work from 1968 - 1976, has for more than sixty years excelled as an educator, scholar, internationalist, university administrator, and leader in a variety of professional associations.

40 CFR 141.51 - Maximum contaminant level goals for inorganic contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant level goals for inorganic contaminants. 141.51 Section 141.51 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Maximum Contaminant Level...

40 CFR 141.50 - Maximum contaminant level goals for organic contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant level goals for organic contaminants. 141.50 Section 141.50 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Maximum Contaminant Level...

40 CFR 141.52 - Maximum contaminant level goals for microbiological contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant level goals for microbiological contaminants. 141.52 Section 141.52 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Maximum Contaminant Level...

78 FR 18817 - Revisions to Reliability Standard for Transmission Vegetation Management

Science.gov (United States)

2013-03-28

... used in the technical reference paper [Exh. A of NERC's petition].'' \\25\\ \\24\\ NERC Petition, Ex. I... set by Institute of Electric and Electronics Engineers (IEEE) Standard 516 that, as indicated in Order... Power Research Institute (EPRI) is planning to undertake field tests of energized high voltage conductor...

A 1-GHz charge pump PLL frequency synthesizer for IEEE 1394b PHY

DEFF Research Database (Denmark)

Ji, J.; Liu, H.; Li, Q.

2012-01-01

This paper presents an implementation of multi-rate SerDes transceiver for IEEE 1394b applications. Simple and effective pre-emphasis and equalizer circuits are used at transmitter and receiver, respectively. A phase interpolator based clock and data recovery circuit with optimized linearity is a...

Corrections to "Connectivity-Based Reliable Multicast MAC Protocol for IEEE 802.11 Wireless LANs"

Directory of Open Access Journals (Sweden)

Choi Woo-Yong

2010-01-01

Full Text Available We have found the errors in the throughput formulae presented in our paper "Connectivity-based reliable multicast MAC protocol for IEEE 802.11 wireless LANs". We provide the corrected formulae and numerical results.

Earth Sciences Division annual report, 1976

International Nuclear Information System (INIS)

Hornady, B.; Duba, A.

1977-01-01

This compilation lists abstracts of papers, internal reports, and talks presented during 1976 at national and international meetings by members of the Earth Sciences Division, Lawrence Livermore Laboratory. Subjects include: coal gasification, gas stimulation, geothermal fields, oil shale retorting, radioactive waste management, geochemistry, geophysics, seismology, explosive phenomenology, and miscellaneous studies

Astronautics and aeronautics, 1976. A chronology

Science.gov (United States)

Ritchie, E. H.

1984-01-01

A chronology of events concerning astronautics and aeronautics for the year 1976 is presented. Some of the many and varied topics include the aerospace industry, planetary exploration, space transportation system, defense department programs, politics, and aerospace medicine. The entries are organized by the month and presented in a news release format.

List of Theses 1975 and 1976.

Science.gov (United States)

Espejo, Cristina Y., Comp.

The fourth in a continuing series, this publication lists the masters' and doctoral theses on various aspects of mass communication concerning Asia submitted to colleges and universities in Asia and abroad in 1975-1976. The 93 entries are grouped into eight sections: general; advertising, management, and public relations; broadcast media; social…

Invisible watermarking optical camera communication and compatibility issues of IEEE 802.15.7r1 specification

Science.gov (United States)

Le, Nam-Tuan

2017-05-01

Copyright protection and information security are two most considered issues of digital data following the development of internet and computer network. As an important solution for protection, watermarking technology has become one of the challenged roles in industry and academic research. The watermarking technology can be classified by two categories: visible watermarking and invisible watermarking. With invisible technique, there is an advantage on user interaction because of the visibility. By applying watermarking for communication, it will be a challenge and a new direction for communication technology. In this paper we will propose one new research on communication technology using optical camera communications (OCC) based invisible watermarking. Beside the analysis on performance of proposed system, we also suggest the frame structure of PHY and MAC layer for IEEE 802.15.7r1 specification which is a revision of visible light communication (VLC) standardization.

IEEE 802.15.4 Frame Aggregation Enhancement to Provide High Performance in Life-Critical Patient Monitoring Systems.

Science.gov (United States)

Akbar, Muhammad Sajjad; Yu, Hongnian; Cang, Shuang

2017-01-28

In wireless body area sensor networks (WBASNs), Quality of Service (QoS) provision for patient monitoring systems in terms of time-critical deadlines, high throughput and energy efficiency is a challenging task. The periodic data from these systems generates a large number of small packets in a short time period which needs an efficient channel access mechanism. The IEEE 802.15.4 standard is recommended for low power devices and widely used for many wireless sensor networks applications. It provides a hybrid channel access mechanism at the Media Access Control (MAC) layer which plays a key role in overall successful transmission in WBASNs. There are many WBASN's MAC protocols that use this hybrid channel access mechanism in variety of sensor applications. However, these protocols are less efficient for patient monitoring systems where life critical data requires limited delay, high throughput and energy efficient communication simultaneously. To address these issues, this paper proposes a frame aggregation scheme by using the aggregated-MAC protocol data unit (A-MPDU) which works with the IEEE 802.15.4 MAC layer. To implement the scheme accurately, we develop a traffic patterns analysis mechanism to understand the requirements of the sensor nodes in patient monitoring systems, then model the channel access to find the performance gap on the basis of obtained requirements, finally propose the design based on the needs of patient monitoring systems. The mechanism is initially verified using numerical modelling and then simulation is conducted using NS2.29, Castalia 3.2 and OMNeT++. The proposed scheme provides the optimal performance considering the required QoS.

IEEE Xplore® Digital Library - Evolving to Meet YOUR Changing Needs

OpenAIRE

2014-01-01

Представлена презентация доклада "Использование платформы IEEE Digital Library: уникальные научные публикации в области электроники, радиосвязи, вычислительной техники, информационных технологий, энергетики, машиностроения, физики, химии, геологии, нанотехнологий" Эстер Лукаш, специалиста по обучению IEEE (Германия), на семинаре «Использование платформы IEEE Digital Library», прошедшем 02 октября 2014 года в УрФУ, на английском языке....

Radioactive fallout in air and rain: results to the end of 1976

International Nuclear Information System (INIS)

Cambray, R.S.; Fisher, E.M.R.; Eakins, J.D.; Peirson, D.H.

1977-04-01

Samples of atmospheric dust and rainwater have been collected from the United Kingdom and elsewhere. Results are presented an analyses of these samples for various fission products and certain other radionuclides. The average concentration of the long-lived fission product caesium-137 in air in the United Kingdom was, in 1976, about one-third of that in 1975 and about 1% of the maximum which was reached in 1963 to 64. The concentration in rain and the deposition of caesium-137 and strontium-90 averaged over the United Kingdom for 1976 were about half those for 1975. No barium-140 or iodine-131, indicative of recent atmospheric tests, was detected in the United Kingdom after the Chinese explosion on 24 January 1976 but measurable concentrations were detected in air at Hong Kong during February. Fresh activity from the Chinese explosion on 26 September 1976 was detected in the United Kingdom. The peak deposition of iodine-131 that occurred in the second week in Octber was greater than at any time since January 1963 although the total deposition of iodine-131 was less than one-tenth of that in 1962 to 63. Trace amounts of fresh activity attributable to the high-yield Chinese explosion of 17 November were detected in the United Kingdom in December 1976. In the southern hemisphere the mean concentration of caesium-137 in air in 1976 was about half that in 1975. An estimate is made of the worldwide deposit of caesium-137 and strontium-90. The gamma and beta-ray dose rates from fallout at Chilton are estimated from the observed deposition. Measurements of short-lived fission products in air and rain are given in an Appendix. (author)

Investigating the efficiency of IEEE 802.15.4 for medical monitoring applications.

Science.gov (United States)

Pelegris, P; Banitsas, K

2011-01-01

Recent advancements in wireless communications technologies bring us one step closer to provide reliable Telecare services as an alternative to patients staying in a hospital mainly for monitoring purposes. In this research we investigate the efficiency of IEEE 802.15.4 in a simple scenario where a patient is being monitored using an ECG and a blood analysis module. This approach binds well with assisted living solutions, by sharing the network infrastructure for both monitoring and control while taking advantage of the low power features of the protocol. Such applications are becoming more and more realistic to implement as IEEE 802.15.4 compatible hardware becomes increasingly available. Our aim is to examine the impact of Beacon and Superframe Order in the medium access delay, dropped packets, end to end delay, average retransmission attempts and consumed power focusing on this bandwidth demanding situation where the network load does not allow low duty cycles, in order to draw some conclusions on the effect that this will have to telemonitoring applications.

Dynamic subframe allocation for mobile broadband m-health using IEEE 802.16j mobile multihop relay networks.

Science.gov (United States)

Alinejad, Ali; Istepanian, R S H; Philip, N

2012-01-01

The concept of 4G health will be one of the key focus areas of future m-health research and enterprise activities in the coming years. WiMAX technology is one of the constituent 4G wireless technologies that provides broadband wireless access (BWA). Despite the fact that WiMAX is able to provide a high data rate in a relatively large coverage; this technology has specific limitations such as: coverage, signal attenuation problems due to shadowing or path loss, and limited available spectrum. The IEEE 802.16j mobile multihop relay (MMR) technology is a pragmatic solution designed to overcome these limitations. The aim of IEEE 802.16j MMR is to expand the IEEE 802.16e's capabilities with multihop features. In particular, the uplink (UL) and downlink (DL) subframe allocation in WiMAX network is usually fixed. However, dynamic frame allocation is a useful mechanism to optimize uplink and downlink subframe size dynamically based on the traffic conditions through real-time traffic monitoring. This particular mechanism is important for future WiMAX based m-health applications as it allows the tradeoff in both UL and DL channels. In this paper, we address the dynamic frame allocation issue in IEEE 802.16j MMR network for m-health applications. A comparative performance analysis of the proposed approach is validated using the OPNET Modeler(®). The simulation results have shown an improved performance of resource allocation and end-to-end delay performance for typical medical video streaming application.

40 CFR 141.809 - Supplemental treatment.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Supplemental treatment. 141.809... treatment. (a) Any supplemental drinking water treatment units installed onboard existing or new aircraft... the manufacturer's plans and specifications and FAA requirements. (b) Water supplemental treatment and...

40 CFR 141.803 - Coliform sampling.

Science.gov (United States)

2010-07-01

...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Aircraft Drinking Water Rule § 141.803 Coliform sampling. (a... aircraft water system, the sampling frequency must be determined by the disinfection and flushing frequency... disinfection and flushing frequency recommended by the aircraft water system manufacturer, when available...

Interoperable and standard e-Health solution over Bluetooth.

Science.gov (United States)

Martinez, I; Del Valle, P; Munoz, P; Trigo, J D; Escayola, J; Martínez-Espronceda, M; Muñoz, A; Serrano, L; Garcia, J

2010-01-01

The new paradigm of e-Health demands open sensors and middleware components that permit transparent integration and end-to-end interoperability of new personal health devices. The use of standards seems to be the internationally adopted way to solve these problems. This paper presents the implementation of an end-to-end standards-based e-Health solution. This includes ISO/IEEE11073 standard for the interoperability of the medical devices in the patient environment and EN13606 standard for the interoperable exchange of the Electronic Healthcare Record. The design strictly fulfills all the technical features of the most recent versions of both standards. The implemented prototype has been tested in a laboratory environment to demonstrate its feasibility for its further transfer to the healthcare system.

Prenatal Care: New Hampshire Residents - 1976.

Science.gov (United States)

Mires, Maynard H.; Sirc, Charles E.

Data from 1976 New Hampshire birth certificates were used to examine the correlations between the degree (month of pregnancy that prenatal care began) and intensity (number of prenatal visits) of prenatal care and low infant birth weight, illegitimacy, maternal age, maternal education, and complications of pregnancy. The rate of low birth weight…

14 CFR Appendix B to Part 141 - Private Pilot Certification Course

Science.gov (United States)

2010-01-01

... (CONTINUED) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Pt. 141, App. B Appendix B to Part 141...) Accident reporting requirements of the National Transportation Safety Board; (3) Applicable subjects of the... checks and end-of-course tests in accordance with the school's approved training course, consisting of...

Real-Time Support on IEEE 802.11 Wireless Ad-Hoc Networks: Reality vs. Theory

Science.gov (United States)

Kang, Mikyung; Kang, Dong-In; Suh, Jinwoo

The usable throughput of an IEEE 802.11 system for an application is much less than the raw bandwidth. Although 802.11b has a theoretical maximum of 11Mbps, more than half of the bandwidth is consumed by overhead leaving at most 5Mbps of usable bandwidth. Considering this characteristic, this paper proposes and analyzes a real-time distributed scheduling scheme based on the existing IEEE 802.11 wireless ad-hoc networks, using USC/ISI's Power Aware Sensing Tracking and Analysis (PASTA) hardware platform. We compared the distributed real-time scheduling scheme with the real-time polling scheme to meet deadline, and compared a measured real bandwidth with a theoretical result. The theoretical and experimental results show that the distributed scheduling scheme can guarantee real-time traffic and enhances the performance up to 74% compared with polling scheme.

Polymorphisms at Amino Acid Residues 141 and 154 Influence Conformational Variation in Ovine PrP

Science.gov (United States)

Yang, Sujeong; Thackray, Alana M.; Hopkins, Lee; Monie, Tom P.; Burke, David F.; Bujdoso, Raymond

2014-01-01

Polymorphisms in ovine PrP at amino acid residues 141 and 154 are associated with susceptibility to ovine prion disease: Leu141Arg154 with classical scrapie and Phe141Arg154 and Leu141His154 with atypical scrapie. Classical scrapie is naturally transmissible between sheep, whereas this may not be the case with atypical scrapie. Critical amino acid residues will determine the range or stability of structural changes within the ovine prion protein or its functional interaction with potential cofactors, during conversion of PrPC to PrPSc in these different forms of scrapie disease. Here we computationally identified that regions of ovine PrP, including those near amino acid residues 141 and 154, displayed more conservation than expected based on local structural environment. Molecular dynamics simulations showed these conserved regions of ovine PrP displayed genotypic differences in conformational repertoire and amino acid side-chain interactions. Significantly, Leu141Arg154 PrP adopted an extended beta sheet arrangement in the N-terminal palindromic region more frequently than the Phe141Arg154 and Leu141His154 variants. We supported these computational observations experimentally using circular dichroism spectroscopy and immunobiochemical studies on ovine recombinant PrP. Collectively, our observations show amino acid residues 141 and 154 influence secondary structure and conformational change in ovine PrP that may correlate with different forms of scrapie. PMID:25126555

0011-0030.IEEE 754: 64 Bit Double Precision FloatsThis.pdf | 01 ...

Indian Academy of Sciences (India)

Home; public; Volumes; reso; 021; 01; 0011-0030.IEEE 754: 64 Bit Double Precision FloatsThis.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 ...

14 CFR Appendix A to Part 141 - Recreational Pilot Certification Course

Science.gov (United States)

2010-01-01

... rating for which the course applies. (b) Each student must demonstrate satisfactory proficiency prior to... (CONTINUED) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Pt. 141, App. A Appendix A to Part 141.... A person must hold a student pilot certificate prior to enrolling in the flight portion of the...

25 CFR 141.30 - Retaliation prohibited.

Science.gov (United States)

2010-04-01

... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.30 Retaliation prohibited. No licensee may refuse service to any customer for the purpose of retaliating against that customer for...

Freedom of Speech Newsletter, May 1976.

Science.gov (United States)

Allen, Winfred G., Jr., Ed.

This issue of the "Freedom of Speech Newsletter" contains three articles. "Big Brother, 1976--Judges and the Gag Order" by Miles Clark examines constitutional censorship of the media and government secrecy. "Democratic Rights: A Socialist View" by Kipp Dawson argues that "the rulers of the United States have never granted the American people any…

Proceedings of the 1988 IEEE international conference on robotics and automation. Volume 1

International Nuclear Information System (INIS)

Anon.

1988-01-01

These proceedings compile the papers presented at the international conference (1988) sponsored by IEEE Council on ''Robotics and Automation''. The subjects discussed were: automation and robots of nuclear power stations; algorithms of multiprocessors; parallel processing and computer architecture; and U.S. DOE research programs on nuclear power plants

Plankton and other data collected from net casts in the Gulf of Alaska and Bering Sea from NOAA Ship MILLER FREEMAN from 1976-04-26 to 1976-05-31 (NCEI Accession 7700419)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Plankton and other data were collected using net casts in the Gulf of Alaska and Bering Sea from NOAA Ship MILLER FREEMAN from 26 April 1976 to 31 May 1976. Data...

NIH-IEEE 2015 Strategic Conference on Healthcare Innovations and Point-of-Care Technologies for Prec

Science.gov (United States)

NIH and the Institute for Electrical and Electronics Engineering, Engineering in Medicine and Biology Society (IEEE/EMBS) hosted the third iteration of the Healthcare Innovations and Point-of-Care Technologies Conference last week.

25 CFR 141.22 - Subleasing prohibited.

Science.gov (United States)

2010-04-01

... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.22 Subleasing prohibited. No licensee may lease, sublet, rent, or sell any building that the licensee occupies for any purpose to any person...

Research report 1976

International Nuclear Information System (INIS)

1976-01-01

In 1976 the activities coordinated with the sientific programs of the IPP Garching have been continued. In the section 'wave and plasma heating', a) the THETA-pinch experiment has been finished, b) the investigations concerning the propagation of linearly polarized Alfven waves have been extended to wave types without axial symmetry, and c) for an investigation of the coupling of waves to current heated plasmas, the construction of a linear set-up has been started. In the section 'laser applications', the theoretically expected advantages of time-resolved scattering diagnostics, with a pulsed laser could be verified experimentally. For stationary scattering in the IR (10.6 μm), the energy-resolved measurement of the ion line of the magnetic-field-stabilized high-current arc could be demonstrated. For the pulsed scattering diagnostic at 10.6 μm with modulation detection, preliminary data of the thermal high current arc plasma spectrum have been recorded. The development of a stationary single-mode CO 2 laser for time-resolved scattering in the IR region with modulation detection has been put forward. In the section 'short-time techniques', the pulse width of the high-pressure nitrogen lasers could be reduced to tau = 40 psec at 15 bar. Single pulses smaller than 10 psec could be obtained by a combination of a nitrogen laser with an extremely short resonator used as a dye-laser. In the section 'dense plasma' ('plasma focus') the scaling laws of the stored energy and neutron yield have been studied. The theoretical work for interpretation of the processes occuring during the dense phase of the focus and the preparations for radiation absorption near the plasma frequency have been put forward. The annual report includes a complete list of scientific publications, reports and statements of 1976. (GG) [de

Dynamic Spectrum Access: regulations, standards and green radio policy considerations

CSIR Research Space (South Africa)

Mfupe, L

2012-09-01

Full Text Available of ICT-related emissions globally. The overarching goal is to reach consensus within the global ICT sector on a common methodological framework for the measurement of energy consumption and carbon emissions arising from the production, and operation... of the standards that are of interest in the context of this paper include: (Note all IEEE standards are defined in [39]): ETSI reconfigurable radio systems (RRS) [37]: ETSI considers the feasibility of possible operations of the long- term evolution (LTE...

POLLING AND DUAL-LEVEL TRAFFIC ANALYSIS FOR IMPROVED DOS DETECTION IN IEEE 802.21 NETWORKS

Directory of Open Access Journals (Sweden)

Nygil Alex Vadakkan

2014-06-01

Full Text Available The IEEE 802.21 standard was developed for communication of devices in a heterogeneous environment which included greater support for handoffs. This paper focuses on the denial of service (DoS vulnerabilities faced by such Media Independent Handover (MIH networks & various effective countermeasures that can be deployed to prevent their impact on such heterogeneous networks. The use of polling mechanism coupled with real time as well as offline traffic analysis can keep a good number of attacks at bay. The use of offline traffic analysis is to use the model and compare it with a lighter model and see if any of the excluded features in the lighter model have had suspicious variations which could be a varied form of DoS attack or an attack that is completely new. The countermeasures that have been developed also allows for the increase in efficiency of data transfer as well as higher rates of success in handoffs.

A longitudinal analysis of nanotechnology literature: 1976-2004

International Nuclear Information System (INIS)

Li Xin; Chen Hsinchun; Dang Yan; Lin Yiling; Larson, Catherine A.; Roco, Mihail C.

2008-01-01

Nanotechnology research and applications have experienced rapid growth in recent years. We assessed the status of nanotechnology research worldwide by applying bibliographic, content map, and citation network analysis to a data set of about 200,000 nanotechnology papers published in the Thomson Science Citation Index Expanded database (SCI) from 1976 to 2004. This longitudinal study shows a quasi-exponential growth of nanotechnology articles with an average annual growth rate of 20.7% after 1991. The United States had the largest contribution of nanotechnology research and China and Korea had the fastest growth rates. The largest institutional contributions were from the Chinese Academy of Sciences and the Russian Academy of Sciences. The high-impact papers generally described tools, theories, technologies, perspectives, and overviews of nanotechnology. From the top 20 institutions, based on the average number of paper citations in 1976-2004, 17 were in the Unites States, 2 in France and 1 in Germany. Content map analysis identified the evolution of the major topics researched from 1976 to 2004, including investigative tools, physical phenomena, and experiment environments. Both the country citation network and the institution citation network had relatively high clustering, indicating the existence of citation communities in the two networks, and specific patterns in forming citation communities. The United States, Germany, Japan, and China were major citation centers in nanotechnology research with close inter-citation relationships.

Closure report for underground storage tank 141-R3U1 and its associated underground piping

Energy Technology Data Exchange (ETDEWEB)

Mallon, B.J.; Blake, R.G.

1994-03-01

Underground storage tank UST 141-R3U1 at Lawrence Livermore National Laboratory (LLNL), was registered with the State Water Resources Control Board on June 27, 1984. This tank system consisted of a concrete tank, lined with polyvinyl chloride, and approximately 100 feet of PVC underground piping. UST 141-R3U1 had a capacity of 450 gallons. The underground piping connected three floor drains and one sink inside Building 141 to UST 141-R3U1. The wastewater collected in UST 141-R3U1 contained organic solvents, metals, and inorganic acids. On November 30, 1987, the 141-R3U1 tank system failed a precision tank test. The 141-R3U1 tank system was subsequently emptied and removed from service pending further precision tests to determine the location of the leak within the tank system. A precision tank test on February 5, 1988, was performed to confirm the November 30, 1987 test. Four additional precision tests were performed on this tank system between February 25, 1988, and March 6, 1988. The leak was located where the inlet piping from Building 141 penetrates the concrete side of UST 141-R3U1. The volume of wastewater that entered the backfill and soil around and/or beneath UST 141-R3U1 is unknown. On December 13, 1989, the LLNL Environmental Restoration Division submitted a plan to close UST 141-R3U1 and its associated piping to the Alameda County Department of Environmental Health. UST 141-R3U1 was closed as an UST, and shall be used instead as additional secondary containment for two aboveground storage tanks.

Closure report for underground storage tank 141-R3U1 and its associated underground piping

International Nuclear Information System (INIS)

Mallon, B.J.; Blake, R.G.

1994-03-01

Underground storage tank UST 141-R3U1 at Lawrence Livermore National Laboratory (LLNL), was registered with the State Water Resources Control Board on June 27, 1984. This tank system consisted of a concrete tank, lined with polyvinyl chloride, and approximately 100 feet of PVC underground piping. UST 141-R3U1 had a capacity of 450 gallons. The underground piping connected three floor drains and one sink inside Building 141 to UST 141-R3U1. The wastewater collected in UST 141-R3U1 contained organic solvents, metals, and inorganic acids. On November 30, 1987, the 141-R3U1 tank system failed a precision tank test. The 141-R3U1 tank system was subsequently emptied and removed from service pending further precision tests to determine the location of the leak within the tank system. A precision tank test on February 5, 1988, was performed to confirm the November 30, 1987 test. Four additional precision tests were performed on this tank system between February 25, 1988, and March 6, 1988. The leak was located where the inlet piping from Building 141 penetrates the concrete side of UST 141-R3U1. The volume of wastewater that entered the backfill and soil around and/or beneath UST 141-R3U1 is unknown. On December 13, 1989, the LLNL Environmental Restoration Division submitted a plan to close UST 141-R3U1 and its associated piping to the Alameda County Department of Environmental Health. UST 141-R3U1 was closed as an UST, and shall be used instead as additional secondary containment for two aboveground storage tanks

Status of the IEEE P896 Future Backplane Bus

International Nuclear Information System (INIS)

Gustavson, D.B.

1983-10-01

The IEEE P896 Future Backplane Bus project has been influenced by and has influenced FASTBUS and several other contemporary bus designs. This paper summarizes the current status of that project, which is directed toward the needs of modern 32-bit microprocessor systems with multiple processors. Some of the technology developed for P896 will be important for future non-ECL implementations of FASTBUS and other buses. In particular, new bus drivers and receivers should greatly improve the performance and reliability of backplane buses and cable buses. The current status of the P896 serial bus is also summarized

15th IEEE International Conference on Intelligent Engineering Systems

CERN Document Server

Živčák, Jozef; Aspects of Computational Intelligence Theory and Applications

2013-01-01

This volume covers the state-of-the art of the research and development in various aspects of computational intelligence and gives some perspective directions of development. Except the traditional engineering areas that contain theoretical knowledge, applications, designs and projects, the book includes the area of use of computational intelligence in biomedical engineering. „Aspects of Computational Intelligence: Theory and Applications” is a compilation of carefully selected extended papers written on the basis of original contributions presented at the 15th IEEE International Conference on Intelligent Engineering Systems 2011, INES 2011 held at June 23.-26. 2011 in AquaCity Poprad, Slovakia.    

Recommendations for Autonomous Industrial Vehicle Performance Standards

OpenAIRE

Bostelman , Roger

2016-01-01

International audience; A workshop was held at the IEEE International Conference on Robotics and Automation, called: “Autonomous Industrial Vehicles: From the Laboratory to the Factory Floor”. Nine research papers were presented followed by a discussion session summarized in this paper. The workshop findings are intended to be useful for developing standards within the ASTM F45 Committee for Driverless Automatic Industrial Vehicles. This paper provides feedback from the discussion listing the...

33 CFR 141.30 - Evidence of status as a resident alien.

Science.gov (United States)

2010-07-01

... alien. 141.30 Section 141.30 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Evidence of status as a resident alien. For the purposes of this part, the employer may accept as sufficient evidence that a person is a resident alien any one of the following documents and no others: (a) A...

Contrasting roles of the ABCG2 Q141K variant in prostate cancer

Energy Technology Data Exchange (ETDEWEB)

Sobek, Kathryn M. [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Cummings, Jessica L. [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Department of Critical Care Medicine, University of Pittsburgh, Pittsburgh, PA (United States); Bacich, Dean J. [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Department of Urology, University of Texas Health Science Center, San Antonio, TX (United States); O’Keefe, Denise S., E-mail: OKeefeD@uthscsa.edu [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Department of Urology, University of Texas Health Science Center, San Antonio, TX (United States)

2017-05-01

ABCG2 is a membrane transport protein that effluxes growth-promoting molecules, such as folates and dihydrotestosterone, as well as chemotherapeutic agents. Therefore it is important to determine how variants of ABCG2 affect the transporter function in order to determine whether modified treatment regimens may be necessary for patients harboring ABCG2 variants. Previous studies have demonstrated an association between the ABCG2 Q141K variant and overall survival after a prostate cancer diagnosis. We report here that in patients with recurrent prostate cancer, those who carry the ABCG2 Q141K variant had a significantly shorter time to PSA recurrence post-prostatectomy than patients homozygous for wild-type ABCG2 (P=0.01). Transport studies showed that wild-type ABCG2 was able to efflux more folic acid than the Q141K variant (P<0.002), suggesting that retained tumoral folate contributes to the decreased time to PSA recurrence in the Q141K variant patients. In a seemingly conflicting study, it was previously reported that docetaxel-treated Q141K variant prostate cancer patients have a longer survival time. We found this may be due to less efficient docetaxel efflux in cells with the Q141K variant versus wild-type ABCG2. In human prostate cancer tissues, confocal microscopy revealed that all genotypes had a mixture of cytoplasmic and plasma membrane staining, with noticeably less staining in the two homozygous KK patients. In conclusion, the Q141K variant plays contrasting roles in prostate cancer: 1) by decreasing folate efflux, increased intracellular folate levels result in enhanced tumor cell proliferation and therefore time to recurrence decreases; and 2) in patients treated with docetaxel, by decreasing its efflux, intratumoral docetaxel levels and tumor cell drug sensitivity increase and therefore patient survival time increases. Taken together, these data suggest that a patient's ABCG2 genotype may be important when determining a personalized treatment

A note on bound constraints handling for the IEEE CEC'05 benchmark function suite.

Science.gov (United States)

Liao, Tianjun; Molina, Daniel; de Oca, Marco A Montes; Stützle, Thomas

2014-01-01

The benchmark functions and some of the algorithms proposed for the special session on real parameter optimization of the 2005 IEEE Congress on Evolutionary Computation (CEC'05) have played and still play an important role in the assessment of the state of the art in continuous optimization. In this article, we show that if bound constraints are not enforced for the final reported solutions, state-of-the-art algorithms produce infeasible best candidate solutions for the majority of functions of the IEEE CEC'05 benchmark function suite. This occurs even though the optima of the CEC'05 functions are within the specified bounds. This phenomenon has important implications on algorithm comparisons, and therefore on algorithm designs. This article's goal is to draw the attention of the community to the fact that some authors might have drawn wrong conclusions from experiments using the CEC'05 problems.

Uplink capacity of multi-class IEEE 802.16j relay networks with adaptive modulation and coding

DEFF Research Database (Denmark)

Wang, Hua; Xiong, C; Iversen, Villy Bæk

2009-01-01

The emerging IEEE 802.16j mobile multi-hop relay (MMR) network is currently being developed to increase the user throughput and extend the service coverage as an enhancement of existing 802.16e standard. In 802.16j, the intermediate relay stations (RSs) help the base station (BS) communicate...... with those mobile stations (MSs) that are either too far away from the BS or placed in an area where direct communication with BS experiences unsatisfactory level of service. In this paper, we investigate the uplink Erlang capacity of a two-hop 802.16j relay system supporting both voice and data traffics...... with adaptive modulation and coding (AMC) scheme applied in the physical layer. We first develop analytical models to calculate the blocking probability in the access zone and the outage probability in the relay zone, respectively. Then a joint algorithm is proposed to determine the bandwidth distribution...

40 CFR 141.80 - General requirements.

Science.gov (United States)

2010-07-01

... service line replacement, and public education. These requirements are triggered, in some cases, by lead... requirements. (1) All water systems shall install and operate optimal corrosion control treatment as defined in... specified by the State under § 141.83. (f) Lead service line replacement requirements. Any system exceeding...

Non-natives: 141 scientists object

OpenAIRE

Simberloff, Daniel; Vilà, Montserrat

2011-01-01

Supplementary information to: Non-natives: 141 scientists object Full list of co-signatories to a Correspondence published in Nature 475, 36 (2011); doi: 10.1038/475036a. Daniel Simberloff University of Tennessee, Knoxville, Tennessee, USA. Jake Alexander Institute of Integrative Biology, Zurich, Switzerland. Fred Allendorf University of Montana, Missoula, Montana, USA. James Aronson CEFE/CNRS, Montpellier, France. Pedro M. Antunes Algoma University, Sault Ste. Marie, Onta...

A high-linearity InGaP/GaAs HBT power amplifier for IEEE 802.11a/n

International Nuclear Information System (INIS)

Cui Jie; Chen Lei; Kang Chunlei; Shi Jia; Zhang Xuguang; Ai Baoli; Liu Yi

2013-01-01

A three-stage 4.8–6 GHz monolithic power amplifier (PA) compatible with IEEE 802.11a/n designed based on an advanced 2 μm InGaP/GaAs hetero-junction bipolar transistor (HBT) process is presented. The PA integrates input matching and closed-loop power control circuits on chip. Under 3.3 V DC bias, the amplifier achieves a ∼31 dB small signal gain, excellent wide band input and output matching among overall 1.2 GHz bandwidth, and up to 24.5 dBm linear output power below EVM 3% with IEEE 802.11a 64QAM OFDM input signal. (semiconductor integrated circuits)

Design and implementation of an IEEE 802.11 baseband OFDM transceiver in 0.18 μm CMOS

International Nuclear Information System (INIS)

Wu Bin; Zhou Yumei; Zhu Yongxu; Zhang Zhengdong; Cai Jingjing

2011-01-01

An SISO IEEE 802.11 baseband OFDM transceiver ASIC is implemented. The chip can support all of the SISO IEEE 802.11 work modes by optimizing the key module and sharing the module between the transmitter and receiver. The area and power are decreased greatly compared with other designs. The baseband prototype has been verified under the WLAN baseband test equipment and through transferring the video. The 0.18 μm 1P/6M CMOS technology layout is finished and the chip is fabricated in SMIC, which occupies a 2.6 x 2.6 mm 2 area and consumes 83 mW under typical work modes. (semiconductor integrated circuits)

Design and implementation of an IEEE 802.11 baseband OFDM transceiver in 0.18 μm CMOS

Science.gov (United States)

Bin, Wu; Yumei, Zhou; Yongxu, Zhu; Zhengdong, Zhang; Jingjing, Cai

2011-05-01

An SISO IEEE 802.11 baseband OFDM transceiver ASIC is implemented. The chip can support all of the SISO IEEE 802.11 work modes by optimizing the key module and sharing the module between the transmitter and receiver. The area and power are decreased greatly compared with other designs. The baseband prototype has been verified under the WLAN baseband test equipment and through transferring the video. The 0.18 μm 1P/6M CMOS technology layout is finished and the chip is fabricated in SMIC, which occupies a 2.6 × 2.6 mm2 area and consumes 83 mW under typical work modes.

Design and implementation of an IEEE 802.11 baseband OFDM transceiver in 0.18 {mu}m CMOS

Energy Technology Data Exchange (ETDEWEB)

Wu Bin; Zhou Yumei; Zhu Yongxu; Zhang Zhengdong; Cai Jingjing, E-mail: wubin@ime.ac.cn [Institute of Microelectronics, Chinese Academy of Sciences, Beijing 100029 (China)

2011-05-15

An SISO IEEE 802.11 baseband OFDM transceiver ASIC is implemented. The chip can support all of the SISO IEEE 802.11 work modes by optimizing the key module and sharing the module between the transmitter and receiver. The area and power are decreased greatly compared with other designs. The baseband prototype has been verified under the WLAN baseband test equipment and through transferring the video. The 0.18 {mu}m 1P/6M CMOS technology layout is finished and the chip is fabricated in SMIC, which occupies a 2.6 x 2.6 mm{sup 2} area and consumes 83 mW under typical work modes. (semiconductor integrated circuits)

40 CFR 141.808 - Audits and inspections.

Science.gov (United States)

2010-07-01

... (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Aircraft Drinking Water Rule § 141.808 Audits and..., disinfection and flushing, and general maintenance and self-inspections of aircraft water system. (b) Air... delivery of safe drinking water. ...

Analysis of Adaptive Control Scheme in IEEE 802.11 and IEEE 802.11e Wireless LANs

Science.gov (United States)

Lee, Bih-Hwang; Lai, Hui-Cheng

In order to achieve the prioritized quality of service (QoS) guarantee, the IEEE 802.11e EDCAF (the enhanced distributed channel access function) provides the distinguished services by configuring the different QoS parameters to different access categories (ACs). An admission control scheme is needed to maximize the utilization of wireless channel. Most of papers study throughput improvement by solving the complicated multidimensional Markov-chain model. In this paper, we introduce a back-off model to study the transmission probability of the different arbitration interframe space number (AIFSN) and the minimum contention window size (CWmin). We propose an adaptive control scheme (ACS) to dynamically update AIFSN and CWmin based on the periodical monitoring of current channel status and QoS requirements to achieve the specific service differentiation at access points (AP). This paper provides an effective tuning mechanism for improving QoS in WLAN. Analytical and simulation results show that the proposed scheme outperforms the basic EDCAF in terms of throughput and service differentiation especially at high collision rate.

Annual report of Tandem Accelerator Center, University of Tsukuba, for fiscal 1976

International Nuclear Information System (INIS)

1977-01-01

A research center of the University of Tsukuba, Tandem Accelerator Center (TAC) has a 12 UD Pelletron tandem accelerator as its principal apparatus; of which acceptance test was finished in July 1976. Activities of the TAC for the period of April 1976 to March 1977 are reported: accelerator and beam transport system, general equipments, equipment development, nuclear physics, chemistry, and biological and medical Science. (Mori, K.)

Extending the IEEE 802.15.4 security suite with a compact implementation of the NIST P-192/B-163 elliptic curves.

Science.gov (United States)

de la Piedra, Antonio; Braeken, An; Touhafi, Abdellah

2013-07-29

Typically, commercial sensor nodes are equipped with MCUsclocked at a low-frequency (i.e., within the 4-12 MHz range). Consequently, executing cryptographic algorithms in those MCUs generally requires a huge amount of time. In this respect, the required energy consumption can be higher than using a separate accelerator based on a Field-programmable Gate Array (FPGA) that is switched on when needed. In this manuscript, we present the design of a cryptographic accelerator suitable for an FPGA-based sensor node and compliant with the IEEE802.15.4 standard. All the embedded resources of the target platform (Xilinx Artix-7) have been maximized in order to provide a cost-effective solution. Moreover, we have added key negotiation capabilities to the IEEE 802.15.4 security suite based on Elliptic Curve Cryptography (ECC). Our results suggest that tailored accelerators based on FPGA can behave better in terms of energy than contemporary software solutions for motes, such as the TinyECC and NanoECC libraries. In this regard, a point multiplication (PM) can be performed between 8.58- and 15.4-times faster, 3.40- to 23.59-times faster (Elliptic Curve Diffie-Hellman, ECDH) and between 5.45- and 34.26-times faster (Elliptic Curve Integrated Encryption Scheme, ECIES). Moreover, the energy consumption was also improved with a factor of 8.96 (PM).

Extending the IEEE 802.15.4 Security Suite with a Compact Implementation of the NIST P-192/B-163 Elliptic Curves

Directory of Open Access Journals (Sweden)

Abdellah Touhafi

2013-07-01

Full Text Available Typically, commercial sensor nodes are equipped with MCUsclocked at a low-frequency (i.e., within the 4–12 MHz range. Consequently, executing cryptographic algorithms in those MCUs generally requires a huge amount of time. In this respect, the required energy consumption can be higher than using a separate accelerator based on a Field-programmable Gate Array (FPGA that is switched on when needed. In this manuscript, we present the design of a cryptographic accelerator suitable for an FPGA-based sensor node and compliant with the IEEE802.15.4 standard. All the embedded resources of the target platform (Xilinx Artix-7 have been maximized in order to provide a cost-effective solution. Moreover, we have added key negotiation capabilities to the IEEE 802.15.4 security suite based on Elliptic Curve Cryptography (ECC. Our results suggest that tailored accelerators based on FPGA can behave better in terms of energy than contemporary software solutions for motes, such as the TinyECC and NanoECC libraries. In this regard, a point multiplication (PM can be performed between 8.58- and 15.4-times faster, 3.40- to 23.59-times faster (Elliptic Curve Diffie-Hellman, ECDH and between 5.45- and 34.26-times faster (Elliptic Curve Integrated Encryption Scheme, ECIES. Moreover, the energy consumption was also improved with a factor of 8.96 (PM.

Adaptive Radio Resource Allocation in Hierarchical QoS Scheduling for IEEE 802.16 Systems

DEFF Research Database (Denmark)

Wang, Hua; Dittmann, Lars

2007-01-01

Future mobile communication systems such as IEEE 802.16 are expected to deliver a variety of multimedia services with diverse QoS requirements. To guarantee the QoS provision, appropriate scheduler architecture and scheduling algorithms have to be carefully designed. In this paper, we propose...

40 CFR 141.551 - What strengthened combined filter effluent turbidity limits must my system meet?

Science.gov (United States)

2010-07-01

... effluent turbidity limits must my system meet? 141.551 Section 141.551 Protection of Environment... Effluent Requirements § 141.551 What strengthened combined filter effluent turbidity limits must my system meet? Your system must meet two strengthened combined filter effluent turbidity limits. (a) The first...

26 CFR 31.3401(a)(14)-1 - Group-term life insurance.

Science.gov (United States)

2010-04-01

...) EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE Collection of Income Tax at Source § 31.3401(a)(14)-1 Group-term life insurance. (a) The cost of... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Group-term life insurance. 31.3401(a)(14)-1...

Industrial Wireless Sensors: A User's Perspective on the Impact of Standards on Wide-spread Deployment

Energy Technology Data Exchange (ETDEWEB)

Taft, Cyrus W. [Taft Engineering, Inc.; Manges, Wayne W [ORNL; Sorge, John N [Southern Company Services, Inc.

2012-01-01

The role of wireless sensing technologies in industrial instrumentation will undoubtedly become more important in the years ahead. . Deployment of such instrumentation in an industrial setting with its heightened security and robustness criteria hinges on user acceptance of verified performance as well as meeting cost requirements. Today, industrial users face many choices when specifying a wireless sensor network, including radio performance, battery life, interoperability, security, and standards compliance. The potential market for industrial wireless sensors is literally millions of wireless instruments and it is imperative that accurate information for applying the technology to real-world applications be available to the end-user so that they can make informed deployment decisions. The majority of industrial wireless automation designs now being deployed or being considered for deployment are based on three different standards . The HART Communications Foundation s WirelessHART (IEC 62591), the International Society of Automation s ISA100.11a, and the offering from the Industrial Wireless Alliance of China known as WIA-PA (IEC 62601). Aside from these industrial automation standards, users must also be cognizant of the underlying wireless network standards IEEE 802.11, IEEE 802.15.4, and IEEE 802.15.3a and their interactions with the three principal industrial automation protocols mentioned previously. The crucial questions being asked by end users revolve around sensor network performance, interoperability, reliability, and security. This paper will discuss potential wireless sensor applications in power plants, barriers to the acceptance of wireless technology, concerns related to standards, and provide an end user prospective on the issues affecting wide-spread deployment of wireless sensors. Finally, the authors conclude with a discussion of a recommended path forward including how standards organizations can better facilitate end user decision making and

40 CFR 60.141a - Definitions.

Science.gov (United States)

2010-07-01

... steel production cycle are also included when the hot metal transfer station or skimming station is an... Process Steelmaking Facilities for Which Construction is Commenced After January 20, 1983 § 60.141a... amended or in subpart A of this part. Basic oxygen process furnace (BOPF) means any furnace with a...

40 CFR 141.721 - Reporting requirements.

Science.gov (United States)

2010-07-01

... operational data for toolbox options. Microbial Toolbox Reporting Requirements Toolbox option Systems must... coagulant (iv) At least 0.5-log mean reduction of influent turbidity or compliance with alternative State... treatment compliance date in § 141.713. (ii) If monthly average of daily max turbidity is greater than 1 NTU...

IEEE 1394 CAMERA IMAGING SYSTEM FOR BROOKHAVENS BOOSTER APPLICATION FACILITY BEAM DIAGNOSTICS

International Nuclear Information System (INIS)

BROWN, K.A.; FRAK, B.; GASSNER, D.; HOFF, L.; OLSEN, R.H.; SATOGATA, T.; TEPIKIAN, S.

2002-01-01

Brookhaven's Booster Applications Facility (BAF) will deliver resonant extracted heavy ion beams from the AGS Booster to short-exposure fixed-target experiments located at the end of the BAF beam line. The facility is designed to deliver a wide range of heavy ion species over a range of intensities from 10 3 to over 10 8 ions/pulse, and over a range of energies from 0.1 to 3.0 GeV/nucleon. With these constraints we have designed instrumentation packages which can deliver the maximum amount of dynamic range at a reasonable cost. Through the use of high quality optics systems and neutral density light filters we will achieve 4 to 5 orders of magnitude in light collection. By using digital IEEE1394 camera systems we are able to eliminate the frame-grabber stage in processing and directly transfer data at maximum rates of 400 Mb/set. In this note we give a detailed description of the system design and discuss the parameters used to develop the system specifications. We will also discuss the IEEE1394 camera software interface and the high-level user interface

Space research in the Netherlands 1976

International Nuclear Information System (INIS)

1977-06-01

The reports of the four working groups of the Netherlands Committee for Geophysics and Space Research are given for 1976. The research desribed includes the electromagnetic and particle radiation of the sun and stars, cosmic rays and non-solar X-and gamma-radiation, photometric observations in the far infrared and ultraviolet spectral regions and observational and geometric satellite geodesy. (Auth.)

Cancer mortality in Ireland, 1976-1986

International Nuclear Information System (INIS)

Seymour, C.; Herity, B.; Moriarty, M.J.

1989-01-01

This volume brings together in easily accessible form up-to-date mortality statistics for cancer for the Republic of Ireland. Because of small numbers in many of the malignant neoplasms studied rates and standardised mortality ratios have been calculated for the 11 year period 1976-86. Basic data only is presented, based on cancer type, location, sex and age group

14 CFR 141.41 - Flight simulators, flight training devices, and training aids.

Science.gov (United States)

2010-01-01

..., and training aids. 141.41 Section 141.41 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... aids. An applicant for a pilot school certificate or a provisional pilot school certificate must show that its flight simulators, flight training devices, training aids, and equipment meet the following...

Prompt nuclear analysis bibliography 1976

International Nuclear Information System (INIS)

Bird, J.R.; Campbell, B.L.; Cawley, R.J.

1978-05-01

A prompt nuclear analysis bibliography published in 1974 has been updated to include literature up to the end of 1976. The number of publications has more than doubled since mid-1973. The bibliography is now operated as a computer file and searches can be made on key words and parameters. Tables of references are given for each of the categories: backscattering, ion-ion, ion-gamma, ion-neutron, neutron-gamma, neutron-neutron and gamma-ray-induced reactions

Predictable and reliable ECG monitoring over IEEE 802.11 WLANs within a hospital.

Science.gov (United States)

Park, Juyoung; Kang, Kyungtae

2014-09-01

Telecardiology provides mobility for patients who require constant electrocardiogram (ECG) monitoring. However, its safety is dependent on the predictability and robustness of data delivery, which must overcome errors in the wireless channel through which the ECG data are transmitted. We report here a framework that can be used to gauge the applicability of IEEE 802.11 wireless local area network (WLAN) technology to ECG monitoring systems in terms of delay constraints and transmission reliability. For this purpose, a medical-grade WLAN architecture achieved predictable delay through the combination of a medium access control mechanism based on the point coordination function provided by IEEE 802.11 and an error control scheme based on Reed-Solomon coding and block interleaving. The size of the jitter buffer needed was determined by this architecture to avoid service dropout caused by buffer underrun, through analysis of variations in transmission delay. Finally, we assessed this architecture in terms of service latency and reliability by modeling the transmission of uncompressed two-lead electrocardiogram data from the MIT-BIH Arrhythmia Database and highlight the applicability of this wireless technology to telecardiology.

Temperature profile data collected using XBTs from the AUSTRAL RAINBOW from the Pacific Ocean during the Thermal Structure Monitoring Program in the Pacific (TRANSPAC) project, 1976-10-20 to 1976-10-23 (NODC Accession 8100228)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected using bathythermograph (BT/XBT) casts from AUSTRAL RAINBOW in the Pacific Ocean from October 20, 1976 to October 23, 1976....

IEEE Std 600: IEEE trial-use standard requirements for organizations that conduct qualification testing of safety systems equipment for use in nuclear power generating stations

International Nuclear Information System (INIS)

Anon.

1992-01-01

The purpose of this standard is to provide requirements for establishing a program for conducting qualification tests of safety systems equipment used in nuclear power generating stations. Compliance with the requirements of this standard does not assure the adequacy of the qualification tests performed. This standard applies to organizations that conduct qualification tests on equipment that has a definable safety function and is an identifiable part of a safety system for use in nuclear power generating stations. It requires a technical program, a quality assurance program, and a demonstrated ability to meet specified technical requirements. It does not apply to materials tests, production tests, normal performance testing, qualification by analysis, qualification by operating experience, or reliability tests such as diesel-generator multiple start tests. The intent of this standard is to achieve greater consistency, reliability, and reproducibility of test results and to provide adequate control of qualification testing of safety systems equipment

Real-Time-Simulation of IEEE-5-Bus Network on OPAL-RT-OP4510 Simulator

Science.gov (United States)

Atul Bhandakkar, Anjali; Mathew, Lini, Dr.

2018-03-01

The Real-Time Simulator tools have high computing technologies, improved performance. They are widely used for design and improvement of electrical systems. The advancement of the software tools like MATLAB/SIMULINK with its Real-Time Workshop (RTW) and Real-Time Windows Target (RTWT), real-time simulators are used extensively in many engineering fields, such as industry, education, and research institutions. OPAL-RT-OP4510 is a Real-Time Simulator which is used in both industry and academia. In this paper, the real-time simulation of IEEE-5-Bus network is carried out by means of OPAL-RT-OP4510 with CRO and other hardware. The performance of the network is observed with the introduction of fault at various locations. The waveforms of voltage, current, active and reactive power are observed in the MATLAB simulation environment and on the CRO. Also, Load Flow Analysis (LFA) of IEEE-5-Bus network is computed using MATLAB/Simulink power-gui load flow tool.

WIH-based IEEE 802.11 ECG monitoring implementation.

Science.gov (United States)

Moein, A; Pouladian, M

2007-01-01

New wireless technologies make possible the implementation of high level integration wireless devices which allow the replacement of traditional large wired monitoring devices. It offers new functionalities to physicians and will reduce the costs. Among these functionalities, biomedical signals can be sent to other devices (PDA, PC . . . ) or processing centers, without restricting the patients' mobility. This article discusses the WIH (Ward-In-Hand) structure and the software required for its implementation before an operational example is presented with its results. The aim of this project is the development and implementation of a reduced size electrocardiograph based on IEEE 802.11 with high speed and more accuracy, which allows wireless monitoring of patients, and the insertion of the information into the Wi-Fi hospital networks.