47 CFR 0.17 - Functions of the Office.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Functions of the Office. 0.17 Section 0.17 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMISSION ORGANIZATION Organization Office of Legislative Affairs § 0.17 Functions of the Office. The Office of Legislative Affairs is directly responsible...
16 CFR 0.17 - Bureau of Consumer Protection.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Bureau of Consumer Protection. 0.17 Section... ORGANIZATION § 0.17 Bureau of Consumer Protection. The Bureau investigates unfair or deceptive acts or..., and international agencies and organizations in consumer protection enforcement and regulatory matters...
FDIC Institution Directory (ID) -- Insured Insitution Download File
Federal Deposit Insurance Corporation — The FDIC's Institution Directory (ID) download file provides a list of all FDIC-insured institutions. The file includes demographic information related to the...
DEFF Research Database (Denmark)
Machida, S.; Tadakuma, T.; Satake, A.
2005-01-01
Stokes and anti-Stokes photoluminescence (AS-PL) has been investigated in a step-graded Inx(Al0.17Ga0.83)1–xAs/Al0.17Ga0.83As quantum-well (QW) heterostructure consisting of five QWs with different x values. Stokes PL spectra of this sample show a significant difference in PL intensity between...... the wells under indirect excitation conditions due to the existence of competitive resonant and nonresonant capture processes, while they exhibit a rather uniform PL intensity distribution under direct excitation. When the excitation wavelength is tuned to 810 nm for AS-PL detection, it is transparent...... is basically determined by the competitive capture of photoexcited carriers through the thick barriers, generated far from the five wells due to the nonlinear excitation processes in GaAs. ©2005 American Institute of Physics...
Energy Technology Data Exchange (ETDEWEB)
Lei, Dian; Wang, Wei; Gong, Xiao, E-mail: elegong@nus.edu.sg, E-mail: yeo@ieee.org; Liang, Gengchiau; Yeo, Yee-Chia, E-mail: elegong@nus.edu.sg, E-mail: yeo@ieee.org [Department of Electrical and Computer Engineering, National University of Singapore, Singapore 117576 (Singapore); Zhang, Zheng; Pan, Jisheng [Institute of Material Research and Engineering, A*STAR (Agency for Science, Technology and Research), 3 Research Link, Singapore 117602 (Singapore); Tok, Eng-Soon [Department of Physics, National University of Singapore, Singapore 117551 (Singapore)
2016-01-14
The effect of room temperature sulfur passivation of the surface of Ge{sub 0.83}Sn{sub 0.17} prior to high-k dielectric (HfO{sub 2}) deposition is investigated. X-ray photoelectron spectroscopy (XPS) was used to examine the chemical bonding at the interface of HfO{sub 2} and Ge{sub 0.83}Sn{sub 0.17}. Sulfur passivation is found to be effective in suppressing the formation of both Ge oxides and Sn oxides. A comparison of XPS results for sulfur-passivated and non-passivated Ge{sub 0.83}Sn{sub 0.17} samples shows that sulfur passivation of the GeSn surface could also suppress the surface segregation of Sn atoms. In addition, sulfur passivation reduces the interface trap density D{sub it} at the high-k dielectric/Ge{sub 0.83}Sn{sub 0.17} interface from the valence band edge to the midgap of Ge{sub 0.83}Sn{sub 0.17}, as compared with a non-passivated control. The impact of the improved D{sub it} is demonstrated in Ge{sub 0.83}Sn{sub 0.17} p-channel metal-oxide-semiconductor field-effect transistors (p-MOSFETs). Ge{sub 0.83}Sn{sub 0.17} p-MOSFETs with sulfur passivation show improved subthreshold swing S, intrinsic transconductance G{sub m,int}, and effective hole mobility μ{sub eff} as compared with the non-passivated control. At a high inversion carrier density N{sub inv} of 1 × 10{sup 13 }cm{sup −2}, sulfur passivation increases μ{sub eff} by 25% in Ge{sub 0.83}Sn{sub 0.17} p-MOSFETs.
DEFF Research Database (Denmark)
Machida, S.; Matsuo, M.; Fujiwara, K.
2002-01-01
Perpendicular motion of photoexcited electron and hole pairs assisted by phononscattering is investigated in a novel step-graded staircase heterostructure consisting of strained In-1(Al0.17Ga0.83)(1-x). As multiple quantum wells (QWs) with similar widths but five different x values by cw and time...... amplitude in the inter-mediate temperature range, These variations reveal that the photoexcited carriers directionally move from shallower to deeper QWs via phonon-assisted activation above the barrier hand edge state. The PL dynamics directly indicate the perpendicular flowing of photoexcited carriers...
International Nuclear Information System (INIS)
Gupta, A.; Gross, R.; Olsson, E.; Segmueller, A.; Koren, G.; Tsuei, C.C.
1990-01-01
Heteroepitaxial growth of strained multilayer thin films of YBa 2 Cu 3 O 7-δ /Nd 1.83 Ce 0.17 CuO x by pulsed-laser deposition is reported. The coherency strain results in biaxial compression of the tetragonal Nd 1.83 Ce 0.17 CuO x layers, whereas the biaxial tension in the YBa 2 Cu 3 O 7-δ layers removes the orthorhombic distortion and makes the unit cell isotropic in the basal plane (a=b). Depending on their oxygen content, either the YBa 2 Cu 3 O 7-δ or the Nd 1.83 Ce 0.17 CuO x layers are superconducting in these multilayers. The strain-induced structural modification has a significant influence on the superconducting transition temperature of the YBa 2 Cu 3 O 7-δ layers
17 CFR 17.02 - Form, manner and time of filing reports.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Form, manner and time of filing reports. 17.02 Section 17.02 Commodity and Securities Exchanges COMMODITY FUTURES TRADING... markets located in that time zone, and central time for information concerning all other markets. (b...
17 CFR 201.152 - Filing of papers: Form.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Filing of papers: Form. 201... PRACTICE Rules of Practice General Rules § 201.152 Filing of papers: Form. (a) Specifications. Papers filed... white paper measuring 81/2×11 inches, except that, to the extent that the reduction of larger documents...
Growth and transport properties of multilayer superconducting films of Nd1.83Co0.17CuOx/YBa2Cu3O7-δ
International Nuclear Information System (INIS)
Gupta, A.; Gross, R.; Olsson, E.; Segmuller, A.; Koren, G.
1990-01-01
This paper reports on strained multilayer thin films of YBa 2 Cu 3 O 7-δ /Nd 1.83 Ce 0.17 CuO x that have been prepared by laser ablation deposition. For individual layers below a critical layer thickness of about 250 Angstrom, coherency strain compresses the Nd 1.83 Ce 0.17 CuO x lattice and expands the YBa 2 Cu 3 O 7-δ lattice. The orthorhombic distortion in the YBa 2 Cu 3 O 7-δ layers is also removed. Depending on their oxygen content, either the YBa 2 Cu 3 O 7-δ , or the Nd 1.83 Ce 0.17 CuO x layers are superconducting in these multilayers. The strain-induced structural modification has a significant influence on the superconducting transition temperature and critical current density of the YBa 2 Cu 3 O 7-δ layers. Zero field critical current densities as high as 1.1 x 10 7 A/cm 2 at 77K have been measured for the YBa 2 Cu 3 O 7-δ layers
Photoluminescence characterization of GaAs/GaAs0.64P0.19Sb0.17/GaAs heterostructure
International Nuclear Information System (INIS)
Chen, J.Y.; Chen, B.H.; Huang, Y.S.; Chin, Y.C.; Tsai, H.S.; Lin, H.H.; Tiong, K.K.
2013-01-01
Interfacial characteristics of GaAs/GaAs 0.64 P 0.19 Sb 0.17 GaAs heterostructures and emission properties of a quaternary GaAs 0.64 P 0.19 Sb 0.17 layer were studied by excitation-power- and temperature-dependent photoluminescence (PL) measurements. The GaAs-to-GaAsPSb upper interface related emission feature and signals from GaAsPSb and GaAs were observed and characterized. The upper interface related emission peak was attributed to the radiative recombination of spatially separated electron–hole pairs and suggesting the type-II alignment at the GaAs/GaAsPSb interface. The localized excitonic emission feature of GaAsPSb revealed a blueshift due to the saturation effect of localized states and showed a fast thermal-quench with the increase of temperature. The temperature variation of the band edge emission signal of GaAsPSb was found to follow that of GaAs closely. -- Highlights: ► PL characterization of GaAs/GaAsPSb/GaAs heterostructure. ► Type-II alignment at the GaAs/GaAsPSb interface. ► Near-band-edge emission lines of GaAsPSb
21 CFR 17.31 - Form, filing, and service of papers.
2010-04-01
... 17.31 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL CIVIL MONEY PENALTIES HEARINGS § 17.31 Form, filing, and service of papers. (a) Form. (1) Documents filed with the Division of Dockets Management (HFA-305), Food and Drug Administration, 5630 Fishers Lane...
Conformal image-guided microbeam radiation therapy at the ESRF biomedical beamline ID17
International Nuclear Information System (INIS)
Donzelli, Mattia; Bräuer-Krisch, Elke; Nemoz, Christian; Brochard, Thierry; Oelfke, Uwe
2016-01-01
Purpose: Upcoming veterinary trials in microbeam radiation therapy (MRT) demand for more advanced irradiation techniques than in preclinical research with small animals. The treatment of deep-seated tumors in cats and dogs with MRT requires sophisticated irradiation geometries from multiple ports, which impose further efforts to spare the normal tissue surrounding the target. Methods: This work presents the development and benchmarking of a precise patient alignment protocol for MRT at the biomedical beamline ID17 of the European Synchrotron Radiation Facility (ESRF). The positioning of the patient prior to irradiation is verified by taking x-ray projection images from different angles. Results: Using four external fiducial markers of 1.7 mm diameter and computed tomography-based treatment planning, a target alignment error of less than 2 mm can be achieved with an angular deviation of less than 2 ∘ . Minor improvements on the protocol and the use of smaller markers indicate that even a precision better than 1 mm is technically feasible. Detailed investigations concerning the imaging dose lead to the conclusion that doses for skull radiographs lie in the same range as dose reference levels for human head radiographs. A currently used online dose monitor for MRT has been proven to give reliable results for the imaging beam. Conclusions: The ESRF biomedical beamline ID17 is technically ready to apply conformal image-guided MRT from multiple ports to large animals during future veterinary trials.
Conformal image-guided microbeam radiation therapy at the ESRF biomedical beamline ID17
Energy Technology Data Exchange (ETDEWEB)
Donzelli, Mattia, E-mail: donzelli@esrf.fr [European Synchrotron Radiation Facility, 71, Avenue des Martyrs, Grenoble 38000, France and The Institute of Cancer Research, 15 Cotswold Road, Sutton SM2 5NG (United Kingdom); Bräuer-Krisch, Elke; Nemoz, Christian; Brochard, Thierry [European Synchrotron Radiation Facility, 71, Avenue des Martyrs, Grenoble 38000 (France); Oelfke, Uwe [The Institute of Cancer Research, 15 Cotswold Road, Sutton SM2 5NG (United Kingdom)
2016-06-15
Purpose: Upcoming veterinary trials in microbeam radiation therapy (MRT) demand for more advanced irradiation techniques than in preclinical research with small animals. The treatment of deep-seated tumors in cats and dogs with MRT requires sophisticated irradiation geometries from multiple ports, which impose further efforts to spare the normal tissue surrounding the target. Methods: This work presents the development and benchmarking of a precise patient alignment protocol for MRT at the biomedical beamline ID17 of the European Synchrotron Radiation Facility (ESRF). The positioning of the patient prior to irradiation is verified by taking x-ray projection images from different angles. Results: Using four external fiducial markers of 1.7 mm diameter and computed tomography-based treatment planning, a target alignment error of less than 2 mm can be achieved with an angular deviation of less than 2{sup ∘}. Minor improvements on the protocol and the use of smaller markers indicate that even a precision better than 1 mm is technically feasible. Detailed investigations concerning the imaging dose lead to the conclusion that doses for skull radiographs lie in the same range as dose reference levels for human head radiographs. A currently used online dose monitor for MRT has been proven to give reliable results for the imaging beam. Conclusions: The ESRF biomedical beamline ID17 is technically ready to apply conformal image-guided MRT from multiple ports to large animals during future veterinary trials.
Directory of Open Access Journals (Sweden)
José Alberto Rodrigues Pedroso
2010-06-01
Full Text Available A síndrome de disfunção de múltiplos órgãos e sistemas (DMOS e a disfunção renal aguda compartilham muitos dos fatores fisiológicos envolvidos em seu desenvolvimento. Estudos recentes correlacionam suscetibilidades individuais, determinadas geneticamente, à disfunção de órgãos em pacientes criticamente enfermos, situação em que o gene da enzima conversora da angiotensina (ECA poderia ser um candidato para elucidar predisposição ou risco genético. Nosso objetivo foi examinar os efeitos da presença de dois polimorfismos, I/D e -262A > T, na disfunção renal em pacientes agudamente graves do Sul do Brasil. O escore SOFA (sequential organ failure assessment à admissão e a tendência da função renal (medida pelo escore renal diário do SOFA foram determinados em pacientes de unidade de terapia intensiva (UTI. Um total de 153 pacientes adultos (79 homens foi incluído no estudo. Houve monitoração diária da função renal durante toda a permanência na UTI e também pós-UTI. Observou-se a progressão para insuficiência renal (SOFA 3 e 4 nos primeiros sete dias de internação em UTI, bem como necessidade de diálise. As frequências genotípicas gerais em nossa amostra foram II = 0,17; ID = 0,46; DD = 0,37; e AA = 0,30; AT = 0,55; TT = 0,15; e as frequências alélicas foram I = 0,40, D = 0,60; e A = 0,56; T = 0,44. Este é o primeiro estudo para verificar a influência de polimorfismos I/D e -262A > T da ECA em disfunção renal aguda em pacientes críticos. Nenhuma associação significativa foi encontrada entre os genótipos ou as frequências alélicas e a evolução da função renal. Os polimorfismos I/D e -262A > T da ECA não têm impacto significativo sobre a evolução da função renal durante a primeira semana de internação na UTI nem exercem qualquer influência sobre a mortalidade em pacientes graves.Multiple organ failure syndrome and acute renal dysfunction share many of physiologic factors involved in
DEFF Research Database (Denmark)
Tadakuma, T.; Machida, S.; Satake, A.
2004-01-01
Photolumiscence (PL) and PL excitation (PLE) spectra of a novel step-graded strained Inx(Al0.17Ga0.83)1-xAs/Al0.17Ga0.83As multiple-quantum-well heterostructure consisting of five quantum wells with different x values have been investigated. Under indirect barrier excitation conditions a strongly...
2013-01-01
Background The use of microorganisms in the synthesis of nanoparticles emerges as an eco-friendly and exciting approach, for production of nanoparticles due to its low energy requirement, environmental compatibility, reduced costs of manufacture, scalability, and nanoparticle stabilization compared with the chemical synthesis. Results The production of gold nanoparticles by the thermophilic bacterium Geobacillus sp. strain ID17 is reported in this study. Cells exposed to Au3+ turned from colourless into an intense purple colour. This change of colour indicates the accumulation of intracellular gold nanoparticles. Elemental analysis of particles composition was verified using TEM and EDX analysis. The intracellular localization and particles size were verified by TEM showing two different types of particles of predominant quasi-hexagonal shape with size ranging from 5–50 nm. The mayority of them were between 10‒20 nm in size. FT-IR was utilized to characterize the chemical surface of gold nanoparticles. This assay supports the idea of a protein type of compound on the surface of biosynthesized gold nanoparticles. Reductase activity involved in the synthesis of gold nanoparticles has been previously reported to be present in others microorganisms. This reduction using NADH as substrate was tested in ID17. Crude extracts of the microorganism could catalyze the NADH-dependent Au3+ reduction. Conclusions Our results strongly suggest that the biosynthesis of gold nanoparticles by ID17 is mediated by enzymes and NADH as a cofactor for this biological transformation. PMID:23919572
Tetragonal-to-Tetragonal Phase Transition in Lead-Free (KxNa1−xNbO3 (x = 0.11 and 0.17 Crystals
Directory of Open Access Journals (Sweden)
Dabin Lin
2014-06-01
Full Text Available Lead free piezoelectric crystals of (KxNa1−xNbO3 (x = 0.11 and 0.17 have been grown by the modified Bridgman method. The structure and chemical composition of the obtained crystals were determined by X-ray diffraction (XRD and electron probe microanalysis (EPMA. The domain structure evolution with increasing temperature for (KxNa1−xNbO3 (x = 0.11 and 0.17 crystals was observed using polarized light microscopy (PLM, where distinguished changes of the domain structures were found to occur at 400 °C and 412 °C respectively, corresponding to the tetragonal to tetragonal phase transition temperatures. Dielectric measurements performed on (K0.11Na0.89NbO3 crystals exhibited tetragonal to tetragonal and tetragonal to cubic phase transitions temperatures at 405 °C and 496 °C, respectively.
17 CFR 201.153 - Filing of papers: Signature requirement and effect.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Filing of papers: Signature... COMMISSION RULES OF PRACTICE Rules of Practice General Rules § 201.153 Filing of papers: Signature... telephone number on every filing. (b) Effect of signature. (1) The signature of a counsel or party shall...
17 CFR 270.24b-3 - Sales literature deemed filed.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales literature deemed filed... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.24b-3 Sales literature deemed filed. Any advertisement, pamphlet, circular, form letter or other sales literature addressed to or intended...
CRED Gridded Bathymetry of West St. Rogatien Bank (100-017) in the Northwestern Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-017b is a 60-m ASCII grid of depth data collected near Kure Atoll in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced as part...
17 CFR 270.24b-2 - Filing copies of sales literature.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Filing copies of sales literature. 270.24b-2 Section 270.24b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... literature. Copies of material filed with the Commission for the sole purpose of complying with section 24(b...
17 CFR 240.12b-36 - Use of financial statements filed under other acts.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Use of financial statements... statements filed under other acts. Where copies of certified financial statements filed under other acts... manually signed or manually signed copies of the certificate shall be filed with the financial statements...
17 CFR 229.1003 - (Item 1003) Identity and background of filing person.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1003) Identity and background of filing person. 229.1003 Section 229.1003 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY AND...
46 CFR 160.017-13 - Construction.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Construction. 160.017-13 Section 160.017-13 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Chain Ladder § 160.017-13 Construction. (a) General. Each chain...
46 CFR 160.017-15 - Performance.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 160.017-15 Section 160.017-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Chain Ladder § 160.017-15 Performance. (a) Each chain ladder...
10 CFR 2.302 - Filing of documents.
2010-01-01
... this part shall be electronically transmitted through the E-Filing system, unless the Commission or... all methods of filing have been completed. (e) For filings by electronic transmission, the filer must... digital ID certificates, the NRC permits participants in the proceeding to access the E-Filing system to...
International Nuclear Information System (INIS)
Rogge, R.B.; Gaulin, B.D.; Harrison, A.
1992-01-01
Neutron scattering measurements have been performed on a single crystal sample of CsCo 0.83 Mg 0.17 Br 3 , a quasi-one-dimensional, Ising-like antiferromagnet. Residual three-dimensional interactions between the dilute magnetic chains precipitate a phase transition to long range order at T N ∼ 8.5 K, and short range correlations persist as high as 40 K. Relatively high energy inelastic scattering from both ''bulk'' spin wave modes and ''end'' modes is observed from the finite chains. The low energy inelastic spectrum is dominated by soliton scattering due to anti-phase domain walls propagating along the finite chains
Energy Technology Data Exchange (ETDEWEB)
Mohamed, Za, E-mail: zaineb.mohamed24@yahoo.fr [Laboratoire de Physique de la matière condensée et des nanosciences, Faculté des Sciences, 5019, Université de Monastir (Tunisia); Tka, E.; Dhahri, J. [Laboratoire de Physique de la matière condensée et des nanosciences, Faculté des Sciences, 5019, Université de Monastir (Tunisia); Hlil, E.K. [Institut Néel, CNRS et Université Joseph Fourrier, B.P. 166, B.P.W-38042 Grenoble Cedex 9 (France)
2014-12-05
Highlights: • La{sub 0.67}Sr{sub 0.16}Ca{sub 0.17}MnO{sub 3} sample was prepared by solid state method. • La{sub 0.67}Sr{sub 0.16}Ca{sub 0.17}MnO{sub 3} crystallizes in a rhombohedral R3{sup ‾}c structure. • The variation of (M) vs. (T) reveals a (FM) to (PM) phase transition around T{sub C}. • The magnetocaloric effect is studied and the |ΔS{sub M}{sup max}| and RCP are determined. - Abstract: Structural, magnetic and magnetocaloric properties of La{sub 0.67}Sr{sub 0.16}Ca{sub 0.17}MnO{sub 3} perovskite have been studied. A solid state reaction method was used in the preparation phase. X-ray diffraction analysis using Rietveld refinement revealed that this sample crystallizes in the distorted rhombohedral system with R3{sup ‾}c space group. The variation of magnetization (M) vs. temperature (T), under an applied magnetic field of 0.05T, revealed a transition from a ferromagnetic (FM) to paramagnetic (PM) phase at around Curie temperature (T{sub C} = 336 K). Using Arrott plots, it was found that the transition is of a second-order. Isothermal measurements of magnetization allow us, through thermodynamic Maxwell relations, to determine the magnetic entropy change (ΔS{sub M}). A large ΔS{sub M} deduced from isothermal magnetization curves, has been observed in our sample with a peak centered around its respective T{sub C}. The maximum of the magnetic entropy change ΔS{sub M}{sup max} in a magnetic field change of 5T is found to be 5.51 J kg{sup −1} K{sup −1} at 335 K. In addition, the compound showed a large relative cooling power (RCP) value of about 234 J/kg while the maximum refrigerant capacity of 174 J/kg was attained at the applied field of 5T. As a result, the studied sample can be considered as a potential material for magnetic refrigeration.
Causes of Mortality in Older People with Intellectual Disability: Results from the HA-ID Study
Oppewal, Alyt; Schoufour, Josje D.; van der Maarl, Hanne J. K.; Evenhuis, Heleen M.; Hilgenkamp, Thessa I. M.; Festen, Dederieke A.
2018-01-01
We aim to provide insight into the cause-specific mortality of older adults with intellectual disability (ID), with and without Down syndrome (DS), and compare this to the general population. Immediate and primary cause of death were collected through medical files of 1,050 older adults with ID, 5 years after the start of the Healthy Ageing and…
Development of data file system for cardiovascular nuclear medicine
International Nuclear Information System (INIS)
Hayashida, Kohei; Nishimura, Tsunehiko; Uehara, Toshiisa; Nisawa, Yoshifumi.
1985-01-01
A computer-assisted filing system for storing and processing data from cardiac pool scintigraphy and myocardial scintigraphy has been developed. Individual patient data are stored with his (her) identification number (ID) into floppy discs successively in order of receiving scintigraphy. Data for 900 patients can be stored per floppy disc. Scintigraphic findings can be outputted in a uniform file format, and can be used as a reporting format. Output or retrieval of filed individual patient data is possible according to each examination, disease code or ID. This system seems to be used for prospective study in patients with cardiovascular diseases. (Namekawa, K.)
STS-26 Commander Hauck in fixed based (FB) shuttle mission simulator (SMS)
1988-01-01
STS-26 Discovery, Orbiter Vehicle (OV) 103, Commander Frederick H. Hauck, wearing comunications kit assembly headset and seated in the commanders seat on forward flight deck, looks over his shoulder toward the aft flight deck. A flight data file (FDF) notebook rests on his lap. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.
Daozhen, Chen; Lu, Liu; Min, Yang; Xinyu, Jiang; Ying, Huang
2007-10-01
The aim of this study was to examine the radioiodinating condition of 17-allylamino-17-demethoxy geldanamycin (17-AAG) and observe its biodistribution in the hepatoma cell line HepA tumorearing ICR mice for understanding the possibility of its application in nuclear medicine. [(131)I]iodo-17-AAG was prepared by the reaction of 17-AAG with Na[(131)I] in the presence of hydrogen peroxide. [(131)I]iodo-17-AAG was purified by high-performance liquid chromatography (HPLC). The stability of [(131)I]iodo-17-AAG was measured by thin-layer chromatography (TLC). The distributions in HepA tumor-bearing ICR mice at 0.5, 1, 4, 8, 24, and 48 hours after injection of [(131)I]iodo-17-AAG were measured. Tumor uptake studies were performed in HepA tumor-bearing ICR mice. The labeling yield was over 83%. The radiochemical purity of [(131)I]iodo-17-AAG was 99.6% after purification. The specific activity was greater than 4 Ci/micromol. The labeled compound was stable for at least 120 hours in saline at 4 degrees C. It was initially in blood at 5 minutes with 4.79% of injected dose per g of tissue (%ID/g), and then dropped 0.33% ID/g at 24 hours. The uptake in liver, lung, and kidney at 4.44% ID/g, 2.03% ID/g, and 2.17% ID/g decreased with time, and less than 1% ID/g was measured after 24 hours in those organs. There was rapid tumor uptake, which reached 1.26% ID/g at 0.5 hours, the highest uptake at 8 hours. Yet, the [(131)I]iodo-17-AAG in the contralateral muscle was at a low level during the 48 hours. The tumor-contralateral muscle (T/CM) radioactivity ratio for [(131)I]iodo-17-AAG remained constant at all time points. [(131)I]iodo-17-AAG can be efficiently radiolabeled at high specific activity, purified by HPLC and stored with little radiolysis at this specific activities. [(131)I]iodo-17-AAG is a promising radiopharmaceutical in nuclear medicine, especially for tumor-targeted radionuclide brachytherapy.
17 CFR 230.433 - Conditions to permissible post-filing free writing prospectuses.
2010-04-01
... writing prospectus used at the same time as a communication in a business combination transaction subject... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Conditions to permissible post... Prospectuses § 230.433 Conditions to permissible post-filing free writing prospectuses. (a) Scope of section...
Applying Open Researchers and Contributors ID in scholarly journals
Directory of Open Access Journals (Sweden)
Jeonghee Im
2015-02-01
Full Text Available Open Researchers and Contributors ID (ORCID launched its registry services in October 2012. Consequently, adding personal information to the ORCID registry became routine work for researchers. To add ORCID to an online article, the tag needs to be included in the Journal Article Tag Suite extensible markup language file, if such a file has been produced by the publisher. Subsequently, all co-authors’ ORCID can be easily and conveniently collected and then integrated into the manuscript management system. In the current age of information and the Internet, journals need to keep pace with the surge of new standards and technologies. Editors should be able to accept and apply these new systems rapidly.
77 FR 26538 - Vigue, Peter A.; Notice of Filing
2012-05-04
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6627-001] Vigue, Peter A.; Notice of Filing Take notice that on April 26, 2012, Peter A. Vigue submitted for filing, a supplement to the application for authority to hold interlocking positions filed on March 6, 2012, pursuant to...
Zand, Vahid; Mokhtari, Hadi; Reyhani, Mohammad-Frough; Nahavandizadeh, Neda; Azimi, Shahram
2017-11-01
The aim of the present study was to compare the amount of the smear layer remaining in prepared root canals with different protocols of Bio RaCe files and XP-endo Finisher file (XPF) in association with 17% EDTA and sodium hypochlorite solution. A total of 68 extracted single-rooted teeth were randomly divided into 4 experimental groups (n=14) and two control groups (n=6). The root canals were prepared with Bio RaCe files (FKG Dentaire, Switzerland) using the crown-down technique based on manufacturer's instructions and irrigated according to the following irrigation techniques: Group 1: XPF with 2 mL of 2.5% NaOCl for 1 minute. Group 2:, XPF with 1 mL of 17% EDTA for one minute. Group 3: XPF was used for 1 minute in association with normal saline solution. Group 4: XP-endo Finisher file for 30 seconds in association with 2.5% NaOCl and 17% EDTA for 30 seconds. The negative control group: NaOCl (2.5%) was used during root canal preparation, followed by irrigation with 17% EDTA at the end of root canal preparation. The positive control group: Normal saline solution was used for irrigation during root canal preparation. In all the groups, during preparation of the root canals with Bio RaCe file, 20 mL of 2.5% NaOCl was used for root canal irrigation and at the end of the procedural steps 20 mL of normal saline solution was used as a final irrigant. The samples were analyzed under SEM at ×1000‒2000 magnification and evaluated using Torabinejad scoring system. Data were analyzed with non-parametric Kruskal-Wallis test and post hoc Mann-Whitney U test, using SPSS. Statistical significant was defined at P <0.05. The results of the study showed the least amount of the smear layer at coronal, middle and apical thirds of the root canals in groups 2, which was not significantly different from the negative control group ( P <0.5). Under the limitations of the present study, use of a combination of NaOCl and EDTA in association with XPF exhibited the best efficacy for the
International Nuclear Information System (INIS)
Sharma, Pankaj; Patel, Divya; Chaudhary, Jaideep
2012-01-01
As transcriptional regulators of basic helix–oop–helix (bHLH) transcription and non-bHLH factors, the inhibitor of differentiation (Id1, Id2, Id3, and Id4) proteins play a critical role in coordinated regulation of cell growth, differentiation, tumorigenesis, and angiogenesis. Id1 regulates prostate cancer (PCa) cell proliferation, apoptosis, and androgen independence, but its clinical significance in PCa remains controversial. Moreover, there is lack of evidence on the expression of Id2 and Id3 in PCa progression. In this study we investigated the expression of Id2 and Id3 and reevaluated the expression of Id1 in PCa. We show that increased Id1 and Id3 protein expression is strongly associated with increasing grade of PCa. At the molecular level, we report that silencing either Id1 or Id3 attenuates cell cycle. Although structurally and mechanistically similar, our results show that both these proteins are noncompensatory at least in PCa progression. Moreover, through gene silencing approaches we show that Id1 and Id3 primarily attenuates CDKN1A (p21) and CDKN1B (p27), respectively. We also demonstrate that silencing Id3 alone significantly attenuates proliferation of PCa cells as compared with Id1. We propose that increased Id1 and Id3 expression attenuates all three cyclin-dependent kinase inhibitors (CDKN2B, -1A, and -1B) resulting in a more aggressive PCa phenotype
75 FR 4061 - Favinger, Thomas; Notice of Filing
2010-01-26
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6223-000] Favinger, Thomas; Notice of Filing January 19, 2010. Take notice that on January 15, 2010, Mr. Thomas G. Favinger filed an application for authority to hold interlocking positions, pursuant to section 305(b) of the...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 35647 was deployed in the region of American Samoa to assess ocean currents and sea surface temperature. SVP drifter data files contain...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 35649 was deployed in the region of American Samoa to assess ocean currents and sea surface temperature. SVP drifter data files contain...
CRED APEX Drifting Buoy Argos_ID 26070 Data in the NW Hawaiian Islands, the Pacific Ocean
National Oceanic and Atmospheric Administration, Department of Commerce — CRED APEX drifter Argos_ID 26070 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. APEX drifter data files...
A comparison of apical transportation between FlexMaster and Twisted Files rotary instruments.
Duran-Sindreu, Fernando; García, Marc; Olivieri, Juan Gonzalo; Mercadé, Montse; Morelló, Sergio; Roig, Miguel
2012-07-01
The aim of this study was to evaluate apical transportation in root canals after the use of Twisted Files (TF; SybronEndo, Orange, CA) and FlexMaster (VDW, Munich, Germany) #40/04 rotary files. A double-digital radiographic technique was used to compare apical transportation between the TF and FlexMaster systems. Each rotary system was used to instrument mesial canals from 80 extracted mandibular molars. The central axes of the file imaged before instrumentation (#15 K-file) and the master apical rotary file (#40/04) were superimposed digitally. AutoCAD 2008 (Autodesk Inc, San Rafael, CA) was used to measure apical transportation at 0.5 mm from the working length (WL). The data were analyzed using the Student's t test, and significance was set at P < .05. The mean amount of apical transportation at 0.5 mm from the WL was 0.17 ± 0.09 mm for the FlexMaster group and 0.19 ± 0.12 mm for the TF group. No statistically significant differences in apical transportation were found between the 2 groups. Under the conditions of the study, no statistically significant differences in apical transportation were observed between FlexMaster and TF rotary files. Copyright © 2012 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.
Kurzawińska, Grażyna; Barlik, Magdalena; Drews, Krzysztof; Różycka, Agata; Seremak-Mrozikiewicz, Agnieszka; Ożarowski, Marcin; Klejewski, Andrzej; Czerny, Bogusław; Wolski, Hubert
2016-01-01
Recurrent miscarriage (RM) is one of the most common obstetric complications. Numerous studies have suggested that genetic variants leading to an impaired balance between coagulation and fibrinolysis may contribute to elevated risk of pregnancy loss. The aim of the study was to investigate a possible association between angiotensin-converting enzyme (ACE, rs1799752) I/D and plasminogen activator inhibitor type 1 (PAI-1, rs1799768) 4G/5G polymorphisms with RM among Polish women. DNA was extracted from peripheral blood samples of 152 women with a history of ≥ 2 consecutive pregnancy losses before 22 weeks of gestation, and 180 healthy controls with at least 1 live birth at term and no history of pregnancy loss. Polymerase chain reaction (PCR) and restriction fragment length polymorphism (RFLP) were used to identify the polymorphisms. No statistically significant differences were found in genotype and allele frequencies of the studied polymorphisms. The most relevant difference between the study group and controls was found for the ID genotype distribution of the ACE gene (52.6 vs. 46.7%, OR = 1.27, p = 0.28). The analysis of genotype coexistence revealed a higher incidence of the combination of the ACE II and the PAI-1 4G/4G genotypes in the control group (10.0 vs.5.9% in control group; p = 0.17). The obtained results suggest no apparent association between the ACE I/D, PAI-1 4G/5G polymorphisms and increased RM susceptibility in the analyzed Polish population.
77 FR 76476 - Combined Notice of Filings #1
2012-12-28
.... Comments Due: 5 p.m. ET 1/8/13. Docket Numbers: ER13-573-000. Applicants: CMS Energy Resource Management.... submits tariff filing per 35.13(a)(2)(iii: First Revised Service Agreement No. 3279; Queue No. X1-046 to...
75 FR 68350 - Fischer, Thomas J.; Notice of Filing
2010-11-05
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6422-000] Fischer, Thomas J.; Notice of Filing October 29, 2010. Take notice that on October 29, 2010, Thomas J. Fischer filed an Application for Authorization to Hold Interlocking Positions as Director of Wisconsin Electric...
STS-69 Flight Day 9 Video File
1995-01-01
The song, 'He's A Tramp', from the Walt Disney cartoon movie, 'Lady and the Tramp', awakened the astronauts, Cmdr. Dave Walker, Pilot Ken Cockrell, and Mission Specialists Jim Voss, Jim Newman, and Mike Gernhardt, on the ninth day of the STS-69 mission. The Wake Shield Facility (WSF) was again unberthed from the shuttle cargo bay and , using the shuttle's robot arm, held over the side of the shuttle for five hours where it collected data on the electrical field build-up around the spacecraft as part of the Charging Hazards and Wake Studies Experiment (CHAWS). Voss and Gernhardt rehearsed their Extravehicular Activity (EVA) spacewalk, which was planned for the next day. Earth views included cloud cover, a hurricane, and its eye.
2012-02-29
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project Nos. 13824-000, 13826-000] FFP Missouri 17, LLC BOST2 Hydroelectric, LLC; Notice Announcing Filing Priority for Preliminary Permit... Hydroelectric, LLC, Project No. 13826-000. 2. FFP Missouri 17, LLC, Project No. 13824-000. Dated: February 22...
Critical current density of strained multilayer thin films of Nd1.83Ce0.17CuOx/YBa2Cu3O7-δ
International Nuclear Information System (INIS)
Gross, R.; Gupta, A.; Olsson, E.; Segmueller, A.; Koren, G.
1990-01-01
The superconducting transport properties of strained multilayer thin films of YBa 2 Cu 3 O 7-δ / Nd 1.83 Ce 0.17 CuO x , grown heteroepitaxially by laser ablation deposition, are reported. For individual layer thicknesses below a critical layer thickness of about 250 A, coherency strain removes the orthorhombic distortion in the YBa 2 Cu 3 O 7-δ layers and makes them twin-free. Zero-field critical current densities as high as 1.1x10 7 A/cm 2 at 77 K have been measured for the YBa 2 Cu 3 O 7-δ layers. Flux pinning energies at zero temperature and zero magnetic field in the range of 80--140 meV have been found
Magnetoresistance anisotropy of ultrathin epitaxial La0.83Sr0.17MnO3 films
Balevičius, Saulius; Tornau, Evaldas E.; ŽurauskienÄ--, Nerija; Stankevič, Voitech; Šimkevičius, Česlovas; TolvaišienÄ--, Sonata; PlaušinaitienÄ--, Valentina; Abrutis, Adulfas
2017-12-01
We present the study of temperature dependence of resistivity (ρ), magnetoresistance (MR), and magnetoresistance anisotropy (AMR) of thin epitaxial La0.83Sr0.17MnO3 films. The films with thickness from 4 nm to 140 nm were grown on an NdGaO3 (001) substrate by a pulsed injection metal organic chemical vapor deposition technique. We demonstrate that the resistivity of these films significantly increases and the temperature Tm of the resistivity maximum in ρ(T) dependence decreases with the decrease of film thickness. The anisotropy of ρ(T) dependence with respect to the electrical current direction along the [100] or [010] crystallographic axis of the film is found for ultrathin films (4-8 nm) at temperatures close to Tm. Both MR and AMR, measured in magnetic fields up to 0.7 T applied in the film plane parallel and perpendicular to the current direction, have shown strong dependence on the film thickness. It was also found that the anisotropy of magnetoresistance could change its sign from positive (thicker films) to negative (ultrathin films) and obtain very small values at a certain intermediate thickness (20 nm) when the current is flowing perpendicular to the easy magnetization axis [010]. While the positive AMR effect was assigned to the conventional magnetic ordering of manganites, the AMR of ultrathin films was influenced by the pinning of magnetization to the easy axis. The temperature dependence and change of the AMR sign with film thickness is shown to be well described by the two-region model (more strained closer to the film substrate and more relaxed further from it) assuming that the relative concentration of both regions changes with the film thickness. The possibility to use the effect of the AMR compensation for the development of scalar in-plane magnetic field sensors is discussed.
75 FR 10244 - Ellsworth, David C.; Notice of Filing
2010-03-05
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-3716-001] Ellsworth, David C.; Notice of Filing February 25, 2010. Take notice that on February 12, 2010, David C. Ellsworth filed an informational report for authority to hold interlocking positions, pursuant to section 45.9 of...
76 FR 9012 - Favinger, Thomas G.; Notice of Filing
2011-02-16
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6223-002] Favinger, Thomas G.; Notice of Filing Take notice that on January 31, 2011 Thomas G. Favinger submitted for filing, an application for authority to hold interlocking positions, pursuant to Section 305(b) of the...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 35651 was deployed in the region of American Samoa to assess ocean currents and sea surface temperature. SVP drifter data files contain...
Now called RSA SecurID, SecurID is a mechanism developed by Security Dynamics that allows two-factor authentication for a user on a network resource. It works on the principle of the unique password mode, based on a shared secret. Every sixty seconds, the component generates a new six-digit token on the screen. The latter comes from the current time (internal clock) and the seed (SecurID private key that is available on the component, and is also from the SecurID server). During an authentication request, the SecurID server will check the entered token by performing exactly the same calculation as that performed by your component. The server knows the two information required for this calculation: the current time and the seed of your component. Access is allowed if the token calculated by the server matches the token you specified.
77 FR 21555 - Manning, Richard W.; Notice of Filing
2012-04-10
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6835-001] Manning, Richard W.; Notice of Filing Take notice that on April 2, 2012, Richard W. Manning submitted for filing... not serve to make protestants parties to the proceeding. Any person wishing to become a party must...
76 FR 21889 - Lasky, Charles D.; Notice of Filing
2011-04-19
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-4962-007] Lasky, Charles D.; Notice of Filing Take notice that on April 12, 2011, Charles D. Lasky submitted for filing an... the Commission's Rules of Practice and Procedure (18 CFR 385.211, 385.214). Protests will be...
77 FR 14773 - Vigue, Peter A.; Notice of Filing
2012-03-13
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6627-001] Vigue, Peter A.; Notice of Filing Take notice that on March 6, 2012, Peter A. Vigue submitted for filing, an application for authority to hold interlocking positions, pursuant to section 305(b) of the Federal Power Act, 16...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 28638 was deployed in the region of Marianas Archipelago to assess ocean currents and sea surface temperature. SVP drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 29099 was deployed in the region of Marianas Archipelago to assess ocean currents and sea surface temperature. SVP drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED APEX drifter Argos_ID 25321 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. APEX drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 30291 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED APEX drifter Argos_ID 24963 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. APEX drifter data files...
76 FR 19350 - Truax, Hal D.; Notice of Filing
2011-04-07
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6528-000] Truax, Hal D.; Notice of Filing Take notice that on April 1, 2011, Hal D. Truax submitted for filing, an application for authority to hold interlocking positions, pursuant to section 305(b) of the Federal Power Act, 16 U.S.C...
2011-11-10
... SECURITIES AND EXCHANGE COMMISSION [Release No. 34-65694; File No. SR-BATS-2011-046] Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. November 4, 2011. Pursuant to Section 19(b)(1) of...
idSpace Tooling and Training for collaborative distributed product innovation
Rutjens, Marjo; Bitter-Rijpkema, Marlies; Grube, Pascal; Heider, Thomas
2009-01-01
Rutjens, M., Bitter-Rijpkema, M., Grube, P. P., & Heider, T. (2009). idSpace Tooling and Training for collaborative distributed product innovation. Workshop during the e-Learning Baltic conference. June, 17-19, 2009, Rostock, Germany.
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 29103 was deployed in the region of Marianas Archipelago to assess ocean currents and sea surface temperature. SVP drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 44770 was deployed in the region of American Samoa to assess ocean currents and sea surface temperature. SVP drifter data files contain...
76 FR 76710 - Merritt, Beck C.; Notice of Filing
2011-12-08
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6730-000] Merritt, Beck C.; Notice of Filing Take notice that on December 1, 2011, Beck C. Merritt submitted for filing, an..., 16 U.S.C. 825d (b) and Part 45 of Title 18 of the Code of Federal Regulations, 18 CFR part 45. Any...
78 FR 12307 - Taylor, G. Tom; Notice of Filing
2013-02-22
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-5705-001] Taylor, G. Tom; Notice of Filing Take notice that on February 14, 2013, G. Tom Taylor filed an application to hold interlocking positions pursuant to section 305(b) of the Federal Power Act, 16 U.S.C. 825d(b), Part 45 of the...
The Varied Variability of PKS 0736+017
Clements, S. D.; Cubides, L. A.; Greiwe, C. L.; Habermas, K. S.; Jenks, A. K.; Long, A. M.; Patel, J. A.; Torres, Y. V.
2003-05-01
The flat spectrum radio quasar PKS 0736+017 has been an exciting observing target, exhibiting diverse optical variability behaviors and even sharing its field one evening with a minor planet. The behavior of PKS 0736+017 has included persistently faint and quiescent periods, episodes of quasi-periodic microvariability, dramatic flaring events, and periods of unusual oscillations. These assorted behaviors are examined, with particular emphasis on the quasi-periodic variations and unusual oscillations that accompanied a dramatic flare.
International Nuclear Information System (INIS)
Dickens, J.K.
1990-03-01
Graphical comparisons of recently obtained experimental beta-ray spectra with predicted beta-ray spectra based on the Evaluated Nuclear Structure Data File are exhibited for 77 fission products having masses 79--99 and 130--146 and lifetimes between 0.17 and 23650 sec. The comparisons range from very poor to excellent. For beta decay of 47 nuclides, estimates are made of ground-state transition intensities. For 14 cases the value in ENSDF gives results in very good agreement with the experimental data. 12 refs., 77 figs., 1 tab
Imipenem Resistance in Clostridium difficile Ribotype 017, Portugal
Isidro, Joana; Santos, Andrea; Nunes, Alexandra; Borges, Vítor; Silva, Catarina; Vieira, Luís; Mendes, Aristides L.; Serrano, Mónica; Henriques, Adriano O.; Gomes, João Paulo
2018-01-01
We describe imipenem-resistant and imipenem-susceptible clinical isolates of Clostridium difficile ribotype 017 in Portugal. All ribotype 017 isolates carried an extra penicillin-binding protein gene, pbp5, and the imipenem-resistant isolates had additional substitutions near the transpeptidase active sites of pbp1 and pbp3. These clones could disseminate and contribute to imipenem resistance. PMID:29553322
A functionally significant polymorphism in ID3 is associated with human coronary pathology.
Directory of Open Access Journals (Sweden)
Ani Manichaikul
Full Text Available We previously identified association between the ID3 SNP rs11574 and carotid intima-media thickness in the Diabetes Heart Study, a predominantly White diabetic population. The nonsynonymous SNP rs11574 results in an amino acid substitution in the C-terminal region of ID3, attenuating the dominant negative function of ID3 as an inhibitor of basic HLH factor E12-mediated transcription. In the current investigation, we characterize the association between the functionally significant polymorphism in ID3, rs11574, with human coronary pathology.The Multi-Ethnic Study of Atherosclerosis (MESA is a longitudinal study of subclinical cardiovascular disease, including non-Hispanic White (n = 2,588, African American (n = 2,560 and Hispanic (n = 2,130 participants with data on coronary artery calcium (CAC. The Coronary Assessment in Virginia cohort (CAVA included 71 patients aged 30-80 years, undergoing a medically necessary cardiac catheterization and intravascular ultrasound (IVUS at the University of Virginia. ID3 SNP rs11574 risk allele was associated with the presence of CAC in MESA Whites (P = 0.017. In addition, the risk allele was associated with greater atheroma burden and stenosis in the CAVA cohort (P = 0.003, P = 0.04 respectively. The risk allele remained predictive of atheroma burden in multivariate analysis (Model 1: covariates age, gender, and LDL, regression coefficient = 9.578, SE = 3.657, p = 0.0110; Model 2: covariates Model 1, presence of hypertension, presence of diabetes, regression coefficient = 8.389, SE = 4.788, p = 0.0163.We present additional cohorts that demonstrate association of ID3 SNP rs11574 directly with human coronary artery pathology as measured by CAC and IVUS: one a multiethnic, relatively healthy population with low levels of diabetes and the second a predominantly White population with a higher incidence of T2DM referred for cardiac catheterization.
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 29105 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
Lifescience Database Archive (English)
Full Text Available List Contact us BodyParts3D Table of 3D organ model IDs and organ names (PART-OF Tree) Data detail Data name Table of 3D org...an model IDs and organ names (PART-OF Tree) DOI 10.18908/lsdba.nbdc00837-002 Description of ...data contents List of downloadable 3D organ models in a tab-delimited text file format, describing the correspondence between 3D org...an model IDs and organ names available in PART-OF Tree. D...atabase Site Policy | Contact Us Table of 3D organ model IDs and organ names (PART-OF Tree) - BodyParts3D | LSDB Archive ...
Zhong, Hong-xia; Shi, Jun-jie; Zhang, Min; Jiang, Xin-he; Huang, Pu; Ding, Yi-min
2014-10-23
Improving p-type doping efficiency in Al-rich AlGaN alloys is a worldwide problem for the realization of AlGaN-based deep ultraviolet optoelectronic devices. In order to solve this problem, we calculate Mg acceptor activation energy and investigate its relationship with Mg local structure in nanoscale (AlN)5/(GaN)1 superlattice (SL), a substitution for Al(0.83)Ga(0.17)N disorder alloy, using first-principles calculations. A universal picture to reduce acceptor activation energy in wide-gap semiconductors is given for the first time. By reducing the volume of the acceptor local structure slightly, its activation energy can be decreased remarkably. Our results show that Mg acceptor activation energy can be reduced significantly from 0.44 eV in Al(0.83)Ga(0.17)N disorder alloy to 0.26 eV, very close to the Mg acceptor activation energy in GaN, and a high hole concentration in the order of 10(19) cm(-3) can be obtained in (AlN)5/(GaN)1 SL by Mg(Ga) δ-doping owing to GaN-monolayer modulation. We thus open up a new way to reduce Mg acceptor activation energy and increase hole concentration in Al-rich AlGaN.
Zhong, Hong-Xia; Shi, Jun-Jie; Zhang, Min; Jiang, Xin-He; Huang, Pu; Ding, Yi-Min
2014-10-01
Improving p-type doping efficiency in Al-rich AlGaN alloys is a worldwide problem for the realization of AlGaN-based deep ultraviolet optoelectronic devices. In order to solve this problem, we calculate Mg acceptor activation energy and investigate its relationship with Mg local structure in nanoscale (AlN)5/(GaN)1 superlattice (SL), a substitution for Al0.83Ga0.17N disorder alloy, using first-principles calculations. A universal picture to reduce acceptor activation energy in wide-gap semiconductors is given for the first time. By reducing the volume of the acceptor local structure slightly, its activation energy can be decreased remarkably. Our results show that Mg acceptor activation energy can be reduced significantly from 0.44 eV in Al0.83Ga0.17N disorder alloy to 0.26 eV, very close to the Mg acceptor activation energy in GaN, and a high hole concentration in the order of 1019 cm-3 can be obtained in (AlN)5/(GaN)1 SL by MgGa δ-doping owing to GaN-monolayer modulation. We thus open up a new way to reduce Mg acceptor activation energy and increase hole concentration in Al-rich AlGaN.
17 CFR 259.5s - Form U5S, for annual reports filed under section 5(c) of the Act.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form U5S, for annual reports filed under section 5(c) of the Act. 259.5s Section 259.5s Commodity and Securities Exchanges SECURITIES... 1935 Forms for Registration and Annual Supplements § 259.5s Form U5S, for annual reports filed under...
Energy Technology Data Exchange (ETDEWEB)
Bourguiba, Fayçal, E-mail: fayssalbourguiba@gmail.com [Laboratoire de la Matière Condensée et des Nanosciences, Département de Physique, Faculté des Sciences de Monastir, Monastir, 5019 (Tunisia); Dhahri, Ah.; Tahri, Tarek [Laboratoire de Physique appliqué, Département de physique, Faculté des sciences de, Sfax, 3018 (Tunisia); Dhahri, J. [Laboratoire de la Matière Condensée et des Nanosciences, Département de Physique, Faculté des Sciences de Monastir, Monastir, 5019 (Tunisia); Abdelmoula, N. [Laboratoire des Matériaux Ferroélectriques (LMF), LR-Physique-Mathématiques et Applications, Université de Sfax, Faculté des Sciences (FSS), Route de Soukra km 3.5 B.P 1171, 3000, Sfax (Tunisia); Taibi, K. [Laboratoire de Science et Génie des Matériaux, Faculté de Génie Mécanique et Génie des Procédés, Université des Sciences et de la Technologie Houari Boumediene BP32 El Alia, Bab Ezzouar, 16111, Alger (Algeria); Hlil, E.K. [Institut Néel, CNRS-Université J. Fourier, B.P. 166, 38042, Grenoble (France)
2016-08-05
The effect of replacing titanium by iron and molybdenum in the B site on the structural and physical properties of BaTi{sub 0.5}(Fe{sub 0.33}Mo{sub 0.17})O{sub 3} polycrystalline sample was investigated by X-ray diffraction, scanning electron microscopy (SEM) as well as dielectric characterizations. Crystal phase, microstructure, and dielectric property of the ceramic were examined. A single hexagonal perovskite structure with space group P6{sub 3}/mmc was obtained at 1400 °C and stabilized at room temperature. The microstructural study of the sintered pellets revealed that the plate-like grains are the typical grain morphologies in this ceramic. The temperature dependence of the dielectric properties was investigated in the frequency range 1 kHz to 1 MHz. Three dielectric relaxations were observed in the present ceramic at the temperature ranges of 330–473 K, 473–550 K and 650–800 K with a maximum in the dielectric permittivity (ε{sup ’}{sub r} ∼ 3518 at 443 K at 1 KHz, ε{sup ’}{sub r} ∼4335 at 502 K at 1 KHz and ε{sup ’}{sub r} ∼11,331 at 749 K at 1 KHz) that shifted to a higher temperature with increasing frequency. Temperature dependent variation of the dielectric constant showed a diffused phase transition which can be well described by fitting the modified Curie–Weiss relation, (1/ε{sup ‘}{sub r}–1/ε{sup ‘}{sub r,max})=(T–T{sub m}){sup γ}/C. - Highlights: • The BaTi{sub 0.5}(Fe{sub 0.33}Mo{sub 0.17})O{sub 3} ceramic was prepared by solid state reaction. • The sample crystallizes in the hexagonal P6{sub 3}/mmc structure. • Temperature dependency dielectric study showed relaxor kind phase transition for different temperature Regions.
46 CFR 162.017-3 - Materials, construction, and workmanship.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Materials, construction, and workmanship. 162.017-3..., CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ENGINEERING EQUIPMENT Valves, Pressure-Vacuum Relief, for Tank Vessels § 162.017-3 Materials, construction, and workmanship. (a) The valves shall be of...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 24955 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 24946 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 30111 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
2011-05-13
... SECURITIES AND EXCHANGE COMMISSION [Release No. 34-64445; File No. SR-BATS-2011-017] Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change To Add BATS Rule 11.22, Entitled ``Data Products'' May 9, 2011. Pursuant to Section 19(b)(1) of...
Pengalaman Komunikasi Pelanggan Zalora.co.id (Studi Fenomenologi Pelanggan Zalora.co.id)
Aji, Widya Andhika; Pradekso, Tandiyo; Ulfa, Nurist Surayya
2013-01-01
1PENGALAMAN KOMUNIKASI PELANGGAN ZALORA.CO.ID(Studi Fenomenologi Pelanggan Zalora.co.id)Oleh:Widya Andhika AjiFakultas Ilmu Sosial dan Ilmu PolitikUniversitas Diponegoro SemarangABSTRAKPenelitian ini bertujuan untuk menganalisis pengalaman komunikasi danpemahaman penerimaan konsumen terkait pesan komunikasi pemasaran dalamberbelanja di Zalora.co.id. Dengan menggunakan sampel pada lima informandan metode wawancara, dapat ditarik kesimpulan: Pelanggan Zalora.co.idmemiliki pengalaman komunikasi ...
2012-02-15
... expenses as ``other'' (miscellaneous), a very general categorization that provides FINRA limited visibility... supplemental filing would play with respect to a broker-dealer's annual audit.\\28\\ \\26\\ CAI. \\27\\ Id. \\28\\ Id... any future schedules or reports be done through the more typical self- regulatory organization (``SRO...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV
2013-03-14
... SECURITIES AND EXCHANGE COMMISSION [Release No. 34-69079; File No. SR-BATS-2013-017] Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change Related to Fees for Use of BATS Exchange, Inc. March 8, 2013. Pursuant to Section 19(b)(1) of the...
Id-1 and Id-2 genes and products as markers of epithelial cancer
Desprez, Pierre-Yves [El Cerrito, CA; Campisi, Judith [Berkeley, CA
2008-09-30
A method for detection and prognosis of breast cancer and other types of cancer. The method comprises detecting expression, if any, for both an Id-1 and an Id-2 genes, or the ratio thereof, of gene products in samples of breast tissue obtained from a patient. When expressed, Id-1 gene is a prognostic indicator that breast cancer cells are invasive and metastatic, whereas Id-2 gene is a prognostic indicator that breast cancer cells are localized and noninvasive in the breast tissue.
2013-02-08
... SECURITIES AND EXCHANGE COMMISSION [File No. 500-1] Advance Nanotech, Inc., Advanced ID Corp., Aeon Holdings, Inc. (n/k/a BCM Energy Partners, Inc.), ANTS Software, Inc., Beauty Brands Group, Inc... current and accurate information concerning the securities of Advanced Nanotech, Inc. because it has not...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 24953 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
STANEF, ENDF/B Book-keeping Operations for ENDF Format Files
International Nuclear Information System (INIS)
Dunford, Charles L.
2007-01-01
1 - Description of program or function: STANEF performs bookkeeping operations on a data file containing one or more material evaluations in ENDF format. Version 7.01 (Feb 2005): set success flag when done added new element roentgenium (rg) corrected symbol generation for second third metastable state (Kellett, NEA) added symbol nn for neutron in symbol generation and xx for unnamed elements corrections for fact that some compilers do not recognize the intrinsic function jfix 2 - Method of solution: STANEF operations include: Creation or modification of a 'tape ID' record, Creation or update of the directory in MT=451, Create or modify special Hollerith ID records in MT=451 (ENDF-6 only), Re-sequencing, Conversion of integer and floating point fields to standard format, Creation of a binary (ENDF alternate format) file
Wang, Jiaming; Xu, Fujun; Zhang, Xia; An, Wei; Li, Xin-Zheng; Song, Jie; Ge, Weikun; Tian, Guangshan; Lu, Jing; Wang, Xinqiang; Tang, Ning; Yang, Zhijian; Li, Wei; Wang, Weiying; Jin, Peng; Chen, Yonghai; Shen, Bo
2014-01-01
Type-II band alignment structure is coveted in the design of photovoltaic devices and detectors, since it is beneficial for the transport of photogenerated carriers. Regrettably, for group-III-nitride wide bandgap semiconductors, all existing devices are limited to type-I heterostructures, owing to the unavailable of type-II ones. This seriously restricts the designing flexibility for optoelectronic devices and consequently the relevant performance of this material system. Here we show a brandnew type-II band alignment of the lattice-matched In0.17Al0.83N/GaN heterostructure from the perspective of both experimental observations and first-principle theoretical calculations. The band discontinuity is dominated by the conduction band offset ΔEC, with a small contribution from the valence band offset ΔEV which equals 0.1 eV (with being above). Our work may open up new prospects to realize high-performance III-Nitrides optoelectronic devices based on type-II energy band engineering. PMID:25283334
STS-84 M.S. Kondakova with husband Ryumin at SLF
1997-01-01
STS-84 Mission Specialist Elena V. Kondakova, a cosmonaut with the Russian Space Agency, and her husband, Valery Ryumin, greet press represenatives and other well wishers after her arrival at KSCs Shuttle Landing Facility. Ryumin is director of the Mir- Shuttle program for RSC Energia in Russia. This will be Kondakovas first flight on a U.S. Space Shuttle, but her second trip into space. She spent 169 days in space as flight engineer of the 17th main mission on Mir from October 1994 to March 1995. STS-84 will be the sixth docking of the Space Shuttle with the Russian Space Station Mir. During the docking, STS-84 Mission Specialist C. Michael Foale will transfer to the Russian space station to become a member of the Mir 23 crew, replacing U.S. astronaut Jerry M. Linenger, who will return to Earth on Atlantis. Foale is scheduled to remain on Mir about four months until his replacement arrives on STS-86 in September.
International Nuclear Information System (INIS)
Eriksson, A.K.; Eriksson, S.G.; Chapon, L.C.; Knee, C.S.
2010-01-01
The oxygen deficient perovskites, Bi 0.15 Sr 0.85-x Ae x CoO 3-δ , x = 0 and Ae x = Ba 0.28 , Ca 0.17 , were studied with in-situ neutron powder diffraction and combined TGA/DSC in order to investigate their behaviour at elevated temperatures in oxidising conditions. The phase stability of the I4/mmm supercell structure adopted by Bi 0.15 Sr 0.85 CoO 3-δ is shown to be dependent on temperature and the oxygen content of the phase, with three structural events, at T ∼ 250, 590 and 880 o C, detected. The first transition occurs as the perovskite supercell vanishes due to oxygen absorption; the second transition is also associated with oxidation and involves the decomposition of the perovskite phase via an exothermic process to yield a dominant hexagonal phase. Finally, at T ∼ 900 o C the perovskite phase re-forms. For the Ba and Ca containing materials the decomposition to the hexagonal phase occurs at T ∼ 600 o C and ∼ 650 o C respectively. The presence of Ca at the A-site is found to stabilise the I4/mmm supercell structure in the range RT - 650 o C. The antiferromagnetic to paramagnetic transitions occur at T N ∼ 250 o C, T N ∼ 175 o C and T N ∼ 145 o C for the samples with Ae x = Ba 0.28 , x = 0 and Ae x = Ca 0.17 , respectively.
48 CFR 3035.017 - Federally Funded Research and Development Centers.
2010-10-01
... CONTRACTING RESEARCH AND DEVELOPMENT CONTRACTING Scope of Part 3035.017 Federally Funded Research and... use of Federally Funded Research and Development Centers (FFRDCs) in (FAR) 48 CFR 35.017. [71 FR 25771... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Federally Funded Research...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 24949 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
17 CFR 232.13 - Date of filing; adjustment of filing date.
2010-04-01
..., shall not affect the date of filing. (2) If the conditions of paragraph (a)(1) of this section are... and consistent with the public interest and the protection of investors. (c) Payment of fees. Fees...
Jiang, Xin-He; Shi, Jun-Jie; Zhang, Min; Zhong, Hong-Xia; Huang, Pu; Ding, Yi-Min; He, Ying-Ping; Cao, Xiong
2015-12-01
To resolve the p-type doping problem of Al-rich AlGaN alloys, we investigate the influence of biaxial and hydrostatic strains on the activation energy, formation energy and band gap of Mg-doped GaN, AlN, Al0.83Ga0.17N disorder alloy and (AlN)5/(GaN)1 superlattice based on first-principles calculations by combining the standard DFT and hybrid functional. We find that the Mg acceptor activation energy {{E}\\text{A}} , the formation energy {{E}\\text{f}} and the band gap {{E}\\text{g}} decrease with increasing the strain ɛ. The hydrostatic strain has a more remarkable impact on {{E}\\text{g}} and {{E}\\text{A}} than the biaxial strain. Both {{E}\\text{A}} and {{E}\\text{g}} have a linear dependence on the hydrostatic strain. For the biaxial strain, {{E}\\text{g}} shows a parabolic dependence on ɛ if \\varepsilon ≤slant 0 while it becomes linear if \\varepsilon ≥slant 0 . In GaN and (AlN)5/(GaN)1, {{E}\\text{A}} parabolically depends on the biaxial compressive strain and linearly depends on the biaxial tensible strain. However, the dependence is approximately linear over the whole biaxial strain range in AlN and Al0.83Ga0.17N. The Mg acceptor activation energy in (AlN)5/(GaN)1 can be reduced from 0.26 eV without strain to 0.16 (0.22) eV with the hydrostatic (biaxial) tensible strain 3%.
Evaluation of STS 430 and STS 444 for SOFC Interconnect Applications
International Nuclear Information System (INIS)
Kim, S. H.; Huh, J. Y.; Jun, J. H.; Kim, D. H.; Jun, J. H.
2007-01-01
Ferritic stainless steels for the SOFC interconnect applications are required to possess not only a good oxidation resistance, but also a high electrical conductivity of te oxide scale that forms during exposure at the SOFC operating environment. In order to understand the effects of alloying elements on the oxidation behavior of ferritic stainless steels and on the electrical properties of oxide scales, two kinds of commercial ferritic stainless steels, STS 430 and STS 444, were investigated by performing isothermal oxidations at 800 .deg. C in a wet air containing 3% H 2 O. The results showed that STS 444 was superior to STS 430 in both of the oxidation resistance and the area specific resistance. Although STS 444 contained a less amount of Mn for the (Mn, Cr) 3 O 4 spinel formation than STS 430, the minor alloying elements of Al and Mo in STS 444, which were accumulated in the base metal region adjacent the scale, were suggested to reduce the scale growth rate and to enhance the scale adherence to the base metal
17 CFR 232.501 - Modular submissions and segmented filings.
2010-04-01
..., EDGAR will suspend the modular submission and notify the electronic filer by electronic mail. After six... COMMISSION REGULATION S-T-GENERAL RULES AND REGULATIONS FOR ELECTRONIC FILINGS Edgar Functions § 232.501 Modular submissions and segmented filings. An electronic filer may use the following procedures to submit...
FCC046: A CANDIDATE GASEOUS POLAR RING DWARF ELLIPTICAL GALAXY IN THE FORNAX CLUSTER
Energy Technology Data Exchange (ETDEWEB)
De Rijcke, S.; Buyle, P.; Koleva, M. [Department of Physics and Astronomy, Ghent University, Krijgslaan 281 S9, B-9000 Ghent (Belgium)
2013-06-20
FCC046 is a Fornax Cluster dwarf elliptical galaxy. Optical observations have shown that this galaxy, besides an old and metal-poor stellar population, also contains a very young centrally concentrated population and is actively forming stars, albeit at a very low level. Here, we report on 21 cm observations of FCC046 with the Australia Telescope Compact Array which we conducted in the course of a small survey of Fornax Cluster early-type dwarf galaxies. We have discovered a {approx}10{sup 7} M{sub Sun} H I cloud surrounding FCC046. We show that the presence of this significant gas reservoir offers a concise explanation for this galaxy's optical morphological and kinematical properties. Surprisingly, the H I gas, as evidenced by its morphology and its rotational motion around the galaxy's optical major axis, is kinematically decoupled from the galaxy's stellar body. This is the first time such a ring of gaseous material in minor-axis rotation is discovered around a dwarf galaxy.
Tejada, A.; Braunger, S.; Korte, L.; Albrecht, S.; Rech, B.; Guerra, J. A.
2018-05-01
The complex refractive indices of formamidinium cesium lead mixed-halide [FA0.83Cs0.17Pb(I1- xBrx)3] perovskite thin films of compositions ranging from x = 0 to 0.4, with both flat and wrinkle-textured surface topographies, are reported. The films are characterized using a combination of variable angle spectroscopic ellipsometry and spectral transmittance in the wavelength range of 190 nm to 850 nm. Optical constants, film thicknesses and roughness layers are obtained point-by-point by minimizing a global error function, without using optical dispersion models, and including topographical information supplied by a laser confocal microscope. To evaluate the bandgap engineering potential of the material, the optical bandgaps and Urbach energies are then accurately determined by applying a band fluctuation model for direct semiconductors, which considers both the Urbach tail and the fundamental band-to-band absorption region in a single equation. With this information, the composition yielding the optimum bandgap of 1.75 eV for a Si-perovskite tandem solar cell is determined.
STS-90 Pilot Scott Altman arrives at KSC for TCDT
1998-01-01
STS-90 Pilot Scott Altman poses in the cockpit of his T-38 jet trainer aircraft after arriving at the KSC Shuttle Landing Facility along with other members of the crew from NASAs Johnson Space Center to begin Terminal Countdown Demonstration Test (TCDT) activities. The TCDT is held at KSC prior to each Space Shuttle flight to provide crews with the opportunity to participate in simulated countdown activities. Columbia is targeted for launch of STS-90 on April 16 at 2:19 p.m. EST and will be the second mission of 1998. The mission is scheduled to last nearly 17 days.
Beam transport radiation shielding for branch lines 2-ID-B and 2-ID-C
International Nuclear Information System (INIS)
Feng, Y.P.; Lai, B.; McNulty, I.; Dejus, R.J.; Randall, K.J.; Yun, W.
1995-01-01
The x-ray radiation shielding requirements beyond the first optics enclosure have been considered for the beam transport of the 2-ID-B and 2-ID-C branch lines of Sector 2 (SRI-CAT) of the APS. The first three optical components (mirrors) of the 2-ID-B branch are contained within the shielded first optics enclosure. Calculations indicate that scattering of the primary synchrotron beam by beamline components outside the enclosure, such as apertures and monochromators, or by gas particles in case of vacuum failure is within safe limits for this branch. A standard 2.5-inch-diameter stainless steel pipe with 1/16-inch-thick walls provides adequate shielding to reduce the radiation dose equivalent rate to human tissue to below the maximum permissible limit of 0.25 mrem/hr. The 2-ID-C branch requires, between the first optics enclosure where only two mirrors are used and the housing for the third mirror, additional lead shielding (0.75 mm) and a minimum approach distance of 2.6 cm. A direct beam stop consisting of at least 4.5 mm of lead is also required immediately downstream of the third mirror for 2-ID-C. Finally, to stop the direct beam from escaping the experimental station, a beam stop consisting of at least 4-mm or 2.5-mm steel is required for the 2-ID-B or 2-ID-C branches, respectively. This final requirement can be met by the vacuum chambers used to house the experiments for both branch lines
Globus File Transfer Services | High-Performance Computing | NREL
installed on the systems at both ends of the data transfer. The NREL endpoint is nrel#globus. Click Login on the Globus web site. On the login page select "Globus ID" as the login method and click Login to the Globus website. From the Manage Data drop down menu, select Transfer Files. Then click Get
A proposed HTTP service based IDS
Directory of Open Access Journals (Sweden)
Mohamed M. Abd-Eldayem
2014-03-01
Full Text Available The tremendous growth of the web-based applications has increased information security vulnerabilities over the Internet. Security administrators use Intrusion-Detection System (IDS to monitor network traffic and host activities to detect attacks against hosts and network resources. In this paper IDS based on Naïve Bayes classifier is analyzed. The main objective is to enhance IDS performance through preparing the training data set allowing to detect malicious connections that exploit the http service. Results of application are demonstrated and discussed. In the training phase of the proposed IDS, at first a feature selection technique based on Naïve Bayes classifier is used, this technique identifies the most important HTTP traffic features that can be used to detect HTTP attacks. In the testing and running phases proposed IDS classifies the network traffic based on the requested service, then based on the selected features Naïve Bayes classifier is used to analyze the HTTP service based traffic and identifies the HTTP normal connections and attacks. The performance of the IDS is measured through experiments using NSL-KDD data set. The results show that the detection rate of the IDS is about 99%, the false-positive rate is about 1%, and the false-negative rate is about 0.25%; therefore, proposed IDS holds the highest detection rate and the lowest false alarm compared with other leading IDS. In addition, the proposed IDS based on Naïve Bayes is used to classify network connections as a normal or attack. And it holds a high detection rate and a low false alarm.
78 FR 31914 - Combined Notice of Filings #1
2013-05-28
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Combined Notice of Filings 1 Take notice...: ISO New England Inc. Rhode Island Engine Genco LLC Resource Termination Filing. Filed Date: 5/17/13... information, call (866) 208-3676 (toll free). For TTY, call (202) 502-8659. Dated: May 17, 2013. Nathaniel J...
KungFQ: a simple and powerful approach to compress fastq files.
Grassi, Elena; Di Gregorio, Federico; Molineris, Ivan
2012-01-01
Nowadays storing data derived from deep sequencing experiments has become pivotal and standard compression algorithms do not exploit in a satisfying manner their structure. A number of reference-based compression algorithms have been developed but they are less adequate when approaching new species without fully sequenced genomes or nongenomic data. We developed a tool that takes advantages of fastq characteristics and encodes them in a binary format optimized in order to be further compressed with standard tools (such as gzip or lzma). The algorithm is straightforward and does not need any external reference file, it scans the fastq only once and has a constant memory requirement. Moreover, we added the possibility to perform lossy compression, losing some of the original information (IDs and/or qualities) but resulting in smaller files; it is also possible to define a quality cutoff under which corresponding base calls are converted to N. We achieve 2.82 to 7.77 compression ratios on various fastq files without losing information and 5.37 to 8.77 losing IDs, which are often not used in common analysis pipelines. In this paper, we compare the algorithm performance with known tools, usually obtaining higher compression levels.
Tinjauan Desain Website Kemlu.Go.Id
Danu Widhyatmoko
2013-01-01
Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007). At the end of the article, several recommendations in developing kemlu.go.id website are...
Thais, Savannah Jennifer; The ATLAS collaboration
2018-01-01
Efficient and accurate electron identification is of critical importance to measuring many physics processes with leptons in the final state, including H->4l, dark vector boson searches, and various SUSY searches. This poster will describe the current status of the Likelihood driven Electron ID, highlighting the recent move from a MC driven ID to a data-driven ID. It will include the most recent identification efficiency and scale-factor measurements. Additionally, it will describe continued improvements for Run 2 electron ID, highlighting improvements in the low pt region and potential Machine Learning improvements.
Tinjauan Desain Website Kemlu.Go.Id
Directory of Open Access Journals (Sweden)
Danu Widhyatmoko
2013-04-01
Full Text Available Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007. At the end of the article, several recommendations in developing kemlu.go.id website are presented to create better appearance.
Barron, Paul E.
In the last half century, public awareness of issues such as population growth, environmental pollution and the threat of nuclear war has pressured science education to reform to increase student social responsibility. The emerging Science-Technology-Society (STS) movement addressed these concerns by developing numerous strategies and curricula. Considerable diagnostic research has been conducted on student knowledge of the nature of science, but not on the wider scope of STS content (e.g., the nature of science and technology and their interactions with society). However, researchers have not widely studied the impact of comprehensive STS curricula on students' knowledge of STS content nor the nature of STS teaching practice that influenced this knowledge gain. This study examined student success and teacher performance in a special STS course in Ontario, Canada. Research questions focused on the STS content knowledge gain by students completing this course and the impact of the STS teachers' teaching practices on this knowledge gain. Student data were collected using pre-course and post-course assessments of students' STS content knowledge. Teacher data were obtained using semi-structured interviews, classroom observations and videotapes. Statistical analysis indicated that, after completing the STS course, students significantly increased their STS content knowledge as measured by the Views on Science Technology Society instrument. Gender and academic achievement had no significant impact on this knowledge gain, implying that this course, as taught by these teachers, could appeal to a wide range of students as a general education course. The second part of the study indicated that detailed research is needed on the relationship between STS teaching practice and student STS content knowledge gain. The small sample size prevents generalizations but initial indications show that factors such constructivist teaching practices and strong teacher STS content knowledge
Association of interleukin 17 / angiotensin II with refractory ...
African Journals Online (AJOL)
Table 2 Multiple linear regression analysis showing relationship between IL 17, Ang II and mean arterial pressure in hemodialysis patients. Variables. B t value. P value. IL 17. 6.320. 10.221. 0.000. Ang II. 0.143. 2.442. 0.017. Discussion. This study aimed to investigate the association between. IL 17 and the risk of refractory ...
STS-90 Pilot Scott Altman in white room before launch
1998-01-01
STS-90 Pilot Scott Altman is assisted by NASA and USA closeout crew members immediately preceding launch for the nearly 17-day Neurolab mission. Investigations during the Neurolab mission will focus on the effects of microgravity on the nervous system. Linnehan and six fellow crew members will shortly enter the orbiter at KSC's Launch Pad 39B, where the Space Shuttle Columbia will lift off during a launch window that opens at 2:19 p.m. EDT, April 17.
DEFF Research Database (Denmark)
Jensen, Tenna; Jespersen, Astrid Pernille; Grønnow, Liv Cæcilie
2015-01-01
Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune.......Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune....
Ryzhov, V. A.; Lazuta, A. V.; Molkanov, P. L.; Khavronin, V. P.; Kurbakov, A. I.; Runov, V. V.; Mukovskii, Ya. M.; Pestun, A. E.; Privezentsev, R. V.
2012-10-01
The magnetic, transport and structural properties are studied for La0.83Sr0.17MnO3 and La0.82Sr0.18CoO3 single crystals with nearly the same doping and the metallic ground state. Their comparisons have shown that ferromagnetic clusters originate in the paramagnetic matrix below Т*>TC in both samples and exhibit similar properties. This suggests the possible universality of such phenomena in doped mixed-valence oxides of transition metals with the perovskite-type structure. The cluster density increases on cooling and plays an important role on the physical properties of these systems. The differences in cluster evolutions and scenarios of their insulator-metal transitions are related to different magnetic behaviors of the matrixes in these crystals that is mainly due to distinct spin states of the Mn3+ and Co3+ ions.
Energy Technology Data Exchange (ETDEWEB)
Wang, Wei; Zhou, Qian; Dong, Yuan; Yeo, Yee-Chia, E-mail: yeo@ieee.org [Department of Electrical and Computer Engineering, National University of Singapore, Singapore 117576 (Singapore); Tok, Eng Soon [Department of Physics, National University of Singapore, Singapore 117551 (Singapore)
2015-06-08
We investigated the critical thickness (h{sub c}) for plastic relaxation of Ge{sub 1−x}Sn{sub x} grown by molecular beam epitaxy. Ge{sub 1−x}Sn{sub x} films with various Sn mole fraction x (x ≤ 0.17) and different thicknesses were grown on Ge(001). The strain relaxation of Ge{sub 1−x}Sn{sub x} films and the h{sub c} were investigated by high-resolution x-ray diffraction and reciprocal space mapping. It demonstrates that the measured h{sub c} values of Ge{sub 1−x}Sn{sub x} layers are as much as an order of magnitude larger than that predicted by the Matthews and Blakeslee (M-B) model. The People and Bean (P-B) model was also used to predict the h{sub c} values in Ge{sub 1−x}Sn{sub x}/Ge system. The measured h{sub c} values for various Sn content follow the trend, but slightly larger than that predicted by the P-B model.
Long term file migration. Part I: file reference patterns
International Nuclear Information System (INIS)
Smith, A.J.
1978-08-01
In most large computer installations, files are moved between on-line disk and mass storage (tape, integrated mass storage device) either automatically by the system or specifically at the direction of the user. This is the first of two papers which study the selection of algorithms for the automatic migration of files between mass storage and disk. The use of the text editor data sets at the Stanford Linear Accelerator Center (SLAC) computer installation is examined through the analysis of thirteen months of file reference data. Most files are used very few times. Of those that are used sufficiently frequently that their reference patterns may be examined, about a third show declining rates of reference during their lifetime; of the remainder, very few (about 5%) show correlated interreference intervals, and interreference intervals (in days) appear to be more skewed than would occur with the Bernoulli process. Thus, about two-thirds of all sufficiently active files appear to be referenced as a renewal process with a skewed interreference distribution. A large number of other file reference statistics (file lifetimes, interference distributions, moments, means, number of uses/file, file sizes, file rates of reference, etc.) are computed and presented. The results are applied in the following paper to the development and comparative evaluation of file migration algorithms. 17 figures, 13 tables
Facts about Infectious Diseases (ID)
... an ID Specialist? Facts about ID Pocketcard Infectious diseases are caused by microscopic organisms that penetrate the body’s natural ... from diseases such as AIDS or treatment of diseases such as cancer, may allow ... of contaminated food or water, bites from vectors such as ticks or mosquitoes ...
Yeast Interacting Proteins Database: YCL046W, YGL115W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YCL046W - Dubious open reading frame unlikely to encode a protein, based on availab...ading frame unlikely to encode a protein, based on available experimental and comparative sequence data; par
One ID Card for the Entire Campus.
Ridenour, David P.; Ferguson, Linda M.
1986-01-01
The implementation by Indiana State University of a machine-readable photo ID system for their food services prompted an investigation into the available alternatives and requirements for a more efficient all-University ID card system. The new ID system is described. (AUTHOR/MLW)
Sustainable use of oil sands for geotechnical construction and road building
CSIR Research Space (South Africa)
Anochie-Boateng, Joseph
2012-02-01
Full Text Available of the three oil sand samples. Oil Sand ID w [%] wb [%] D10 D30 D50 D60 Cu Cc SE-09 1.4 8.5 0.07 0.12 0.17 0.19 2.9 1.17 SE-14 3.2 13.3 0.08 0.14 0.18 0.21 2.8 1.24 AU-14 2.2 14.5 0.09 0.17 0.22 0.27 3.0 1.19 w = water content; wb = bitumen content; Di... = grain size (mm) corresponding to i-percent passing by mass; Cu = coefficient of uniformity; Cc = coefficient of curvature. Sample Preparation The oil sand samples were prepared for the laboratory testing program using an Industrial Process...
Desprez, Pierre-Yves; Campisi, Judith
2014-09-30
A method for treatment and amelioration of breast, cervical, ovarian, endometrial, squamous cells, prostate cancer and melanoma in a patient comprising targeting Id-1 or Id-2 gene expression with a delivery vehicle comprising a product which modulates Id-1 or Id-2 expression.
Shi, Yan-hui; Zhang, Yong-gang; Ma, Ying-jie; Gu, Yi; Chen, Xing-you; Gong, Qian; Du, Ben; Zhang, Jian; Zhu, Yi
2018-03-01
The performance of wavelength extended In0.83Ga0.17As/InP photodetectors has been improved notably through modifying the position of electron barriers in absorption layer. In order to fully utilize the diffusion component of the photocurrent, the In0.66Ga0.34As/InAs superlattice electron barrier is moved to the edge of the depletion region. Enhanced peak photo responsivity up to 0.84 A/W is realized, which raises 24% compared to that of a reference detector with the superlattice barrier in the middle of the absorber. The dark current slightly increases by 25% at room temperature while decreases by more than an order of magnitude at 150 K, resulting in about 10% or more than twofold improvements for the detectivity, respectively. The results suggest that optimized barrier position is a necessity for barrier-type photodetectors to achieve better performances.
17 CFR 240.17Ad-3 - Limitations on expansion.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Limitations on expansion. 240... expansion. (a) Any registered transfer agent which is required to file any notice pursuant to § 240.17Ad-2 (c) or (d) for each of three consecutive months shall not from the fifth business day after the end...
Ethnic Variation in Service Utilisation among Children with Intellectual Disability
Dura-Vila, G.; Hodes, M.
2009-01-01
Background: This study examined whether service utilisation among children with intellectual disability (ID) varied by ethnic cultural group. Method: Survey carried out in four special schools in London. Information was provided by school teachers using case files, and 242 children aged 7 to 17 years with mild and moderate ID were identified.…
Babakhanyan, Anna; Leke, Rose G. F.; Salanti, Ali; Bobbili, Naveen; Gwanmesia, Philomina; Leke, Robert J. I.; Quakyi, Isabella A.; Chen, John J.; Taylor, Diane Wallace
2014-01-01
In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8–9% of males had antibodies to full-length VAR2CSA, but 90–96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a. PMID:24505415
Directory of Open Access Journals (Sweden)
Anna Babakhanyan
Full Text Available In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8-9% of males had antibodies to full-length VAR2CSA, but 90-96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a.
Evaluation of ID-PaGIA syphilis antibody test.
Naaber, Paul; Makoid, Ene; Aus, Anneli; Loivukene, Krista; Poder, Airi
2009-01-01
Laboratory diagnosis of syphilis is usually accomplished by serology. There are currently a large number of different commercial treponemal tests available that vary in format, sensitivity and specificity. To evaluate the ID-PaGIA Syphilis Antibody Test as an alternative to other specific treponemal tests for primary screening or confirmation of diagnosis. Serum samples from healthy adults (n = 100) were used for detection of specificity of ID-PaGIA. To evaluate sensitivity of ID-PaGIA serum samples (n = 101) from patients with confirmed or suspected syphilis were tested for syphilis antibodies with FTA-Abs IgM, ID-PaGIA, ELISA IgM and TPHA tests. No false-positive results were found with ID-PaGIA. Sensitivity of various treponemal tests was the following: FTA-Abs IgM: 95.5%, ID-PaGIA and ELISA IgM: 94%, and TPHA 75%. The positive and negative predictive values of ID-PaGIA were 100 and 89.5%, respectively. Compared with other treponemal tests ID-PaGIA has excellent sensitivity and specificity.
Directory of Open Access Journals (Sweden)
Wang Chun Huy
2017-01-01
Full Text Available In this work, the piezoelectric ceramic system of the (1-x(Na0.5K0.5NbO3 - xBi(Na0.83K0.17TiO3 with composition close to the morphotropic phase boundary is studied. (Na0.5K0.5NbO3 with 0∼5 mole% Bi(Na0.83K0.17TiO3 has been prepared following the conventional mixed oxide process. The effect of sintering time on the properties of 0.97(Na0.5K0.5NbO3-0.03Bi(Na0.83K0.17TiO3 ceramics is discussed. For 0.97(Na0.5K0.5NbO3-0.03Bi(Na0.83K0.17TiO3 ceramics, the electromechanical coupling coefficients of the thickness mode kt and the piezoelectric constant d33 reach 0.46 and 155 p/CN, respectively, at the sintering of 1100 °C for 3 h. Dielectric and piezoelectric properties have maximum values at the sintering temperature of 1100 °C for 5 h. For 0.97(Na0.5K0.5NbO3 -0.03Bi(Na0.83K0.17TiO3 ceramics, the electromechanical coupling coefficients of the thickness mode kt and the piezoelectric constant d33 reach 0.56 and 190, respectively, at the sintering of 1100 °C for 5 h. The effect of prolonging the sintering time to the 0.97(Na0.5K0.5NbO3-0.03Bi(Na0.83K0.17TiO3 system is a helpful method on ceramic processing to improve densification and properties.
77 FR 105 - Combined Notice of Filings #2
2012-01-03
... tariff filing per 35.17(b): Effective Date Change for ``Fully Integrated'' DR Rules to be effective 6/1... Numbers: ER12-10-001. Applicants: Energy International Power Marketing. Description: Energy International Power Marketing submits tariff filing per 35: EIP Compliance Filing to be effective 10/3/2011. Filed...
Attachment quality of children with ID and its link to maternal sensitivity and structuring.
Feniger-Schaal, Rinat; Joels, Tirtsa
2018-05-01
Attachment theory produced a fertile field of research and clinical application. Although the topic of attachment of children with intellectual disability (ID) has received increasing research attention over the past 15 years, the empirical evidence is still limited. We applied theoretical and empirical knowledge of parenting typically developing children to examine the mother-child relationship in the ID population. The aim was to examine maternal sensitivity and structuring and its association with children's attachment classification and their disability. Forty preschool children (mean age 47.25, range 26-75 months) with non-specific ID and their mothers participated in the study. The mean developmental age was 25.92 months (SD = 10.89), The DQ mean score was 55.45 (SD = 17.28). We assessed children's quality of attachment using the SSP and maternal interactive behavior using the Emotional Availability Scales. Forty percent of children showed secure attachment, and 32.5% showed disorganized attachment. Attachment classifications correlated significantly with maternal sensitivity and maternal structuring but not with the child's cognitive disability. The results point to the importance of maternal interactive behavior for children with ID. Clinical implication may consider interventions aiming to enhance maternal sensitivity and structuring to improve children's quality of attachment. Copyright © 2018 Elsevier Ltd. All rights reserved.
Turning to Ontology in STS? Turning to STS through ‘Ontology’
van Heur, B.; Leydesdorff, L.; Wyatt, S.
2012-01-01
We examine the evidence for the claim of an ‘ontological turn’ in science and technology studies (STS). Despite an increase in references to ‘ontology’ in STS since 1989, we show that there has not so much been an ontological turn as multiple discussions deploying the language of ontology,
Virtual file system on NoSQL for processing high volumes of HL7 messages.
Kimura, Eizen; Ishihara, Ken
2015-01-01
The Standardized Structured Medical Information Exchange (SS-MIX) is intended to be the standard repository for HL7 messages that depend on a local file system. However, its scalability is limited. We implemented a virtual file system using NoSQL to incorporate modern computing technology into SS-MIX and allow the system to integrate local patient IDs from different healthcare systems into a universal system. We discuss its implementation using the database MongoDB and describe its performance in a case study.
2010-07-08
.... DART. DART is a routing option currently offered by the Exchange in which the entering firm instructs the System to first route to alternative trading systems included in the System routing table. DART... . Please include File No. SR-BATS-2010-017 on the subject line. Paper Comments Send paper comments in...
Kloos, W E; George, C G
1991-01-01
The accuracies of the MicroScan Pos ID and Rapid Pos ID panel systems (Baxter Diagnostic Inc., MicroScan Division, West Sacramento, Calif.) were compared with each other and with the accuracies of conventional methods for the identification of 25 Staphylococcus species and 4 subspecies. Conventional methods included those used in the original descriptions of species and subspecies and DNA-DNA hybridization. The Pos ID panel uses a battery of 18 tests, and the Rapid Pos ID panel uses a battery of 42 tests for the identification of Staphylococcus species. The Pos ID panel has modified conventional and chromogenic tests that can be read after 15 to 48 h of incubation; the Rapid Pos ID panel has tests that use fluorogenic substrates or fluorometric indicators, and test results can be read after 2 h of incubation in the autoSCAN-W/A. Results indicated that both MicroScan systems had a high degree of congruence (greater than or equal to 90%) with conventional methods for the species S. capitis, S. aureus, S. auricularis, S. saprophyticus, S. cohnii, S. arlettae, S. carnosus, S. lentus, and S. sciuri and, in particular, the subspecies S. capitis subsp. capitis and S. cohnii subsp. cohnii. The Rapid Pos ID panel system also had greater than or equal to 90% congruence with conventional methods for S. epidermidis, S. caprae, S. warneri subsp. 2, S. xylosus, S. kloosii, and S. caseolyticus. For both MicroScan systems, congruence with conventional methods was 80 to 90% for S. haemolyticus subsp. 1, S. equorum, S. intermedius, and S. hyicus; and in addition, with the Rapid Pos ID panel system congruence was 80 to 89% for S. capitis subsp. ureolyticus, S. warneri subsp. 1, S. hominis, S. cohnii subsp. urealyticum, and S. simulans. The MicroScan systems identified a lower percentage (50 to 75%) of strains of S. lugdunensis, S. gallinarum, S. schleiferi, and S. chromogenes, although the addition of specific tests to the systems might increase the accuracy of identification
Low doses of Paclitaxel repress breast cancer invasion through DJ-1/KLF17 signalling pathway.
Ismail, Ismail Ahmed; El-Sokkary, Gamal H; Saber, Saber H
2018-04-27
Paclitaxel (taxol) is an important agent against many tumours, including breast cancer. Ample data documents that paclitaxel inhibits breast cancer metastasis while others prove that paclitaxel enhances breast cancer metastasis. The mechanisms by which paclitaxel exerts its action are not well established. This study focuses on the effect of paclitaxel, particularly the low doses on breast cancer metastasis and the mechanisms that regulate it. Current results show that, paclitaxel exerts significant cytotoxicity even at low doses in both MCF-7 and MDA-MB-231 cells. Interestingly, paclitaxel significantly inhibits cell invasion and migration, decreases Snail and increases E-cadherin mRNA expression levels at the indicated low doses. Furthermore, paclitaxel-inhibiting breast cancer metastasis is associated with down-regulation of DJ-1 and ID-1 mRNA expression level with a concurrent increase in KLF17 expression. Under the same experimental conditions, paclitaxel induces KLF17 and concurrently represses ID-1 protein levels. Our results show for the first time that paclitaxel inhibits breast cancer metastasis through regulating DJ-1/KLF17/ID-1 signalling pathway; repressed DJ-1 and ID-1 and enhanced KLF17 expression. © 2018 John Wiley & Sons Australia, Ltd.
Saxena, Raghvendra; Chandra, Amaresh
2011-11-01
Transferability of sequence-tagged-sites (STS) markers was assessed for genetic relationships study among accessions of marvel grass (Dichanthium annulatum Forsk.). In total, 17 STS primers of Stylosanthes origin were tested for their reactivity with thirty accessions of Dichanthium annulatum. Of these, 14 (82.4%) reacted and a total 106 (84 polymorphic) bands were scored. The number of bands generated by individual primer pairs ranged from 4 to 11 with an average of 7.57 bands, whereas polymorphic bands ranged from 4 to 9 with an average of 6.0 bands accounts to an average polymorphism of 80.1%. Polymorphic information content (PIC) ranged from 0.222 to 0.499 and marker index (MI) from 1.33 to 4.49. Utilizing Dice coefficient of genetic similarity dendrogram was generated through un-weighted pairgroup method with arithmetic mean (UPGMA) algorithm. Further, clustering through sequential agglomerative hierarchical and nested (SAHN) method resulted three main clusters constituted all accessions except IGBANG-D-2. Though there was intermixing of few accessions of one agro-climatic region to another, largely groupings of accessions were with their regions of collections. Bootstrap analysis at 1000 scale also showed large number of nodes (11 to 17) having strong clustering (> 50). Thus, results demonstrate the utility of STS markers of Stylosanthes in studying the genetic relationships among accessions of Dichanthium.
Commissioning of the IDS Neutron Detector and $\\beta$-decay fast-timing studies at IDS
Piersa, Monika
2016-01-01
The following report describes my scientific activities performed during the Summer Student Programme at ISOLDE. The main part of my project was focused on commissioning the neutron detector dedicated to nuclear decay studies at ISOLDE Decay Station (IDS). I have participated in all the steps needed to make it operational for the IS609 experiment. In the testing phase, we obtained expected detector response and calibrations confirmed its successful commissioning. The detector was mounted in the desired geometry at IDS and used in measurements of the beta-delayed neutron emission of $^8$He. After completing aforementioned part of my project, I became familiar with the fast-timing method. This technique was applied at IDS in the IS610 experiment performed in June 2016 to explore the structure of neutron-rich $^{130-134}$Sn nuclei. Since the main part of my PhD studies will be the analysis of data collected in this experiment, the second part of my project was dedicated to acquiring knowledge about technical de...
Application of the Levenshtein Distance Metric for the Construction of Longitudinal Data Files
Doran, Harold C.; van Wamelen, Paul B.
2010-01-01
The analysis of longitudinal data in education is becoming more prevalent given the nature of testing systems constructed for No Child Left Behind Act (NCLB). However, constructing the longitudinal data files remains a significant challenge. Students move into new schools, but in many cases the unique identifiers (ID) that should remain constant…
46 CFR 160.017-27 - Production tests and examination.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Production tests and examination. 160.017-27 Section 160... examination. (a) General. Each ladder manufactured under Coast Guard approval must be tested in accordance... for effective monitoring throughout the production schedule. (e) Visual examination. The visual...
48 CFR 1335.017 - Federal funded research and development centers.
2010-10-01
... OF COMMERCE SPECIAL CATEGORIES OF CONTRACTING RESEARCH AND DEVELOPMENT CONTRACTING 1335.017 Federal funded research and development centers. ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Federal funded research...
Expression of Id2 in the Second Heart Field and Cardiac Defects in Id2 Knock-Out Mice
Jongbloed, M. R. M.; Vicente-Steijn, R.; Douglas, Y. L.; Wisse, L. J.; Mori, K.; Yokota, Y.; Bartelings, M. M.; Schalij, M. J.; Mahtab, E. A.; Poelmann, R. E.; Gittenberger-De Groot, A. C.
2011-01-01
The inhibitor of differentiation Id2 is expressed in mesoderm of the second heart field, which contributes myocardial and mesenchymal cells to the primary heart tube. The role of Id2 in cardiac development is insufficiently known. Heart development was studied in sequential developmental stages in
76 FR 22390 - Combined Notice of Filings #1
2011-04-21
...: Conforming Tariff Record--Exhibit 1D Billing Policy to be effective 5/1/2011. Filed Date: 04/12/2011.... Description: Entergy Arkansas, Inc. submits tariff filing per 35.17(b): West Memphis Corrected NITSA to be...: ER11-3333-000. Applicants: NV Energy, Inc. Description: NV Energy, Inc. submits tariff filing per 35.12...
Bauer, Lyndon; Smith, Jeff; Kajons, Nicole; Tutt, Doug
2018-04-24
Australian surveys indicate that a large proportion of packaged liquor outlets do not check identification for young people before selling alcohol to them. There are a substantial number of presentations to Emergency Departments from young people aged 15 to 17 years. This subgroup is second only to those aged 18 to 24 years. In the 15- to 17-year-old age group, supply from direct purchase or underage friends, who have purchased alcohol, represents substantial sources of alcohol that is more likely to be consumed without parental supervision. Teenagers 18-19 years of age approached a randomly selected sample of bottle shops, on the NSW Central Coast Region, to attempt to purchase alcohol without producing identification (ID). Legally we are unable to test with teens under the age of 18. If outlets do not check ID for customers 18 or 19 years of age, we propose they might not check identification for 15- to 17-year-olds. A raft of local interventions was employed over four-survey periods to attempt to reduce selling rates. The lowest alcohol sales without ID occurred in 2015 when NSW Liquor and Gaming successfully prosecuted a Central Coast outlet for an underage sale. The rate of alcohol sales without checking ID each year was as follows: 2012-43.8%, 2014-37.55%, 2015-21.5% and 2016-45%. Alcohol sales to young customers without checking ID are common, widespread and seemingly resistant to non-punitive interventions. The NSW Liquor Act could be modified to allow compliance testing and much more practical enforcement. While Central Coast bottle shops have a better record than other Australian areas showing some improvements with our non-punitive industry education interventions, the results need to improve substantially to stifle primary supply. © 2018 Australian Health Promotion Association.
76 FR 12725 - Combined Notice of Filings #2
2011-03-08
... MBR Tariff to be effective 3/2/2011. Filed Date: 03/01/2011 Accession Number: 20110301-5090 Comment... Substitute First Revised MBR Tariff to be effective 3/2/ 2011. Filed Date: 03/01/2011 Accession Number... 35.17(b): Revised Application for MBR and MBR Tariffs to be effective 4/1/2011. Filed Date: 02/28...
2012-01-12
... reasons. The Exchange believes that it is a more straightforward way to communicate floating volume tiers... Rates'' at http://www.nasdaqtrader.com/Trader.aspx?id=PriceListTrading2#rebates , and EDGX Exchange Fee... SECURITIES AND EXCHANGE COMMISSION [Release No. 34-66115; File No. SR-NYSEArca-2011-101] Self...
76 FR 35209 - Orlando Utilities Commission; Notice of Filing
2011-06-16
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. NJ11-12-001] Orlando Utilities Commission; Notice of Filing Take notice that on May 26, 2011, Orlando Utilities Commission submitted its tariff filing per 35.17(b): Amendment to Compliance Filing to be effective 4/15/2011. Any...
17 CFR 275.203-2 - Withdrawal from investment adviser registration.
2010-04-01
... application). (b) Electronic filing. Once you have filed your Form ADV (17 CFR 279.1) (or any amendments to... file must be filed with the IARD, unless you have received a hardship exemption under § 275.203-3. (c... EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.203-2...
Kim, Young Jin; Kim, Si Hyun; Park, Hyun-Jung; Park, Hae-Geun; Park, Dongchul; Song, Sae Am; Lee, Hee Joo; Yong, Dongeun; Choi, Jun Yong; Kook, Joong-Ki; Kim, Hye Ran; Shin, Jeong Hwan
2016-08-01
All 50 Clostridium difficile strains were definitely identified by Vitek2 system, Rapid ID 32A system, and MALDI-TOF. For 18 non-difficile Clostridium strains, the identification results were correct in 0, 2, and 17 strains by Vitek2, Rapid ID 32A, and MALDI-TOF, respectively. MALDI-TOF could be used as the primary tool for identification of Clostridium species. Copyright © 2016 Elsevier Ltd. All rights reserved.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Motions. 17.32 Section 17.32 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL CIVIL MONEY PENALTIES... shall be filed with the Division of Dockets Management (HFA-305), Food and Drug Administration, 5630...
78 FR 14530 - Combined Notice of Filings #2
2013-03-06
...: California Independent System Operator Corporation submits tariff filing per 35.13(a)(2)(iii): 2013-02-27 Pay... per 35.17(b): 2013-02-28--OASIS Att J Errata to be effective 4/15/2013. Filed Date: 2/27/13. Accession... Due: 5 p.m. ET 3/20/13. The filings are accessible in the Commission's eLibrary system by clicking on...
41 CFR 105-56.017 - Centralized salary offset computer match.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Centralized salary... Services Administration 56-SALARY OFFSET FOR INDEBTEDNESS OF FEDERAL EMPLOYEES TO THE UNITED STATES Centralized Salary Offset (CSO) Procedures-GSA as Creditor Agency § 105-56.017 Centralized salary offset...
Cyclin D1, Id1 and EMT in breast cancer
International Nuclear Information System (INIS)
Tobin, Nicholas P; Sims, Andrew H; Lundgren, Katja L; Lehn, Sophie; Landberg, Göran
2011-01-01
Cyclin D1 is a well-characterised cell cycle regulator with established oncogenic capabilities. Despite these properties, studies report contrasting links to tumour aggressiveness. It has previously been shown that silencing cyclin D1 increases the migratory capacity of MDA-MB-231 breast cancer cells with concomitant increase in 'inhibitor of differentiation 1' (ID1) gene expression. Id1 is known to be associated with more invasive features of cancer and with the epithelial-mesenchymal transition (EMT). Here, we sought to determine if the increase in cell motility following cyclin D1 silencing was mediated by Id1 and enhanced EMT-features. To further substantiate these findings we aimed to delineate the link between CCND1, ID1 and EMT, as well as clinical properties in primary breast cancer. Protein and gene expression of ID1, CCND1 and EMT markers were determined in MDA-MB-231 and ZR75 cells by western blot and qPCR. Cell migration and promoter occupancy were monitored by transwell and ChIP assays, respectively. Gene expression was analysed from publicly available datasets. The increase in cell migration following cyclin D1 silencing in MDA-MB-231 cells was abolished by Id1 siRNA treatment and we observed cyclin D1 occupancy of the Id1 promoter region. Moreover, ID1 and SNAI2 gene expression was increased following cyclin D1 knock-down, an effect reversed with Id1 siRNA treatment. Similar migratory and SNAI2 increases were noted for the ER-positive ZR75-1 cell line, but in an Id1-independent manner. In a meta-analysis of 1107 breast cancer samples, CCND1 low /ID1 high tumours displayed increased expression of EMT markers and were associated with reduced recurrence free survival. Finally, a greater percentage of CCND1 low /ID1 high tumours were found in the EMT-like 'claudin-low' subtype of breast cancer than in other subtypes. These results indicate that increased migration of MDA-MB-231 cells following cyclin D1 silencing can be mediated by Id
Sabolčák, Peter
2006-01-01
FlowIDS is system which can detect some of the undesirable traffi c in computer networks (undesirable traffic could be also ie. virus activity or overloading of network) and mostly doing counteraction which are set by administrator. Information about data ows are provided by hardware of network infrastructure, eliminitaion of undesirable activity is done through changes in network hardware settings. Regarding the quantity of solution which are provided on market, I decided to focus on Cisco n...
17 CFR 210.6-04 - Balance sheets.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Balance sheets. 210.6-04... sheets. This rule is applicable to balance sheets filed by registered investment companies except for... of this part. Balance sheets filed under this rule shall comply with the following provisions: Assets...
International Nuclear Information System (INIS)
Bäuerle, Bettina; Sandalova, Tatyana; Schneider, Gunter; Rieger, Paul-Gerhard
2006-01-01
This is the first report of the crystallization of an IDS-epimerase from A. tumefaciens BY6 and its l-selenomethionine derivative. The initial degradation of all stereoisomers of the complexing agent iminodisuccinate (IDS) is enabled by an epimerase in the bacterial strain Agrobacterium tumefaciens BY6. This protein was produced in Escherichia coli, purified and crystallized by the hanging-drop vapour-diffusion method. Crystals of IDS-epimerase were obtained under several conditions. The best diffracting crystals were grown in 22% PEG 3350, 0.2 M (NH 4 ) 2 SO 4 and 0.1 M bis-Tris propane pH 7.2 at 293 K. These crystals belong to the monoclinic space group P2 1 , with unit-cell parameters a = 55.4, b = 104.2, c = 78.6 Å, β = 103.3°, and diffracted to 1.7 Å resolution. They contain two protein molecules per asymmetric unit. In order to solve the structure using the MAD phasing method, crystals of the l-selenomethionine-substituted epimerase were grown in the presence of 20% PEG 3350, 0.2 M Na 2 SO 4 and 0.1 M bis-Tris propane pH 8.5
17 CFR 202.3a - Instructions for filing fees.
2010-04-01
... Commission's Web site at http://www.sec.gov for the proper format. (2) Instructions for payment of fees by... facilitate tracing the funds if any problems occur. If a wire transfer of filing fees does not contain the... paragraph (e). A company must update its account and other addresses using the EDGAR Web site. This method...
Derivation of Huntington Disease affected Genea046 human embryonic stem cell line
Directory of Open Access Journals (Sweden)
Biljana Dumevska
2016-03-01
Full Text Available The Genea046 human embryonic stem cell line was derived from a donated, fully commercially consented ART blastocyst, carrying HTT gene CAG expansion of 45 repeats, indicative of Huntington Disease. Following ICM outgrowth on inactivated human feeders, karyotype was confirmed as 46, XX by CGH and STR analysis demonstrated a female Allele pattern. The hESC line had pluripotent cell morphology, 85% of cells expressed Nanog, 92% Oct4, 75% Tra1–60 and 99% SSEA4 and demonstrated Alkaline Phosphatase activity. The cell line was negative for Mycoplasma and visible contamination.
48 CFR 235.017 - Federally Funded Research and Development Centers.
2010-10-01
... DEVELOPMENT CONTRACTING 235.017 Federally Funded Research and Development Centers. (a) Policy. (2) No DoD... Funded Research and Development Center (FFRDC) if a member of its board of directors or trustees... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Federally Funded Research...
17 CFR 210.3-13 - Filing of other financial statements in certain cases.
2010-04-01
... EXCHANGE COMMISSION FORM AND CONTENT OF AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933... Financial Statements § 210.3-13 Filing of other financial statements in certain cases. The Commission may... investors, permit the omission of one or more of the financial statements herein required or the filing in...
Kanabus, Benoît; Popa, Délia
2017-01-01
Dès lors, on entend mieux la question sur laquelle se referment les mille pages du Marx : « La pensée de Marx nous place devant la question abyssale : qu’est-ce que la vie » ? Cette question peut être reposée à nouveaux frais à l’âge du capitalisme avancé, où, comme le notait Adorno, la vie est devenue « l’idéologie de sa propre absence ». La recherche d’un autre rapport à l’idéologie vient alors prendre le relais de la lutte anti-idéologique de la théorie critique. Cette recherche part du po...
77 FR 43585 - Combined Notice of Filings #1
2012-07-25
...-000. Applicants: Mehoopany Wind Energy LLC. Description: Notice of Self-Certification of Exempt Wholesale Generator Status of Mehoopany Wind Energy LLC. Filed Date: 7/17/12. Accession Number: 20120717... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Combined Notice of Filings 1 Take notice...
ID3 contributes to cerebrospinal fluid seeding and poor prognosis in medulloblastoma
International Nuclear Information System (INIS)
Phi, Ji Hoon; Choi, Seung Ah; Lim, Sang-Hee; Lee, Joongyub; Wang, Kyu-Chang; Park, Sung-Hye; Kim, Seung-Ki
2013-01-01
The inhibitor of differentiation (ID) genes have been implicated as promoters of tumor progression and metastasis in many human cancers. The current study investigated the expression and functional roles of ID genes in seeding and prognosis of medulloblastoma. ID gene expression was screened in human medulloblastoma tissues. Knockdown of ID3 gene was performed in medulloblastoma cells in vitro. The expression of metastasis-related genes after ID3 knockdown was assessed. The effect of ID3 knockdown on tumor seeding was observed in an animal model in vivo. The survival of medulloblastoma patients was plotted according to the ID3 expression levels. Significantly higher ID3 expression was observed in medulloblastoma with cerebrospinal fluid seeding than tumors without seeding. Knockdown of ID3 decreased proliferation, increased apoptosis, and suppressed the migration of D283 medulloblastoma cells in vitro. In a seeding model of medulloblastoma, ID3 knockdown in vivo with shRNA inhibited the growth of primary tumors, prevented the development of leptomeningeal seeding, and prolonged animal survival. High ID3 expression was associated with shorter survival of medulloblastoma patients, especially in Group 4 medulloblastomas. High ID3 expression is associated with medullolbastoma seeding and is a poor prognostic factor, especially in patients with Group 4 tumors. ID3 may represent the metastatic/ aggressive phenotype of a subgroup of medulloblastoma
International Nuclear Information System (INIS)
Jiang Xinyu; Liu Lu; Gao Wen; Chen Daozhen; Huang Ying; Yang Min; Luo Shineng
2008-01-01
Objective: The aims of the study were to find out the optimal 131 I labeling method with 17-allylamino, 17-demethoxygeldanamycin (17-AAG) and also to study its biodistribution in animals. Methods: 131 I-17-AAG was prepared by the reaction of 17-AAG with Na 131 I in the presence of hydrogen peroxide. The labeling efficiency and the stability of 131 I-17-AAG were measured by paper chromatograph. The biodistribution in the ICR normal mice was observed by the blood samplings and major organs that were taken out from mice at 0.5, 1, 4, 8, 24 h after 131 I-17-AAG injection through tail veins. VX2 tumor was also implanted in rabbit liver for in vivo imaging with SPECT. Results: The optimal labeling conditions of 17-AAG with mi were determined. The labeling efficiency was 85.65%. The radiochemical purity of 131 I- 17-AAG in acetoacetate solution was (96.51 ± 0.80)% after purification and its radiochemical purity in normal saline solution was (95.57 ± 0.09)%. The radiochemical purity could keep to 90% in normal saline after 5 d at 4 degree C. The biodistribution study in normal mice showed that the uptake (percentage activity of injection dose per gram of tissue, % ID/g) in liver and kidney was less than that in cholecyst [(3.0963 ± 1.3394) %ID/g] at 0.5 h post-injection, and the uptake in stomach and intestine reached to the highest level at 4 h post-injection. The SPECT images showed that the 131 I-17-AAG was obviously concentrated in the tumor after injection at 2 h and 4 d, 6 d, 14 d with the highest tumor to non-tumor (T/NT) radioactivity ratio of 10.36. Conclusions: The labeling method of 17-AAG with 131 I was successfully established. The 131 I-17-AAG in normal saline had a good stability. The main biodistribution in mice was in digestive system and was excreted through the intestinal tract. The SPECT images showed that 131 I-17-AAG might be a potential target-directed agent to the tumor. (authors)
ID-pilet teeb Tallinnas võidukäiku / Anneli Lepp
Lepp, Anneli
2006-01-01
Vt. ka Postimees : na russkom jazõke 12. jaan. lk 3. Tallinna transpordiameti peaökonomisti Mart Moosuse sõnul moodustas ID-pilet 60,7% ühistranspordi piletituludest, Tartus oli vastav näitaja aga alla 1%. Tartut teenindava bussifirma AS Connex Eesti finantsjuht Tiina Telling peab suure erinevuse põhjuseks asjaolu, et Tallinnas on ID-pilet paberpiletist 40-88% soodsam, Tartus hinnavahe aga puudub või on lausa negatiivne ID-pileti kahjuks. Lisa: ID-pilet
Directory of Open Access Journals (Sweden)
Hendro Agus Prakoso
2016-09-01
berita kedua media tersebut. Frekuensi berita berjumlah 107 di Republika.co.id dan 51 berita di Tempo.co.id Ragam berita Republika.co.id didominasi konsep Spesialisasi sebesar 22,4% dari 107 berita, sedangkan pada Tempo.co.id didominasi konsep Nama baik sebesar 23,5% dari 51 berita. Sumber berita pada Republika.co.id mayoritas berasal dari Liputan langsung sebesar 42,9% dari 107 berita sedangkan pada Tempo.co.id mayoritas berasal dari Intelektual sebesar 54,9% dari 51 berita.
75 FR 9887 - Combined No.tice of Filings
2010-03-04
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Combined No.tice of Filings February 17, 2010. Take notice that the Commission has received the following Natural Gas Pipeline Rate and Refund Report filings: Docket Numbers: RP10-370-000. Applicants: Kinder Morgan Interstate Gas Trans. LLC...
Epigenetic inactivation of inhibitor of differentiation 4 (Id4) correlates with prostate cancer
International Nuclear Information System (INIS)
Sharma, Pankaj; Chinaranagari, Swathi; Patel, Divya; Carey, Jason; Chaudhary, Jaideep
2012-01-01
The inhibitor of DNA-binding (Id) proteins, Id1–4 are negative regulators of basic helix-loop-helix (bHLH) transcription factors. As key regulators of cell cycle and differentiation, expression of Id proteins are increasingly observed in many cancers and associated with aggressiveness of the disease. Of all the four Id proteins, the expression of Id1, Id2, and to a lesser extent, Id3 in prostate cancer and the underlying molecular mechanism is relatively well known. On the contrary, our previous results demonstrated that Id4 acts as a potential tumor suppressor in prostate cancer. In the present study, we extend these observations and demonstrate that Id4 is down-regulated in prostate cancer due to promoter hypermethylation. We used prostate cancer tissue microarrays to investigate Id4 expression. Methylation specific PCR on bisulfite treated DNA was used to determine methylation status of Id4 promoter in laser capture micro-dissected normal, stroma and prostate cancer regions. High Id4 expression was observed in the normal prostate epithelial cells. In prostate cancer, a stage-dependent decrease in Id4 expression was observed with majority of high grade cancers showing no Id4 expression. Furthermore, Id4 expression progressively decreased in prostate cancer cell line LNCaP and with no expression in androgen-insensitive LNCaP-C81 cell line. Conversely, Id4 promoter hypermethylation increased in LNCaP-C81 cells suggesting epigenetic silencing. In prostate cancer samples, loss of Id4 expression was also associated with promoter hypermethylation. Our results demonstrate loss of Id4 expression in prostate cancer due to promoter hypermethylation. The data strongly support the role of Id4 as a tumor suppressor
Schieve, Laura A.; Clayton, Heather B.; Durkin, Maureen S.; Wingate, Martha S.; Drews-Botsch, Carolyn
2015-01-01
While studies report associations between perinatal outcomes and both autism spectrum disorder (ASD) and intellectual disability (ID), there has been little study of ASD with versus without co-occurring ID. We compared perinatal risk factors among 7547 children in the 2006-2010 Autism and Developmental Disability Monitoring Network classified as…
76 FR 62790 - Combined Notice of Filings #1
2011-10-11
... Tuesday, October 18, 2011. Docket Numbers: ER11-4651-000. Applicants: Ford Motor Company. Description: Notice of Termination of Ford Motor Company. Filed Date: 09/27/2011. Accession Numbers: 20110927-5136... England Power Company. Description: New England Power Company submits tariff filing per 35.17(b...
Achieving Payoffs from an Industry Cloud Ecosystem at BankID
DEFF Research Database (Denmark)
Eaton, Ben; Hallingby, Hanne Kristine; Nesse, Per-Jonny
2014-01-01
BankID is an industry cloud owned by Norwegian banks. It provides electronic identity, authentication and electronic signing capabilities for banking, merchant and government services. More than 60% of the population uses BankID services. As the broader ecosystem around BankID evolved, challenges......—arising from tensions between different parts of the ecosystem—had to be resolved. The four lessons learned from the BankID case will help others to build an industry cloud and establish a healthy ecosystem to service a broad user base....
Jiang, Yuanzhi; Zhang, Lijuan; Zhang, Hang; Zhang, Cui; Liu, Shuangxi
2016-10-01
Hierarchical Ni0.54Co0.46O2 architectures composed by nanowires or nanosheets were successfully grown on bio-mass carbon fiber cloth (CFC) by hydrothermal method. The morphology of Ni0.54Co0.46O2 can be effectively controlled by using different precipitators. The structural effects of the two kinds of morphologies were researched. the results suggest that the Ni0.54Co0.46O2 nanosheet arrays grown on CFC (NCO-NSs/CFC) shows a higher Faradaic areal capacity of 438 μAh cm-2 (238.1 mAh g-1) at a current density of 1 mA cm-2 and still about 90.3% initial capacity retention even at the high current density of 50 mA cm-2. Moreover, an all-solid-state flexible symmetric supercapacitor device has been successfully assembled. The optimized device delivers superior electrochemical performance with an outstanding energy density of 92.4 Wh kg-1 at a power density of 207.2 W kg-1. Such hierarchical nanostructure composed by well-aligned uniform Ni0.54Co0.46O2 nanosheet arrays grown on bio-mass carbon fiber cloth might hold great promise as battery-type electrode material for high-performance supercapacitor.
27 CFR 17.6 - Signature authority.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Signature authority. 17.6... PRODUCTS General Provisions § 17.6 Signature authority. No claim, bond, tax return, or other required... other proper notification of signature authority has been filed with the TTB office where the required...
IMI's CANCER-ID: Status of liquid biopsy standardization
Pantel, Klaus; Terstappen, Leon W. M. M.; Baggiani, Barbara; Krahn, Thomas; Schlange, Thomas
The CANCER-ID (www.cancer-id.eu) consortium was established in early 2015 with more than 30 partners as part of the Innovative Medicines Initiative (IMI), Europe's largest public-private partnership funded in equal parts by the European Union and the European Federation of Pharmaceutical Industries
Security analysis for biometric data in ID documents
Schimke, S.; Kiltz, S.; Vielhauer, C.; Kalker, A.A.C.M.
2005-01-01
In this paper we analyze chances and challenges with respect to the security of using biometrics in ID documents. We identify goals for ID documents, set by national and international authorities, and discuss the degree of security, which is obtainable with the inclusion of biometric into documents
Complex autism spectrum disorder in a patient with a 17q12 microduplication.
Brandt, Tracy; Desai, Khyati; Grodberg, David; Mehta, Lakshmi; Cohen, Ninette; Tryfon, Ana; Kolevzon, Alexander; Soorya, Latha; Buxbaum, Joseph D; Edelmann, Lisa
2012-05-01
Autism spectrum disorders (ASDs) are phenotypically complex developmental neuropsychiatric disorders affecting approximately 0.6% of the population. About 30-70% of affected children are also considered to have intellectual disability (ID). The underlying genetic causes of ASDs are diverse with a defined etiology in 16-20%. Array comparative genomic hybridization (aCGH) has proven useful in identifying sub-microscopic chromosome aberrations in a subset of patients, some of which have been shown to be recurrent. One such aberration is the 1.4 Mb microdeletion at chromosome 17q12, which has been reported to be associated with renal disease, growth restriction, diabetes, cognitive impairment, seizures, and in some cases an ASD. Patients with the reciprocal chromosome 17q12 microduplication typically have also been identified with ID and in some cases seizures and behavioral abnormalities. Here we report a patient with a de novo, 1.4 Mb microduplication diagnosed with significant ID involving complex deficits and autism. To our knowledge, this is the first report of a patient with the 17q12 microduplication and a complex ASD phenotype. Copyright © 2012 Wiley Periodicals, Inc.
Rohnke, M.; Schaepe, K.; Bachmann, A.-K.; Laenger, M.; Janek, J.
2017-11-01
The modelling of electrode kinetics of solid oxide fuel cells is challenging, as the electrodes can change their composition and microstructure during operation at high temperature. Here we present results from in situ studies, applying time of flight secondary ion mass spectrometry (ToF-SIMS) to investigate compositional surface changes of lanthanum strontium manganate (LSM) model electrodes. Geometrically well-defined LSM electrodes with the composition La0.74Sr0.17Mn1.01O2.9 were deposited as thin films on yttria stabilised zirconia (YSZ) single crystals by pulsed laser deposition. As counter electrode, a porous platinum electrode was applied on the backside of the solid electrolyte. The electrochemical polarisation experiments were carried out inside the ToF-SIMS analysis chamber at 430 °C, and the ToF-SIMS measurements were performed - in contrast to former work - for the first time during electrical polarisation at elevated temperatures. By applying either a cathodic or anodic potential to the LSM cathode, enrichment or depletion of the different metallic constituents on both, the LSM and free YSZ surface, and within the LSM near surface region, were observed. After polarisation, the system relaxes towards the thermodynamic equilibrium state. Already after the first heat treatment, diffusion of manganese and strontium from the LSM electrode onto the free YSZ surface is observed. The concomitant spreading of the three-phase boundary seems to be one reason for electrode activation after polarisation.
Ontogeny and Variability in Ribbing of Late Valanginian Lamellaptychi (Ammonitina)
Czech Academy of Sciences Publication Activity Database
Vašíček, Zdeněk; Klein, J.; Janssen, N. M. M.
2016-01-01
Roč. 86, č. 1 (2016), s. 17-28 ISSN 0208-9068 Institutional support: RVO:68145535 Keywords : Lamellaptychi * Mortilletilamellaptychus * ontogeny * Late Valanginian * south-eastern France Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.833, year: 2016 http://www.asgp.pl/sites/default/files/volumes/86_1_017_028.pdf
Energy Technology Data Exchange (ETDEWEB)
Bäuerle, Bettina [Institute of Microbiology, University of Stuttgart, 70569 Stuttgart (Germany); Sandalova, Tatyana; Schneider, Gunter [Department of Medical Biochemistry and Biophysics, Karolinska Institutet, 17177 Stockholm (Sweden); Rieger, Paul-Gerhard, E-mail: pg.rieger@imb.uni-stuttgart.de [Institute of Microbiology, University of Stuttgart, 70569 Stuttgart (Germany)
2006-08-01
This is the first report of the crystallization of an IDS-epimerase from A. tumefaciens BY6 and its l-selenomethionine derivative. The initial degradation of all stereoisomers of the complexing agent iminodisuccinate (IDS) is enabled by an epimerase in the bacterial strain Agrobacterium tumefaciens BY6. This protein was produced in Escherichia coli, purified and crystallized by the hanging-drop vapour-diffusion method. Crystals of IDS-epimerase were obtained under several conditions. The best diffracting crystals were grown in 22% PEG 3350, 0.2 M (NH{sub 4}){sub 2}SO{sub 4} and 0.1 M bis-Tris propane pH 7.2 at 293 K. These crystals belong to the monoclinic space group P2{sub 1}, with unit-cell parameters a = 55.4, b = 104.2, c = 78.6 Å, β = 103.3°, and diffracted to 1.7 Å resolution. They contain two protein molecules per asymmetric unit. In order to solve the structure using the MAD phasing method, crystals of the l-selenomethionine-substituted epimerase were grown in the presence of 20% PEG 3350, 0.2 M Na{sub 2}SO{sub 4} and 0.1 M bis-Tris propane pH 8.5.
75 FR 28602 - Corning Natural Gas Corporation; Notice of Compliance Filing
2010-05-21
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR09-30-003] Corning Natural Gas Corporation; Notice of Compliance Filing May 17, 2010. Take notice that on May 10, 2010, Corning Natural Gas Corporation, (Corning) filed a corrected rate sheet to replace the rate sheet filed with its...
17 CFR 202.2 - Pre-filing assistance and interpretative advice.
2010-04-01
... filings with the Commission may receive advice of a general nature as to the preparation thereof..., except in connection with matters under the Public Utility Holding Company Act of 1935 and certain matters under the Investment Company Act of 1940, at one of its regional offices. [25 FR 6736, July 15...
17 CFR 230.487 - Effectiveness of registration statements filed by certain unit investment trusts.
2010-04-01
... Investment Companies; Business Development Companies § 230.487 Effectiveness of registration statements filed... Company Act of 1940 that files a registration statement pursuant to the Act in connection with the..., may designate a date and time for such registration statement to become effective. If the registrant...
Lynch, Michael
2017-08-01
This essay takes up a series of questions about the connection between 'symmetry' in Science and Technology Studies (STS) and 'post-truth' in contemporary politics. A recent editorial in this journal by Sergio Sismondo argues that current discussions of 'post-truth' have little to do with conceptions of 'symmetry' or with concerns about 'epistemic democracy' in STS, while others, such as Steve Fuller and Harry Collins, insist that there are such connections. The present essay discusses a series of questions about the meaning of 'post-truth' and 'symmetry', and the connections of those concepts to each other and to 'epistemic democracy'. The essay ends with a series of other questions about STS and contemporary politics, and an invitation to further discussions.
77 FR 12276 - Combined Notice of Filings #1
2012-02-29
.... Docket Numbers: ER12-610-001. Applicants: Shiloh III Lessee, LLC. Description: Shiloh III Lessee MBR...: Perrin Ranch Wind, LLC Second Amendment to MBR Application to be effective 1/1/2012. Filed Date: 2/17/12... Cimarron Renewable Energy Company, LLC's MBR Application. Filed Date: 2/9/12. Accession Number: 20120209...
A brief review of revocable ID-based public key cryptosystem
Directory of Open Access Journals (Sweden)
Tsu-Yang Wu
2016-03-01
Full Text Available The design of ID-based cryptography has received much attention from researchers. However, how to revoke the misbehaviour/compromised user in ID-based public key cryptosystem becomes an important research issue. Recently, Tseng and Tsai proposed a novel public key cryptosystem called revocable ID-based public key cryptosystem (RIBE to solve the revocation problem. Later on, numerous research papers based on the Tseng-Tsai key RIBE were proposed. In this paper, we brief review Tseng and Tsai's RIBE. We hope this review can help the readers to understand the Tseng and Tsai's revocable ID-based public key cryptosystem.
Id1 represses osteoclast-dependent transcription and affects bone formation and hematopoiesis.
Directory of Open Access Journals (Sweden)
April S Chan
2009-11-01
Full Text Available The bone-bone marrow interface is an area of the bone marrow microenvironment in which both bone remodeling cells, osteoblasts and osteoclasts, and hematopoietic cells are anatomically juxtaposed. The close proximity of these cells naturally suggests that they interact with one another, but these interactions are just beginning to be characterized.An Id1(-/- mouse model was used to assess the role of Id1 in the bone marrow microenvironment. Micro-computed tomography and fracture tests showed that Id1(-/- mice have reduced bone mass and increased bone fragility, consistent with an osteoporotic phenotype. Osteoclastogenesis and pit formation assays revealed that loss of Id1 increased osteoclast differentiation and resorption activity, both in vivo and in vitro, suggesting a cell autonomous role for Id1 as a negative regulator of osteoclast differentiation. Examination by flow cytometry of the hematopoietic compartment of Id1(-/- mice showed an increase in myeloid differentiation. Additionally, we found increased expression of osteoclast genes, TRAP, Oscar, and CTSK in the Id1(-/- bone marrow microenvironment. Lastly, transplantation of wild-type bone marrow into Id1(-/- mice repressed TRAP, Oscar, and CTSK expression and activity and rescued the hematopoietic and bone phenotype in these mice.In conclusion, we demonstrate an osteoporotic phenotype in Id1(-/- mice and a mechanism for Id1 transcriptional control of osteoclast-associated genes. Our results identify Id1 as a principal player responsible for the dynamic cross-talk between bone and bone marrow hematopoietic cells.
La certificazione professionale I&D in Europa
Franco, Augusta
2003-01-01
The statement points out the activity of I&D European associations in the field of competences' certification, in ECIA federation's area as well as in the national one. In the statement there are references on history and outcomes of DECIDoc project; objectives and operative stages of CERTIDoc project, promoted by ECIA; and enterprises of I&D associations in France, Spain, Germany and Italy. Secondly, it is illustrated the activity of Italian librarians and archivists associatio...
17 CFR 230.424 - Filing of prospectuses, number of copies.
2010-04-01
... result in filing with the Commission by that date. (7) A form of prospectus that identifies selling... cross reference to the date(s) of the related prospectus and any prospectus supplements thereto that.... 77e(b)) with respect to the securities currently being offered or sold. The cross reference may be set...
77 FR 24482 - Ameren Corporation; Notice of Filing
2012-04-24
... accounting entries in accordance with the Commission's June 17, 2010 order in Docket No. EC10-52-000 and Part... regarding Ameren Illinois Company's accounting and rate treatment of goodwill. Any person desiring to... interventions in lieu of paper using the ``eFiling'' link at http://www.ferc.gov . Persons unable to file...
People with ID as interviewers and co-researchers: experiences and reflection.
Lieshout, H. van
2012-01-01
Aim: To share the experience of working with people with intellectual disabilities (ID) as interviewers in a qualitative study about community participation of people with ID. We reflect on two perspectives: the interviewers and the researchers. Method: Eighteen people with ID were interviewed by
An online ID identification system for liquefied-gas cylinder plant
He, Jin; Ding, Zhenwen; Han, Lei; Zhang, Hao
2017-11-01
An automatic ID identification system for gas cylinders' online production was developed based on the production conditions and requirements of the Technical Committee for Standardization of Gas Cylinders. A cylinder ID image acquisition system was designed to improve the image contrast of ID regions on gas cylinders against the background. Then the ID digits region was located by the CNN template matching algorithm. Following that, an adaptive threshold method based on the analysis of local average grey value and standard deviation was proposed to overcome defects of non-uniform background in the segmentation results. To improve the single digit identification accuracy, two BP neural networks were trained respectively for the identification of all digits and the easily confusable digits. If the single digit was classified as one of confusable digits by the former BP neural network, it was further tested by the later one, and the later result was taken as the final identification result of this single digit. At last, the majority voting was adopted to decide the final identification result for the 6-digit cylinder ID. The developed system was installed on a production line of a liquefied-petroleum-gas cylinder plant and worked in parallel with the existing weighing step on the line. Through the field test, the correct identification rate for single ID digit was 94.73%, and none of the tested 2000 cylinder ID was misclassified through the majority voting.
2010-10-01
... Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND ACQUISITIONS OF CONTROL Safety Integration Plans § 244.17 Procedures. (a) Each applicant shall file one...
38 CFR 17.34 - Tentative eligibility determinations.
2010-07-01
... 54212, Oct. 6, 1999] Hospital or Nursing Home Care and Medical Services in Foreign Countries ... provisions of §§ 17.36 through 17.38, when an application for hospital care or other medical services, except outpatient dental care, has been filed which requires an adjudication as to service connection or a...
Supporting co-creation with software, the idSpace platform
Van Rosmalen, Peter; Boon, Jo; Bitter-Rijpkema, Marlies; Sie, Rory; Sloep, Peter
2014-01-01
Innovation, in general, requires teamwork among specialist of different disciplines. The idSpace project developed ideas on how teams of collaborating innovators could best be supported. These ideas were embodied in a platform that the project developed. This idSpace platform allows its users to
Experiment information - GRIPDB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us GRI...a.nbdc01665-002 Description of data contents Experimentally identified GPCR interaction regions Data file File name: gri...pdb_exp_info.zip File URL: ftp://ftp.biosciencedbc.jp/archive/gripdb/LATEST/gripdb_exp_info.zip ...File size: 6.2 KB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/gri...es Data item Description ID Experiment information ID GRIP ID1 GRIP ID related wigh the experiment GRIP ID2 No. in GRI
46 CFR 171.017 - One and two compartment standards of flooding.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false One and two compartment standards of flooding. 171.017... standards of flooding. (a) One compartment standard of flooding. A vessel is designed to a one compartment standard of flooding if the margin line is not submerged when the total buoyancy between each set of two...
A Case Study: Business Process Reengineering at Raymond W. Bliss Army Community Hospital
1997-05-01
Among the causes listed are: • Inadequate Management of Resistance • Attempting Painless Reengineering • Lack of Understanding About Reengineering...Parathyroid Proc. 0.9554 $5,458 1 0.9554 $5,458 SD 290 Thyroid Proc 0.9362 $5,349 3 2.8086 $16,046 SD 291 Thyroglossal Proc 0.4657 $2,661 2 0.9314 $5,321...Tissues Breast Age 0-17 0.6146 $2,799 SD 284 Minor skin disord. w/o CC 0.4042 $1,841 SD 289 Parathyroid Proc. 0.9554 $4,351 SD 290 Thyroid Proc
Zhu, Ming; Zhang, Jie; Nie, Shaofa; Yan, Weirong
2012-09-01
There have been many studies concerning the associations of angiotensin-converting enzyme (ACE) I/D, angiotensinogen (AGT) M235T polymorphisms with pregnancy induced hypertension (PIH) among Chinese populations. However, the results were inconsistent, prompting the necessity of meta-analysis. Studies published in English and Chinese were mainly searched in EMbase, PubMed and CBM up to January 2012. Twenty-three studies with 3,551 subjects for ACE I/D and seven studies with 1,296 subjects for AGT M235T were included. Significant associations were found between ACE I/D and PIH under dominant, recessive and allelic models. A separate analysis confined to preeclampsia suggested that ACE I/D was associated with preeclampsia under recessive model and allelic model, but not dominant model. Stratified analyses were conducted as meta-regression analysis indicated that the sample size of case group was a significant source of heterogeneity, which suggested no significant association between ACE I/D and PIH in the subgroup of more than 100 cases. Associations were found between AGT M235T and PIH under dominant genetic model (OR = 1.59; 95 %CI: 1.04-2.42), recessive genetic model (OR = 1.60; 95 %CI: 1.07-2.40), and allelic model (OR = 1.40; 95 %CI: 1.17-1.68). No publication bias was found in either meta-analysis. The present meta-analysis suggested significant associations between ACE I/D, AGT M235T and PIH in Chinese populations. However, no significant association was found between ACE I/D and PIH in the subgroup of more than 100 cases. Studies with larger sample sizes are necessary to investigate the associations between gene polymorphisms and PIH in Chinese populations.
Energy Technology Data Exchange (ETDEWEB)
Williams, C.L.; Heyman, J.S.; Porreca, F.; Burks, T.F.
1986-03-05
The authors were interested in characterizing the relative importance of central (cerebral, spinal) and peripheral opioid receptors in inhibition of gastrointestinal transit. The mu-receptor selective agonist, (NMePhe/sup 3/,D-Pro/sup 4/)morphiceptin (PL017), was evaluated for its effectiveness in slowing gastrointestinal transit after subcutaneous, intracerebroventricular (i.c.v.) or intrathecal (i.th.) administration when given alone or after pretreatment with naloxonazine, an irreversible mu/sub 1/ selective opioid receptor antagonist. Male, ICR mice (20-25 g) were pretreated with saline, naloxone or naloxonazine (35 mg/kg, s.c.) 25 hr prior to testing. Gastrointestinal transit was evaluated in previously fasted (18 hr) mice by oral administration of a liquid radiolabelled marker (Na/sub 2//sup 51/CrO/sub 4/). I.th. PL017 (100-1000 ng) was effective in slowing transit, but was essentially insensitive to naloxone or naloxonazine pretreatment. PL017 produced a dose-related inhibition of transit when given by either the i.c.v. (100-1000 ng) or s.c.(1-10 mg/kg) route; this effect was not sensitive to naloxone pretreatment but was antagonized by naloxonazine. These results indicate that the opioid receptors mediating gastrointestinal transit in the brain and periphery may be mu/sub 1/. In contrast, the insensitivity to naloxonazine suggests that the gastrointestinal effects of PL017 in the spinal cord may be the result of activation of mu/sub 2/ or possibly delta opioid receptors.
A Contextual Model for Identity Management (IdM) Interfaces
Fuller, Nathaniel J.
2014-01-01
The usability of Identity Management (IdM) systems is highly dependent upon design that simplifies the processes of identification, authentication, and authorization. Recent findings reveal two critical problems that degrade IdM usability: (1) unfeasible techniques for managing various digital identifiers, and (2) ambiguous security interfaces.…
DEFF Research Database (Denmark)
Schøsler, Jørn
2013-01-01
Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer.......Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer....
How to save distressed IDS-physician marriages: a case study.
Collins, H; Johnson, B A
1998-04-01
A hospital-driven IDS that encounters serious problems resulting from ownership of a physician practice should address those problems by focusing on three core areas: vision and leadership, effectiveness of operations, and physician compensation arrangements. If changes in these areas do not lead to improvements, the IDS may need to consider organizational restructuring. In one case study, a hospital-driven IDS faced the problem of owning a poorly performing MSO with a captive physician group. The IDS's governing board determined that the organization lacked effective communication with the physicians and that realization of the organization's vision would require greater physician involvement in organizational decision making. The organization is expected to undergo some corporate reorganization in which physicians will acquire an equity interest in the enterprise.
A Good IDS Response Protocol of MANET Containment Strategies
Cheng, Bo-Chao; Chen, Huan; Tseng, Ryh-Yuh
Much recent research concentrates on designing an Intrusion Detection System (IDS) to detect the misbehaviors of the malicious node in MANET with ad-hoc and mobility natures. However, without rapid and appropriate IDS response mechanisms performing follow-up management services, even the best IDS cannot achieve the desired primary goal of the incident response. A competent containment strategy is needed to limit the extent of an attack in the Incident Response Life Cycle. Inspired by the T-cell mechanisms in the human immune system, we propose an efficient MANET IDS response protocol (T-SecAODV) that can rapidly and accurately disseminate alerts of the malicious node attacks to other nodes so as to modify their AODV routing tables to isolate the malicious nodes. Simulations are conducted by the network simulator (Qualnet), and the experiment results indicate that T-SecAODV is able to spread alerts steadily while greatly reduce faulty rumors under simultaneous multiple malicious node attacks.
Ekspert : mobiil-ID kasutamine valimistel turvariske ei tekita / Holger Roonemaa
Roonemaa, Holger
2008-01-01
E-valimiste projektijuhi Taavi Martensi väitel pole põhjust kahelda mobiil-ID turvalisuses. Valimiskomisjoni esimehe Heiki Sibula meelest peaks m-ID kaarte välja andma kodakondsus- ja migratsiooniamet
Picture This: How to Establish an Effective School ID Card Program
Finkelstein, David
2013-01-01
Most school districts do not have an ID card policy that everyone knows and follows, yet. many school districts are implementing ID card programs to address concerns about safety, efficiency, and convenience. A well-thought-out ID card program leads to greater security and smoother operations throughout the school and should thus be a priority.…
Inhibitor of differentiation 4 (Id4) is a potential tumor suppressor in prostate cancer
International Nuclear Information System (INIS)
Carey, Jason PW; Asirvatham, Ananthi J; Galm, Oliver; Ghogomu, Tandeih A; Chaudhary, Jaideep
2009-01-01
Inhibitor of differentiation 4 (Id4), a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH) transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP) analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS), expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR), p21, p27 and p53 expression in DU145 cells. The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously silenced tumor suppressors
Id-1 is not expressed in the luminal epithelial cells of mammary glands
International Nuclear Information System (INIS)
Uehara, Norihisa; Chou, Yu-Chien; Galvez, Jose J; Candia, Paola de; Cardiff, Robert D; Benezra, Robert; Shyamala, Gopalan
2003-01-01
The family of inhibitor of differentiation/DNA binding (Id) proteins is known to regulate development in several tissues. One member of this gene family, Id-1, has been implicated in mammary development and carcinogenesis. Mammary glands contain various cell types, among which the luminal epithelial cells are primarily targeted for proliferation, differentiation and carcinogenesis. Therefore, to assess the precise significance of Id-1 in mammary biology and carcinogenesis, we examined its cellular localization in vivo using immunohistochemistry. Extracts of whole mammary glands from wild type and Id-1 null mutant mice, and tissue sections from paraffin-embedded mouse mammary glands from various developmental stages and normal human breast were subjected to immunoblot and immunohistochemical analyses, respectively. In both these procedures, an anti-Id-1 rabbit polyclonal antibody was used for detection of Id-1. In immunoblot analyses, using whole mammary gland extracts, Id-1 was detected. In immunohistochemical analyses, however, Id-1 was not detected in the luminal epithelial cells of mammary glands during any stage of development, but it was detected in vascular endothelial cells. Id-1 is not expressed in the luminal epithelial cells of mammary glands
1 CFR 17.3 - Criteria for emergency publication.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Criteria for emergency publication. 17.3..., AND PROCESSING OF DOCUMENTS FILING FOR PUBLIC INSPECTION AND PUBLICATION SCHEDULES Emergency Schedule § 17.3 Criteria for emergency publication. The emergency schedule is designed to provide the fastest...
75 FR 30014 - Consumers Energy Company; Notice of Baseline Filing
2010-05-28
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR10-25-000] Consumers Energy Company; Notice of Baseline Filing May 21, 2010. Take notice that on May 17, 2010, Consumers Energy Company (Consumers) submitted a baseline filing of its Statement of Operating Conditions for the...
Confinement margins for ignition and driven operation in Iter Eda ID
International Nuclear Information System (INIS)
Johner, J.
1995-09-01
Preliminary calculations for ITER EDA ID have been performed using the 1/2D thermal equilibrium code HELIOS. It is found that: - The maximum ignition margin for ITER ID (29%) is 6% less than for ITER OD (35%) and 5% less than for ITER CDA (34%). - Decreasing the ration τ * He /τ E from the nominal value 10 to a value of 5 gives a 12% gain in the maximum ignition margin. Increasing the ration from 10 to 15 causes a 22% loss in the margin. Furthermore, ignited equilibria non longer exist for τ * He /τ E ≥ 17.6. - Operation in driven mode with 50 MW of external power increases the confinement capability by 13%. With 100 MW, the improvement is 24%. - Lowering the fusion power from 1500 to 1000 MW slightly improves the maximum ignition margin (+5%) and allows operation below the Greenwald density limit. - A 10% reduction of the toroidal magnetic field with a correlative diminution of the plasma current for constant safety factor operation, causes a dramatic reduction (-18%) of the maximum ignition margin. - A fraction of neon of 0.68% would completely suppress the ignition margin. Furthermore, ignited equilibria, with the nominal fusion power and τ * He /τ E , no longer exist when the neon fraction exceeds 0.75%. (Author). 2 refs., 10 figs
1985-01-01
The crew assigned to the STS-51B mission included (seated left to right) Robert F. Overmyer, commander; and Frederick D. Gregory, pilot. Standing, left to right, are Don L. Lind, mission specialist; Taylor G. Wang, payload specialist; Norman E. Thagard, mission specialist; William E. Thornton, mission specialist; and Lodewijk van den Berg, payload specialist. Launched aboard the Space Shuttle Challenger on April 29, 1985 at 12:02:18 pm (EDT), the STS-51A mission's primary payload was the Spacelab-3.
STS-82 Pilot Scott Horowitz at SLF
1997-01-01
STS-82 Pilot Scott J. 'Doc' Horowitz flashes a wide grin for photographers after he lands his T-38 jet at KSCs Shuttle Landing Facility. Horowitz and the other six members of the STS-82 crew came from their home base at Johnson Space Center in Houston, TX, to spend the last few days before launch at KSC. STS-82 is scheduled for liftoff on Feb. 11 during a 65-minute launch window which opens at 3:56 a.m. EST. The 10-day flight aboard the Space Shuttle Discovery will be the second Hubble Space Telescope servicing mission.
Moreaux, G.; Lemoine, F. G.; Argus, D. F.; Santamaria-Gomez, A.; Willis, P.; Soudarin, L.; Gravelle, M.; Ferrage, P.
2016-01-01
In the context of the 2014 realization of the International Terrestrial Reference Frame (ITRF2014), the International DORIS Service (IDS) has delivered to the IERS a set of 1140 weekly SINEX files including station coordinates and Earth orientation parameters, covering the time period from 1993.0 to 2015.0. From this set of weekly SINEX files, the IDS Combination Center estimated a cumulative DORIS position and velocity solution to obtain mean horizontal and vertical motion of 160 stations at 71 DORIS sites. The main objective of this study is to validate the velocities of the DORIS sites by comparison with external models or time series. Horizontal velocities are compared with two recent global plate models (GEODVEL 2010 and NNR-MORVEL56). Prior to the comparisons, DORIS horizontal velocities were corrected for Global Isostatic Adjustment (GIA) from the ICE-6G (VM5a) model. For more than half of the sites, the DORIS horizontal velocities differ from the global plate models by less than 2-3 mm/yr. For five of the sites (Arequipa, Dionysos/Gavdos, Manila, Santiago) with horizontal velocity differences wrt these models larger than 10 mm/yr, comparisons with GNSS estimates show the veracity of the DORIS motions. Vertical motions from the DORIS cumulative solution are compared with the vertical velocities derived from the latest GPS cumulative solution over the time span 1995.0-2014.0 from the University of La Rochelle (ULR6) solution at 31 co-located DORIS-GPS sites. These two sets of vertical velocities show a correlation coefficient of 0.83. Vertical differences are larger than 2 mm/yr at 23 percent of the sites. At Thule the disagreement is explained by fine-tuned DORIS discontinuities in line with the mass variations of outlet glaciers. Furthermore, the time evolution of the vertical time series from the DORIS station in Thule show similar trends to the GRACE equivalent water height.
Moreaux, G.; Lemoine, F. G.; Argus, D. F.; Santamaría-Gómez, A.; Willis, P.; Soudarin, L.; Gravelle, M.; Ferrage, P.
2016-10-01
In the context of the 2014 realization of the International Terrestrial Reference Frame, the International DORIS (Doppler Orbitography Radiopositioning Integrated by Satellite) Service (IDS) has delivered to the IERS a set of 1140 weekly SINEX files including station coordinates and Earth orientation parameters, covering the time period from 1993.0 to 2015.0. From this set of weekly SINEX files, the IDS combination centre estimated a cumulative DORIS position and velocity solution to obtain mean horizontal and vertical motion of 160 stations at 71 DORIS sites. The main objective of this study is to validate the velocities of the DORIS sites by comparison with external models or time-series. Horizontal velocities are compared with two recent global plate models (GEODVEL 2010 and NNR-MORVEL56). Prior to the comparisons, DORIS horizontal velocities were corrected for Global Isostatic Adjustment from the ICE-6G (VM5a) model. For more than half of the sites, the DORIS horizontal velocities differ from the global plate models by less than 2-3 mm yr-1. For five of the sites (Arequipa, Dionysos/Gavdos, Manila and Santiago) with horizontal velocity differences with respect to these models larger than 10 mm yr-1, comparisons with GNSS estimates show the veracity of the DORIS motions. Vertical motions from the DORIS cumulative solution are compared with the vertical velocities derived from the latest GPS cumulative solution over the time span 1995.0-2014.0 from the University of La Rochelle solution at 31 co-located DORIS-GPS sites. These two sets of vertical velocities show a correlation coefficient of 0.83. Vertical differences are larger than 2 mm yr-1 at 23 percent of the sites. At Thule, the disagreement is explained by fine-tuned DORIS discontinuities in line with the mass variations of outlet glaciers. Furthermore, the time evolution of the vertical time-series from the DORIS station in Thule show similar trends to the GRACE equivalent water height.
Inhibitor of differentiation 4 (Id4 is a potential tumor suppressor in prostate cancer
Directory of Open Access Journals (Sweden)
Carey Jason PW
2009-06-01
Full Text Available Abstract Background Inhibitor of differentiation 4 (Id4, a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Methods Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS, expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Results Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR, p21, p27 and p53 expression in DU145 cells. Conclusion The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously
Prediction information - GRIPDB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us GRI...a.nbdc01665-004 Description of data contents Predicted GPCR interaction regions Data file File name: gripdb_...predicted_info.zip File URL: ftp://ftp.biosciencedbc.jp/archive/gripdb/LATEST/gripdb_predicted_info.zip File... size: 219 KB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/gripdb...entries Data item Description ID Prediction information ID GRIP ID GRIP ID related wigh the prediction Predi
Nuclear Structure References (NSR) file
International Nuclear Information System (INIS)
Ewbank, W.B.
1978-08-01
The use of the Nuclear Structure References file by the Nuclear Data Project at ORNL is described. Much of the report concerns format information of interest only to those preparing input to the system or otherwise needing detailed knowledge of its internal structure. 17 figures
ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells
International Nuclear Information System (INIS)
Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep
2016-01-01
Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.
ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells
Energy Technology Data Exchange (ETDEWEB)
Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep, E-mail: jchaudhary@cau.edu
2016-09-09
Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.
Guinea pig ID-like families of SINEs.
Kass, David H; Schaetz, Brian A; Beitler, Lindsey; Bonney, Kevin M; Jamison, Nicole; Wiesner, Cathy
2009-05-01
Previous studies have indicated a paucity of SINEs within the genomes of the guinea pig and nutria, representatives of the Hystricognathi suborder of rodents. More recent work has shown that the guinea pig genome contains a large number of B1 elements, expanding to various levels among different rodents. In this work we utilized A-B PCR and screened GenBank with sequences from isolated clones to identify potentially uncharacterized SINEs within the guinea pig genome, and identified numerous sequences with a high degree of similarity (>92%) specific to the guinea pig. The presence of A-tails and flanking direct repeats associated with these sequences supported the identification of a full-length SINE, with a consensus sequence notably distinct from other rodent SINEs. Although most similar to the ID SINE, it clearly was not derived from the known ID master gene (BC1), hence we refer to this element as guinea pig ID-like (GPIDL). Using the consensus to screen the guinea pig genomic database (Assembly CavPor2) with Ensembl BlastView, we estimated at least 100,000 copies, which contrasts markedly to just over 100 copies of ID elements. Additionally we provided evidence of recent integrations of GPIDL as two of seven analyzed conserved GPIDL-containing loci demonstrated presence/absence variants in Cavia porcellus and C. aperea. Using intra-IDL PCR and sequence analyses we also provide evidence that GPIDL is derived from a hystricognath-specific SINE family. These results demonstrate that this SINE family continues to contribute to the dynamics of genomes of hystricognath rodents.
17 CFR 270.30b1-7 - Monthly report for money market funds.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Monthly report for money... money market funds. (a) Report. Every registered open-end management investment company, or series thereof, that is regulated as a money market fund under § 270.2a-7 must file with the Commission a monthly...
The Self-Identity Protein IdsD Is Communicated between Cells in Swarming Proteus mirabilis Colonies.
Saak, Christina C; Gibbs, Karine A
2016-12-15
Proteus mirabilis is a social bacterium that is capable of self (kin) versus nonself recognition. Swarming colonies of this bacterium expand outward on surfaces to centimeter-scale distances due to the collective motility of individual cells. Colonies of genetically distinct populations remain separate, while those of identical populations merge. Ids proteins are essential for this recognition behavior. Two of these proteins, IdsD and IdsE, encode identity information for each strain. These two proteins bind in vitro in an allele-restrictive manner. IdsD-IdsE binding is correlated with the merging of populations, whereas a lack of binding is correlated with the separation of populations. Key questions remained about the in vivo interactions of IdsD and IdsE, specifically, whether IdsD and IdsE bind within single cells or whether IdsD-IdsE interactions occur across neighboring cells and, if so, which of the two proteins is exchanged. Here we demonstrate that IdsD must originate from another cell to communicate identity and that this nonresident IdsD interacts with IdsE resident in the recipient cell. Furthermore, we show that unbound IdsD in recipient cells does not cause cell death and instead appears to contribute to a restriction in the expansion radius of the swarming colony. We conclude that P. mirabilis communicates IdsD between neighboring cells for nonlethal kin recognition, which suggests that the Ids proteins constitute a type of cell-cell communication. We demonstrate that self (kin) versus nonself recognition in P. mirabilis entails the cell-cell communication of an identity-encoding protein that is exported from one cell and received by another. We further show that this intercellular exchange affects swarm colony expansion in a nonlethal manner, which adds social communication to the list of potential swarm-related regulatory factors. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Directory of Open Access Journals (Sweden)
Chmaisse Hania
2009-01-01
Full Text Available Type-2 diabetes mellitus (T2DM is a chronic disorder characterized by a varying range of predominant insulin resistance with relative insulin deficiency, to predominant insulin secretory defect with or without insulin resistance. Familial clustering as well as epidemiological studies has shown that genetic factors play a role in the development and progression of the disease. Among the genetic factors found to be associated with development of T2DM is the angiotensin-I converting enzyme (ACE gene, which is located on chromosome 17q23. This study was conducted to study the association between ACE gene insertion/deletion (I/D polymorphism and T2DM in a Lebanese diabetic cohort. Fifty-one patients with T2DM and 40 control subjects from different parts of Lebanon underwent genotyping for the ACE I/D, which was performed by PCR using specific primers. Chi-square and analysis of variance (ANOVA were used for asso-ciation studies and to assess the differences in the values among the groups. The distribution of the genotypes in the patients was as follows: 15/51 (29.4% were homozygous for deletion allele (DD genotype, 24/51 (47.1% were heterozygous (ID genotype, and 12/51 (23.5% were homo-zygous for insertion allele (II genotype. Among the control subjects, 16/40 (40% were homo-zygous for deletion (DD genotype, 13/40 (32.5% were heterozygous (ID genotype, and 11/40 (27.5% were homozygous for insertion (II genotype. The prevalence of the D-allele in T2DM patients (52.9% was not significantly different from that in the controls (56.3%. Thus, ACE I/D dimorphism cannot be considered a risk factor for T2DM in the Lebanese population.
Événement, idéologie et utopie
Directory of Open Access Journals (Sweden)
Jean-Luc AMALRIC
2014-12-01
Full Text Available RESUMEL’hypothèse que tente d’esquisser cet article est que l’idée ricœurienne d’une médiatisation dynamique des contradictions de l’imaginaire social présuppose une corrélation originaire de l’idéologie et de l’utopie qui ne peut elle-même être comprise qu’à partir de l’événement de l’institution d’un imaginaire social constituant. Dans un premier temps, l’article s’efforce de cerner ce qui fait la spécificité de la théorie ricœurienne de l’idéologie et de l’utopie comme « pratiques imaginatives », en soulignant à ce titre l’influence déterminante des thèses de Jacques Ellul sur l’idéologie. Puis, dans un second temps, il s’engage dans une analyse régressive qui conduit de la réappropriation ricœurienne de la conception dialectique de l’idéologie et de l’utopie exposée par Mannheim à l’idée d’un fondement événementiel de ces deux formes opposées de l’imaginaire social.Mots-Clés : Evénement, idéologie, utopie, Ellul, Mannheim. ABSTRACTThis paper attempts to sketch out the hypothesis that the Ricœurian conception of a dynamic mediatization of the contradictions of the social imaginary presupposes an original correlation between ideology and utopia, which can itself be understood only from the event that institutes a constitutive social imaginary. The first part of the paper marks out the specificity of the Ricœurian theory of ideology and utopia in terms of “imaginative practices”, underlining the determining influence of Jacques Ellul’s theses on ideology. The second part tries to develop a regressive argument, starting from the Ricœurian re-appropriation of Mannheim’s dialectical conception of ideology and utopia, and leading back to the idea of an event foundation for these two opposed forms of the social imaginary.Keywords : Event, Ideology, Utopia, Ellul, Mannheim
L-Area STS MTR/NRU/NRX Grapple Assembly Closure Mechanics Review
International Nuclear Information System (INIS)
Huizenga, D. J.
2016-01-01
A review of the closure mechanics associated with the Shielded Transfer System (STS) MTR/NRU/NRX grapple assembly utilized at the Savannah River Site (SRS) was performed. This review was prompted by an operational event which occurred at the Canadian Nuclear Laboratories (CNL) utilizing a DTS-XL grapple assembly which is essentially identical to the STS MTR/NRU/NRX grapple assembly used at the SRS. The CNL operational event occurred when a NRU/NRX fuel basket containing spent nuclear fuel assemblies was inadvertently released by the DTS-XL grapple assembly during a transfer. The SM review of the STS MTR/NRU/NRX grapple assembly will examine the operational aspects of the STS and the engineered features of the STS which prevent such an event at the SRS. The design requirements for the STS NRU/NRX modifications and the overall layout of the STS are provided in other documents.
77 FR 16175 - Station Blackout
2012-03-20
... of the near- term actions based on lessons-learned stemming from the March 2011 Fukushima Dai-ichi... http://www.regulations.gov and search for documents filed under Docket ID NRC- 2011-0299. Address.... Fukushima Dai-ichi Event and the NRC Regulatory Response III. Background A. General Design Criteria 2 and 17...
The development of STS payload environmental engineering standards
Bangs, W. F.
1982-01-01
The presently reported effort to provide a single set of standards for the design, analysis and testing of Space Transportation System (STS) payloads throughout the NASA organization must be viewed as essentially experimental, since the concept of incorporating the diverse opinions and experiences of several separate field research centers may in retrospect be judged too ambitious or perhaps even naive. While each STS payload may have unique characteristics, and the project should formulate its own criteria for environmental design, testing and evaluation, a reference source document providing coordinated standards is expected to minimize the duplication of effort and limit random divergence of practices among the various NASA payload programs. These standards would provide useful information to all potential STS users, and offer a degree of standardization to STS users outside the NASA organization.
Regulation of Id2 expression in EL4 T lymphoma cells overexpressing growth hormone.
Weigent, Douglas A
2009-01-01
In previous studies, we have shown that overexpression of growth hormone (GH) in cells of the immune system upregulates proteins involved in cell growth and protects from apoptosis. Here, we report that overexpression of GH in EL4 T lymphoma cells (GHo) also significantly increased levels of the inhibitor of differentiation-2 (Id2). The increase in Id2 was suggested in both Id2 promoter luciferase assays and by Western analysis for Id2 protein. To identify the regulatory elements that mediate transcriptional activation by GH in the Id2 promoter, promoter deletion analysis was performed. Deletion analysis revealed that transactivation involved a 301-132bp region upstream to the Id2 transcriptional start site. The pattern in the human GHo Jurkat T lymphoma cell line paralleled that found in the mouse GHo EL4 T lymphoma cell line. Significantly less Id2 was detected in the nucleus of GHo EL4 T lymphoma cells compared to vector alone controls. Although serum increased the levels of Id2 in control vector alone cells, no difference was found in the total levels of Id2 in GHo EL4 T lymphoma cells treated with or without serum. The increase in Id2 expression in GHo EL4 T lymphoma cells measured by Id2 promoter luciferase expression and Western blot analysis was blocked by the overexpression of a dominant-negative mutant of STAT5. The results suggest that in EL4 T lymphoma cells overexpressing GH, there is an upregulation of Id2 protein that appears to involve STAT protein activity.
Best practices for the implementation of the REAL ID Act.
2015-10-01
The REAL ID Act specifies the minimum standards that must be used to produce and issue drivers license and : identification cards that are REAL ID compliant. Beginning in 2020, if a person does not possess a form of : identification that meets REA...
ID card number detection algorithm based on convolutional neural network
Zhu, Jian; Ma, Hanjie; Feng, Jie; Dai, Leiyan
2018-04-01
In this paper, a new detection algorithm based on Convolutional Neural Network is presented in order to realize the fast and convenient ID information extraction in multiple scenarios. The algorithm uses the mobile device equipped with Android operating system to locate and extract the ID number; Use the special color distribution of the ID card, select the appropriate channel component; Use the image threshold segmentation, noise processing and morphological processing to take the binary processing for image; At the same time, the image rotation and projection method are used for horizontal correction when image was tilting; Finally, the single character is extracted by the projection method, and recognized by using Convolutional Neural Network. Through test shows that, A single ID number image from the extraction to the identification time is about 80ms, the accuracy rate is about 99%, It can be applied to the actual production and living environment.
STS and Researcher Intervention Strategies
Directory of Open Access Journals (Sweden)
Brian Martin
2016-06-01
Full Text Available When I learned about a concerted campaign against Australian vaccination critics, I decided to intervene in the debate. As a result, some proponents of vaccination turned on me, making abusive comments and complaining to university officials. At several points in this experience, I had to make choices about how to intervene or respond. STS perspectives offered valuable insights for understanding the dynamics of the controversy but provided little guidance for making decisions. Some reasons are offered for why STS lacks tools for guiding practical action in such situations.
REFORMASI PEMAHAMAN TEORI MAQᾹṢID SYARIAH Analisis Pendekatan Sistem Jasser Auda
Directory of Open Access Journals (Sweden)
Muhammad Iqbal Fasa
2016-12-01
Full Text Available This paper attempts to offer reform ideas Jasser Auda thought related reforms theoretical understanding of maqᾱṣid sharia. The systems approach is done by Auda critize the theory of classical maqᾱṣid more likely to hierarchical and narrow mindset. The classical maqᾱṣid pressure a point more on protection and preservation. Whereas the new maqᾱṣid theory emphasizes development (construction, development and rights (rights. Thus, Auda developed the concept of human development as the main target of maslahah (public interest. Auda offers the systems approach, namely: cognitive nature; interrelated; wholeness; openness; multi dimentionality and purposefulness. At the end of the discussion in this paper, the authors develop the idea of Jasser Auda by offering Sharia Maqᾱṣid concept in the context of Islamic Economics
Interoperability for electronic ID
Zygadlo, Zuzanna
2009-01-01
Electronic Business, including eBanking, eCommerce and eGovernmental services, is today based on a large variety of security solutions, comprising electronic IDs provided by a broad community of Public Key Infrastructure (PKI) vendors. Significant differences in implementations of those solutions introduce a problem of lack of interoperability in electronic business, which have not yet been resolved by standardization and interoperability initiatives based on existing PKI trust models. It i...
78 FR 6316 - Enterprise Texas Pipeline LLC; Notice of Compliance Filing
2013-01-30
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR13-23-000] Enterprise Texas Pipeline LLC; Notice of Compliance Filing Take notice that on January 17, 2013, Enterprise Texas Pipeline LLC filed a revised Statement of Operating Conditions to comply with a Commission order issued in...
Psychometrics and latent structure of the IDS and QIDS with young adult students.
González, David Andrés; Boals, Adriel; Jenkins, Sharon Rae; Schuler, Eric R; Taylor, Daniel
2013-07-01
Students and young adults have high rates of suicide and depression, thus are a population of interest. To date, there is no normative psychometric information on the IDS and QIDS in these populations. Furthermore, there is equivocal evidence on the factor structure and subscales of the IDS. Two samples of young adult students (ns=475 and 1681) were given multiple measures to test the psychometrics and dimensionality of the IDS and QIDS. The IDS, its subscales, and QIDS had acceptable internal consistencies (αs=.79-90) and favorable convergent and divergent validity correlations. A three-factor structure and two Rasch-derived subscales best fit the IDS. The samples were collected from one university, which may influence generalizability. The IDS and QIDS are desirable measures of depressive symptoms when studying young adult students. Copyright © 2013 Elsevier B.V. All rights reserved.
Gayibova, Ülkü; Dalyan Cılo, Burcu; Ağca, Harun; Ener, Beyza
2014-07-01
.kefyr), however it was 38.7% for the rarely isolated ones (C.krusei, C.lusitaniae, C.inconspicua/C.norvagensis, C.catenulata), representing statistical significance (p= 0.034; x2 test). Although not significant (p= 0.31; x2 test), the rate of concordance was increased (88.1%), when adding the morphological findings to the identification process. Of 211 isolates 37 (17.5%), 50 (23.7%) and 124 (58.8%) were identified according to their growth characteristics on chromogenic agar, blood agar and SDA, respectively, indicating no statistically significant difference between the media (p> 0.05). Although genotypic identification is essential, phenotypic methods are more commonly used in routine laboratories for the identification of yeast species. However, since genotypic identification could not be performed in this study, none of the systems were accepted as the standard method and therefore the sensitivity and specificity of the systems were not calculated. On the other hand, our data indicated that the two identification systems were comparable and careful observation of yeast morphology could add confidence to the identification. In conclusion, since the Phoenix™ Yeast ID system was found more practical with easier interpretation, and the results were obtained earlier than those of the API® ID 32C system (16 hours versus 48 hours), it was thought that Phoenix™ Yeast ID system may be used reliably in the routine laboratories. However, as none of the methods evaluated was completely reliable as a stand-alone, careful evaluation is necessary for species identification.
78 FR 65555 - Establishment of Class E Airspace; Salmon, ID
2013-11-01
...-0531; Airspace Docket No. 13-ANM-20] Establishment of Class E Airspace; Salmon, ID AGENCY: Federal... at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules (IFR) aircraft under control of Salt Lake...
JAVADI, Alireza; SHAMAEI, Masoud; ZAREI, Masoud; REZAEIAN, Lida; KIANI, Arda; ABEDINI, Atefeh
2016-01-01
Background: Sarcoidosis is a multisystem inflammatory disease of unknown origin with characterization of small granulomas. Angiotensin-converting enzyme (ACE) is a pathophysiologic marker of sarcoidosis. We present the ACE insertion/deletion (I/D) polymorphism in correlation with serum ACE level in Iranian patients with sarcoidosis. Methods: From Jan 2014 to Jan 2015, 102 Iranian patients who histopathologically diagnosed for sarcoidosis and 192 healthy age and sex-matched controls were recruited. PCR was used for detection of I/D polymorphism in ACE gene. Results: Frequency of II/ID/DD genotype in sarcoidosis disease was 17%, 35.5%, and 47.1%, respectively. The frequency of D allele was 0.65. A significant association between I/D genotypes and mean of sACE level was seen (DD=85.2±22.9, P<0.001). More frequent genotype in sarcoidosis patients was DD (47%), ID genotype (45.9%) was found more in controls. Logistic regression analysis adjusting age and sex showed that ID to II (OR=0.35, 95%CI=0.17–0.73, P=0.005) and DD to II (OR=2.11, 95%CI=0.98–4.54, P=0.05) could be considered as a predictor factor for the disease activity. No significant model for men in sarcoidosis group was seen, while women with II/ID were associated with a reduced risk for the disease. Conclusion: Although more regional studies with appropriate statistical scale must be done to provide a better diagnosis and prognostic tool for this disease, this study demonstrates that ID and DD genotype could be predictive factors for sarcoidosis. PMID:28032065
CASK inhibits ECV304 cell growth and interacts with Id1
International Nuclear Information System (INIS)
Qi Jie; Su Yongyue; Sun Rongju; Zhang Fang; Luo Xiaofeng; Yang Zongcheng; Luo Xiangdong
2005-01-01
Calcium/calmodulin-dependent serine protein kinase (CASK) is generally known as a scaffold protein. Here we show that overexpression of CASK resulted in a reduced rate of cell growth, while inhibition of expression of endogenous CASK via RNA-mediated interference resulted in an increased rate of cell growth in ECV304 cells. To explore the molecular mechanism, we identified a novel CASK-interacting protein, inhibitor of differentiation 1 (Id1) with a yeast two-hybrid screening. Furthermore, endogenous CASK and Id1 proteins were co-precipitated from the lysates of ECV304 cells by immunoprecipitation. Mammalian two-hybrid protein-protein interaction assays indicated that CASK possessed a different binding activity for Id1 and its alternative splicing variant. It is known that Id proteins play important roles in regulation of cell proliferation and differentiation. Thus, we speculate that the regulation of cell growth mediated by CASK may be involved in Id1. Our findings indicate a novel function of CASK, the mechanism that remains to be further investigated
77 FR 76019 - Combined Notice of Filings
2012-12-26
...: Negotiated Rate Service Agreement--Stone Energy Corp to be effective 12/17/2012. Filed Date: 12/14/12... Numbers: RP13-179-001. Applicants: B-R Pipeline Company. Description: Order No. 587-V Further compliance...
idRHa+ProMod - Rail Hardening Control System
International Nuclear Information System (INIS)
Ferro, L
2016-01-01
idRHa+ProMod is the process control system developed by Primetals Technologies to foresee the thermo-mechanical evolution and micro-structural composition of rail steels subjected to slack quenching into idRHa+ Rail Hardening equipments in a simulation environment. This tool can be used both off-line or in-line, giving the user the chance to test and study the best cooling strategies or letting the automatic control system free to adjust the proper cooling recipe. Optimization criteria have been tailored in order to determine the best cooling conditions according to the metallurgical requirements imposed by the main rail standards and also taking into account the elastoplastic bending phenomena occurring during all stages of the head hardening process. The computational core of idRHa+ProMod is a thermal finite element procedure coupled with special algorithms developed to work out the main thermo-physical properties of steel, to predict the non-isothermal austenite decomposition into all the relevant phases and subsequently to evaluate the amount of latent heat of transformation released, the compound thermal expansion coefficient and the amount of plastic deformation in the material. Air mist and air blades boundary conditions have been carefully investigated by means of pilot plant tests aimed to study the jet impingement on rail surfaces and the cooling efficiency at all working conditions. Heat transfer coefficients have been further checked and adjusted directly on field during commissioning. idRHa+ is a trademark of Primetals Technologies Italy Srl (paper)
idRHa+ProMod - Rail Hardening Control System
Ferro, L.
2016-03-01
idRHa+ProMod is the process control system developed by Primetals Technologies to foresee the thermo-mechanical evolution and micro-structural composition of rail steels subjected to slack quenching into idRHa+ Rail Hardening equipments in a simulation environment. This tool can be used both off-line or in-line, giving the user the chance to test and study the best cooling strategies or letting the automatic control system free to adjust the proper cooling recipe. Optimization criteria have been tailored in order to determine the best cooling conditions according to the metallurgical requirements imposed by the main rail standards and also taking into account the elastoplastic bending phenomena occurring during all stages of the head hardening process. The computational core of idRHa+ProMod is a thermal finite element procedure coupled with special algorithms developed to work out the main thermo-physical properties of steel, to predict the non-isothermal austenite decomposition into all the relevant phases and subsequently to evaluate the amount of latent heat of transformation released, the compound thermal expansion coefficient and the amount of plastic deformation in the material. Air mist and air blades boundary conditions have been carefully investigated by means of pilot plant tests aimed to study the jet impingement on rail surfaces and the cooling efficiency at all working conditions. Heat transfer coefficients have been further checked and adjusted directly on field during commissioning. idRHa+ is a trademark of Primetals Technologies Italy Srl
ID Barrel installed in cryostat
Apsimon, R.; Romaniouk, A.
Wednesday 23rd August was a memorable day for the Inner Detector community as they witnessed the transport and installation of the central part of the inner detector (ID-barrel) into the ATLAS detector. Many members of the collaboration gathered to witness this moment at Point 1. After years of design, construction and commissioning, the outer two detectors (TRT and SCT) of the ID barrel were moved from the SR1 cleanroom to the ATLAS cavern. The barrel was moved across the car park from building 2175 to SX1. Although only a journey of about 100 metres, this required weeks of planning and some degree of luck as far as the weather was concerned. Accelerometers were fitted to the barrel to provide real-time monitoring and no values greater than 0.1 g were recorded, fully satisfying the transport specification for this extremely precise and fragile detector. Muriel, despite her fear of heights, bravely volunteered to keep a close eye on the detector. Swapping cranes to cross the entire parking lot, while Mur...
Directory of Open Access Journals (Sweden)
Čička R.
2012-01-01
Full Text Available The precipitation of secondary phases was investigated in the 0.17C-16Cr-11Mn-0.43N austenitic stainless steel during annealing at 800 and 850°C for times between 5 min and 100 h. Light microscopy, transmission electron microscopy, energy dispersive X-ray spectroscopy, scanning electron microscopy, and differential thermal analysis were used in experiments. Thermodynamic calculations were done by the ThermoCalc database software package. Cr2N and M23C6 were considered to be stable phases at the annealing temperatures. Cells consisting of alternating Cr2N and austenite lamellae were observed in the steel microstructure after sufficiently long annealing. The metastable chi phase was also found in all the annealed samples. After 100 h of annealing the equilibrium sigma started to precipitate. The thermodynamically predicted M6C was not confirmed experimentally in any of the annealed samples. DTA analysis showed the initial precipitation stage was followed by the phase dissolution. For the investigated steel the computational thermodynamics can be used only for qualitative interpretation of the experimental results as the measured endothermal peaks were found to be shifted of about 50 ÷ 70°C related to the computed results.
Magnetism, X-rays and accretion rates in WD 1145+017 and other polluted white dwarf systems
Farihi, J.; Fossati, L.; Wheatley, P. J.; Metzger, B. D.; Mauerhan, J.; Bachman, S.; Gänsicke, B. T.; Redfield, S.; Cauley, P. W.; Kochukhov, O.; Achilleos, N.; Stone, N.
2018-02-01
This paper reports circular spectropolarimetry and X-ray observations of several polluted white dwarfs including WD 1145+017, with the aim to constrain the behaviour of disc material and instantaneous accretion rates in these evolved planetary systems. Two stars with previously observed Zeeman splitting, WD 0322-019 and WD 2105-820, are detected above 5σ and 〈Bz〉 > 1 kG, while WD 1145+017, WD 1929+011, and WD 2326+049 yield (null) detections below this minimum level of confidence. For these latter three stars, high-resolution spectra and atmospheric modelling are used to obtain limits on magnetic field strengths via the absence of Zeeman splitting, finding B* Earth composition material falling on to the magnetic polar regions of white dwarfs, where X-rays and cyclotron radiation may contribute to accretion luminosity. This analysis is applied to X-ray data for WD 1145+017, WD 1729+371, and WD 2326+049, and the upper bound count rates are modelled with spectra for a range of plasma kT = 1-10 keV in both the magnetic and non-magnetic accretion regimes. The results for all three stars are consistent with a typical dusty white dwarf in a steady state at 108-109 g s-1. In particular, the non-magnetic limits for WD 1145+017 are found to be well below previous estimates of up to 1012 g s-1, and likely below 1010 g s-1, thus suggesting the star-disc system may be average in its evolutionary state, and only special in viewing geometry.
STS-37 Breakfast / Ingress / Launch & ISO Camera Views
1991-01-01
The primary objective of the STS-37 mission was to deploy the Gamma Ray Observatory. The mission was launched at 9:22:44 am on April 5, 1991, onboard the space shuttle Atlantis. The mission was led by Commander Steven Nagel. The crew was Pilot Kenneth Cameron and Mission Specialists Jerry Ross, Jay Apt, and Linda Godwing. This videotape shows the crew having breakfast on the launch day, with the narrator introducing them. It then shows the crew's final preparations and the entry into the shuttle, while the narrator gives information about each of the crew members. The countdown and launch is shown including the shuttle separation from the solid rocket boosters. The launch is reshown from 17 different camera views. Some of the other camera views were in black and white.
ID.alistic: identificatie met een touch voor de patiënt
M. Wilschut; M. Zijlmans; Dr. L.S.G.L Wauben
2017-01-01
ID.alistic is een conceptuele patiëntidentificatie methode (middels een vingerafdrukscanner), ter vervanging van het polsbandjessysteem van het Albert Schweitzer ziekenhuis (ASz) dialysecentrum. Dit onderzoek bepaalt de implementeerbaarheid van ID.alistic binnen het dialysecentrum door
DEFF Research Database (Denmark)
Babakhanyan, Anna; Leke, Rose G F; Salanti, Ali
2014-01-01
In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women natura...
Internal validation of the RapidHIT® ID system.
Wiley, Rachel; Sage, Kelly; LaRue, Bobby; Budowle, Bruce
2017-11-01
Traditionally, forensic DNA analysis has required highly skilled forensic geneticists in a dedicated laboratory to generate short tandem repeat (STR) profiles. STR profiles are routinely used either to associate or exclude potential donors of forensic biological evidence. The typing of forensic reference samples has become more demanding, especially with the requirement in some jurisdictions to DNA profile arrestees. The Rapid DNA (RDNA) platform, the RapidHIT ® ID (IntegenX ® , Pleasanton, CA), is a fully automated system capable of processing reference samples in approximately 90min with minimal human intervention. Thus, the RapidHIT ID instrument can be deployed to non-laboratory environments (e.g., booking stations) and run by trained atypical personnel such as law enforcement. In order to implement the RapidHIT ID platform, validation studies are needed to define the performance and limitations of the system. Internal validation studies were undertaken with four early-production RapidHIT ID units. Reliable and concordant STR profiles were obtained from reference buccal swabs. Throughout the study, no contamination was observed. The overall first-pass success rate with an "expert-like system" was 72%, which is comparable to another current RDNA platform commercially available. The system's second-pass success rate (involving manual interpretation on first-pass inconclusive results) increased to 90%. Inhibitors (i.e., coffee, smoking tobacco, and chewing tobacco) did not appear to affect typing by the instrument system; however, substrate (i.e., swab type) did impact typing success. Additionally, one desirable feature not available with other Rapid systems is that in the event of a system failed run, a swab can be recovered and subsequently re-analyzed in a new sample cartridge. Therefore, rarely should additional sampling or swab consumption be necessary. The RapidHIT ID system is a robust and reliable tool capable of generating complete STR profiles within
Bio-fortification and shelf-life extension of idli batter using curry leaves (Murraya koenigii).
Chelliah, R; Ramakrishnan, S R; Premkumar, D; Antony, U
2016-06-01
Among several traditional foods of India, idli is one of the most popular and commonly consumed steamed products. A new method of adding Murraya koenigii (curry leaves) to idli batter as a vehicle for fortification and extension of shelf-life has been developed. Dried curry leaves powder was incorporated with other ingredients like rice and dehusked black gram in different proportions to optimize the most palatable formulation. Rate of fermentation and microbial changes in the batter; nutritional qualities, texture and sensory properties of the prepared product were assessed. Incorporation of curry leaves powder (5 %) in idli batter increased the shelf-life and also increased the flavour, texture and appearance of the idli. The calcium content of the prepared idli was 10 times more than that of the control idli, while dietary fiber content increased by 18.6 %. Anti-microbial activity of the curry leaves in idli batter extended the shelf-life from 2 to 5 days when stored at 30 °C.
1996-01-01
The STS-84 emblem depicts the Space Shuttle Atlantis launching into Earth orbit to join the Russian Space Station Mir as part of Phase One of the International Space Station program. The names of the eight astronauts who flew onboard Atlantis, including the two who changed their positions onboard Mir for a long duration flight, are shown along the border of the patch. The STS-84/Mir-23 team will transfer 7,000 pounds of experiments, Station hardware, food and clothing to and from Mir during the five-day period of docking. The Phase One program is represented by the rising Sun and by the Greek letter Phi followed by one star. This sixth Shuttle-Mir docking mission is symbolized by the six stars surrounding the word Mir in Cyrillic characters. Combined, the seven stars symbolize the current configuration of Mir, composed of six modules launched by the Russians and one module brought up by Atlantis on a previous docking flight.
To ID or Not to ID? Changes in Classification Rates of Intellectual Disability Using "DSM-5"
Papazoglou, Aimilia; Jacobson, Lisa A.; McCabe, Marie; Kaufmann, Walter; Zabel, T. Andrew
2014-01-01
The "Diagnostic and Statistical Manual of Mental Disorders-Fifth Edition" ("DSM-5") diagnostic criteria for intellectual disability (ID) include a change to the definition of adaptive impairment. New criteria require impairment in one adaptive domain rather than two or more skill areas. The authors examined the diagnostic…
ACE I/D genotype, adiposity, and blood pressure in children
Directory of Open Access Journals (Sweden)
Rothschild Max
2009-03-01
Full Text Available Abstract Background Angiotensin converting enzyme (ACE is a possible candidate gene that may influence both body fatness and blood pressure. Although several genetic studies have been conducted in adults, relatively few studies have examined the contribution of potential candidate genes, and specifically ACE I/D, on adiposity and BP phenotypes in childhood. Such studies may prove insightful for the development of the obesity-hypertension phenotype early in life. The purpose of this study was to examine differences in body fatness and resting blood pressure (BP by ACE I/D genotype, and determine if the association between adiposity and BP varies by ACE I/D genotype in children. Methods 152 children (75 girls, 77 boys were assessed for body composition (% body fat using dual energy x-ray absorbtiometry and resting BP according to American Heart Association recommendations. Buccal cell samples were genotyped using newly developed PCR-RFLP tests for two SNPs (rs4341 and rs4343 in complete linkage disequilibrium with the ACE I/D polymorphism. Partial correlations were computed to assess the ociations between % body fat and BP in the total sample and by genotype. ANCOVA was used to examine differences in resting BP by ACE I/D genotype and fatness groups. Results Approximately 39% of youth were overfat based on % body fat (>30% fat in girls, 25% fat in boys. Body mass, body mass index, and fat-free mass were significantly higher in the ACE D-carriers compared to the II group (p Conclusion ACE D-carriers are heavier than ACE II children; however, BP did not differ by ACE I/D genotype but was adversely influenced in the overfat D-carriers. Further studies are warranted to investigate the genetics of fatness and BP phenotypes in children.
Id3 induces an Elk-1–caspase-8-dependent apoptotic pathway in squamous carcinoma cells
International Nuclear Information System (INIS)
Chen, You-Shin; Aubee, Joseph; DiVito, Kyle A; Zhou, Hengbo; Zhang, Weiyi; Chou, Fen-Pi; Simbulan-Rosenthal, Cynthia M; Rosenthal, Dean S
2015-01-01
Inhibitor of differentiation/DNA-binding (Id) proteins are helix–loop–helix (HLH) transcription factors. The Id protein family (Id1–Id4) mediates tissue homeostasis by regulating cellular processes including differentiation, proliferation, and apoptosis. Ids typically function as dominant negative HLH proteins, which bind other HLH proteins and sequester them away from DNA promoter regions. Previously, we have found that Id3 induced apoptosis in immortalized human keratinocytes upon UVB exposure, consistent with its role as a tumor suppressor. To investigate the role of Id3 in malignant squamous cell carcinoma (SCC) cells (A431), a tetracycline-regulated inducible system was used to induce Id3 in cell culture and mouse xenograft models. We found that upon Id3 induction, there was a decrease in cell number under low serum conditions, as well as in soft agar. Microarray, RT-PCR, immunoblot, siRNA, and inhibitor studies revealed that Id3 induced expression of Elk-1, an E-twenty-six (ETS)-domain transcription factor, inducing procaspase-8 expression and activation. Id3 deletion mutants revealed that 80 C-terminal amino acids, including the HLH, are important for Id3-induced apoptosis. In a mouse xenograft model, Id3 induction decreased tumor size by 30%. Using immunofluorescent analysis, we determined that the tumor size decrease was also mediated through apoptosis. Furthermore, we show that Id3 synergizes with 5-FU and cisplatin therapies for nonmelanoma skin cancer cells. Our studies have shown a molecular mechanism by which Id3 induces apoptosis in SCC, and this information can potentially be used to develop new treatments for SCC patients
Kepler Data Release 25 Notes (Q0-Q17)
Mullally, Susan E.; Caldwell, Douglas A.; Barclay, Thomas Stewart; Barentsen, Geert; Clarke, Bruce Donald; Bryson, Stephen T.; Burke, Christopher James; Campbell, Jennifer Roseanna; Catanzarite, Joseph H.; Christiansen, Jessie;
2016-01-01
These Data Release Notes provide information specific to the current reprocessing and re-export of the Q0-Q17 data. The data products included in this data release include target pixel files, light curve files, FFIs,CBVs, ARP, Background, and Collateral files. This release marks the final processing of the Kepler Mission Data. See Tables 1 and 2 for a list of the reprocessed Kepler cadence data. See Table 3 for a list of the available FFIs. The Long Cadence Data, Short Cadence Data, and FFI data are documented in these data release notes. The ancillary files (i.e., cotrending basis vectors, artifact removal pixels, background, and collateral data) are described in the Archive Manual (Thompson et al., 2016).
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Settlement. 9.7 Section 9.7... DISCIPLINARY, ACCESS DENIAL OR OTHER ADVERSE ACTIONS General Provisions § 9.7 Settlement. At any time before... accordance with § 9.20, the parties may file a stipulation for dismissal based on a settlement agreement...
STS 63: Post flight presentation
1995-02-01
At a post flight conference, Captain Jim Wetherbee, of STS Flight 63, introduces each of the other members of the STS 63 crew (Eileen Collins, Pilot; Dr. Bernard Harris, Payload Commander; Dr. Michael Foale, Mission Specialist from England; Dr. Janice Voss, Mission Specialist; and Colonel Vladimir Titor, Mission Specialist from Russia), gave a short autobiography of each member and a brief description of their assignment during this mission. A film was shown that included the preflight suit-up, a view of the launch site, the actual night launch, a tour of the Space Shuttle and several of the experiment areas, several views of earth and the MIR Space Station and cosmonauts, the MlR-Space Shuttle rendezvous, the deployment of the Spartan Ultraviolet Telescope, Foale and Harris's EVA and space walk, the retrieval of Spartan, and the night entry home, including the landing. Several spaceborne experiments were introduced: the radiation monitoring experiment, environment monitoring experiment, solid surface combustion experiment, and protein crystal growth and plant growth experiments. This conference ended with still, color pictures, taken by the astronauts during the entire STS 63 flight, being shown.
2013-02-06
... Services Group, Inc., Commercial/Actuarial/ Information Delivery Services (IDS)/Corporate & Financial... workers and former workers of Hartford Financial Services Group, Inc., Commercial/Actuarial/Information Delivery Services (IDS)/Corporate & Financial Reporting group, Hartford, Connecticut (The Hartford-IDS...
IAEA: 17 countries are candidates for nuclear energy; AIEA: 17 pays candidats a l'energie nucleaire
Energy Technology Data Exchange (ETDEWEB)
Anon.
2011-01-15
In january 2011 IAEA announced that 17 countries had officially expressed their willingness to home nuclear power plants, they have filed applications for the construction of nuclear power plants. Among the countries concerned we find: Poland, Kuwait, Jordan, Morocco, Tunisia, Nigeria, Bangladesh, Thailand, Vietnam, Chile and Uruguay
Identity Management ToolKit (IdM TK)
Department of Veterans Affairs — With the IdM TK, authorized users can search and view identity and exception information from the Administrative Data Repository (ADR). Specifically, users can view...
EXAFS study of Mn1.28Fe0.67P0.46Si0.54 compound with first-order phase transition
International Nuclear Information System (INIS)
L, Yingjie; Huliyageqi, B; Haschaolu, W; Song, Zhiqiang; Tegus, O; Nakai, Ikuo
2014-01-01
Highlights: • We have investigated the Fe and Mn K edge XAFS spectra of the Mn 1.28 Fe 0.67 P 0.46 Si 0.54 compound at 25 K and 295 K. • The site occupation of the Fe and Mn atoms and local structure of Mn 1.28 Fe 0.67 P 0.46 Si 0.54 are determined. • The atomic distances between Fe–Fe in c-plane for the ferromagnetic state are larger than those in the paramagnetic state. - Abstract: The Fe 2 P-type MnFe(P,Si) compounds are investigated by means of magnetic measurements and X-ray absorption fine structure spectroscopy. Magnetic measurements show that the Mn 1.28 Fe 0.67 P 0.46 Si 0.54 compound undergoes a first-order phase transition at the Curie temperature of 254 K. The Fe K-edge and Mn K-edge X-ray absorption fine structure spectra show that Mn atom mainly located at the 3g sites, while the 3f sites are occupied by Fe atoms and Mn atom randomly. The distances between the Fe atom and its nearest neighbor atoms in a triangle Fe–Mn–Fe change from 2.80 Å at 25 K to 2.74 Å at 300 K. On the other hand, the distances between Fe atom and its second neighbor atoms change from 4.06 Å at 25 K to 4.02 Å at 300 K
76 FR 49467 - Combined Notice of Filings #1
2011-08-10
... per 35.13(a)(2)(iii: Modification of its Transmission Depreciation Rate to be effective 10/1/2011...: Arizona Public Service Company submits tariff filing per 35.17(b): Amendment to the APS depreciation...
Czech Academy of Sciences Publication Activity Database
Rowberry, Matthew David; Battiau-Queney, Y.; Walsh, P.; Blažejowski, B.; Bout-Roumazeilles, V.; Trentesaux, A.; Křížová, L.; Griffiths, H.
2014-01-01
Roč. 17, č. 1 (2014), s. 33-42 ISSN 1374-8505 Institutional research plan: CEZ:AV0Z30460519 Keywords : deep weathering * saprolite * ghost -rock * Gash Breccia Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.782, year: 2014 http://popups.ulg.ac.be/1374-8505/index.php?id=4353&file=1&pid=4150
Security and Privacy Improvements for the Belgian eID Technology
Verhaeghe, Pieter; Lapon, Jorn; de Decker, Bart; Naessens, Vincent; Verslype, Kristof
The Belgian Electronic Identity Card enables Belgian citizens to prove their identity digitally and to sign electronic documents. At the end of 2009, every Belgian citizen older than 12 years will have such an eID card. In the future, usage of the eID card may be mandatory. However, irresponsible use of the card may cause harm to individuals.
Energy Technology Data Exchange (ETDEWEB)
Jared Verba; Michael Milvich
2008-05-01
Current Intrusion Detection System (IDS) technology is not suited to be widely deployed inside a Supervisory, Control and Data Acquisition (SCADA) environment. Anomaly- and signature-based IDS technologies have developed methods to cover information technology-based networks activity and protocols effectively. However, these IDS technologies do not include the fine protocol granularity required to ensure network security inside an environment with weak protocols lacking authentication and encryption. By implementing a more specific and more intelligent packet inspection mechanism, tailored traffic flow analysis, and unique packet tampering detection, IDS technology developed specifically for SCADA environments can be deployed with confidence in detecting malicious activity.
X-ray diffraction on MnFeP0.46As0.54 in a magnetic field
International Nuclear Information System (INIS)
Tegus, O.; Koyama, K.; Her, J.L.; Watanabe, K.; Brueck, E.; Buschow, K.H.J.; Boer, F.R. de
2007-01-01
We have performed powder X-ray-diffraction measurements on MnFeP 0.46 As 0.54 in fields up to 5T in the temperature range 8-310K. The compound which has the hexagonal Fe 2 P type of structure shows a field-induced isostructural phase transition. We found that the cell volume decreases slightly and continuously with increasing magnetic field, although the lattice parameter ratio c/a drastically changes. A tentative analysis of the dependence of the lattice parameters on the magnetization has been carried out using the extended Bean-Rodbell model
Energy Technology Data Exchange (ETDEWEB)
NONE
1987-03-01
This data file is a data file concerning coal types for liquefaction in the report on the achievements in the surveys on coal type selection and on coal types (JN0040843). Such items of information were filed as existence and production of coals, various kinds of analyses, and test values relative to data for liquefaction tests that have been collected and sent to date. The file consists of two files of a test sample information file related to existence and production of coals and coal mines, and an analysis and test file accommodating the results of different analyses and tests. However, the test sample information files (1) through (6) have not been put into order on such items of information as test samples and sample collection, geography, geology, ground beds, coal beds, coal mines, development and transportation. The analysis and test file contains (7) industrial analyses, (8) element analysis, (9) ash composition, (10) solubility of ash, (11) structure analysis, (12) liquefaction characteristics (standard version), (13) analysis of liquefaction produced gas, (14) distillation characteristics of liquefaction produced oil, (15) liquefaction characteristics (simplified version), (16) analysis of liquefaction produced gas (simplified version), and (17) distillation characteristics of liquefaction produced oil (simplified version). However, the information related to liquefaction test using a tubing reactor in (15) through (17) has not been put into order. (NEDO)
78 FR 25406 - Proposed Modification of Class E Airspace; Twin Falls, ID
2013-05-01
...) Global Positioning System (GPS) and the Instrument Landing System (ILS) or Localizer (LOC) standard... the earth. * * * * * ANM ID E5 Twin Falls, ID [Modified] Twin Falls Joslin Field-Magic Valley Regional...
78 FR 45478 - Proposed Establishment of Class E Airspace; Salmon, ID
2013-07-29
...-0531; Airspace Docket No. 13-ANM-20] Proposed Establishment of Class E Airspace; Salmon, ID AGENCY... action proposes to establish Class E airspace at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules...
Muon Identification performance: hadron mis-Id measurements and RPC Muon selections
CMS Collaboration
2014-01-01
Pion, kaon, proton mis-identification probabilities as muons have been measured for different Muon ID algorithms. Results from two independent analyses are presented. The performance of a new muon ID algorithm based on matching of inner tracks with hits in muon RPC chambers is also presented.
Energy Technology Data Exchange (ETDEWEB)
Griffith, A.J.; Burgess, D.L.; Kohrman, D. [Univ. of MIchigan, Ann Arbor, MI (United States)] [and others
1994-09-01
The Twirler mutation (Tw) causing cleft palate {plus_minus} cleft lip, vestibular defects and obesity is located within 0.5 cM of an ataxia locus (ax) on mouse chromosome 18. We identified a transgene-induced insertional mutation with vestibular and craniofacial defects that appears to be a new allele of Twirler. Mouse DNA flanking the transgene insertion site was isolated from a cosmid library. An evolutionarily conserved, zoo blot positive cosmid subclone was used to probe a human {lambda} genomic library. From the sequence of a highly homologous human {lambda} clone, we designed STS primers and screened a human P1 library. DNA from two positive P1 clones was hybridized with simple sequence probes, and a (CTAT){sub 12} repeat was detected. Analysis of 62 CEPH parents with primers flanking the repeat identified six alleles containing 9 to 14 copies of the repeat, at frequencies of 0.17, 0.17, 0.17, 0.27, 0.15 and 0.07, respectively. The observed heterozygosity was 49/62 with a calculated PIC value of 0.76. This polymorphic microsatellite marker, designated Umi3, was mapped to the predicted conserved human linkage group by analysis of somatic cell hybrid panels. The anticipated short distance between Umi3 and the disease genes will facilitate detection of linkage in small families. We would like to type appropriate human pedigrees with Umi3 in order to identify patients with inherited disorders homologous to the mouse mutations Twirler and ataxia.
Directory of Open Access Journals (Sweden)
Finn Hedefalk
2014-09-01
Full Text Available The Intermediate Data Structure (IDS is a standardised database structure for longitudinal historical databases. Such a common structure facilitates data sharing and comparative research. In this study, we propose an extended version of IDS, named IDS-Geo, that also includes geographic data. The geographic data that will be stored in IDS-Geo are primarily buildings and/or property units, and the purpose of these geographic data is mainly to link individuals to places in space. When we want to assign such detailed spatial locations to individuals (in times before there were any detailed house addresses available, we often have to create tailored geographic datasets. In those cases, there are benefits of storing geographic data in the same structure as the demographic data. Moreover, we propose the export of data from IDS-Geo using an eXtensible Markup Language (XML Schema. IDS-Geo is implemented in a case study using historical property units, for the period 1804 to 1913, stored in a geographically extended version of the Scanian Economic Demographic Database (SEDD. To fit into the IDS-Geo data structure, we included an object lifeline representation of all of the property units (based on the snapshot time representation of single historical maps and poll-tax registers. The case study verifies that the IDS-Geo model is capable of handling geographic data that can be linked to demographic data.
ACE insertion/deletion (I/D) polymorphism and diabetic nephropathy.
Rahimi, Zohreh
2012-10-01
Angiotensin converting enzyme (ACE) gene encodes ACE, a key component of renin angiotensin system (RAS), plays an important role in blood pressure homeostasis by generating the vasoconstrictor peptide angiotensin II. Directory of Open Access Journals (DOAJ), Google Scholar, Pubmed (NLM), LISTA (EBSCO) and Web of Science have been searched. The presence of ACE insertion/deletion (I/D) polymorphism affects the plasma level of ACE. ACE DD genotype is associated with the highest systemic and renal ACE levels compared with the lowest ACE activity in carriers of II genotype. In this review focus has been performed on the study of ACE I/D polymorphism in various populations and its influence on the risk of onset and progression of diabetic nephropathy. Also, association between ACE I/D polymorphism and response to ACE inhibitor and angiotensin II receptor antagonists will be reviewed. Further, synergistic effect of this polymorphism and variants of some genes on the risk of development of diabetic nephropathy will be discussed.
Independence Day 2004 (ID04) / Raul Hindov
Hindov, Raul
2004-01-01
Ülevaade 20.-22. veebruarini 2004 toimunud kaugluurepatrullide rännaku ja sõdurioskuste kompleksõppusest ID04 (Independence Day 2004 - Iseseisvuspäev 2004), millel osales 25 patrullvõistlusteks valmistuvat meest ja naist
STS-100 MS Parazynski looks over Destiny in SSPF
2000-01-01
In the Space Station Processing Facility, STS-100 Mission Specialist Scott Parazynski looks over part of the U.S. Lab, Destiny. Mission STS-100 will be the ninth construction flight for the International Space Station. It is scheduled to launch April 19, 2001.
sY116, a human Y-linked polymorphic STS
Indian Academy of Sciences (India)
linked STS, showed different electrophoretic mobilities in three males, two infertile and one fertile. A study of this STS among 35 other normal males showed that this locus is polymorphic. sY116 has a poly A-rich stretch whose instability ...
STS-93 Commander Eileen Collins waves to her family
1999-01-01
STS-93 Commander Eileen M. Collins waves to her family nearby, a last meeting before launch of mission STS-93 on July 20. Liftoff is scheduled for 12:36 a.m. EDT. The primary mission of STS-93 is the release of the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X- ray telescope and is expected to unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Steven A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
17 CFR 39.3 - Procedures for registration.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Procedures for registration. 39.3 Section 39.3 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION DERIVATIVES... procedures. An organization desiring to be registered as a derivatives clearing organization shall file...
International Nuclear Information System (INIS)
Noetzel, Erik; Veeck, Jürgen; Niederacher, Dieter; Galm, Oliver; Horn, Felicitas; Hartmann, Arndt; Knüchel, Ruth; Dahl, Edgar
2008-01-01
Inhibitor of DNA binding/Inhibitor of differentiation 4 (ID4) is a critical factor for cell proliferation and differentiation in normal vertebrate development. ID4 has regulative functions for differentiation and growth of the developing brain. The role of ID1, ID2 and ID3 are expected to be oncogenic due to their overexpression in pancreatic cancer and colorectal adenocarcinomas, respectively. Aside from these findings, loss of ID3 expression was demonstrated in ovarian cancer. The aim of the present study was to reveal the factual role of ID4 in carcinogenesis in more detail, since its role for the pathogenesis of human breast cancer has been discussed controversially, assigning both oncogenic and tumour suppressive functions. ID4 promoter methylation, ID4 mRNA expression and ID4 protein expression were analysed in primary human breast cancer specimens using methylation-specific PCR (MSP) (n=170), semiquantitative realtime RT-PCR (n=46) and immunhistochemistry (n=3), respectively. In order to demonstrate a functional association of ID4 promoter methylation with its gene silencing, we performed DNA demethylation analysis with four human breast cell lines using MSP and semiquantitative realtime RT-PCR. In addition, we performed correlations of ID4 promoter methylation with ID4 mRNA and ID4 protein expression in matched samples of breast tumour and corresponding normal tissue. We carried out statistical analyses in order to find correlations between ID4 promoter methylation and clinicopathological parameters. Frequent ID4 promoter methylation was observed in primary breast cancer samples (69%, 117/170). We found a tight correlation (P<0.0001) between ID4 promoter methylation and loss of ID4 expression in primary breast cancer 3 specimens. Demethylating treatment with breast cancer cell lines was associated with clear ID4 mRNA re-expression. Tumours with ID4 promoter methylation showed distinct loss of ID4 expression on both transcription and protein level
Increased Inhibitor of Differentiation 4 (Id4 Expression in Glioblastoma: A Tissue Microarray Study
Directory of Open Access Journals (Sweden)
Weifin Zeng, Elisabeth J. Rushing, Daniel P. Hartmann, Norio Azumi
2010-01-01
Full Text Available Background: The inhibitor of differentiation/DNA binding protein family (Id1-4 is involved in cell cycle control, tumorigenesis and angiogenesis through the negative regulation of helix-loop-helix transcription factors. Of these proteins, Id4 is known to play an important role in neural stem cell differentiation, and deregulation has been implicated in glial neoplasia. However, the expression and significance of Id4 in astrocytomas has not been fully addressed. Herein we report the differential expression of Id4 in astrocytomas of various grades using tissue microarrays (TMA and immunohistochemistry (IHC. Design: The GBM TMA was constructed from 53 archival cases at Georgetown University Hospital and a TMA with normal brain controls and grades II-III astrocytoma was obtained from Cybrdi (Rockville, MD. TMA sections were stained with Id4 antibody and the slides were scored according to the percentage of staining astrocytic nuclei (<9% -, 10-50% +, >51% ++. The Fisher Exact test was used to test for statistical significance. Results: Nuclear staining for Id4 was seen in 73.58% GBMs, 25% grade III, and 12.5% grade II astrocytomas; staining was absent in normal brain tissue. There was a statistically significant difference between GBM and grades II, III astrocytoma (p <0.01. Significant Id4 expression was not detected in normal brain. Conclusions: Our study confirms the frequent upregulation of Id4 expression in GBM, which lends support to its role in tumorigenesis, possibly in the transformation of low to high-grade astrocytoma (i.e. GBM. Further studies are warranted to determine the precise role of Id4 in glial neoplasia and its potential use in targeted therapy for GBM.
STS-87 Mission Specialist Winston E. Scott suits up
1997-01-01
STS-87 Mission Specialist Winston Scott dons his launch and entry suit with the assistance of a suit technician in the Operations and Checkout Building. This is Scotts second space flight. He and the five other crew members will depart shortly for Launch Pad 39B, where the Space Shuttle Columbia awaits liftoff on a 16-day mission to perform microgravity and solar research. Scott is scheduled to perform an extravehicular activity spacewalk with Mission Specialist Takao Doi, Ph.D., of the National Space Development Agency of Japan, during STS-87. He also performed a spacewalk on STS-72.
STS-99 workers carry new Master Events Controller to Endeavour
2000-01-01
Workers carry the replacement Enhanced Main Events Controller (E- MEC) to Shuttle Endeavour at Launch Pad 39A for installation in the aft compartment of the payload bay. The original E-MEC became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. Both E-MECs are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.
28 CFR 0.17 - Office of Investigative Agency Policies.
2010-07-01
... policies relating to procurement for the criminal investigative agencies of the Department, including but... effective policy-level coordination of criminal investigations by the criminal investigative agencies of the... and prosecution of violations of federal criminal law. (f) Reservation. This policy is set forth...
Biodistribution and breast tumor uptake of 16α-[18F]-fluoro-17β-estradiol in rat
International Nuclear Information System (INIS)
Sasaki, Masayuki; Fukumura, Toshimitsu; Kuwabara, Yasuo; Yoshida, Tsuyoshi; Nakagawa, Makoto; Ichiya, Yuichi; Masuda, Kouji
2000-01-01
To evaluate the usefulness of 16α-[ 18 F]-fluoro-17β-estradiol (FES) for the assessment of estrogen receptor (ER), we examined the tissue distribution and kinetics of FES in immature female Sprague-Dawley rats and then examined FES uptake in rat breast tumors induced by 7,12-dimethylbenz(a)anthracene (DMBA). The FES uptake by the uterus, an ER-rich tissue, was highly selective and it was 3.34±0.79%ID/g at 60 minutes and 1.57±0.57%ID/g at 120 minutes after injection. The FES uptakes in ER-negative tissues were 0.12±0.05%ID/g or less and 0.05±0.03%ID/g or less, respectively. Coadministration of unlabeled β-estradiol showed marked depression of uterine FES uptake. The FES uptake by rat breast tumors was 0.14±0.06%ID/g at 60 min and 0.12±0.09%ID/g at 120 min. The FES uptake by rat breast tumors correlated with the ER concentration (r=0.45, p<0.05). In conclusion, these results suggest that the FES uptake by tissue is mainly ER mediated and FES is thus useful for detecting ER positive breast tumors. (author)
Teacher beliefs about teaching science through Science-Technology-Society (STS)
Massenzio, Lynn
2001-07-01
Statement of the problem. As future citizens, students will have the enormous responsibility of making decisions that will require an understanding of the interaction of science and technology and its interface with society. Since many societal issues today are grounded in science and technology, learning science in its social context is vital to science education reform. Science-Technology-Society (STS) has been strongly identified with meeting this goal, but despite its benefits, putting theory into practice has been difficult. Research design and methodology. The purpose of this study was to explore teacher beliefs about teaching science through STS. The following broad research questions guided the study: (1) What are the participants' initial beliefs about teaching science through STS? (2) What beliefs emerge as participants reflect upon and share their STS instructional experiences with their peers? A social constructivist theoretical framework was developed to plan interactions and collect data. Within this framework, a qualitative methodology was used to interpret the data and answer the research questions. Three provisionally certified science teachers engaged in a series of qualitative tasks including a written essay, verbal STS unit explanation, reflective journal writings, and focus group interviews. After implementing their STS unit, the participants engaged in meaningful dialogue with their peers as they reflected upon, shared, and constructed their beliefs. Conclusions. The participants strongly believed in STS as a means for achieving scientific and technological literacy, developing cognition, enhancing scientific habits of mind and affective qualities, and fostering citizen responsibility. Four major assertions were drawn: (a) Participants' initial belief in teaching for citizen responsibility did not fully align with practice, (b) Educators at the administrative level should be made aware of the benefits of teaching science through STS, (c
Explorations of Tenth-Grade STS[E] Curricula across Three Provincial Political Landscapes
Phillips, Christina Ann
This thesis focuses on explorations of science, technology, society and the environment (i.e., STS[E]) outcomes/expectations in tenth-grade level science curricula across three Canadian provinces (i.e., Alberta, Manitoba & Ontario) with distinctive provincial political environments at the time of curriculum construction and/or implementation. Document analysis, discourse analysis and a range of theoretical frameworks (i.e., Levinson, 2010; Pedretti & Nazir, 2011 & Krathwohl, 2002) were used to aid in explorations of STS[E] curriculum segments and discourses in each provincial region. More detailed analysis and thematic exploration is presented for each unit associated with climate change as some interesting patterns emerged following initial analysis. My findings are presented as three comparative case studies and represent a small and original contribution to the large body of scholarly research devoted to studies of STS[E] education, where each province represents a unique case that has been explored regarding some aspects the STS[E] curriculum outcomes/expectations and general political culture as well as some other theoretical factors. Findings from this study indicate that Alberta's STS[E] outcomes may be related to Levinson's (2010) 'deliberative' citizenship focus. The following currents from Pedretti and Nazir (2011) appear to be emphasized: logical reasoning, historical, application & design and socio-cultural aligned outcomes when STS[E] is considered as an entity separate from the Alberta curriculum combination of STS and Knowledge. Ontario's STS[E] expectations may align with Levinson's (2010) 'deliberative' or in some select cases a 'deliberative'/'praxis' framework category with some emphasis related to logical reasoning and socio-cultural awareness (Pedretti & Nazir, 2011) in their STS[E] curriculum. The Manitoba STS[E] outcomes may be aligned with a more 'deliberative' approach with some associations that could intersect with the framework
17 CFR 274.404 - Form TH-Notification of reliance on temporary hardship exemption.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TH-Notification of... Forms for Electronic Filing § 274.404 Form TH—Notification of reliance on temporary hardship exemption. Form TH shall be filed by any electronic filer who submits to the Commission, pursuant to a temporary...
Aaij, R.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves Jr, A.A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Anderson, J.; Andreassen, R.; Andreotti, M.; Andrews, J.E.; Appleby, R.B.; Aquines Gutierrez, O.; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J.J.; Badalov, A.; Balagura, V.; Baldini, W.; Barlow, R.J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Battista, V.; Bay, A.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bettler, M.O.; van Beuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Bizzeti, A.; Bjornstad, P.M.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Borsato, M.; Bowcock, T.J.V.; Bowen, E.; Bozzi, C.; Brambach, T.; van den Brand, J.; Bressieux, J.; Brett, D.; Britsch, M.; Britton, T.; Brodzicka, J.; Brook, N.H.; Brown, H.; Bursche, A.; Busetto, G.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Campora Perez, D.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carranza-Mejia, H.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cassina, L.; Garcia, L.Castillo; Cattaneo, M.; Cauet, Ch.; Cenci, R.; Charles, M.; Charpentier, Ph.; Chen, S.; Cheung, S.F.; Chiapolini, N.; Chrzaszcz, M.; Ciba, K.; Cid Vidal, X.; Ciezarek, G.; Clarke, P.E.L.; Clemencic, M.; Cliff, H.V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Counts, I.; Couturier, B.; Cowan, G.A.; Craik, D.C.; Cruz Torres, M.; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dalseno, J.; David, P.; David, P.N.Y.; Davis, A.; De Bruyn, K.; De Capua, S.; De Cian, M.; de Miranda, J.M.; De Paula, L.; De Silva, W.; De Simone, P.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Deleage, N.; Derkach, D.; Deschamps, O.; Dettori, F.; Di Canto, A.; Dijkstra, H.; Donleavy, S.; Dordei, F.; Dorigo, M.; Dosil Suarez, A.; Dossett, D.; Dovbnya, A.; Dreimanis, K.; Dujany, G.; Dupertuis, F.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, T.; Falabella, A.; Farber, C.; Farinelli, C.; Farley, N.; Farry, S.; Fay, RF.; Ferguson, D.; Fernandez Albor, V.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fontana, M.; Fontanelli, F.; Forty, R.; Francisco, O.; Frank, M.; Frei, C.; Frosini, M.; Fu, J.; Furfaro, E.; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Gao, Y.; Garofoli, J.; Garra Tico, J.; Garrido, L.; Gaspar, C.; Gauld, R.; Gavardi, L.; Gavrilov, G.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gianelle, A.; Giani', S.; Gibson, V.; Giubega, L.; Gligorov, V.V.; Gobel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gordon, H.; Gotti, C.; Grabalosa Gandara, M.; Graciani Diaz, R.; Granado Cardoso, L.A.; Grauges, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Griffith, P.; Grillo, L.; Grunberg, O.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S.C.; Hall, S.; Hamilton, B.; Hampson, T.; Han, X.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S.T.; Harrison, J.; Hartmann, T.; He, J.; Head, T.; Heijne, V.; Hennessy, K.; Henrard, P.; Henry, L.; Hernando Morata, J.A.; van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hulsbergen, W.; Hunt, P.; Hussain, N.; Hutchcroft, D.; Hynds, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jaeger, A.; Jalocha, J.; Jans, E.; Jaton, P.; Jawahery, A.; Jing, F.; John, M.; Johnson, D.; Jones, C.R.; Joram, C.; Jost, B.; Jurik, N.; Kaballo, M.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T.M.; Karodia, S.; Kelsey, M.; Kenyon, I.R.; Ketel, T.; Khanji, B.; Khurewathanakul, C.; Klaver, S.; Kochebina, O.; Kolpin, M.; Komarov, I.; Koopman, R.F.; Koppenburg, P.; Korolev, M.; Kozlinskiy, A.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kurek, K.; Kvaratskheliya, T.; La Thi, V.N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R.W.; Lanciotti, E.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J.P.; Lefevre, R.; Leflat, A.; Lefrancois, J.; Leo, S.; Leroy, O.; Lesiak, T.; Leverington, B.; Li, Y.; Liles, M.; Lindner, R.; Linn, C.; Lionetto, F.; Liu, B.; Liu, G.; Lohn, S.; Longstaff, I.; Lopes, J.H.; Lopez-March, N.; Lowdon, P.; Lu, H.; Lucchesi, D.; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Machefert, F.; Machikhiliyan, I.V.; Maciuc, F.; Maev, O.; Malde, S.; Manca, G.; Mancinelli, G.; Maratas, J.; Marchand, J.F.; Marconi, U.; Benito, C.Marin; Marino, P.; Marki, R.; Marks, J.; Martellotti, G.; Martens, A.; Martin Sanchez, A.; Martinelli, M.; Martinez Santos, D.; Martinez Vidal, F.; Martins Tostes, D.; Massafferri, A.; Matev, R.; Mathe, Z.; Matteuzzi, C.; Mazurov, A.; McCann, M.; McCarthy, J.; McNab, A.; McNulty, R.; McSkelly, B.; Meadows, B.; Meier, F.; Meissner, M.; Merk, M.; Milanes, D.A.; Minard, M.N.; Moggi, N.; Molina Rodriguez, J.; Monteil, S.; Morandin, M.; Morawski, P.; Morda, A.; Morello, M.J.; Moron, J.; Morris, A.B.; Mountain, R.; Muheim, F.; Muller, K.; Muresan, R.; Mussini, M.; Muster, B.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A.D.; Nguyen, T.D.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; O'Hanlon, D.P.; Oblakowska-Mucha, A.; Obraztsov, V.; Oggero, S.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Onderwater, G.; Orlandea, M.; Otalora Goicochea, J.M.; Owen, P.; Oyanguren, A.; Pal, B.K.; Palano, A.; Palombo, F.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Parkes, C.; Parkinson, C.J.; Passaleva, G.; Patel, G.D.; Patel, M.; Patrignani, C.; Pazos Alvarez, A.; Pearce, A.; Pellegrino, A.; Pepe Altarelli, M.; Perazzini, S.; Perez Trigo, E.; Perret, P.; Perrin-Terrin, M.; Pescatore, L.; Pesen, E.; Petridis, K.; Petrolini, A.; Picatoste Olloqui, E.; Pietrzyk, B.; Pilar, T.; Pinci, D.; Pistone, A.; Playfer, S.; Plo Casasus, M.; Polci, F.; Poluektov, A.; Polycarpo, E.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Puig Navarro, A.; Punzi, G.; Qian, W.; Rachwal, B.; Rademacker, J.H.; Rakotomiaramanana, B.; Rama, M.; Rangel, M.S.; Raniuk, I.; Rauschmayr, N.; Raven, G.; Reichert, S.; Reid, M.M.; dos Reis, A.C.; Ricciardi, S.; Richards, A.; Rihl, M.; Rinnert, K.; Rives Molina, V.; Roa Romero, D.A.; Robbe, P.; Rodrigues, A.B.; Rodrigues, E.; Rodriguez Perez, P.; Roiser, S.; Romanovsky, V.; Vidal, A.Romero; Rotondo, M.; Rouvinet, J.; Ruf, T.; Ruffini, F.; Ruiz, H.; Valls, P.Ruiz; Sabatino, G.; Saborido Silva, J.J.; Sagidova, N.; Sail, P.; Saitta, B.; Salustino Guimaraes, V.; Sanchez Mayordomo, C.; Sanmartin Sedes, B.; Santacesaria, R.; Santamarina Rios, C.; Santovetti, E.; Sapunov, M.; Sarti, A.; Satriano, C.; Satta, A.; Savrie, M.; Savrina, D.; Schiller, M.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M.H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Seco, M.; Semennikov, A.; Sepp, I.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Coutinho, R.Silva; Simi, G.; Sirendi, M.; Skidmore, N.; Skwarnicki, T.; Smith, N.A.; Smith, E.; Smith, E.; Smith, J.; Smith, M.; Snoek, H.; Sokoloff, M.D.; Soler, F.J.P.; Soomro, F.; Souza, D.; Souza De Paula, B.; Spaan, B.; Sparkes, A.; Spradlin, P.; Stagni, F.; Stahl, M.; Stahl, S.; Steinkamp, O.; Stenyakin, O.; Stevenson, S.; Stoica, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Stroili, R.; Subbiah, V.K.; Sun, L.; Sutcliffe, W.; Swientek, K.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szczypka, P.; Szilard, D.; Szumlak, T.; T'Jampens, S.; Teklishyn, M.; Tellarini, G.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tourneur, S.; Tran, M.T.; Tresch, M.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Garcia, M.Ubeda; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vagnoni, V.; Valenti, G.; Vallier, A.; Vazquez Gomez, R.; Vazquez Regueiro, P.; Vazquez Sierra, C.; Vecchi, S.; Velthuis, J.J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Viaud, B.; Vieira, D.; Vieites Diaz, M.; Vilasis-Cardona, X.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voss, C.; Voss, H.; de Vries, J.A.; Waldi, R.; Wallace, C.; Wallace, R.; Walsh, J.; Wandernoth, S.; Wang, J.; Ward, D.R.; Watson, N.K.; Websdale, D.; Whitehead, M.; Wicht, J.; Wiedner, D.; Wilkinson, G.; Williams, M.P.; Williams, M.; Wilson, F.F.; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S.A.; Wright, S.; Wu, S.; Wyllie, K.; Xie, Y.; Xing, Z.; Xu, Z.; Yang, Z.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhang, L.; Zhang, W.C.; Zhang, Y.; Zhelezov, A.; Zhokhov, A.; Zhong, L.; Zvyagin, A.
2014-10-03
A search for $CP$ violation in Cabibbo-suppressed $D^{\\pm}\\rightarrow K^0_S K^{\\pm}$ and $D^{\\pm}_{s}\\rightarrow K^0_S \\pi^{\\pm}$ decays is performed using $pp$ collision data, corresponding to an integrated luminosity of 3~fb$^{-1}$, recorded by the LHCb experiment. The individual $CP$-violating asymmetries are measured to be \\begin{eqnarray*} \\mathcal{A}_{CP}^{D^{\\pm}\\rightarrow K^0_S K^{\\pm}} & = & (+0.03 \\pm 0.17 \\pm 0.14) \\% \\\\ \\mathcal{A}_{CP}^{D^{\\pm}_s\\rightarrow K^0_S \\pi^{\\pm}} & = & (+0.38 \\pm 0.46 \\pm 0.17) \\%, \\end{eqnarray*} assuming that $CP$ violation in the Cabibbo-favoured decays is negligible. A combination of the measured asymmetries for the four decay modes $D^{\\pm}_{(s)}\\rightarrow K^0_S K^{\\pm}$ and $D^{\\pm}_{(s)}\\rightarrow K^0_S \\pi^{\\pm}$ gives the sum \\[ \\mathcal{A}_{CP}^{D^{\\pm}\\rightarrow K^0_S K^{\\pm}}+ \\mathcal{A}_{CP}^{D^{\\pm}_s\\rightarrow K^0_S \\pi^{\\pm}} = (+0.41 \\pm 0.49 \\pm 0.26) \\%. \\] In all cases, the first uncertainties are statistical and the second sys...
49 CFR 805.735-17 - Supplementary statements.
2010-10-01
... SAFETY BOARD EMPLOYEE RESPONSIBILITIES AND CONDUCT § 805.735-17 Supplementary statements. Changes in, or additions to, the information contained in an employee's statement of employment and financial interests.... Notwithstanding the filing of the annual report required by this section, each employee shall at all times avoid...
Directory of Open Access Journals (Sweden)
Cǎtǎlin NAE
2010-03-01
Full Text Available This paper is dedicated to a very specific type of analysis tool (VLM - Vortex Lattice Method to be integrated in a IDS - Integrated Design System, tailored for the usage of small aircraft industry. The major interest is to have the possibility to simulate at very low computational costs a preliminary set of aerodynamic characteristics for basic aerodynamic global characteristics (Lift, Drag, Pitching Moment and aerodynamic derivatives for longitudinal and lateral-directional stability analysis. This work enables fast investigations of the influence of configuration changes in a very efficient computational environment. Using experimental data and/or CFD information for a specific calibration of VLM method, reliability of the analysis may me increased so that a first type (iteration zero aerodynamic evaluation of the preliminary 3D configuration is possible. The output of this tool is basic state aerodynamic and associated stability and control derivatives, as well as a complete set of information on specific loads on major airframe components.The major interest in using and validating this type of methods is coming from the possibility to integrate it as a tool in an IDS system for conceptual design phase, as considered for development for CESAR project (IP, UE FP6.
Implementasi Cell ID dan GPS dalam Pencarian Lokasi Fasilitas Kesehatan Terdekat
Directory of Open Access Journals (Sweden)
Fahmi Candra Permana
2017-07-01
Full Text Available Cell ID dan GPS merupakan layanan berbasis lokasi dan teknologi yang banyak membantu manusia dalam hal navigasi dan penemuan tempat-tempat yang bermanfaat di sekitarnya. Salah satu komponen utama dari teknologi ini dapat diterapkan pada telepon seluler. Dalam penelitian ini, dirancang sebuah aplikasi dengan memanfaatkan teknologi berdasar implementasi dari Cell ID dan GPS untuk mengetahui posisi user dan lokasi fasilitas kesehatan terdekat di sekitar user dan penggunaan JSON sebagai sarana untuk menyimpan database pada web. Aplikasi ini diimplementasikan pada telepon seluler dengan sistem operasi Android. Hasil dari penelitian ini menunjukkan bahwa Cell ID dan GPS dapat diimplementasikan dengan baik dengan memanfaatkan akses Internet dan Google Maps untuk mencari fasilitas kesehatan terdekat dan menggambarkan daerah sekitar user.
International Nuclear Information System (INIS)
Maw, Min Khine; Fujimoto, Jiro; Tamaya, Teruhiko
2009-01-01
The inhibitor of DNA-binding (ID) has been involved in cell cycle regulation, apoptosis and angiogenesis. This prompted us to study ID functions in tumor advancement of ovarian cancers. Sixty patients underwent surgery for ovarian cancers. In ovarian cancers, the levels of ID-1, ID-2 and ID-3 mRNAs were determined by real-time reverse transcription-polymerase chain reaction. The histoscore with the localization of ID-1 was determined by immunohistochemistry. Patient prognosis was analyzed with a 36-month survival rate. Microvessel counts were determined by immunohistochemistry for CD34 and factor VIII-related antigen. ID-1 histoscores and mRNA levels both significantly (p < 0.001) increased in ovarian cancers according to clinical stage, regardless of histopathological type. Furthermore, 30 patients with high ID-1 expression had a lower survival rate (53%) compared to patients with low ID-1 expression (80%). ID-1 histoscores and mRNA levels significantly (p < 0.0001) correlated with microvessel counts in ovarian cancers. ID-1 increased in ovarian cancer cells during tumor progression. Moreover, ID-1 expression levels correlated with microvessel counts. Therefore, ID-1 might work on tumor advancement via angiogenesis and is considered to be a candidate for a prognostic indicator in ovarian cancers
Efficient coding and detection of ultra-long IDs for visible light positioning systems.
Zhang, Hualong; Yang, Chuanchuan
2018-05-14
Visible light positioning (VLP) is a promising technique to complement Global Navigation Satellite System (GNSS) such as Global positioning system (GPS) and BeiDou Navigation Satellite System (BDS) which features the advantage of low-cost and high accuracy. The situation becomes even more crucial for indoor environments, where satellite signals are weak or even unavailable. For large-scale application of VLP, there would be a considerable number of Light emitting diode (LED) IDs, which bring forward the demand of long LED ID detection. In particular, to provision indoor localization globally, a convenient way is to program a unique ID into each LED during manufacture. This poses a big challenge for image sensors, such as the CMOS camera in everybody's hands since the long ID covers the span of multiple frames. In this paper, we investigate the detection of ultra-long ID using rolling shutter cameras. By analyzing the pattern of data loss in each frame, we proposed a novel coding technique to improve the efficiency of LED ID detection. We studied the performance of Reed-Solomon (RS) code in this system and designed a new coding method which considered the trade-off between performance and decoding complexity. Coding technique decreases the number of frames needed in data processing, significantly reduces the detection time, and improves the accuracy of detection. Numerical and experimental results show that the detected LED ID can be much longer with the coding technique. Besides, our proposed coding method is proved to achieve a performance close to that of RS code while the decoding complexity is much lower.
Vibrational measurements in 3-ID-B
International Nuclear Information System (INIS)
Sutter, J.; Alp, E.; Barraza, J.; Shu, D.
1998-04-01
The authors have undertaken a series of vibrational measurements in hutch 3-ID-B. Their motivation was to compare two different methods of mounting an interferometer for effectiveness in vibrational isolation and stability. In addition they were able to compare the stability of the optical table with and without its eight large bolts inserted
International Nuclear Information System (INIS)
Kurooka, Hisanori; Sugai, Manabu; Mori, Kentaro; Yokota, Yoshifumi
2013-01-01
Highlights: •Sodium arsenite induces cytoplasmic accumulation of Id3. •Arsenite binds to closely spaced N-terminal cysteine residues of Id3. •N-terminal cysteines are essential for arsenite-induced nuclear export of Id3. •Nuclear export of Id3 counteracts its transcriptional repression activity. -- Abstract: Ids are versatile transcriptional repressors that regulate cell proliferation and differentiation, and appropriate subcellular localization of the Id proteins is important for their functions. We previously identified distinct functional nuclear export signals (NESs) in Id1 and Id2, but no active NES has been reported in Id3. In this study, we found that treatment with the stress-inducing metalloid arsenite led to the accumulation of GFP-tagged Id3 in the cytoplasm. Cytoplasmic accumulation was impaired by a mutation in the Id3 NES-like sequence resembling the Id1 NES, located at the end of the HLH domain. It was also blocked by co-treatment with the CRM1-specific nuclear export inhibitor leptomycin B (LMB), but not with the inhibitors for mitogen-activated protein kinases (MAPKs). Importantly, we showed that the closely spaced N-terminal cysteine residues of Id3 interacted with the arsenic derivative phenylarsine oxide (PAO) and were essential for the arsenite-induced cytoplasmic accumulation, suggesting that arsenite induces the CRM1-dependent nuclear export of Id3 via binding to the N-terminal cysteines. Finally, we demonstrated that Id3 significantly repressed arsenite-stimulated transcription of the immediate-early gene Egr-1 and that this repression activity was inversely correlated with the arsenite-induced nuclear export. Our results imply that Id3 may be involved in the biological action of arsenite
Analyzing endosonic root canal file oscillations: an in vitro evaluation.
Lea, Simon C; Walmsley, A Damien; Lumley, Philip J
2010-05-01
Passive ultrasonic irrigation may be used to improve bacterial reduction within the root canal. The technique relies on a small file being driven to oscillate freely within the canal and activating an irrigant solution through biophysical forces such as microstreaming. There is limited information regarding a file's oscillation patterns when operated while surrounded by fluid as is the case within a canal root. Files of different sizes (#10 and #30, 27 mm and 31 mm) were connected to an ultrasound generator via a 120 degrees file holder. Files were immersed in a water bath, and a laser vibrometer set up with measurement lines superimposed over the files. The laser vibrometer was scanned over the oscillating files. Measurements were repeated 10 times for each file/power setting used. File mode shapes are comprised of a series of nodes/antinodes, with thinner, longer files producing more antinodes. The maximum vibration occurred at the free end of the file. Increasing generator power had no significant effect on this maximum amplitude (p > 0.20). Maximum displacement amplitudes were 17 to 22 microm (#10 file, 27 mm), 15 to 21 microm (#10 file, 31 mm), 6 to 9 microm (#30 file, 27 mm), and 5 to 7 microm (#30, 31 mm) for all power settings. Antinodes occurring along the remaining file length were significantly larger at generator power 1 than at powers 2 through 5 (p generator powers, energy delivered to the file is dissipated in unwanted vibration resulting in reduced vibration displacement amplitudes. This may reduce the occurrence of the biophysical forces necessary to maximize the technique's effectiveness. Copyright (c) 2010 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.
Toward operation of series IDs at BL43LXU of SPring-8
Energy Technology Data Exchange (ETDEWEB)
Baron, A. Q. R.; Tanaka, T.; Soutome, K.; Takao, M.; Nakamura, T.; Kobayashi, K.; Fujita, T.; Takahashi, S.; Aoyagi, H.; Shimosaki, Y.; Seike, T.; Uchiyama, H.; Ishikawa, D.; Chuang, T.-H.; Kimura, H.; Tanaka, H.; Kitamura, H.; Ishikawa, T. [SPring-8, 1-1-1 Kouto, Sayo, Hyogo, 679 (Japan)
2016-07-27
This paper discusses two issues relating to using 3 small gap insertion devices in series at BL43LXU of SPring-8 to make a uniquely powerful source in the 15-26 keV region of the x-ray spectrum. The issues discussed are (1) damage to the covers of the downstream IDs by radiation from the upstream IDs and (2) proper steering of the electron beam to get the best photon beam properties. After tests in several configurations, including one where an ID was run without an impedance-reducing cover, the damage issue was solved by installing a distributed absorber in the most downstream ID. The steering issues were mostly resolved by the introduction of appropriate corrector magnets and feedback. The paper is written from the viewpoint of an interested beamline scientist impressed with the cooperation of different groups to make a source for new science possible.
ID'ing innate and innate-like lymphoid cells.
Verykokakis, Mihalis; Zook, Erin C; Kee, Barbara L
2014-09-01
The immune system can be divided into innate and adaptive components that differ in their rate and mode of cellular activation, with innate immune cells being the first responders to invading pathogens. Recent advances in the identification and characterization of innate lymphoid cells have revealed reiterative developmental programs that result in cells with effector fates that parallel those of adaptive lymphoid cells and are tailored to effectively eliminate a broad spectrum of pathogenic challenges. However, activation of these cells can also be associated with pathologies such as autoimmune disease. One major distinction between innate and adaptive immune system cells is the constitutive expression of ID proteins in the former and inducible expression in the latter. ID proteins function as antagonists of the E protein transcription factors that play critical roles in lymphoid specification as well as B- and T-lymphocyte development. In this review, we examine the transcriptional mechanisms controlling the development of innate lymphocytes, including natural killer cells and the recently identified innate lymphoid cells (ILC1, ILC2, and ILC3), and innate-like lymphocytes, including natural killer T cells, with an emphasis on the known requirements for the ID proteins. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
75 FR 51990 - CenterPoint Energy-Illinois Gas Transmission Company; Notice of Baseline Filing
2010-08-24
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR10-80-000] CenterPoint Energy--Illinois Gas Transmission Company; Notice of Baseline Filing August 17, 2010. Take notice that on August 12, 2010, the applicant listed above submitted their baseline filing of its Statement of Operating...
Magen, Eli; Feldman, Arie; Cohen, Ziona; Alon, Dora Ben; Minz, Evegeny; Chernyavsky, Alexey; Linov, Lina; Mishal, Joseph; Schlezinger, Menacham; Sthoeger, Zev
2010-02-01
A possible link between chronic vascular inflammation and arterial hypertension is now an object of intensive studies. To compare Th1/Th2/Th17 cells-related cytokines, circulating endothelial progenitor cells (EPC), and endothelial function in subjects with resistant arterial hypertension (RAH) and controlled arterial hypertension (CAH). Blood pressure was measured by electronic sphygmomanometer. EPC were identified as CD34+/CD133+/kinase insert domain receptor (KDR)+ cells by flow cytometry. Th1/Th2/Th17 cells-related cytokines were identified using the Human Th1/Th2/Th17 Cytokines MultiAnalyte ELISArray Kit. Endothelium-dependent (FMD) vasodilatation of brachial artery was measured by Doppler ultrasound scanning. RAH group (n = 20) and CAH group (n = 20) and 17 healthy individuals (control group) were recruited. In the RAH group, lower blood levels of EPC number (42.4 +/- 16.7 cells/mL) and EPC% (0.19 +/- 0.08%) were observed than in the CAH group (93.1 +/- 88.7 cells/mL; P = 0.017; 0.27 +/- 0.17; P = 0.036) and control group (68.5 +/- 63.6 cells/mL; P < 0.001; 0.28 +/- 0.17%; P = 0.003), respectively. Plasma transforming growth factor-beta1 levels were significantly higher in the RAH group (1767 +/- 364 pg/mL) than in the CAH group (1292 +/- 349; P < 0.001) and in control group (1203 +/- 419 pg/mL; P < 0.001). In the RAH group, statistically significant negative correlation was observed between systolic blood pressure and EPC% (r = -0.72, P < 0.01). FMD in the RAH group was significantly lower (5.5 +/- 0.8%) than in the CAH group (9.2 +/- 1.4; P < 0.001) and in healthy controls (10.1 +/- 1.1%; P < 0.001). RAH is characterized by reduced circulating EPC, substantial endothelial dysfunction, and increased plasma transforming growth factor-beta1 levels.
17 CFR 259.604 - Form TH-Notification of reliance on temporary hardship exemption.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TH-Notification of... OF 1935 Forms for Electronic Filing § 259.604 Form TH—Notification of reliance on temporary hardship exemption. Form TH shall be filed by any electronic filer who submits to the Commission, pursuant to a...
Generic and Automated Runtime Program Repair
2012-09-01
embedded systems, instead targeting desktop client software such as Firefox [63, 64], server software such as MySQL [63] or webservers [21], or design-by...server php 1,046,000 8,471 44 web programming python 407,000 355 11 general coding wireshark 2,814,000 63 7 packet analyzer total 5,139,000 10,193 105...0.25 php 28 / 44 13.00 8.80 1.84 0.62 python 1 / 11 13.00 8.80 1.22 0.16 wireshark 1 / 7 13.00 8.80 1.23 0.17 total 55 / 105 11.22h 1.60h 4.1.1. Program
78 FR 59663 - Combined Notice of Filings
2013-09-27
... Paso Marketing Company, L.L.C., Gazprom Marketing & Trading USA, Inc. Description: Joint Petition for... Provisions of El Paso Marketing Company, L.L.C. and Gazprom Marketing & Trading USA, Inc. Filed Date: 9/17/13...: Discovery Gas Transmission LLC. Description: 2013 Tariff Revisions--Kinetica Interconnect to be effective 10...
Simulator testing system (STS)
International Nuclear Information System (INIS)
Miller, V.N.
1990-01-01
In recent years there has been a greater demand placed on the capabilities and time usage of real-time nuclear plant simulators due to NRC, INPO and utilities requirements. The requirements applied to certification, new simulators, upgrades, modifications, and maintenance of the simulators vary; however, they all require the capabilities of the simulator to be tested whether it is for NRC 10CFR55.45b requirements, ATP testing of new simulators, ATP testing of upgrades with or without panels, adding software/hardware due to plant modifications, or analyzing software/hardware problems on the simulator. This paper describes the Simulator Testing System (STS) which addresses each one of these requirements placed on simulators. Special attention will be given to ATP testing of upgrades without the use of control room panels. The capabilities and applications of the four parts of STS which are the Display Control Software (DCS), Procedure Control Software (PCS), Display Generator Software (DGS) and the Procedure Generator Software (PGS) will be reviewed
77 FR 68065 - Amendment of Class D and Class E Airspace; Lewiston, ID
2012-11-15
... Measuring Equipment (VOR/ DME), and the Lewiston-Nez Perce Instrument Landing System (ILS) Localizer... feet or more above the surface of the earth. * * * * * ANM ID E5 Lewiston, ID [Modified] Lewiston-Nez...
78 FR 40382 - Modification of Class D and E Airspace; Twin Falls, ID
2013-07-05
... using the Navigation (RNAV) Global Positioning System (GPS) and the Instrument Landing System (ILS) or... or more above the surface of the earth. * * * * * ANM ID E5 Twin Falls, ID [Modified] Twin Falls...
Migraine headaches among university students using id migraine test as a screening tool
Directory of Open Access Journals (Sweden)
Caylan Ayse
2011-08-01
Full Text Available Abstract Background Migraine is a significant health problem, especially for the young people, due to its frequency and accompanying morbidity, causing disability and loss of performance. In this study, our aim was to determine the prevalence of migraine headaches among university students in Edirne, a Turkish city. Methods In this cross-sectional and descriptive study, study population was composed of students registered to Trakya University in the academic year of 2008-2009. Out of these, 3694 of them accepted to participate. Participants who had two or more headaches in the last 3 months formed the headache group. Afterwards, two preliminary questions were applied to the headache group and participants with at least one affirmative response were asked to perform the validated ID-Migraine™ test. Results The mean age of 3694 students participated in the study was 19.23 ± 1.84 (17-39 years, with adolescents:adult ratio being 2.5:1. 1613 students (43.7% did have at least two headaches in the last three months. Migraine-type headache was detected in 266 subjects (7.2% based on the ID-Migraine™ test. Of the migraine group, 72 were male (27.1% and 194 were female (72.9%. There was no significant difference in migraine prevalence between adolescent and adult age groups. Conclusions With a prevalence similar to adults, primary care physicians should be aware of the probability of migraine headaches in university students in order to maintain a successful school performance.
Id2 reinforces TH1 differentiation and inhibits E2A to repress TFH differentiation.
Shaw, Laura A; Bélanger, Simon; Omilusik, Kyla D; Cho, Sunglim; Scott-Browne, James P; Nance, J Philip; Goulding, John; Lasorella, Anna; Lu, Li-Fan; Crotty, Shane; Goldrath, Ananda W
2016-07-01
The differentiation of helper T cells into effector subsets is critical to host protection. Transcription factors of the E-protein and Id families are important arbiters of T cell development, but their role in the differentiation of the TH1 and TFH subsets of helper T cells is not well understood. Here, TH1 cells showed more robust Id2 expression than that of TFH cells, and depletion of Id2 via RNA-mediated interference increased the frequency of TFH cells. Furthermore, TH1 differentiation was blocked by Id2 deficiency, which led to E-protein-dependent accumulation of effector cells with mixed characteristics during viral infection and severely impaired the generation of TH1 cells following infection with Toxoplasma gondii. The TFH cell-defining transcriptional repressor Bcl6 bound the Id2 locus, which provides a mechanism for the bimodal Id2 expression and reciprocal development of TH1 cells and TFH cells.
Overestimation of the 25(OH)D serum concentration with the automated IDS EIA kit.
Cavalier, Etienne; Huberty, Véronique; Cormier, Catherine; Souberbielle, Jean-Claude
2011-02-01
We have recently observed an increasing number of patients presenting very high serum levels of 25-hydroxyvitamin D [25(OH)D] (> 150 ng/mL), which, in all cases, had been measured with the IDS EIA kit adapted on different "open" automated platforms. We performed a comparison between the IDS EIA kit adapted on two different "open"automated platforms and the DiaSorin RIA. We found a systematic bias (higher levels with the IDS EIA kit) for concentrations more than 50-60 ng/mL that was less obvious when the IDS EIA was used in its manual procedure. We thus suggest to use the IDS EIA kit in its manual procedure rather than to adapt it on an automated platform, and to interpret cautiously a 25(OH)D greater than 100 ng/mL with this kit. Copyright © 2011 American Society for Bone and Mineral Research.
STS-92 Pilot Pam Melroy suits up for launch
2000-01-01
In the Operations and Checkout Building, STS-92 Pilot Pamela Ann Melroy smiles during suit check before heading out to the Astrovan for the ride to Launch Pad 39A. During the 11-day mission to the International Space Station, four extravehicular activities (EVAs), or spacewalks, are planned for construction. The payload includes the Integrated Truss Structure Z-1 and the third Pressurized Mating Adapter. The Z-1 truss is the first of 10 that will become the backbone of the Space Station, eventually stretching the length of a football field. PMA-3 will provide a Shuttle docking port for solar array installation on the sixth Station flight and Lab installation on the seventh Station flight. Launch is scheduled for 7:17 p.m. EDT. Landing is expected Oct. 22 at 2:10 p.m. EDT.
Determination of local chromatin composition by CasID.
Schmidtmann, Elisabeth; Anton, Tobias; Rombaut, Pascaline; Herzog, Franz; Leonhardt, Heinrich
2016-09-02
Chromatin structure and function are determined by a plethora of proteins whose genome-wide distribution is typically assessed by immunoprecipitation (ChIP). Here, we developed a novel tool to investigate the local chromatin environment at specific DNA sequences. We combined the programmable DNA binding of dCas9 with the promiscuous biotin ligase BirA* (CasID) to biotinylate proteins in the direct vicinity of specific loci. Subsequent streptavidin-mediated precipitation and mass spectrometry identified both known and previously unknown chromatin factors associated with repetitive telomeric, major satellite and minor satellite DNA. With super-resolution microscopy, we confirmed the localization of the putative transcription factor ZNF512 at chromocenters. The versatility of CasID facilitates the systematic elucidation of functional protein complexes and locus-specific chromatin composition.
THE HOMOGENEOUS STUDY OF TRANSITING SYSTEMS (HoSTS). I. THE PILOT STUDY OF WASP-13
Energy Technology Data Exchange (ETDEWEB)
Gomez Maqueo Chew, Yilen; Cargile, Phillip; Hebb, Leslie; Stassun, Keivan G. [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States); Faedi, Francesca; Pollacco, Don [Department of Physics, University of Warwick, Coventry CV4 7AL (United Kingdom); Doyle, Amanda P.; Smalley, Barry [Astrophysics Group, Keele University, Staffordshire ST5 5BG (United Kingdom); Ghezzi, Luan; Cunha, Katia; Smith, Verne V. [Observatorio Nacional, Rua Gal. Jose Cristino 77, Rio de Janeiro, RJ 20921-400 (Brazil); Sousa, Sergio; Santos, Nuno C. [Centro de Astrofisica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Barros, Susana C. C. [LAM (Laboratoire d' Astrophysique de Marseille) UMR 7326, Aix Marseille Universite, CNRS, F-13388 Marseille (France); Schuler, Simon C. [Stewart Observatory, University of Arizona, Tucson, AZ 85721 (United States); Collier Cameron, Andrew, E-mail: yilen.gomez@vanderbilt.edu [School of Physics and Astronomy, University of St Andrews, St Andrews, Fife KY16 9SS (United Kingdom)
2013-05-01
We present the fundamental stellar and planetary properties of the transiting planetary system WASP-13 within the framework of the Homogeneous Study of Transiting Systems (HoSTS). HoSTS aims to derive the fundamental stellar (T{sub eff}, [Fe/H], M{sub *}, R{sub *}) and planetary (M{sub pl}, R{sub pl}, T{sub eq}) physical properties of known transiting planets using a consistent methodology and homogeneous high-quality data set. Four spectral analysis techniques are independently applied to a Keck+HIRES spectrum of WASP-13 considering two distinct cases: unconstrained parameters and constrained log g from transit light curves. We check the derived stellar temperature against that from a different temperature diagnostic based on an INT+IDS H{alpha} spectrum. The four unconstrained analyses render results that are in good agreement, and provide an improvement of 50% in the precision of T{sub eff}, and of 85% in [Fe/H] with respect to the WASP-13 discovery paper. The planetary parameters are then derived via the Monte Carlo Markov Chain modeling of the radial velocity and light curves, in iteration with stellar evolutionary models to derive realistic uncertainties. WASP-13 (1.187 {+-} 0.065 M{sub Sun }; 1.574 {+-} 0.048 R{sub Sun }) hosts a Saturn-mass, transiting planet (0.500 {+-} 0.037 M{sub Jup}; 1.407 {+-} 0.052 R{sub Jup}), and is at the end of its main-sequence lifetime (4-5.5 Gyr). Our analysis of WASP-13 showcases that both a detailed stellar characterization and transit modeling are necessary to well determine the fundamental properties of planetary systems, which are paramount in identifying and determining empirical relationships between transiting planets and their hosts.
The Implementation of C-ID, R2D2 Model on Learning Reading Comprehension
Rayanto, Yudi Hari; Rusmawan, Putu Ngurah
2016-01-01
The purposes of this research are to find out, (1) whether C-ID, R2D2 model is effective to be implemented on learning Reading comprehension, (2) college students' activity during the implementation of C-ID, R2D2 model on learning Reading comprehension, and 3) college students' learning achievement during the implementation of C-ID, R2D2 model on…
Anmeldung in ILIAS ohne Uni-Login-ID
Schanz, Nadja
2016-01-01
Gewusst wie...! Online-Tutorial der Universitätsbibliothek Tübingen. Erklärt die Anmeldung in Ilias zu Führungen ohne Uni-Login-ID Online Tutorial from university library tuebingen. teaches how to register in Ilias for courses and guided tours without university login
On the validity of Ksub(Id)-measurements in instrumented impact tests
International Nuclear Information System (INIS)
Kalthoff, J.F.; Winkler, S.; Klemm, W.; Beinert, J.
1979-01-01
The influence of inertia effects in determining the dynamic fracture toughness Ksub(Id) by instrumented impact testing is investigated. Model experiments in the brittle fracture regime are carried out with precracked bend specimens machined from the epoxy resin Araldite B. As is usual in these tests, the loads at the tup of the impinging striker are recorded as a function of time during the impact process. For reference purposes, the dynamic fracture toughness value Ksub(Id)sup(m1) is derived from the measured maximum load utilizing static stress intensity factor formulas. In addition to this conventional procedure, the actual stress intensity factors are measured directly at the tip of the crack by means of the shadow optical method of caustics applied in combination with high speed photography. The critical value of these optically measured stress intensity factors (for onset of crack propagation), Ksub(Id)sup(opt), is the true dynamic fracture toughness. In the experiments, the specimen size and the impact velocity were varied. In accordance with expectations, it is found that the hammer load signal is not correlated with the actual crack tip stress intensity factor values by a simple proportionality. The conventionally determined Ksub(Id)sup(m1)-value overestimates the true dynamic fracture toughness Ksub(Id)sup(opt). This overestimation becomes larger for larger specimen sizes and larger impact velocities. The results demonstrate the dominating influence inertia effects can have on hammer load measurements and emphasize the importance of eliminating these effects in order to determine non-erroneous dynamic fracture toughness values. (orig.)
International Nuclear Information System (INIS)
Zhang, Long; Shi, Songting; Zhang, Juan; Zhou, Fangfang; Dijke, Peter ten
2012-01-01
Highlights: ► Expression of Id3 but not Id1 is induced by Wnt3a stimulation in C2C12 cells. ► Wnt3a induces Id3 expression via canonical Wnt/β-catenin pathway. ► Wnt3a-induced Id3 expression does not depend on BMP signaling activation. ► Induction of Id3 expression is critical determinant in Wnt3a-induced cell proliferation and differentiation. -- Abstract: Canonical Wnt signaling plays important roles in regulating cell proliferation and differentiation. In this study, we report that inhibitor of differentiation (Id)3 is a Wnt-inducible gene in mouse C2C12 myoblasts. Wnt3a induced Id3 expression in a β-catenin-dependent manner. Bone morphogenetic protein (BMP) also potently induced Id3 expression. However, Wnt-induced Id3 expression occurred independent of the BMP/Smad pathway. Functional studies showed that Id3 depletion in C2C12 cells impaired Wnt3a-induced cell proliferation and alkaline phosphatase activity, an early marker of osteoblast cells. Id3 depletion elevated myogenin induction during myogenic differentiation and partially impaired Wnt3a suppressed myogenin expression in C2C12 cells. These results suggest that Id3 is an important Wnt/β-catenin induced gene in myoblast cell fate determination.
STS-93 Commander Collins suits up for launch
1999-01-01
During the third launch preparations in the Operations and Checkout Building, STS-93 Commander Eileen M. Collins waves while having her launch and entry suit checked. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
17 CFR 229.1010 - (Item 1010) Financial statements.
2010-04-01
....1010 (Item 1010) Financial statements. (a) Financial information. Furnish the following financial information: (1) Audited financial statements for the two fiscal years required to be filed with the company's... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1010) Financial...
DNA origami-based shape IDs for single-molecule nanomechanical genotyping
Zhang, Honglu; Chao, Jie; Pan, Dun; Liu, Huajie; Qiang, Yu; Liu, Ke; Cui, Chengjun; Chen, Jianhua; Huang, Qing; Hu, Jun; Wang, Lianhui; Huang, Wei; Shi, Yongyong; Fan, Chunhai
2017-04-01
Variations on DNA sequences profoundly affect how we develop diseases and respond to pathogens and drugs. Atomic force microscopy (AFM) provides a nanomechanical imaging approach for genetic analysis with nanometre resolution. However, unlike fluorescence imaging that has wavelength-specific fluorophores, the lack of shape-specific labels largely hampers widespread applications of AFM imaging. Here we report the development of a set of differentially shaped, highly hybridizable self-assembled DNA origami nanostructures serving as shape IDs for magnified nanomechanical imaging of single-nucleotide polymorphisms. Using these origami shape IDs, we directly genotype single molecules of human genomic DNA with an ultrahigh resolution of ~10 nm and the multiplexing ability. Further, we determine three types of disease-associated, long-range haplotypes in samples from the Han Chinese population. Single-molecule analysis allows robust haplotyping even for samples with low labelling efficiency. We expect this generic shape ID-based nanomechanical approach to hold great potential in genetic analysis at the single-molecule level.
STS-82 Pilot Scott Horowitz arrives for TCDT
1997-01-01
STS-82 Pilot Scott J. 'Doc' Horowitz arrives at KSCs Shuttle Landing Facility in a T-38 jet from Houston, TX. Horowitz and the other six crew members are at KSC to participate in the Terminal Countdown Demonstration Test (TCDT), a dress rehearsal for launch. The crew aboard the Space Shuttle Discovery on STS-82 will conduct the second Hubble Space Telescope servicing mission. The 10-day flight is targeted for a Feb. 11 liftoff.
STS-99 workers move new Master Events Controller into aft compartment
2000-01-01
At Launch Pad 39A, workers move the replacement Enhanced Main Events Controller (E-MEC) into Shuttle Endeavour's aft compartment in the payload bay. The original E-MEC became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. Both E-MECs are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.
The faulty Master Events Controller is removed from STS-99 Endeavour
2000-01-01
Technicians remove a faulty Enhanced Main Events Controller (E- MEC) from Shuttle Endeavour at Launch Pad 39A. The E-MEC became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. Both E-MECs are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.
Role of ID Proteins in BMP4 Inhibition of Profibrotic Effects of TGF-β2 in Human TM Cells.
Mody, Avani A; Wordinger, Robert J; Clark, Abbot F
2017-02-01
Increased expression of TGF-β2 in primary open-angle glaucoma (POAG) aqueous humor (AH) and trabecular meshwork (TM) causes deposition of extracellular matrix (ECM) in the TM and elevated IOP. Bone morphogenetic proteins (BMPs) regulate TGF-β2-induced ECM production. The underlying mechanism for BMP4 inhibition of TGF-β2-induced fibrosis remains undetermined. Bone morphogenic protein 4 induces inhibitor of DNA binding proteins (ID1, ID3), which suppress transcription factor activities to regulate gene expression. Our study will determine whether ID1and ID3 proteins are downstream targets of BMP4, which attenuates TGF-β2 induction of ECM proteins in TM cells. Primary human TM cells were treated with BMP4, and ID1 and ID3 mRNA, and protein expression was determined by quantitative PCR (Q-PCR) and Western immunoblotting. Intracellular ID1 and ID3 protein localization was studied by immunocytochemistry. Transformed human TM cells (GTM3 cells) were transfected with ID1 or ID3 expression vectors to determine their potential inhibitory effects on TGF-β2-induced fibronectin and plasminogen activator inhibitor-I (PAI-1) protein expression. Basal expression of ID1-3 was detected in primary human TM cells. Bone morphogenic protein 4 significantly induced early expression of ID1 and ID3 mRNA (P protein in primary TM cells, and a BMP receptor inhibitor blocked this induction. Overexpression of ID1 and ID3 significantly inhibited TGF-β2-induced expression of fibronectin and PAI-1 in TM cells (P protein 4 induced ID1 and ID3 expression suppresses TGF-β2 profibrotic activity in human TM cells. In the future, targeting specific regulators may control the TGF-β2 profibrotic effects on the TM, leading to disease modifying IOP lowering therapies.
An enhanced dynamic ID-based authentication scheme for telecare medical information systems
Directory of Open Access Journals (Sweden)
Ankita Chaturvedi
2017-01-01
Full Text Available The authentication schemes for telecare medical information systems (TMIS try to ensure secure and authorized access. ID-based authentication schemes address secure communication, but privacy is not properly addressed. In recent times, dynamic ID-based remote user authentication schemes for TMIS have been presented to protect user’s privacy. The dynamic ID-based authentication schemes efficiently protect the user’s privacy. Unfortunately, most of the existing dynamic ID-based authentication schemes for TMIS ignore the input verifying condition. This makes login and password change phases inefficient. Inefficiency of the password change phase may lead to denial of service attack in the case of incorrect input in the password change phase. To overcome these weaknesses, we proposed a new dynamic ID-based authentication scheme using a smart card. The proposed scheme can quickly detect incorrect inputs which makes the login and password change phase efficient. We adopt the approach with the aim to protect privacy, and efficient login and password change phases. The proposed scheme also resists off-line password guessing attack and denial of service attack. We also demonstrate the validity of the proposed scheme by utilizing the widely-accepted BAN (Burrows, Abadi, and Needham logic. In addition, our scheme is comparable in terms of the communication and computational overheads with relevant schemes for TMIS.
17 CFR 250.57 - Notices and reports to be filed under section 33.
2010-04-01
... section 33. (a) Notification of Status as Foreign Utility Company. Form U-57 (§ 259.207 of this chapter), notification of status as a foreign utility company, may be filed by, or on behalf of, an entity that seeks to... COMMISSION (CONTINUED) GENERAL RULES AND REGULATIONS, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Regulation...
17 CFR 201.401 - Consideration of stays.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Consideration of stays. 201... PRACTICE Rules of Practice Appeal to the Commission and Commission Review § 201.401 Consideration of stays... consideration. Where the action complained of has already taken effect and the motion for stay is filed within...
17 CFR 10.93 - Obtaining default order.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Obtaining default order. 10.93... Disposition Without Full Hearing § 10.93 Obtaining default order. When a respondent has failed to (a) file an... enter findings and conclusions and a default order against that respondent based upon the matters set...
17 CFR 210.7-04 - Income statements.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Income statements. 210.7-04... 1940, AND ENERGY POLICY AND CONSERVATION ACT OF 1975 Insurance Companies § 210.7-04 Income statements... face of the income statements and in the notes thereto filed for persons to whom this article pertains...
17 CFR 229.1000 - (Item 1000) Definitions.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1000) Definitions. 229.1000 Section 229.1000 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY AND CONSERVATION ACT OF 1975-REGULATION...
Automatic spent fuel ID number reader (I)
International Nuclear Information System (INIS)
Tanabe, S.; Kawamoto, H.; Fujimaki, K.; Kobe, A.
1991-01-01
An effective and efficient technique has been developed for facilitating identification works of LWR spent fuel stored in large scale spent fuel storage pools of such as processing plants. Experience shows that there are often difficulties in the implementation of operator's nuclear material accountancy and control works as well as safeguards inspections conducted on spent fuel assemblies stored in deep water pool. This paper reports that the technique is realized as an automatic spent fuel ID number reader system installed on fuel handling machine. The ID number reader system consists of an optical sub-system and an image processing sub-system. Thousands of spent fuel assemblies stored in under water open racks in each storage pool could be identified within relatively short time (e.g. within several hours) by using this combination. Various performance tests were carried out on image processing sub-system in 1990 using TV images obtained from different types of spent fuel assemblies stored in various storage pools of PWR and BWR power stations
Cloning and shake flask expression of hrIDS- Like in Pichia pastoris ...
African Journals Online (AJOL)
The human Iduronate-2-sulfate sulfatase (hIDS-Like) was cloned into the methylotrophic yeast Pichia pastoris under the control of alcohol oxidase promoter (AOX1) and the -mating factor signal peptide (a-factor). Six clones were identified by PCR. Using clone IDS28, the enzyme was secreted into the culture medium, ...
Decay data file based on the ENSDF file
Energy Technology Data Exchange (ETDEWEB)
Katakura, J. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1997-03-01
A decay data file with the JENDL (Japanese Evaluated Nuclear Data Library) format based on the ENSDF (Evaluated Nuclear Structure Data File) file was produced as a tentative one of special purpose files of JENDL. The problem using the ENSDF file as primary source data of the JENDL decay data file is presented. (author)
Cladding the inside surface of a 3 1/4 in. ID Zircaloy-2 pressure tube with 1S aluminum
International Nuclear Information System (INIS)
Watson, R.D.
1966-09-01
A hot-press sizing technique has been developed for cladding the inside surface of Zircaloy-2 pressure tubes with 1S aluminum. The process is performed in air with the Zircaloy-2 and aluminum at a temperature of approximately 950 o F. A controlled atmosphere is not required, either during preheating or while the cladding is being applied. Tubes 30 inches long and 3 1/4 inches ID have been coated with 1S aluminum in thicknesses ranging from 0.005 inches to more than 0.02 inches; tubes longer than 30 inches have not been attempted. The lining of aluminum is firmly attached to the Zircaloy-2 at all points in the tube but the bond strength varies considerably - from. 6500 to 28000 lbf/in 2 . This work is the subject of Canadian Patent Application No. 955,358 filed March 21, 1966. (author)
IAEA: 17 countries are candidates for nuclear energy
International Nuclear Information System (INIS)
Anon.
2011-01-01
In january 2011 IAEA announced that 17 countries had officially expressed their willingness to home nuclear power plants, they have filed applications for the construction of nuclear power plants. Among the countries concerned we find: Poland, Kuwait, Jordan, Morocco, Tunisia, Nigeria, Bangladesh, Thailand, Vietnam, Chile and Uruguay
STS-114: Crew Interviews: 1. Jim Kelly 2. Charlie Camarda
2005-01-01
1) STS-114 Pilot James Kelly mentions his primary job as the Pilot is to back up Commander Eileen Collins all through the flight. James discusses in detail his robotics operations for all of the extravehicular activities and spacewalk work, as well as moving the logistics module back and forth, onto the station and back in the payload bay. He shares his thoughts on the Columbia, the STS-114 mission as a new chapter in space exploration, and the International Space Station. 2) STS-114 Mission Specialist Charlie Camarda discusses his major role in the mission, his feelings for this being his first Space Shuttle flight; shares his thoughts on the Columbia; mentioned that STS-114 is a baby step to what is needed to do for the next step in space exploration, and gave some examples on how the International Space Station can help pave the path to future space exploration.
Zircaloy cladding ID/OD oxidation studies. Final report
International Nuclear Information System (INIS)
Westerman, R.E.; Hesson, G.M.
1977-11-01
The ID/OD oxide ratio that forms on Zircaloy tubing at temperatures relevant to postulated LOCA conditions was measured as a function of time, temperature, and distance from the rupture. The average ratio at the rupture position was less than unity, and decreased with decreasing test time and increasing distance from the point of rupture. The maximum observed ID/OD oxide ratio was 1.4. Ratios in excess of unity were typically found to be a consequence of the OD oxide being thinner than would have been anticipated from the nominal test conditions. Confirmatory data were also obtained on the isothermal oxidation kinetics of Zircaloy. These data are in good agreement with those obtained by other investigators and confirm the conservative nature of the Baker-Just equation that is required for use in licensing calculations
75 FR 37423 - Combined Notice of Filings #1
2010-06-29
...Power Resources Management, LLC; Dighton Power, LLC; Lake Road Generating Company, L.P. Description... et al. submits an Assignment, Cotenancy and Common Facilities Agreement etc. Filed Date: 06/17/2010... Monday, July 12, 2010. Docket Numbers: ER10-1492-000. Applicants: Midwest ISO and Midwest ISO...
Alía, P; Mañá, J; Capdevila, O; Alvarez, A; Navarro, M A
2005-01-01
Serum angiotensin converting enzyme (SACE) concentration is considered a marker of sarcoidosis activity. This concentration is influenced by an insertion/deletion (I/D) polymorphism of the ACE gene, such that SACE levels follow the pattern DD>ID>II. The aim of our work was to study the relationship between I/D polymorphism and susceptibility to sarcoidosis, as well as the relation between this polymorphism and the clinical presentation and evolution of the disease in 177 sarcoidosis patients. A group of 104 individuals without sarcoidosis was included as control. Genotyping was done by a polymerase chain reaction (PCR) method, and SACE concentration at diagnosis was determined by a kinetic method. No differences were observed in genotype or allele distributions between patients and controls, nor between patients considering the type of presentation (Löfgren versus non-Löfgren) and evolution of the disease (acute versus chronic). As reported for healthy populations, SACE concentrations followed the pattern DD>ID>II in sarcoidosis patients, but significant differences between genotypes existed only in the Löfgren group (p = 0.003) and in acute patients (p = 0.02). SACE concentrations at diagnosis were lower in acute patients (p = 0.05) and in Löfgren's syndrome (p = 0.04), but this seemed to occur only in ID individuals (p = 0.02 and p = 0.01, respectively). No relation was thus found between I/D polymorphism and susceptibility to sarcoidosis, but ACE I/D genotyping may improve the assessment of disease activity, both at diagnosis and during the follow-up of treated and untreated patients.
STS-93 Pilot Ashby suits up for launch
1999-01-01
In the Operations and Checkout Building during final launch preparations for the third time, STS-93 Pilot Jeffrey S. Ashby pulls on his glove, part of his launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen Collins, Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
Identification of an active ID-like group of SINEs in the mouse.
Kass, David H; Jamison, Nicole
2007-09-01
The mouse genome consists of five known families of SINEs: B1, B2, B4/RSINE, ID, and MIR. Using RT-PCR we identified a germ-line transcript that demonstrates 92.7% sequence identity to ID (excluding primer sequence), yet a BLAST search identified numerous matches of 100% sequence identity. We analyzed four of these elements for their presence in orthologous genes in strains and subspecies of Mus musculus as well as other species of Mus using a PCR-based assay. All four analyzed elements were identified either only in M. musculus or exclusively in both M. musculus and M. domesticus, indicative of recent integrations. In conjunction with the identification of transcripts, we present an active ID-like group of elements that is not derived from the proposed BC1 master gene of ID elements. A BLAST of the rat genome indicated that these elements were not in the rat. Therefore, this family of SINEs has recently evolved, and since it has thus far been observed mainly in M. musculus, we refer to this family as MMIDL.
RPD: Reusable Pseudo-Id Distribution for a Secure and Privacy Preserving VANET
Directory of Open Access Journals (Sweden)
Sulaiman Ashraph
2013-08-01
Full Text Available In any VANET, security and privacy are the two fundamental issues. Obtaining efficient security in vehicular communication is essential without compromising privacy-preserving mechanisms. Designing a suitable protocol for VANET by having these two issues in mind is challenging because efficiency, unlinkablity and traceability are the three qualities having contradictions between them. In this paper, we introduce an efficient Reusable Pseudo-id Distribution (RPD scheme. The Trusted Authority (TA designating the Road Side Units (RSUs to generate n reusable pseudo ids and distribute them to the On Board Units (OBUs on request characterizes the proposed protocol. RSUs issue the aggregated hashes of all its valid pseudo-ids along with a symmetric shared key and a particular pseudo-id to each vehicle that enters into its coverage range. Through this the certificates attached to the messages can be eliminated and thus resulting in a significantly reduced packet size. The same anonymous keys can then be re-distributed by the RSUs episodically to other vehicles. We analyze the proposed protocol extensively to demonstrate its merits and efficiency.
Razavian, Hamid; Iranmanesh, Pedram; Mojtahedi, Hamid; Nazeri, Rahman
2015-01-01
Introduction: Presence of surface defects in endodontic instruments can lead to unwanted complications such as instrument fracture and incomplete preparation of the canal. The current study was conducted to evaluate the effect of autoclave cycles on surface characteristics of S-File by scanning electron microscopy (SEM). Methods and Materials: In this experimental study, 17 brand new S-Files (#30) were used. The surface characteristics of the files were examined in four steps (without autocla...
17 CFR 229.1016 - (Item 1016) Exhibits.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1016) Exhibits. 229.1016 Section 229.1016 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY AND CONSERVATION ACT OF 1975-REGULATION S-...
17 CFR 270.8b-2 - Definitions.
2010-04-01
... such document is filed with such exchange. (j) Share. The term “share” means a share of stock in a... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definitions. 270.8b-2 Section 270.8b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND...
Demonstrating idAnimate : a multi-touch system for sketching and rapidly manipulating animations
Quevedo Fernandez, Javier; Martens, J.B.O.S.
2012-01-01
This demonstration presents idAnimate, a multi-touch application for sketching animations. Thanks to the affordances provided by multitouch interfaces, idAnimate yields a novel, intuitive and easy to use animation technique named transformation-by-example, that allows users to author animations in
Directory of Open Access Journals (Sweden)
García-Carpintero, Esther
2014-06-01
Full Text Available The development and improvement of cooperation between the industrial sector and the public R&D system can produce competitive advantages for the companies. The present work describes experiences and perceptions of Spanish biotechnology companies in their collaboration with the public R&D system. Results show that almost all the biotechnological companies with R&D activities (93.6% have cooperated with the public R&D system. The main barriers found by the companies are the excess of bureaucracy and the slow response of public researchers. Results obtained also suggest the need to establish public policies and programmes to promote knowledge and technology transfer from public research centres to companies, with a special focus on encouraging researchers from the public R&D system and on improving how Technology Transfer Offices work.El desarrollo y la mejora de la cooperación entre el sector productivo y el sistema público de I+D puede generar un conjunto de ventajas competitivas para estas empresas. El presente trabajo describe las experiencias y percepciones de las empresas biotecnológicas españolas en su colaboración con el sistema público de I+D. Los resultados muestran que prácticamente la totalidad de empresas biotecnológicas españolas con actividades de I+D (un 93,6% han mantenido algún tipo de colaboración con el sistema público de I+D. Los principales obstáculos percibidos por estas empresas en su colaboración con el sistema público de I+D son el exceso de burocracia y la respuesta lenta de los investigadores. Los resultados obtenidos sugieren la conveniencia de establecer políticas y programas públicos para fomentar la transferencia de conocimiento y tecnología desde el sistema público de I+D a las empresas, fundamentalmente centrados en la necesidad de incentivar a los investigadores del sistema público de I+D y mejorar el funcionamiento de las Oficinas de Transferencia de Tecnología.
STS-32 Commander Brandenstein adjusts IMAX camera during training session
1989-01-01
STS-32 Commander Daniel C. Brandenstein adjusts IMAX camera setting during briefing and training session as technician looks on. The session was conducted in the JSC Mockup and Integration Laboratory (MAIL) Bldg 9B. The IMAX camera will be used onboard Columbia, Orbiter Vehicle (OV) 102, during the STS-32 mission.
STS-9 crewmembers in training session in bldg 9A
1983-01-01
Members of the STS-9 crew discuss flight procedures with a trainer in bldg 9A before the STS-9 mission. From left to right are Brewster Shaw, pilot; John Young, crew commander; Robert Parker, mission specialist; and unidentified trainer. They are reviewing procedures manuals on the shuttle mock-up hatch.
78 FR 38708 - Combined Notice of Filings #2
2013-06-27
...: Midcontinent Independent System Operator, Inc. submits 2013-06-17 Name Change Filing to be effective 6/1/2013.... Applicants: Gray County Wind Energy, LLC. Description: Gray County Wind Energy, LLC submits Gray County Wind... Wind Energy Center, LLC. Description: High Majestic Wind Energy Center, LLC submits High Majestic Wind...
77 FR 56638 - Combined Notice of Filings #1
2012-09-13
.... Applicants: New York Independent System Operator, Inc. Description: Amendment to NYISO OATT, Attachment Y....m. e.t. 9/17/12. Docket Numbers: ER12-2368-000. Applicants: Denver City Energy Associates, LP... Denver City Energy Associates, L.P. tariff. Filed Date: 9/5/12. Accession Number: 20120905-5122. Comments...
The paradox of IDs: an account of an ethnographic experience in the US
Directory of Open Access Journals (Sweden)
Mariza Peirano
2008-01-01
Full Text Available In the modern world, IDs are indispensable objects, without which we cannot prove that we are who we say we are. We need material substantiation that attests to the authenticity of our self-identification. This paper is an account of an ethnographic experience about IDs and identification processes in the US, based on the examination of two events in which Eliot Spitzer, the New York State governor from January 2007 to March 2008, was a central figure. A comparison with the Brazilian scenario is present throughout the paper, and it ends by focusing on the ID theft phenomenon.
Papaspyridonos, Marianna; Matei, Irina; Huang, Yujie; do Rosario Andre, Maria; Brazier-Mitouart, Helene; Waite, Janelle C; Chan, April S; Kalter, Julie; Ramos, Ilyssa; Wu, Qi; Williams, Caitlin; Wolchok, Jedd D; Chapman, Paul B; Peinado, Hector; Anandasabapathy, Niroshana; Ocean, Allyson J; Kaplan, Rosandra N; Greenfield, Jeffrey P; Bromberg, Jacqueline; Skokos, Dimitris; Lyden, David
2015-04-29
A central mechanism of tumour progression and metastasis involves the generation of an immunosuppressive 'macroenvironment' mediated in part through tumour-secreted factors. Here we demonstrate that upregulation of the Inhibitor of Differentiation 1 (Id1), in response to tumour-derived factors, such as TGFβ, is responsible for the switch from dendritic cell (DC) differentiation to myeloid-derived suppressor cell expansion during tumour progression. Genetic inactivation of Id1 largely corrects the myeloid imbalance, whereas Id1 overexpression in the absence of tumour-derived factors re-creates it. Id1 overexpression leads to systemic immunosuppression by downregulation of key molecules involved in DC differentiation and suppression of CD8 T-cell proliferation, thus promoting primary tumour growth and metastatic progression. Furthermore, advanced melanoma patients have increased plasma TGFβ levels and express higher levels of ID1 in myeloid peripheral blood cells. This study reveals a critical role for Id1 in suppressing the anti-tumour immune response during tumour progression and metastasis.
miR-342 regulates BRCA1 expression through modulation of ID4 in breast cancer.
Directory of Open Access Journals (Sweden)
Elisabetta Crippa
Full Text Available A miRNAs profiling on a group of familial and sporadic breast cancers showed that miRNA-342 was significantly associated with estrogen receptor (ER levels. To investigate at functional level the role of miR-342 in the pathogenesis of breast cancer, we focused our attention on its "in silico" predicted putative target gene ID4, a transcription factor of the helix-loop-helix protein family whose expression is inversely correlated with that of ER. ID4 is expressed in breast cancer and can negatively regulate BRCA1 expression. Our results showed an inverse correlation between ID4 and miR-342 as well as between ID4 and BRCA1 expression. We functionally validated the interaction between ID4 and miR-342 in a reporter Luciferase system. Based on these findings, we hypothesized that regulation of ID4 mediated by miR-342 could be involved in the pathogenesis of breast cancer by downregulating BRCA1 expression. We functionally demonstrated the interactions between miR-342, ID4 and BRCA1 in a model provided by ER-negative MDA-MB-231 breast cancer cell line that presented high levels of ID4. Overexpression of miR-342 in these cells reduced ID4 and increased BRCA1 expression, supporting a possible role of this mechanism in breast cancer. In the ER-positive MCF7 and in the BRCA1-mutant HCC1937 cell lines miR-342 over-expression only reduced ID4. In the cohort of patients we studied, a correlation between miR-342 and BRCA1 expression was found in the ER-negative cases. As ER-negative cases were mainly BRCA1-mutant, we speculate that the mechanism we demonstrated could be involved in the decreased expression of BRCA1 frequently observed in non BRCA1-mutant breast cancers and could be implicated as a causal factor in part of the familial cases grouped in the heterogeneous class of non BRCA1 or BRCA2-mutant cases (BRCAx. To validate this hypothesis, the study should be extended to a larger cohort of ER-negative cases, including those belonging to the BRCAx class.
International Nuclear Information System (INIS)
Schanbacher, B.D.; Ewing, L.L.
1975-01-01
A simultaneous radioimmunoassay procedure for plasma testosterone (T), 5alpha-androstan-17beta-ol-3-one (DHT), 5alpha- androstane-3alpha,17beta-diol (3alphaol), and 5alpha-androstan- 3beta,17beta-diol (3betaol) is described in this report. Peripheral plasma concentrations of T, DHT, 3alphaol, and 3βol were 1.61 +- 0.26, 0.49 +- 0.15, 0.17 +- 0.03, and 0.24 +- 0.04 ng/ml, respectively, in adult male rabbits. In contrast, T, DHT, 3αol, and 3βol peripheral plasma concentrations in dexamethasone-treated castrate rabbits were 0.07 +- 0.001, 0.02 +- 0.01, 0.07 +- 0.01, and 0.05 +- 0.01 ng/ml, respectively. These results represent the first simultaneous measurement of T, DHT, 3αol, and 3βol in peripheral plasma of any male vertebrate. Moreover, we suggest that DHT, 3αol, and 3βol represent the unidentified immunoreactive material found in peripheral plasma of male rabbits by Falvo and Nalbandov. (auth)
Id2 reinforces TH1 cell differentiation and inhibits E2A to repress TFH cell differentiation
Shaw, Laura A.; Bélanger, Simon; Omilusik, Kyla D.; Cho, Sunglim; Scott-Browne, James P.; Nance, J. Philip; Goulding, John; Lasorella, Anna; Lu, Li-Fan; Crotty, Shane; Goldrath, Ananda W.
2016-01-01
Differentiation of T helper (TH) effector subsets is critical for host protection. E protein transcription factors and Id proteins are important arbiters of T cell development, but their role in differentiation of TH1 and TFH cells is not well understood. TH1 cells showed robust Id2 expression compared to TFH cells, and RNAi depletion of Id2 increased TFH cell frequencies. Further, TH1 cell differentiation was blocked by Id2 deficiency, leading to E protein-dependent accumulation of effector cells with mixed characteristics during viral infection and severely impaired generation of TH1 cells following Toxoplasma gondii infection. The TFH-defining transcriptional repressor Bcl6 bound the Id2 locus, providing a mechanism for the bimodal Id2 expression and reciprocal development of TH1 and TFH cell fates. PMID:27213691
17 CFR 256.01-11 - Methods of allocation.
2010-04-01
... applicable and currently effective methods of allocation filed with the Commission. Both direct and allocated... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Methods of allocation. 256.01... HOLDING COMPANY ACT OF 1935 General Instructions § 256.01-11 Methods of allocation. Indirect costs and...
75 FR 54607 - Combined Notice of Filings #1
2010-09-08
..., September 17, 2010. Docket Numbers: ER00-107-005. Applicants: La Paloma Generating Company, LLC. Description: Supplemental Information of La Paloma Generating Company, LLC. Filed Date: 08/27/2010. Accession Number...: ER07-232-004; ER07-374-003; ER05-1316-003. Applicants: Aragonne Wind LLC; Buena Vista Energy, LLC...
78 FR 21353 - Combined Notice of Filings #1
2013-04-10
... Partners, LLC, Delaware City Refining Company, LLC, PBF Power Marketing LLC. Description: Supplement to Lea.... Description: Duquesne submits new OATT Attachment H-17C to be effective 6/1/2013. Filed Date: 4/1/13.... Docket Numbers: ER13-1222-000. Applicants: NV Energy, Inc. Description: OATT Revisions to Attachment N...
Science-Technology-Society (STS): A New Paradigm in Science Education
Mansour, Nasser
2009-01-01
Changes in the past two decades of goals for science education in schools have induced new orientations in science education worldwide. One of the emerging complementary approaches was the science-technology-society (STS) movement. STS has been called the current megatrend in science education. Others have called it a paradigm shift for the field…
17 CFR 229.1115 - (Item 1115) Certain derivatives instruments.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1115) Certain derivatives instruments. 229.1115 Section 229.1115 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF...
Eisenman, Laura T.; Farley-Ripple, Elizabeth; Culnane, Mary; Freedman, Brian
2013-01-01
Social networks of persons with intellectual disabilities (ID) have been characterized as smaller and less diverse than those of typical peers. Advocates have focused on strengthening those social networks by expanding circles of social support, protection, and friendship. As young adults with ID experience increasing levels of community…
2013-01-04
... Services Group, Inc., Commercial/Actuarial/ Information Delivery Services (IDS)/Corporate & Financial... Assistance (TAA) applicable to workers and former workers of Hartford Financial Services Group, Inc., Commercial/ Actuarial/Information Delivery Services (IDS)/Corporate & Financial Reporting group, Hartford...
Kang, Hui-Yuan; Wang, Xin-Rong; Gao, Li; Wang, Wei; Li, Mian-Yang; Wang, Li-Li; Wang, Cheng-Bin; Yu, Li
2015-04-01
To evaluate significance of ID4 gene mehtylation in demethylating myelodysplastic syndrome(MDS) cell Line MUTZ1 and 2 patients with MDS. The methylation-specific PCR (MS-PCR) and reverse transcription-PCR (RT-PCR) were applied to identify the methylation status and gene expression of ID4 gene in MDS cell line MUTZ1, a patient with aplastic anemia(AA) and a donor with normal bone marrow (NBM). RT-PCR was applied to detect the ID4 gene expression status in MUTZ1 cell line treated with decitabine at 3 different concentrations. Then bisulfite sequencing PCR (BSP) was applied to detect ID4 gene methylation status in 2 MDS parients treated with decitabine. The MDS cell line MUTZ-1 displayed a complete methylation of ID4 gene promoter with little mRNA expression. Inversely, bone marrow of an AA patient and NBM showed complete unmethylation of this gene with intensity mRNA expression. With the increase of decitabine concentration, ID4 gene mRNA expression was more and more increased. After decitabine treatment, ID4 gene methylation-positive frequencies of both the 2 MDS patients were much more decreased than that of the first treatment. So, ID4 gene mRNA expression inhibited by promoter hypemethylation could be recovered by using demethylation medicine. ID4 as a new potential anti-oncogene suggests that its methylation may become a marker for selection and assessment of therapeutic schedules in patients with MDS.
The faulty Master Events Controller is carried away from STS-99 Endeavour
2000-01-01
Workers carry away the faulty Enhanced Main Events Controller (E- MEC) from Shuttle Endeavour at Launch Pad 39A. The E-MEC became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. Both E-MECs are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.
Le traitement de l’idéologie dans la sociologie de Luc Boltanski
Directory of Open Access Journals (Sweden)
David Vrydaghs
2006-10-01
Full Text Available IntroductionLe concept d’idéologie apparaît dans la sociologie de Luc Boltanski à partir du Nouvel Esprit du capitalisme, publié en 1999. L’auteur y revient dans La Condition fœtale, paru en 2004. On aurait donc pu se contenter de ces ouvrages pour examiner le traitement réservé à l’idéologie dans la sociologie de Luc Boltanski. On préférera pourtant revenir aux travaux antérieurs du sociologue, et ce pour deux raisons.D’abord parce que le concept d’idéologie tel qu’il est employé dans Le Nou...
Directory of Open Access Journals (Sweden)
I Ketut Ngastawa
2015-12-01
Full Text Available Paper that had the title: "Juridical implications of the Constitutional Court Decision Number 011-017/PUU-I/2003 on the Legal Protection for the Rights to be Eelected." This explores two issues: 1 how the legal protection of the settings selected in the state system of Indonesia ; 2 what are juridical implications of the Constitutional Court Decision Number 011-017/PUU-I/2003 on the legal protection for the rights to be elected. To solve both problems, this paper uses normative legal research methods. Approach being used is the statute approach, case approach, and a conceptual approach. Further legal materials collected were identified and analyzed using descriptive analysis techniques. Legal protection for the right to be elected in the state system of Indonesia can be traced from the 1945 opening, the articles in the body of the 1945 Constitution, Article 27 paragraph (1, Article 28D (1 and paragraph (3 and Article 28 paragraph (3 1945 Second Amendment, MPR Decree Number XVII/MPR/1998, Article 43 of Law Number 39 of 1999, Article 21 of the Universal Declaration of Human Rights, and Article 25 of the International Covenant on Civil and Political Rights. Discussion of the juridical implications of the Constitutional Court Decision Number 011-017/PUU-I/2003 on the legal protection for the rights to be elected have been included: a only on the juridical implications of representative institutions no longer marked with specified requirements as stipulated in Article 60 letter g of Law Number 12 Year 2003 in Law Number 10 Year 2008; b juridical implications of the political field for the right to be elected is the absence of any discriminatory treatment in legislative product formed by the House of Representatives and the President as well as products of other legislation forward.
Suurnimed jäid müümata / Maria-Kristiina Soomre
Soomre, Maria-Kristiina, 1978-
2001-01-01
9. mai Christie' oksjonist, müümata jäänud Picasso, Degas', Cezanne'i tööd. 8. mai Sotheby oksjonist, kus edukalt müüdi töid S. J. Seegeri kogust, 3,85 miljoni dollari eest M. Beckmanni "Perseuse viimane katsumus". Sotheby kaasaegse kunsti oksjonil New Yorgis müüdi 5,6 miljoni dollari eest J. Koonsi skulptuur M. Jacksonist. Müümata jäid A. Warholi "Viis supipurki", A. Calderi 3 skulptuuri
International Nuclear Information System (INIS)
Tang, Zhenjie; Hu, Dan; Zhang, Xiwei; Zhao, Yage; Li, Rong
2016-01-01
The postdeposition annealing (PDA)-treated charge-trap flash memory capacitor with stacked Zr_0_._4_6Si_0_._5_4O_2/Al_2O_3 charge-trapping layer flanked by a SiO_2 tunneling oxide and an Al_2O_3 blocking oxide was fabricated and investigated. It is observed that the memory capacitor exhibits prominent memory characteristics with large memory windows 12.8 V in a ±10 V gate sweeping voltage range, faster program/erase speed, and good data-retention characteristics even at 125 C compared to a single charge-trapping layer (Zr_0_._4_6Si_0_._5_4O_2, Zr_0_._7_9Si_0_._2_1O_2, and Zr_0_._4_6Al_1_._0_8O_2_._5_4). The quantum wells and introduced interfacial traps of the stacked trapping layer regulate the storage and loss behavior of charges, and jointly contribute to the improved memory characteristics. Hence, the memory capacitor with a stacked trapping layer is a promising candidate in future nonvolatile charge-trap memory device design and application. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
DEFF Research Database (Denmark)
Johansen, P; Andersen, J D; Børsting, Claus
2013-01-01
on the peak height and the signal to noise data exported from the TYPER 4.0 software. With the forensic analysis parameters, all inconsistencies were eliminated in reactions with ≥10ng DNA. However, the average call rate decreased to 69.9%. The iPLEX(®) Sample ID Plus Panel was tested on 10 degraded samples......Sequenom launched the first commercial SNP typing kit for human identification, named the iPLEX(®) Sample ID Plus Panel. The kit amplifies 47 of the 52 SNPs in the SNPforID panel, amelogenin and two Y-chromosome SNPs in one multiplex PCR. The SNPs were analyzed by single base extension (SBE......) and Matrix Assisted Laser Desorption/Ionization-Time of Flight Mass Spectrometry (MALDI-TOF MS). In this study, we evaluated the accuracy and sensitivity of the iPLEX(®) Sample ID Plus Panel by comparing the typing results of the iPLEX(®) Sample ID Plus Panel with those obtained with our ISO 17025 accredited...
ACE Gene I/D Polymorphism and Obesity in 1,574 Patients with Type 2 Diabetes Mellitus.
Pan, Yan-Hong; Wang, Min; Huang, Yan-Mei; Wang, Ying-Hui; Chen, Yin-Ling; Geng, Li-Jun; Zhang, Xiao-Xi; Zhao, Hai-Lu
2016-01-01
Association between ACE gene I/D polymorphism and the risk of overweight/obesity remains controversial. We investigated the possible relationship between ACE gene I/D polymorphism and obesity in Chinese type 2 diabetes mellitus (T2DM) patients. In this study, obesity was defined as a body mass index (BMI) value ≥ 25 kg/m 2 and subjects were classified into 4 groups (lean, normal, overweight, and obese). PCR (polymerase chain reaction) was used to detect the ACE gene I/D polymorphism in T2DM patients. Metabolic measurements including blood glucose, lipid profile, and blood pressure were obtained. Frequencies of the ACE genotypes (DD, ID, and II) were not significant among the 4 groups of BMI-defined patients ( P = 0.679) while ACE II carriers showed higher systolic blood pressure (SBP) and pulse pressure (PP) (all P ACE gene I/D polymorphism with obesity is insignificant in Chinese patients with T2DM. SBP and PP might be higher in the ACE II carriers than in the DD and ID carriers.
STS-93 Commander Eileen Collins suits up for launch
1999-01-01
For the third time, in the Operations and Checkout Building, STS- 93 Commander Eileen M. Collins tries on her helmet with her launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
Model-independent measurement of mixing parameters in $D^0 \\to K_S^0 \\pi^+ \\pi^-$ decays
Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Ruscio, Francesco; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fohl, Klaus; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Edmund; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefkova, Slavorima; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zucchelli, Stefano
2016-04-06
The first model-independent measurement of the charm mixing parameters in the decay $D^0 \\to K_S \\pi^+ \\pi^-$ is reported, using a sample of $pp$ collision data recorded by the LHCb experiment, corresponding to an integrated luminosity of 1.0 fb$^{-1}$ at a centre-of-mass energy of 7 TeV. The measured values are \\begin{eqnarray*} x &=& ( -0.86 \\pm 0.53 \\pm 0.17 ) \\times 10^{-2}, \\\\ y &=& ( +0.03 \\pm 0.46 \\pm 0.13 ) \\times 10^{-2}, \\end{eqnarray*} where the first uncertainties are statistical and include small contributions due to the external input for the strong phase measured by the CLEO collaboration, and the second uncertainties are systematic.
The genus curve of the Abell clusters
Rhoads, James E.; Gott, J. Richard, III; Postman, Marc
1994-01-01
We study the topology of large-scale structure through a genus curve measurement of the recent Abell catalog redshift survey of Postman, Huchra, and Geller (1992). The structure is found to be spongelike near median density and to exhibit isolated superclusters and voids at high and low densities, respectively. The genus curve shows a slight shift toward 'meatball' topology, but remains consistent with the hypothesis of Gaussian random phase initial conditions. The amplitude of the genus curve corresponds to a power-law spectrum with index n = 0.21(sub -0.47 sup +0.43) on scales of 48/h Mpc or to a cold dark matter power spectrum with omega h = 0.36(sub -0.17 sup +0.46).
Further results on muon-antineutrino-electron scattering
International Nuclear Information System (INIS)
Hasert, F.J.
1975-01-01
In a further study of the neutral current interactions muon-antineutrino e - →muon-antineutrino e - , the Gargamelle collaboration analyzed 70% of the photographic film from the Freon neutrino (antineutrino) experiment. Three non-ambiguous events were found, that correspond within a 90% confidence to an upper limit for the cross section below 0.17x10 -41 cm 2 /e - . A 0.46 event background was calculated, and the probability for the three events to be background is lower than 1%. Signal loss corrections were effected in terms of the Salam-Ward-Weinberg model, and an upper limit (sin 2 theta(W) 2 theta(W) are concluded to be 0.1 2 thate(W) [fr
International Nuclear Information System (INIS)
Mulmule, Manoj D.; Shimmy, Shankar M.; Bambole, Vaishali; Jamdar, Sahayog N.; Rawat, K.P.; Sarma, K.S.S.
2017-01-01
Idli, a steam-cooked breakfast food item consumed in India, is famous as a staple food for its spongy texture and unique fermented taste. Idli preparation is a time consuming process; although instant Idli pre-mixes as powder or batter are available in the market, they do not have the distinctive taste and aroma similar to the Idli prepared at home. Hence ready-to-eat (RTE) form of this food is in demand. Therefore, an attempt was made to prepare RTE Idli bearing similar taste as home-cooked Idli with an extended shelf-life of up to two months at an ambient temperature using Electron Beam Irradiation (EBI) at dosages 2.5 kGy, 5 kGy and 7.5 kGy and combination processing comprised of EBI dosage at 2.5 kGy and thermal treatment (80 °C for 20 min). The treated Idli's were microbiologically and sensorially evaluated at storage periods of zero day, 14 days, 30 days and 60 days. Idli's irradiated at 7.5 kGy and subjected to combination processing at 2.5 kGy and thermal treatment were shelf-stable for 60 days. 2.5 kGy and 5 kGy radiation dosages alone were not sufficient to preserve Idli samples for more than 14 days. Undesirable change in sensory properties of Idli was observed at an EBI dosage of 7.5 kGy. Sensory properties of combination processed Idli's were found to undergo minor change over the storage period. The present work suggests that lowest radiation dosage in combination with thermal treatment could be useful to achieve the extended shelf-life without considerably impairing the organoleptic quality of Ready-to-Eat Idli. - Highlights: • Idli (traditional Indian fermented food) was prepared in ready-to-eat (RTE) form. • Ready-to-eat Idli was then subjected to combination processing comprised of lowest irradiation dosage of 2.5 kGy with mild heat treatment to extend its shelf life. • Increase in hardness and decrease in brightness of combination processed Idli was observed. • Combination processed Idli was microbiologically safe and
STS-49 Endeavour/Intelsat Briefing
1992-01-01
Lak Virdee of Intelsat, summarizes Intelsat's role in the STS-49 Endeavour mission. He discusses the reboost hardware, giving details on the capture arm and docker adapter assembly. He describes the rendezvous between Intelsat and the Endeavour Orbiter. Mr. Virdee then answers questions from the press.
17 CFR 229.1011 - (Item 1011) Additional information.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1011) Additional information. 229.1011 Section 229.1011 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY AND CONSERVATION ACT OF 1975...
Interfacial scanning tunneling spectroscopy (STS) of chalcogenide/metal hybrid nanostructure
Energy Technology Data Exchange (ETDEWEB)
Saad, Mahmoud M.; Abdallah, Tamer [Physics Department, Faculty of Science, Ain Shams University, Abbassia, Cairo (Egypt); Easawi, Khalid; Negm, Sohair [Department of Physics and Mathematics, Faculty of Engineering (Shoubra), Benha University (Egypt); Talaat, Hassan, E-mail: hassantalaat@hotmail.com [Physics Department, Faculty of Science, Ain Shams University, Abbassia, Cairo (Egypt)
2015-05-15
Graphical abstract: - Highlights: • Comparing band gaps values obtained optically with STS. • Comparing direct imaging with calculated dimensions. • STS determination of the interfacial band bending of metal/chalcogenide. - Abstract: The electronic structure at the interface of chalcogenide/metal hybrid nanostructure (CdSe–Au tipped) had been studied by UHV scanning tunneling spectroscopy (STS) technique at room temperature. This nanostructure was synthesized by a phase transfer chemical method. The optical absorption of this hybrid nanostructure was recorded, and the application of the effective mass approximation (EMA) model gave dimensions that were confirmed by the direct measurements using the scanning tunneling microscopy (STM) as well as the high-resolution transmission electron microscope (HRTEM). The energy band gap obtained by STS agrees with the values obtained from the optical absorption. Moreover, the STS at the interface of CdSe–Au tipped hybrid nanostructure between CdSe of size about 4.1 ± 0.19 nm and Au tip of size about 3.5 ± 0.29 nm shows a band bending about 0.18 ± 0.03 eV in CdSe down in the direction of the interface. Such a result gives a direct observation of the electron accumulation at the interface of CdSe–Au tipped hybrid nanostructure, consistent with its energy band diagram. The presence of the electron accumulation at the interface of chalcogenides with metals has an important implication for hybrid nanoelectronic devices and the newly developed plasmon/chalcogenide photovoltaic solar energy conversion.
Teachers' learning on the workshop of STS approach as a way of enhancing inventive thinking skills
Ngaewkoodrua, Nophakun; Yuenyong, Chokchai
2018-01-01
To improve science teachers to develop the STS lesson plans for enhancing the students' inventive thinking skills, the workshop of improving science teachers to develop the STS lesson plans for enhancing the Inventive thinking skills were organized. The paper aimed to clarify what teachers learn from the workshop. The goal of the activity of the workshop aimed to: 1) improve participants a better understanding of the relationship between the Inquiry based learning with STS approach, 2) understand the meaning and importance of the STS approach and identify the various stages of Yuenyong (2006) STS learning process, 3) discuss what they learned from the examples of Yuenyong (2006) lesson plan, 4) develop some activities for each stage of Yuenyong (2006) STS approach, and 5) ideas of providing STS approach activities for enhancing inventive thinking skills. Participants included 3 science teachers who work in Khon Kaen, Thailand. Methodology regarded interpretive paradigm. Teachers' learning about pedagogy of enhancing the students' inventive thinking skills will be interpreted through participant observation, teachers' tasks, and interview. The finding revealed that all participants could demonstrate their ideas how to generate the STS lesson plans as a way of enhancing inventive thinking skills. Teachers could mention some element of inventive thinking skills which could be generated on their STS learning activities.
2011-07-07
...-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule... Exchange Act of 1934, as amended (the ``Act''). Upon effectiveness of a plan filed pursuant to Rule 17d-2...(a) through 9.25, which concern advertising and sales literature, would be deleted and the text of...
75 FR 72820 - Combined Notice Of Filings No. 1
2010-11-26
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Combined Notice Of Filings No. 1 November 17, 2010. Take notice that the Commission has received the following Natural Gas Pipeline Rate and.... Eastern Time on Monday, November 29, 2010. Docket Numbers: RP11-1532-000. Applicants: Venice Gathering...
Dhingra, Annil; Ruhal, Nidhi; Miglani, Anjali
2015-04-01
Successful endodontic therapy depends on many factor, one of the most important step in any root canal treatment is root canal preparation. In addition, respecting the original shape of the canal is of the same importance; otherwise, canal aberrations such as transportation will be created. The purpose of this study is to compare and evaluate Reciprocating WaveOne ,Reciproc and Rotary Oneshape Single File Instrumentation System On Cervical Dentin Thickness, Cross Sectional Area and Canal Transportation on First Mandibular Molar Using Cone Beam Computed Tomography. Sixty Mandibular First Molars extracted due to periodontal reason was collected from the Department of Oral and Maxillofacial. Teeth were prepared using one rotary and two reciprocating single file system. Teeth were divided into 3 groups 20 teeth in each group. Pre instrumentation and Post instrumentation scans was done and evaluated for three parameters Canal Transportation, Cervical Dentinal Thickness, Cross-sectional Area. Results were analysed statistically using ANOVA, Post-Hoc Tukey analysis. The change in cross-sectional area after filing showed significant difference at 0mm, 1mm, 2mm and 7mm (pfile system over a distance of 7 mm (starting from 0mm and then evaluation at 1mm, 2mm, 3mm, 5mm and 7mm), the results showed a significant difference among the file systems at various lengths (p= 0.014, 0.046, 0.004, 0.028, 0.005 & 0.029 respectively). Mean value of cervical dentinal removal is maximum at all the levels for oneshape and minimum for waveone showing the better quality of waveone and reciproc over oneshape file system. Significant difference was found at 9mm, 11mm and 12mm between all the three file systems (p<0.001,< 0.001, <0.001). It was concluded that reciprocating motion is better than rotary motion in all the three parameters Canal Transportation, Cross-sectional Area, Cervical Dentinal Thickness.
Zhong, Hong-xia; Shi, Jun-jie; Zhang, Min; Jiang, Xin-he; Huang, Pu; Ding, Yi-min
2015-01-01
We calculate Mg-acceptor activation energy EA and investigate the influence of O-atom, occupied the Mg nearest-neighbor, on EA in nanoscale (AlN)5/(GaN)1 superlattice (SL), a substitution for Al0.83Ga0.17N disorder alloy, using first-principles calculations. We find that the N-atom bonded with Ga-atom is more easily substituted by O-atom and nMgGa-ON (n = 1-3) complexes are favorable and stable in the SL. The O-atom plays a dominant role in reducing EA. The shorter the Mg-O bond is, the smaller the EA is. The Mg-acceptor activation energy can be reduced significantly by nMgGa-ON δ-codoping. Our calculated EA for 2MgGa-ON is 0.21 eV, and can be further reduced to 0.13 eV for 3MgGa-ON, which results in a high hole concentration in the order of 1020 cm-3 at room temperature in (AlN)5/(GaN)1 SL. Our results prove that nMgGa-ON (n = 2,3) δ-codoping in AlN/GaN SL with ultrathin GaN-layer is an effective way to improve p-type doping efficiency in Al-rich AlGaN.
Directory of Open Access Journals (Sweden)
Hong-xia Zhong
2015-01-01
Full Text Available We calculate Mg-acceptor activation energy EA and investigate the influence of O-atom, occupied the Mg nearest-neighbor, on EA in nanoscale (AlN5/(GaN1 superlattice (SL, a substitution for Al0.83Ga0.17N disorder alloy, using first-principles calculations. We find that the N-atom bonded with Ga-atom is more easily substituted by O-atom and nMgGa-ON (n = 1-3 complexes are favorable and stable in the SL. The O-atom plays a dominant role in reducing EA. The shorter the Mg-O bond is, the smaller the EA is. The Mg-acceptor activation energy can be reduced significantly by nMgGa-ON δ-codoping. Our calculated EA for 2MgGa-ON is 0.21 eV, and can be further reduced to 0.13 eV for 3MgGa-ON, which results in a high hole concentration in the order of 1020 cm−3 at room temperature in (AlN5/(GaN1 SL. Our results prove that nMgGa-ON (n = 2,3 δ-codoping in AlN/GaN SL with ultrathin GaN-layer is an effective way to improve p-type doping efficiency in Al-rich AlGaN.
Directory of Open Access Journals (Sweden)
Retha Arjadi
Full Text Available Depression screening and examination in Indonesia are highly challenging due to the disproportionately low number of mental health professionals in comparison to the Indonesian population. Self-report questionnaires on depression are cost-effective and time-efficient. The current study investigates the psychometric properties of the Indonesian Inventory of Depressive Symptomatology Self Report (IDS-SR.The participants were 904 Indonesians (aged 16-61; 50.2% female, recruited via an online survey using Qualtrics. Confirmatory factor analysis of the one-factor, three-factor, and four-factor model were explored. Convergent and divergent validity of the total score of the Indonesian IDS-SR and each factor were examined, as well as the Cronbach's Alpha reliability. In addition, an optimal cut-off score for the Indonesian IDS-SR was established using ROC curve analysis.The three-factor model of "cognitive/mood", "anxiety/arousal", and "sleep disturbance" was the best fit with the Indonesian IDS-SR data. Convergent and divergent validity were good. Cronbach's Alpha reliability was excellent for the total score, good for the factors "cognitive/mood" and "anxiety/arousal", but insufficient for the factor "sleep disturbance". The optimal cut-off score of the Indonesian IDS-SR was 14, with 87% sensitivity and 86% specificity.As a multifactorial instrument to measure depression that has good validity and reliability, the Indonesian IDS-SR can be used to assess depressive symptoms for the purpose of research and clinical practice. The optimal cut-off score of the Indonesian IDS-SR is in accordance with the internationally used cut-off score.
Accessing files in an Internet: The Jade file system
Peterson, Larry L.; Rao, Herman C.
1991-01-01
Jade is a new distribution file system that provides a uniform way to name and access files in an internet environment. It makes two important contributions. First, Jade is a logical system that integrates a heterogeneous collection of existing file systems, where heterogeneous means that the underlying file systems support different file access protocols. Jade is designed under the restriction that the underlying file system may not be modified. Second, rather than providing a global name space, Jade permits each user to define a private name space. These private name spaces support two novel features: they allow multiple file systems to be mounted under one directory, and they allow one logical name space to mount other logical name spaces. A prototype of the Jade File System was implemented on Sun Workstations running Unix. It consists of interfaces to the Unix file system, the Sun Network File System, the Andrew File System, and FTP. This paper motivates Jade's design, highlights several aspects of its implementation, and illustrates applications that can take advantage of its features.
Accessing files in an internet - The Jade file system
Rao, Herman C.; Peterson, Larry L.
1993-01-01
Jade is a new distribution file system that provides a uniform way to name and access files in an internet environment. It makes two important contributions. First, Jade is a logical system that integrates a heterogeneous collection of existing file systems, where heterogeneous means that the underlying file systems support different file access protocols. Jade is designed under the restriction that the underlying file system may not be modified. Second, rather than providing a global name space, Jade permits each user to define a private name space. These private name spaces support two novel features: they allow multiple file systems to be mounted under one directory, and they allow one logical name space to mount other logical name spaces. A prototype of the Jade File System was implemented on Sun Workstations running Unix. It consists of interfaces to the Unix file system, the Sun Network File System, the Andrew File System, and FTP. This paper motivates Jade's design, highlights several aspects of its implementation, and illustrates applications that can take advantage of its features.
International Nuclear Information System (INIS)
Meng, Qingzhen; Jia, Zhuqing; Wang, Weiping; Li, Binhong; Ma, Kangtao; Zhou, Chunyan
2011-01-01
Highlights: → Id1 was upregulated during the cardiac differentiation process of P19CL6 cells. → Id1 upregulated expression of cardiac specific genes Gata4, α-MHC and ISL1. → Id1 promoted proliferation of P19CL6 cells. → Overexpression of Id1 increased activity of TOP flash. → Wnt3a or LiCl treatment promoted Id1 expression in P19CL6 cells. -- Abstract: The inhibitor of DNA binding (Id) family of genes encodes negative regulators of basic helix-loop-helix transcription factors and has been implicated in such diverse cellular processes as differentiation, proliferation, apoptosis and migration. Id knockout mouse embryos display multiple cardiac defects but the specific role of Id1 in cardiac differentiation is unclear. In the present study, we investigated the function of Id1 in DMSO-induced P19CL6 cells, a widely-accepted cell model of cardiac differentiation. We found that Id1 was upregulated during the cardiac differentiation of P19CL6 cells. The expression of cardiac specific marker genes, Gata4, α-MHC and ISL1, was upregulated in P19CL6 cells stably transfected with Id1 (P19CL6-Id1) during cardiac differentiation. The overexpression of Id1 reduced the number of cells in G1 phase and increased the cell population in G2, M and S phases, while knockdown of Id1 increased the number of cells in G1 phase from 48.6 ± 2.51% to 62.2 ± 1.52% at day 0 of cardiac induction, and from 52.5 ± 3.41% to 63.7 ± 1.02% at day 3 after cardiac induction, indicating that Id1 promoted proliferation of P19CL6 cells. Luciferase assays showed that the activity of TOP flash was higher in P19CL6-Id1 cells than wildtype P19CL6 cells, while Id1 expression was also upregulated in P19CL6 cells treated with Wnt3a or LiCl. This indicates that there may be positive feedback between Id1 and Wnt signaling which plays an important role in cardiac differentiation.
Development ceramic composites based on Al2O3, SiO2 and IG-017 additive
Kurovics, E.; Shmakova, A.; Kanev, B.; Gömze, L. A.
2017-02-01
Based on high purity alumina and quartz powders and IG-017 bio-original additives the authors have developed new ceramic composite materials for different industrial purposes. The main goal was to fine a material and morphological structures of high performance ceramic composites as frames for development complex materials for extreme consumptions in the future. For this the mixed powders of Al2O3 , SiO2 and IG-017 bio-original additive were uniaxially pressed at different compaction pressures into disc shapes and were sintered in electric kiln under air (1) and nitrogrn (2) atmosphere. The grain size distributions of the raw materials were determined by laser granulometry. There thermo-physical properties were also determined by derivatography. The prepared and sintered specimens were tested on geometrical sizes, microstructure and morphology by scanning electron microscopy, porosity and water absorption. In this work the authors present the results of their research and investigation.
Directory of Open Access Journals (Sweden)
Hussein A. Kazem
2013-01-01
Full Text Available This paper presents a method for determining optimal sizes of PV array, wind turbine, diesel generator, and storage battery installed in a building integrated system. The objective of the proposed optimization is to design the system that can supply a building load demand at minimum cost and maximum availability. The mathematical models for the system components as well as meteorological variables such as solar energy, temperature, and wind speed are employed for this purpose. Moreover, the results showed that the optimum sizing ratios (the daily energy generated by the source to the daily energy demand for the PV array, wind turbine, diesel generator, and battery for a system located in Sohar, Oman, are 0.737, 0.46, 0.22, and 0.17, respectively. A case study represented by a system consisting of 30 kWp PV array (36%, 18 kWp wind farm (55%, and 5 kVA diesel generator (9% is presented. This system is supposed to power a 200 kWh/day load demand. It is found that the generated energy share of the PV array, wind farm, and diesel generator is 36%, 55%, and 9%, respectively, while the cost of energy is 0.17 USD/kWh.
Directory of Open Access Journals (Sweden)
Joseph Dumit
2017-09-01
Full Text Available Game design offers a powerful pedagogical paradigm for engaging students in thinking and researching sociotechnical systems. Using the example of designing a game around fracking, this paper describes how game design grapples with emergent dynamic processes, and how students are drawn into becoming STS researchers.
Motta, Mario
2017-06-01
WD1145 is a 17th magnitude white dwarf star 570 light years away in Virgo, that was discovered to have a disintegrating planetoid in close orbit by Andrew Vanderburg a graduate student at Harvard CFA, while data mining the Kepler 2 mission. He contacted me to obtain transit data to elucidate the nature of its rather bizarre transit light curves. I obtained multiple observations of WD1145 over the course of a year, and found a series of complex transit light curves that could only be interpreted as a ring complex or torus in close orbit around WD1145. Combined with data from other amateur astronomers, professional observations, and satellite data it became clear that WD1145 has a small planetoid in close orbit at the Roche limit and is breaking apart forming a ring of debris material that is then raining down on the white dwarf. The surface of the star is "polluted" by heavy metals by spectroscopic data. Given that in the intense gravitational field of a white dwarf any heavy metals could not for long last on the surface, this confirms that we are tracking in real time the destruction of a small planet by its host star.
Jiang, Yuanzhi; Zhang, Lijuan; Zhang, Hang; Zhang, Cui; Liu, Shuangxi
2016-11-01
The authors regret that the chemical formula of "Ni0.54Co0.46O2" is incorrect throughout the article and should be changed to "Ni0.54Co0.46O" in all cases. Moreover, there was a clerical mistake in Equation (2) which should be corrected as "E = ∫ I × V(t) dt / 3.6 ". These clerical mistakes do NOT have any effect on the discussion or conclusion of the article.
STS-110 Extravehicular Activity (EVA)
2002-01-01
STS-110 mission specialist Lee M.E. Morin carries an affixed 35 mm camera to record work which is being performed on the International Space Station (ISS). Working with astronaut Jerry L. Ross (out of frame), the duo completed the structural attachment of the S0 (s-zero) truss, mating two large tripod legs of the 13 1/2 ton structure to the station's main laboratory during a 7-hour, 30-minute space walk. The STS-110 mission prepared the Station for future space walks by installing and outfitting the 43-foot-long S0 truss and preparing the Mobile Transporter. The S0 Truss was the first of 9 segments that will make up the Station's external framework that will eventually stretch 356 feet (109 meters), or approximately the length of a football field. This central truss segment also includes a flatcar called the Mobile Transporter and rails that will become the first 'space railroad,' which will allow the Station's robotic arm to travel up and down the finished truss for future assembly and maintenance. The completed truss structure will hold solar arrays and radiators to provide power and cooling for additional international research laboratories from Japan and Europe that will be attached to the Station. Milestones of the S-110 mission included the first time the ISS robotic arm was used to maneuver space walkers around the Station and marked the first time all space walks were based out of the Station's Quest Airlock. It was also the first Shuttle to use three Block II Main Engines. The Space Shuttle Orbiter Atlantis, STS-110 mission, was launched April 8, 2002 and returned to Earth April 19, 2002.
STS-93 Commander Collins suits up before launch
1999-01-01
In the Operations and Checkout Building, STS-93 Commander Eileen M. Collins gets help donning her launch and entry suit. After Space Shuttle Columbia's July 20 launch attempt was scrubbed at the T-7 second mark in the countdown, the launch was rescheduled for Thursday, July 22, at 12:28 a.m. EDT. The target landing date is July 26, 1999, at 11:24 p.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X- ray telescope and is expected unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
Astronaut Heidemarie M. Stefanyshyn-Piper During STS-115 Training
2005-01-01
Wearing a training version of the shuttle launch and entry suit, STS-115 astronaut and mission specialist, Heidemarie M. Stefanyshyn-Piper, puts the final touches on her suit donning process prior to the start of a water survival training session in the Neutral Buoyancy Laboratory (NBL) near Johnson Space Center. Launched on September 9, 2006, the STS-115 mission continued assembly of the International Space Station (ISS) with the installation of the truss segments P3 and P4.
17 CFR 240.15d-2 - Special financial report.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Special financial report. 240....15d-2 Special financial report. (a) If the registration statement under the Securities Act of 1933 did... registration statement, file a special report furnishing certified financial statements for such last full...
STS-93 Mission Specialist Hawley suits up for launch
1999-01-01
For the third time, during final launch preparations in the Operations and Checkout Building, STS-93 Mission Specialist Steven A. Hawley (Ph.D.) waves after donning his launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Hawley, Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
EuroSCORE II and STS as mortality predictors in patients undergoing TAVI
Directory of Open Access Journals (Sweden)
Vitor Emer Egypto Rosa
2016-02-01
Full Text Available SUMMARY Introduction: the EuroSCORE II and STS are the most used scores for surgical risk stratification and indication of transcatheter aortic valve implantation (TAVI. However, its role as a tool for mortality prediction in patients undergoing TAVI is still unclear. Objective: to evaluate the performance of the EuroSCORE II and STS as predictors of in-hospital and 30-day mortality in patients undergoing TAVI. Methods: we included 59 symptomatic patients with severe aortic stenosis that underwent TAVI between 2010 and 2014. The variables were analyzed using Student's t-test and Fisher's exact test and the discriminative power was evaluated using receiver operating characteristic curve (ROC and area under the curve (AUC with a 95% confidence interval. Results: mean age was 81±7.3 years, 42.3% men. The mean EuroSCORE II was 7.6±7.3 % and STS was 20.7±10.3%. Transfemoral procedure was performed in 88.13%, transapical in 3.38% and transaortic in 8.47%. In-hospital mortality was 10.1% and 30-day mortality was 13.5%. Patients who died had EuroSCORE II and STS higher than the survivors (33.7±16.7vs. 18.6±7.3% p=0,0001 for STS and 13.9±16.1 vs. 4.8±3.8% p=0.0007 for EuroSCORE II. The STS showed an AUC of 0.81 and the EuroSCORE II of 0.77 and there were no differences in the discrimination ability using ROC curves (p=0.72. Conclusion: in this cohort, the STS and EuroSCORE II were predictors of in-hospital and 30-days mortality in patients with severe aortic stenosis undergoing TAVI.
Relationship between major depressive disorder and ACE gene I/D polymorphism in a Turkish population
Directory of Open Access Journals (Sweden)
Sema Inanir
2016-04-01
Full Text Available Abstract Background Major depressive disorder (MDD is a complex disease and a significant health problem that is prevalent across the world. Angiotensin-converting enzyme (ACE has an important role in renin-angiotensin system (RAS and converts inactive angiotensin I to a potent vasopressor and aldosterone-stimulating peptide angiotensin II. Levels of ACE in plasma vary according to the insertion/deletion (I/D polymorphism of ACE gene. Objective The aim of the current study was to examine the influence ACE gene I/D variations on the risk of MDD. Methods In the present case-control study, we analyzed ACE I/D polymorphism in 346 MDD patients and 210 healthy subjects using polymerase chain reaction technique. Results Comparing the two groups, no significant difference was observed with regard to either genotype distributions or allele frequencies of the I/D polymorphism of ACE gene. Discussion Our findings suggest that the ACE I/D polymorphism is not associated with MDD in Turkish case-control study. Further studies are still needed.
Online data handling and storage at the CMS experiment
Andre, J.-M.; Andronidis, A.; Behrens, U.; Branson, J.; Chaze, O.; Cittolin, S.; Darlea, G.-L.; Deldicque, C.; Demiragli, Z.; Dobson, M.; Dupont, A.; Erhan, S.; Gigi, D.; Glege, F.; Gómez-Ceballos, G.; Hegeman, J.; Holzner, A.; Jimenez-Estupiñán, R.; Masetti, L.; Meijers, F.; Meschi, E.; Mommsen, RK; Morovic, S.; Nuñez-Barranco-Fernández, C.; O'Dell, V.; Orsini, L.; Paus, C.; Petrucci, A.; Pieri, M.; Racz, A.; Roberts, P.; Sakulin, H.; Schwick, C.; Stieger, B.; Sumorok, K.; Veverka, J.; Zaza, S.; Zejdl, P.
2015-12-01
During the LHC Long Shutdown 1, the CMS Data Acquisition (DAQ) system underwent a partial redesign to replace obsolete network equipment, use more homogeneous switching technologies, and support new detector back-end electronics. The software and hardware infrastructure to provide input, execute the High Level Trigger (HLT) algorithms and deal with output data transport and storage has also been redesigned to be completely file- based. All the metadata needed for bookkeeping are stored in files as well, in the form of small documents using the JSON encoding. The Storage and Transfer System (STS) is responsible for aggregating these files produced by the HLT, storing them temporarily and transferring them to the T0 facility at CERN for subsequent offline processing. The STS merger service aggregates the output files from the HLT from ∼62 sources produced with an aggregate rate of ∼2GB/s. An estimated bandwidth of 7GB/s in concurrent read/write mode is needed. Furthermore, the STS has to be able to store several days of continuous running, so an estimated of 250TB of total usable disk space is required. In this article we present the various technological and implementation choices of the three components of the STS: the distributed file system, the merger service and the transfer system.
Online Data Handling and Storage at the CMS Experiment
Energy Technology Data Exchange (ETDEWEB)
Andre, J. M.; et al.
2015-12-23
During the LHC Long Shutdown 1, the CMS Data Acquisition (DAQ) system underwent a partial redesign to replace obsolete network equipment, use more homogeneous switching technologies, and support new detector back-end electronics. The software and hardware infrastructure to provide input, execute the High Level Trigger (HLT) algorithms and deal with output data transport and storage has also been redesigned to be completely file- based. All the metadata needed for bookkeeping are stored in files as well, in the form of small documents using the JSON encoding. The Storage and Transfer System (STS) is responsible for aggregating these files produced by the HLT, storing them temporarily and transferring them to the T0 facility at CERN for subsequent offline processing. The STS merger service aggregates the output files from the HLT from ~62 sources produced with an aggregate rate of ~2GB/s. An estimated bandwidth of 7GB/s in concurrent read/write mode is needed. Furthermore, the STS has to be able to store several days of continuous running, so an estimated of 250TB of total usable disk space is required. In this article we present the various technological and implementation choices of the three components of the STS: the distributed file system, the merger service and the transfer system.
Enhancing privacy of users in eID schemes
Shrishak, Kris; Erkin, Z.; Schaar, Remco
2016-01-01
In todays world transactions are increasingly being performed over the internetbut require identication of users as in face-to-face transactions. In order to facilitate eGovernance as well as other eCommerce services Electronic Identiation(eID) schemes, which intend to provide unique and reliable
STS-133/ET-137 Tanking Test Photogrammetry Assessment
Oliver, Stanley T.
2012-01-01
Following the launch scrub of Space Shuttle mission STS-133 on November 5, 2010, an anomalous condition of cracked and raised thermal protection system (TPS) foam was observed on the External Tank (ET). Subsequent dissection of the affected TPS region revealed cracks in the feet of two Intertank (IT) metallic stringers. An extensive investigation into the cause(s) and corrective action(s) for the cracked stringers was initiated, involving a wide array of material and structural tests and nondestructive evaluations, with the intent to culminate into the development of flight rational. One such structural test was the instrumented tanking test performed on December 17, 2010. The tanking test incorporated two three-dimensional optical displacement measurement systems to measure full-field outer surface displacements of the TPS surrounding the affected region that contained the stringer cracks. The results showed that the radial displacement and rotation of the liquid oxygen (LO2) tank flange changed significantly as the fluid level of the LO2 approached and passed the LO2 tank flange.
STS-101 Crew Interview / Scott Horowitz
2000-01-01
Live footage of a preflight interview with Pilot Scott J. Horowitz is seen. The interview addresses many different questions including why Horowitz became an astronaut, the events that led to his interest, any role models that he had, and his inspiration. Other interesting information that this one-on-one interview discusses is the reaction and reasons for the splitting-up of the objectives for STS-101 with STS-106. Horowitz also mentions the scheduled space-walk, docking with the International Space Station (ISS), the new glass cockpit of Atlantis, the repairs of equipment and change of the batteries. Horowitz also discusses his responsibilities during the space-walk, and docking of the spacecraft. He stresses that he will have an added challenge during the space-walk, his inability to see where he needs to place the Extravehicular Activities (EVA) crew.
Mulmule, Manoj D.; Shimmy, Shankar M.; Bambole, Vaishali; Jamdar, Sahayog N.; Rawat, K. P.; Sarma, K. S. S.
2017-02-01
Idli, a steam-cooked breakfast food item consumed in India, is famous as a staple food for its spongy texture and unique fermented taste. Idli preparation is a time consuming process; although instant Idli pre-mixes as powder or batter are available in the market, they do not have the distinctive taste and aroma similar to the Idli prepared at home. Hence ready-to-eat (RTE) form of this food is in demand. Therefore, an attempt was made to prepare RTE Idli bearing similar taste as home-cooked Idli with an extended shelf-life of up to two months at an ambient temperature using Electron Beam Irradiation (EBI) at dosages 2.5 kGy, 5 kGy and 7.5 kGy and combination processing comprised of EBI dosage at 2.5 kGy and thermal treatment (80 °C for 20 min). The treated Idli's were microbiologically and sensorially evaluated at storage periods of zero day, 14 days, 30 days and 60 days. Idli's irradiated at 7.5 kGy and subjected to combination processing at 2.5 kGy and thermal treatment were shelf-stable for 60 days. 2.5 kGy and 5 kGy radiation dosages alone were not sufficient to preserve Idli samples for more than 14 days. Undesirable change in sensory properties of Idli was observed at an EBI dosage of 7.5 kGy. Sensory properties of combination processed Idli's were found to undergo minor change over the storage period. The present work suggests that lowest radiation dosage in combination with thermal treatment could be useful to achieve the extended shelf-life without considerably impairing the organoleptic quality of Ready-to-Eat Idli.
Ko, Jupil; Rosen, Adam B; Brown, Cathleen N
2017-09-12
To cross-culturally adapt the Identification Functional Ankle Instability for use with Korean-speaking participants. The English version of the IdFAI was cross-culturally adapted into Korean based on the guidelines. The psychometric properties in the Korean version of the IdFAI were measured for test-retest reliability, internal consistency, criterion-related validity, discriminative validity, and measurement error 181 native Korean-speakers. Intra-class correlation coefficients (ICC 2,1 ) between the English and Korean versions of the IdFAI for test-retest reliability was 0.98 (standard error of measurement = 1.41). The Cronbach's alpha coefficient was 0.89 for the Korean versions of IdFAI. The Korean versions of the IdFAI had a strong correlation with the SF-36 (r s = -0.69, p 10 was the optimal cutoff score to distinguish between the group memberships. The minimally detectable change of the Korean versions of the IdFAI score was 3.91. The Korean versions of the IdFAI have shown to be an excellent, reliable, and valid instrument. The Korean versions of the IdFAI can be utilized to assess the presence of Chronic Ankle Instability by researchers and clinicians working among Korean-speaking populations. Implications for rehabilitation The high recurrence rate of sprains may result into Chronic Ankle Instability (CAI). The Identification of Functional Ankle Instability Tool (IdFAI) has been validated and recommended to identify patients with Chronic Ankle Instability (CAI). The Korean version of the Identification of Functional Ankle Instability Tool (IdFAI) may be also recommend to researchers and clinicians for assessing the presence of Chronic Ankle Instability (CAI) in Korean-speaking population.
Screening of Lactobacillus plantarum isolated from fermented idli ...
African Journals Online (AJOL)
Probiotics are defined as live microorganisms which when administered in adequate amounts confer a health benefit on the host. The objective of this study was to screen eight potential probiotic Lactobacillus plantarum strains from fermented idli batter using in vitro assays such as bile tolerance, acid tolerance, transit ...
Next Generation Qualification: Kinemetrics STS-5A Seismometer Evaluation
Energy Technology Data Exchange (ETDEWEB)
Merchant, Bion John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Slad, George William [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-10-01
Sandia National Laboratories has tested and evaluated two seismometers, the STS-5A, manufactured by Kinemetrics. These seismometers measure three axes of broadband ground velocity using a UVW configuration with feedback control in a mechanically levelled borehole package. The purpose of the seismometer evaluation was to determine a measured sensitivity, response, self-noise, dynamic range, and self-calibration ability. The Kinemetrics STS-5A seismometers are being evaluated for the U.S. Air Force as part of their Next Generation Qualification effort.
Preti, Antonio; Sheehan, David V; Coric, Vladimir; Distinto, Marco; Pitanti, Mirko; Vacca, Irene; Siddi, Alessandra; Masala, Carmelo; Petretto, Donatella Rita
2013-10-01
The Sheehan Suicidality Tracking Scale (S-STS) is a patient self-report or clinician-administered rating scale that tracks spontaneous and treatment-emergent suicidal ideation and behaviors. This study set out to evaluate the reliability, convergent and divergent validity of the S-STS in a sample of college students, a population with a high risk of completed and attempted suicide. Cross-sectional, survey design. Participants (303 undergraduate students; males: 42%) completed several measures assessing psychological distress (General Health Questionnaire; GHQ); self-esteem (Rosenberg Self Esteem Scale; RSES); social support (Modified Social Support Survey; MOSSS); and suicidal behavior, including ideation and attempts (S-STS). Both internal consistency and test-retest stability were excellent for the S-STS-global score. The S-STS subscale on suicide ideation also showed good reliability, while the subscale on suicidal behavior showed some inconsistency at retest. Convergent and divergent validity of S-STS was confirmed. All S-STS items loaded on a single factor, which had an excellent fit for the unidimensional model, thus justifying the use of the S-STS as a screening tool. In a mediation model, self-esteem and social support explained 45% of the effects of psychological distress on suicide ideation and behavior as measured by the S-STS-global score. This study provided promising evidence on the convergent, divergent, internal consistency and test-retest stability of the Sheehan Suicidality Tracking Scale. The cross-sectional design and lack of measures of hopelessness and helplessness prevent any conclusion about the links of suicidal behavior with self-esteem and social support. Copyright © 2013 Elsevier Inc. All rights reserved.
Knoto-ID: a tool to study the entanglement of open protein chains using the concept of knotoids.
Dorier, Julien; Goundaroulis, Dimos; Benedetti, Fabrizio; Stasiak, Andrzej
2018-05-02
The backbone of most proteins forms an open curve. To study their entanglement, a common strategy consists in searching for the presence of knots in their backbones using topological invariants. However, this approach requires to close the curve into a loop, which alters the geometry of curve. Knoto-ID allows evaluating the entanglement of open curves without the need to close them, using the recent concept of knotoids which is a generalization of the classical knot theory to open curves. Knoto-ID can analyse the global topology of the full chain as well as the local topology by exhaustively studying all subchains or only determining the knotted core. Knoto-ID permits to localize topologically non-trivial protein folds that are not detected by informatics tools detecting knotted protein folds. Knoto-ID is written in C ++ and includes R (www.R-project.org) scripts to generate plots of projections maps, fingerprint matrices and disk matrices. Knoto-ID is distributed under the GNU General Public License (GPL), version 2 or any later version and is available at https://github.com/sib-swiss/Knoto-ID. A binary distribution for Mac OS X, Linux and Windows with detailed user guide and examples can be obtained from https://www.vital-it.ch/software/Knoto-ID. julien.dorier@sib.swiss.
12 CFR 725.17 - Applications for extensions of credit.
2010-01-01
... NATIONAL CREDIT UNION ADMINISTRATION CENTRAL LIQUIDITY FACILITY § 725.17 Applications for extensions of credit. (a) A Regular member may apply for a Facility advance to meet its liquidity needs by filing an... Agent by its member natural person credit unions for pending loans to meet liquidity needs; or (ii...
2010-04-01
... the Securities and Exchange Commission (17 CFR 240.17a-11(c)), must file written notice to that effect... futures commission merchant or as a leverage transaction merchant must be liquidated immediately... leverage transaction merchant shall be only for the purposes of liquidation, because that clearing member...
A non-parametric peak calling algorithm for DamID-Seq.
Directory of Open Access Journals (Sweden)
Renhua Li
Full Text Available Protein-DNA interactions play a significant role in gene regulation and expression. In order to identify transcription factor binding sites (TFBS of double sex (DSX-an important transcription factor in sex determination, we applied the DNA adenine methylation identification (DamID technology to the fat body tissue of Drosophila, followed by deep sequencing (DamID-Seq. One feature of DamID-Seq data is that induced adenine methylation signals are not assured to be symmetrically distributed at TFBS, which renders the existing peak calling algorithms for ChIP-Seq, including SPP and MACS, inappropriate for DamID-Seq data. This challenged us to develop a new algorithm for peak calling. A challenge in peaking calling based on sequence data is estimating the averaged behavior of background signals. We applied a bootstrap resampling method to short sequence reads in the control (Dam only. After data quality check and mapping reads to a reference genome, the peaking calling procedure compromises the following steps: 1 reads resampling; 2 reads scaling (normalization and computing signal-to-noise fold changes; 3 filtering; 4 Calling peaks based on a statistically significant threshold. This is a non-parametric method for peak calling (NPPC. We also used irreproducible discovery rate (IDR analysis, as well as ChIP-Seq data to compare the peaks called by the NPPC. We identified approximately 6,000 peaks for DSX, which point to 1,225 genes related to the fat body tissue difference between female and male Drosophila. Statistical evidence from IDR analysis indicated that these peaks are reproducible across biological replicates. In addition, these peaks are comparable to those identified by use of ChIP-Seq on S2 cells, in terms of peak number, location, and peaks width.
A non-parametric peak calling algorithm for DamID-Seq.
Li, Renhua; Hempel, Leonie U; Jiang, Tingbo
2015-01-01
Protein-DNA interactions play a significant role in gene regulation and expression. In order to identify transcription factor binding sites (TFBS) of double sex (DSX)-an important transcription factor in sex determination, we applied the DNA adenine methylation identification (DamID) technology to the fat body tissue of Drosophila, followed by deep sequencing (DamID-Seq). One feature of DamID-Seq data is that induced adenine methylation signals are not assured to be symmetrically distributed at TFBS, which renders the existing peak calling algorithms for ChIP-Seq, including SPP and MACS, inappropriate for DamID-Seq data. This challenged us to develop a new algorithm for peak calling. A challenge in peaking calling based on sequence data is estimating the averaged behavior of background signals. We applied a bootstrap resampling method to short sequence reads in the control (Dam only). After data quality check and mapping reads to a reference genome, the peaking calling procedure compromises the following steps: 1) reads resampling; 2) reads scaling (normalization) and computing signal-to-noise fold changes; 3) filtering; 4) Calling peaks based on a statistically significant threshold. This is a non-parametric method for peak calling (NPPC). We also used irreproducible discovery rate (IDR) analysis, as well as ChIP-Seq data to compare the peaks called by the NPPC. We identified approximately 6,000 peaks for DSX, which point to 1,225 genes related to the fat body tissue difference between female and male Drosophila. Statistical evidence from IDR analysis indicated that these peaks are reproducible across biological replicates. In addition, these peaks are comparable to those identified by use of ChIP-Seq on S2 cells, in terms of peak number, location, and peaks width.
Liu, Kun; Liu, Yong; Yan, Jianchao; Sun, Zhenyuan
2018-03-25
Partial body weight support or loading sit-to-stand (STS) rehabilitation can be useful for persons with lower limb dysfunction to achieve movement again based on the internal residual muscle force and external assistance. To explicate how the muscles contribute to the kinetics and kinematics of STS performance by non-invasive in vitro detection and to nondestructively estimate the muscle contributions to STS training with different loadings, a wearable sensor system was developed with ground reaction force (GRF) platforms, motion capture inertial sensors and electromyography (EMG) sensors. To estimate the internal moments of hip, knee and ankle joints and quantify the contributions of individual muscle and gravity to STS movement, the inverse dynamics analysis on a simplified STS biomechanical model with external loading is proposed. The functional roles of the lower limb individual muscles (rectus femoris (RF), gluteus maximus (GM), vastus lateralis (VL), tibialis anterior (TA) and gastrocnemius (GAST)) during STS motion and the mechanism of the muscles' synergies to perform STS-specific subtasks were analyzed. The muscle contributions to the biomechanical STS subtasks of vertical propulsion, anteroposterior (AP) braking and propulsion for body balance in the sagittal plane were quantified by experimental studies with EMG, kinematic and kinetic data.
RNA-ID, a Powerful Tool for Identifying and Characterizing Regulatory Sequences.
Brule, C E; Dean, K M; Grayhack, E J
2016-01-01
The identification and analysis of sequences that regulate gene expression is critical because regulated gene expression underlies biology. RNA-ID is an efficient and sensitive method to discover and investigate regulatory sequences in the yeast Saccharomyces cerevisiae, using fluorescence-based assays to detect green fluorescent protein (GFP) relative to a red fluorescent protein (RFP) control in individual cells. Putative regulatory sequences can be inserted either in-frame or upstream of a superfolder GFP fusion protein whose expression, like that of RFP, is driven by the bidirectional GAL1,10 promoter. In this chapter, we describe the methodology to identify and study cis-regulatory sequences in the RNA-ID system, explaining features and variations of the RNA-ID reporter, as well as some applications of this system. We describe in detail the methods to analyze a single regulatory sequence, from construction of a single GFP variant to assay of variants by flow cytometry, as well as modifications required to screen libraries of different strains simultaneously. We also describe subsequent analyses of regulatory sequences. © 2016 Elsevier Inc. All rights reserved.
Fraudulent ID using face morphs: Experiments on human and automatic recognition.
Robertson, David J; Kramer, Robin S S; Burton, A Mike
2017-01-01
Matching unfamiliar faces is known to be difficult, and this can give an opportunity to those engaged in identity fraud. Here we examine a relatively new form of fraud, the use of photo-ID containing a graphical morph between two faces. Such a document may look sufficiently like two people to serve as ID for both. We present two experiments with human viewers, and a third with a smartphone face recognition system. In Experiment 1, viewers were asked to match pairs of faces, without being warned that one of the pair could be a morph. They very commonly accepted a morphed face as a match. However, in Experiment 2, following very short training on morph detection, their acceptance rate fell considerably. Nevertheless, there remained large individual differences in people's ability to detect a morph. In Experiment 3 we show that a smartphone makes errors at a similar rate to 'trained' human viewers-i.e. accepting a small number of morphs as genuine ID. We discuss these results in reference to the use of face photos for security.
STS-71 astronauts before egress training
1994-01-01
Astronaut Robert L. Gibson (left), STS-71 mission commander, converses with two crew mates prior to emergency egress training in the Systems Integration Facility at JSC. Astronaut Bonnie J. Dunbar and Gregory J. Harbaugh are attired in training versions o
Bi-phase CO{sub 2} cooling of the CBM STS detector
Energy Technology Data Exchange (ETDEWEB)
Lavrik, Evgeny [Physikalisches Institut der Universitaet Tuebingen (Germany); Collaboration: CBM-Collaboration
2016-07-01
The Compressed Baryonic Matter (CBM) experiment aims to study the properties of nuclear matter at high net-baryon densities. The Silicon Tracking System (STS) is the key detector to reconstruct charged particle tracks created in heavy-ion interactions. The foreseen interaction rate of up to 10 MHz requires radiation hard detectors as well as efficient cooling of the silicon sensors. To avoid thermal runaway the system must be kept at -5 C or below all the time. This is rather challenging because the overall thermal load in the 2 m{sup 3} STS enclosure is up to 40 kW. Because of these requirements liquid CO{sub 2} is used as a cooling agent as it is superior in terms of volumetric heat transfer coefficient compared to other agents. This contribution shows the thermal simulations and measurement results of the STS front-end electronic boxes as well as an overview of 1 kW TRACI-XL cooling plant developed at GSI and its use to perform thermal measurements of a fully heat loaded STS quarter station.
The sustainability paradigm and the STS approach: mediations for science education
Directory of Open Access Journals (Sweden)
Elizandra Rêgo de Vasconcelos
2012-12-01
Full Text Available The society has been confronted with issues that involve interactions between science, technology and society (STS, which reveal social, economic, environmental, ethical implications, among others. The sustainability paradigm occupies a prominent position in this area. We understand that the STS guidelines are an important instrument for building the concept of sustainability in science education, whose perspectives consistent with the formation of citizens with environmental sensitivity-citizens who are able to analyze and evaluate critically issues related to the social, environmental and economic field, among other aspects. We propose, in this article, to discuss the possible links between the sustainability paradigm, the STS approach and the process of teaching and learning in science. This articulation certainly helps to think the implications of the current development model and the relationships STS, inserted, for example, on various issues, contexts, dimensions, knowledge and teaching strategies. Certainly, we must undertake the effort to approximate the natural and social fields, in the apprehension of the complex reality as it stands nowadays
Application of Sharī‘ah contracts in contemporary Islamic finance: A maqāṣid perspective
Directory of Open Access Journals (Sweden)
Younes Soualhi
2015-12-01
Full Text Available This research exposes the underlying maqāṣid embedded in Sharī‘ah contracts as applied in Islamic banking and finance. It addresses the problem of not observing maqāṣid in nominated and combined Sharī‘ah contracts as well as the problem of not sufficiently imbuing maqāṣid in products developed by Islamic financial institutions. As a benchmark of the maqāṣid of wealth, the research adopts Ibn ‘Āshūr’s classification of maqāṣid to evaluate the conformity of Sharī‘ah contracts to Maqāṣid al-Sharī‘ah namely, justice, circulation, transparency, and firmness. The study focuses on three markets related to the application of Sharī‘ah contracts, namely, banking, Islamic capital market, and takāful. The study concludes that, by and large, the application of Sharī‘ah contracts has observed Maqāṣid al-Sharī‘ah during its development and initial application stages of Islamic finance products; however, offering such products in the market has raised economic questions as to their viability and economic values. In addition, the malpractice of some Sharī‘ah contracts has long raised concerns as to the maqāṣid compliance of such products. The research recommends a de-sophistication of Islamic financial engineering to minimise the possibility of convergence with conventional finance. The research also emphasises product differentiation based on less complicated combined Sharī‘ah contracts.
Views of STS-4 crew during a training session in the SMS
1982-01-01
Views of STS-4 crew during a training session in the Shuttle Mission Simulator (SMS) in bldg 5. Astronauts Thomas K. Mattingly, II. (left) and Henry W. Hartsfield, Jr., commander and pilot respectively for STS-4 get in some training time in the SMS.
Views of STS-5 crew during a training session in the SMS
1982-01-01
Views of STS-5 crew during a training session in the Shuttle Mission Simulator (SMS). Astronaut Robert F. Overmyer, STS-5 pilot, participates in training session wearing a communications kit assembly (ASSY). He is dressed in regular flight suit and is studying flight documentation.
17 CFR 12.407 - Satisfaction of reparation award; enforcement; sanctions.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Satisfaction of reparation... Satisfaction of reparation award; enforcement; sanctions. (a) Satisfaction of reparation award—(1) Where... satisfaction of an award (as prescribed in paragraph (a) or (b) of this section) expires, file with the...
47 CFR 25.130 - Filing requirements for transmitting earth stations.
2010-10-01
.... Additional filing requirements for Vehicle-Mounted Earth Stations are described in § 25.226. In addition... equal rights between terrestrial and space services, except that applications for user transceiver units... part 17 of this chapter, must include the FCC Antenna Structure Registration Number(s) for the affected...
ACE I/D polymorphism in Indian patients with hypertrophic cardiomyopathy and dilated cardiomyopathy
DEFF Research Database (Denmark)
Rai, Taranjit Singh; Dhandapany, Perundurai Subramaniam; Ahluwalia, Tarun Veer Singh
2008-01-01
The study was carried to determine the association of angiotensin converting enzyme (ACE) insertion/deletion (I/D) polymorphism with the risk of hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy (DCM), and restrictive cardiomyopathy (RCM).......The study was carried to determine the association of angiotensin converting enzyme (ACE) insertion/deletion (I/D) polymorphism with the risk of hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy (DCM), and restrictive cardiomyopathy (RCM)....
Digital Repository Service at National Institute of Oceanography (India)
Pattan, J.N.; Banakar, V.K.
.43 1.34 1.36 1.55 0.60 0.17 4977 5620 716 1746 1095 348 8 Siliceous 4.34 2.02 0.60 0.19 0.66 2.10 1.22 1.15 0.13 256 184 119 59 48 1.4 23 ooze* Buried Ba Y La Ce Nd Sm Eu Gd Dy Ho Er Yb Lu Ce # depth (cm) Surface* 1639 104 119 455 139 30.0 7.2 29....27 92.5 1416 101 80 492 86 19.1 4.5 20.6 17.0 3.1 8.5 8.0 1.4 0.46 Siliceous 2229 45 35 94 42 11.3 2.7 10.3 9.7 1.8 5.2 4.8 0.8 0.08 ooze* * sediment-nodule pair from the surface of SK-176 core. Ce # Ce anomaly = log \\[ Ce(2/3 La + I/3 Nd)\\], based...
ID-1 mass storage system for mainframe by using FDDI network
International Nuclear Information System (INIS)
Morita, Y.; Fujii, H.; Inoue, E.; Kodama, H. Manabe, A.; Miyamoto, A.; Nomachi, M.; Watase, Y.; Yasu, Y.
1994-01-01
The authors have developed an ID-1 mass storage system as a distributed data server for Fujitsu mainframe computers. The system consists of a SONY ID-1 recorder DIR-1000, a tape robot system DMS-24 and a SCSI-II interface DFC-1500, which are connected to Spar Station 10 with an FDDI interface. The maximum speed of 7.5 Mbytes/sec is achieved for data transfer between Sparc Station 10 memory and DIR-1000 with a buffer size of 1 Mbytes. The system has been used successfully since last October to migrate more than 1 Tbytes data
Evaluation of the Micro-ID system for the identification of Yersinia pestis.
Harrison, D N; Williams, J E
1985-01-01
One hundred isolates of Yersinia pestis identified by conventional means were tested by the Micro-ID system to assess its reliability for distinguishing Y. pestis from other members of the family Enterobacteriaceae. The Micro-ID system gave Y. pestis as a choice for the identification of 89 of these cultures, although not always as the first choice. Most nitrate-negative strains of Y. pestis keyed out with Yersinia pseudotuberculosis as first choice and Y. pestis as second or fourth choice.
File list: InP.Bld.50.AllAg.Th17 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Bld.50.AllAg.Th17 mm9 Input control Blood Th17 SRX288138,SRX495621,SRX288137,SR...X220933,SRX172342,SRX1328057,SRX1328056 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.Bld.50.AllAg.Th17.bed ...
STS-93 Mission Specialist Cady Coleman suits up for launch
1999-01-01
For the third time, during final launch preparations in the Operations and Checkout Building, STS-93 Mission Specialist Catherine G. Coleman (Ph.D.) dons her launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Coleman, and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
Desprez, Pierre-Yves; Campisi, Judith
2014-08-19
A method for treatment of breast cancer and other types of cancer. The method comprises targeting and modulating Id-1 gene expression, if any, for the Id-1 gene, or gene products in breast or other epithelial cancers in a patient by delivering products that modulate Id-1 gene expression. When expressed, Id-1 gene is a prognostic indicator that cancer cells are invasive and metastatic.
STS-93 Pilot Ashby suits up before launch
1999-01-01
In the Operations and Checkout Building during final launch preparations for the second time, STS-93 Pilot Jeffrey S. Ashby waves after donning his launch and entry suit while a suit tech adjusts his boot. After Space Shuttle Columbia's July 20 launch attempt was scrubbed at the T-7 second mark in the countdown, the launch was rescheduled for Thursday, July 22, at 12:28 a.m. EDT. The target landing date is July 26, 1999, at 11:24 p.m. EDT. STS- 93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X-ray telescope and is expected unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Eileen M. Collins, Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
Radikal konservativ idédebat og højreautoritær fascination i Danmark, ca. 1928-1940
DEFF Research Database (Denmark)
Holm, Adam
1999-01-01
Historie, Højreradikalisme, Konservatisme, Fascisme, Mellemkrigstid, Idéhistorie, Intellektuelle......Historie, Højreradikalisme, Konservatisme, Fascisme, Mellemkrigstid, Idéhistorie, Intellektuelle...
Automated Archiving of Archaeological Aerial Images
Directory of Open Access Journals (Sweden)
Michael Doneus
2016-03-01
Full Text Available The main purpose of any aerial photo archive is to allow quick access to images based on content and location. Therefore, next to a description of technical parameters and depicted content, georeferencing of every image is of vital importance. This can be done either by identifying the main photographed object (georeferencing of the image content or by mapping the center point and/or the outline of the image footprint. The paper proposes a new image archiving workflow. The new pipeline is based on the parameters that are logged by a commercial, but cost-effective GNSS/IMU solution and processed with in-house-developed software. Together, these components allow one to automatically geolocate and rectify the (oblique aerial images (by a simple planar rectification using the exterior orientation parameters and to retrieve their footprints with reasonable accuracy, which is automatically stored as a vector file. The data of three test flights were used to determine the accuracy of the device, which turned out to be better than 1° for roll and pitch (mean between 0.0 and 0.21 with a standard deviation of 0.17–0.46 and better than 2.5° for yaw angles (mean between 0.0 and −0.14 with a standard deviation of 0.58–0.94. This turned out to be sufficient to enable a fast and almost automatic GIS-based archiving of all of the imagery.
Energy Technology Data Exchange (ETDEWEB)
Lim, Il-Ho; Park, Chun-Kil; Kim, Hyung Sun; Jeong, Dea-Yong [Inha University, Incheon (Korea, Republic of); Lee, Yong-Seok [Sodoyeon Co., Yeoju (Korea, Republic of); Kong, Young-Min [University of Ulsan, Ulsan (Korea, Republic of); Kang, Kweon Ho [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2016-03-15
To improve the surface hardness of the STS304, Yttria stabilized zirconia (YSZ) films with nano-sized grain were deposited by an aerosol-deposition (AD) method. Coating layers showed dense structure and had -5µm thickness. When 3 mol% YSZ powders with tetragonal phase were deposited on STS304 substrate, tetragonal structure was transformed to cubic structure due to the high impact energy during the AD process. At the same time, strong impact by YSZ particles allowed the austenite phase in STS304 to be transformed into martensite phase. Surface hardness measured with nano indentor showed that YSZ coated film had 11.5 GPa, which is larger value than 7 GPa of STS304.
STS-76 Payload Cmdr Ronald Sega suits up
1996-01-01
STS-76 Payload Commander Ronald M. Sega is donning his launch/entry suit in the Operations and Checkout Building with assistance from a suit technician. The third docking between the Russian Space Station Mir and the U.S. Space Shuttle marks the second trip into space for Sega, who recently served a five-month assignment in Russia as operations director for NASA activities there. Once suitup activities are completed the six-member STS-76 flight crew will depart for Launch Pad 39B, where the Space Shuttle Atlantis is undergoing final preparations for liftoff during an approximately seven-minute launch window opening around 3:13 a.m. EST, March 22.
The ubiquitin ligase ASB4 promotes trophoblast differentiation through the degradation of ID2.
Directory of Open Access Journals (Sweden)
W H Davin Townley-Tilson
Full Text Available Vascularization of the placenta is a critical developmental process that ensures fetal viability. Although the vascular health of the placenta affects both maternal and fetal well being, relatively little is known about the early stages of placental vascular development. The ubiquitin ligase Ankyrin repeat, SOCS box-containing 4 (ASB4 promotes embryonic stem cell differentiation to vascular lineages and is highly expressed early in placental development. The transcriptional regulator Inhibitor of DNA binding 2 (ID2 negatively regulates vascular differentiation during development and is a target of many ubiquitin ligases. Due to their overlapping spatiotemporal expression pattern in the placenta and contrasting effects on vascular differentiation, we investigated whether ASB4 regulates ID2 through its ligase activity in the placenta and whether this activity mediates vascular differentiation. In mouse placentas, ASB4 expression is restricted to a subset of cells that express both stem cell and endothelial markers. Placentas that lack Asb4 display immature vascular patterning and retain expression of placental progenitor markers, including ID2 expression. Using JAR placental cells, we determined that ASB4 ubiquitinates and represses ID2 expression in a proteasome-dependent fashion. Expression of ASB4 in JAR cells and primary isolated trophoblast stem cells promotes the expression of differentiation markers. In functional endothelial co-culture assays, JAR cells ectopically expressing ASB4 increased endothelial cell turnover and stabilized endothelial tube formation, both of which are hallmarks of vascular differentiation within the placenta. Co-transfection of a degradation-resistant Id2 mutant with Asb4 inhibits both differentiation and functional responses. Lastly, deletion of Asb4 in mice induces a pathology that phenocopies human pre-eclampsia, including hypertension and proteinuria in late-stage pregnant females. These results indicate that
STS-95 Mission Specialist Pedro Duque in white room
1998-01-01
In the environmental chamber known as the white room, STS-95 Mission Specialist Pedro Duque of Spain, with the European Space Agency, is prepared by white room crew members Danny Wyatt (left) and Travis Thompson (right) for entry into the Space Shuttle Discovery for his first flight into space. The STS-95 mission, targeted for launch at 2 p.m. EST on Oct. 29, is expected to last 8 days, 21 hours and 49 minutes, and return to KSC at 11:49 a.m. EST on Nov. 7.
2011-06-29
... Insider Trading and Securities Fraud Enforcement Act of 1988 (``ITSFEA''),\\17\\ requires every registered... rules. \\16\\ 15 U.S.C. 78o(g). \\17\\ See Insider Trading and Securities Fraud Enforcement Act of 1988, Pub... SECURITIES AND EXCHANGE COMMISSION [Release No. 34-64736; File No. SR-FINRA-2011-028] Self...
17 CFR 9.24 - Petition for stay pending review.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Petition for stay pending... Respect to Appeals § 9.24 Petition for stay pending review. (a) Time to file. (1) Within ten days after... disciplinary or access denial action pending consideration by the Commission of the notice of appeal and, if...
Energy Technology Data Exchange (ETDEWEB)
L, Yingjie; Huliyageqi, B; Haschaolu, W; Song, Zhiqiang [Inner Mongolia Key Laboratory for Physics and Chemistry of Functional Materials, Physics and Electronic Information College, Inner Mongolia Normal University, Hohhot 010022 (China); Tegus, O, E-mail: tegusph@imnu.edu.cn [Inner Mongolia Key Laboratory for Physics and Chemistry of Functional Materials, Physics and Electronic Information College, Inner Mongolia Normal University, Hohhot 010022 (China); Nakai, Ikuo [Department of Electrical and Electronic Engineering, Tottori University, Tottori 680-8552 (Japan)
2014-10-15
Highlights: • We have investigated the Fe and Mn K edge XAFS spectra of the Mn{sub 1.28}Fe{sub 0.67}P{sub 0.46}Si{sub 0.54} compound at 25 K and 295 K. • The site occupation of the Fe and Mn atoms and local structure of Mn{sub 1.28}Fe{sub 0.67}P{sub 0.46}Si{sub 0.54} are determined. • The atomic distances between Fe–Fe in c-plane for the ferromagnetic state are larger than those in the paramagnetic state. - Abstract: The Fe{sub 2}P-type MnFe(P,Si) compounds are investigated by means of magnetic measurements and X-ray absorption fine structure spectroscopy. Magnetic measurements show that the Mn{sub 1.28}Fe{sub 0.67}P{sub 0.46}Si{sub 0.54} compound undergoes a first-order phase transition at the Curie temperature of 254 K. The Fe K-edge and Mn K-edge X-ray absorption fine structure spectra show that Mn atom mainly located at the 3g sites, while the 3f sites are occupied by Fe atoms and Mn atom randomly. The distances between the Fe atom and its nearest neighbor atoms in a triangle Fe–Mn–Fe change from 2.80 Å at 25 K to 2.74 Å at 300 K. On the other hand, the distances between Fe atom and its second neighbor atoms change from 4.06 Å at 25 K to 4.02 Å at 300 K.
The Role of TPA I/D and PAI-1 4G/5G Polymorphisms in Multiple Sclerosis
Živković, Maja; Starčević Čizmarević, Nada; Lovrečić, Luca; Klupka-Sarić, Inge; Stanković, Aleksandra; Gašparović, Iva; Dinčić, Evica; Stojković, Ljiljana; Rudolf, Gorazd; Šega Jazbec, Saša; Perković, Olivio; Sinanović, Osman; Sepčić, Juraj; Kapović, Miljenko; Peterlin, Borut
2014-01-01
Background. Previous studies have shown impaired fibrinolysis in multiple sclerosis (MS) and implicated extracellular proteolytic enzymes as important factors in demyelinating neuroinflammatory disorders. Tissue-type plasminogen activator (t-PA) and its inhibitor (PAI-1) are key molecules in both fibrinolysis and extracellular proteolysis. In the present study, an association of the TPA Alu I/D and PAI-1 4G/5G polymorphisms with MS was analyzed within the Genomic Network for Multiple Sclerosis (GENoMS). Methods. The GENoMS includes four populations (Croatian, Slovenian, Serbian, and Bosnian and Herzegovinian) sharing the same geographic location and a similar ethnic background. A total of 885 patients and 656 ethnically matched healthy blood donors with no history of MS in their families were genotyped using PCR-RFLP. Results. TPA DD homozygosity was protective (OR = 0.79, 95% CI 0.63–0.99, P = 0.037) and PAI 5G5G was a risk factor for MS (OR = 1.30, 95% CI 1.01–1.66, P = 0.038). A significant effect of the genotype/carrier combination was detected in 5G5G/I carriers (OR = 1.39 95% CI 1.06–1.82, P = 0.017). Conclusions. We found a significantly harmful effect of the combination of the PAI-1 5G/5G genotype and TPA I allele on MS susceptibility, which indicates the importance of gene-gene interactions in complex diseases such as MS. PMID:24825926
Group-ID based RFID Mutual Authentication
Directory of Open Access Journals (Sweden)
LEE, Y.
2013-11-01
Full Text Available For passive type RFID tags, EPCglobal Class 1 Generation-2 Revision is used widely as a de facto standard. As it was designed for low cost, it is quite vulnerable to security issues, such as privacy concerns. This paper presents a new RFID mutual authentication protocol, which is designed to be configured on EPC Gen2 platform and to meet various security requirements while providing efficiency using PRNG (Pseudo Random Number Generator. Group-ID is used to minimize the authentication time. Security analysis of the proposed protocol is discussed.
Directory of Open Access Journals (Sweden)
Gutmann Anja
2010-01-01
Full Text Available Abstract Background ID proteins are dominant negative inhibitors of basic helix-loop-helix transcription factors that have multiple functions during development and cellular differentiation. Ectopic (over-expression of ID1 extends the lifespan of primary human epithelial cells. High expression levels of ID1 have been detected in multiple human malignancies, and in some have been correlated with unfavorable clinical prognosis. ID1 protein is localized at the centrosomes and forced (over-expression of ID1 results in errors during centrosome duplication. Results Here we analyzed the steady state expression levels of the four ID-proteins in 18 tumor cell lines and assessed the number of centrosome abnormalities. While expression of ID1, ID2, and ID3 was detected, we failed to detect protein expression of ID4. Expression of ID1 correlated with increased supernumerary centrosomes in most cell lines analyzed. Conclusions This is the first report that shows that not only ectopic expression in tissue culture but endogenous levels of ID1 modulate centrosome numbers. Thus, our findings support the hypothesis that ID1 interferes with centrosome homeostasis, most likely contributing to genomic instability and associated tumor aggressiveness.
Pre-STS-3 press conference held at the JSC public affairs facility
1982-01-01
Astronauts Jack R. Lousma, center, and C. Gordon Fullerton, left, respond to a visual display of the Columbia and its remote manipulator system in space during a pre-STS-3 press conference. Dr. John Lawrence, public information specialist, is at the far right (25903); Astronaut Lousma, listens as a newsman directs a question his way. In the background is the STS-3 mission logo (25904); Astronaut Fullerton uses an electronic pointer to localize an area on a prjected visual of the OSS payload package to be carried in the cargo bay of the Columbia on STS-3. On far right is Dr. Lawrence (25905).
Online data handling and storage at the CMS experiment
Andre, Jean-marc Olivier; Behrens, Ulf; Branson, James; Chaze, Olivier; Demiragli, Zeynep; Dobson, Marc; Dupont, Aymeric; Erhan, Samim; Gigi, Dominique; Glege, Frank; Gomez Ceballos, Guillelmo; Hegeman, Jeroen Guido; Holzner, Andre Georg; Jimenez Estupinan, Raul; Masetti, Lorenzo; Meijers, Franciscus; Meschi, Emilio; Mommsen, Remigius; Morovic, Srecko; Nunez Barranco Fernandez, Carlos; O'Dell, Vivian; Orsini, Luciano; Paus, Christoph Maria Ernst; Petrucci, Andrea; Pieri, Marco; Racz, Attila; Roberts, Penelope Amelia; Sakulin, Hannes; Schwick, Christoph; Stieger, Benjamin Bastian; Sumorok, Konstanty; Veverka, Jan; Zaza, Salvatore; Zejdl, Petr
2015-01-01
During the LHC Long Shutdown 1, the CMS Data Acquisition (DAQ) system underwent a partial redesign to replace obsolete network equipment, use more homogeneous switching technologies, and support new detector back-end electronics. The software and hardware infrastructure to provide input, execute the High Level Trigger (HLT) algorithms and deal with output data transport and storage has also been redesigned to be completely file- based. All the metadata needed for bookkeeping are stored in files as well, in the form of small 'documents' using the JSON encoding. The Storage and Transfer System (STS) is responsible for aggregating these files produced by the HLT, storing them temporarily and transferring them to the T0 facility at CERN for subsequent offline processing. The STS merger service aggregates the output files from the HLT from ~62 sources produced with an aggregate rate of ~2GB/s. An estimated bandwidth of 7GB/s in concurrent read/write mode is needed. Furthermore, the STS has to be able to store ...
Angiotensin-converting enzyme I/D polymorphism in chronic obstructive pulmonary disease
Directory of Open Access Journals (Sweden)
Pabst S
2009-12-01
Full Text Available Abstract Study objective The etiology of chronic obstructive lung disease (COPD is unclear. It is supposed to be the product of an exogenous antigenic stimulus, such as tobacco smoke, and an endogenous genetic susceptibility. The angiotensin-converting enzyme (ACE gene contains a polymorphism based on the presence (insertion [I] or absence (deletion [D] of a 287-bp nonsense domain, resulting in three different genotypes (II, ID and DD. The aim of the study was to find out whether the ACE gene polymorphism can determine the course of COPD. Patients and design We genotyped 152 Caucasian patients with COPD and 158 healthy controls for the ACE (I/D polymorphism. We divided the COPD group into one group of 64 patients with a stable course of disease, defined as less than three hospitalizations over the last three years due to COPD, and another group of 88 patients with an instable course with more than three hospitalizations. Results The I-allele was significantly associated with an increased risk for COPD in a dominant model (OR 1.67 (95% CI 1.00 to 2.78, p = 0.048, but not in a recessive or co-dominant model. Moreover, the I-allele of ACE (I/D was significantly increased in patients with a stable course of COPD (p = 0.012 compared with controls. In a dominant model (II/ID v DD we found an even stronger association between the I-allele and a stable course of COPD (OR 3.24 (95% CI 1.44 to 7.31, p = 0.003. Conclusion These data suggest that the presence of an ACE I-allele determines a stable course of COPD.
Oberste, M S; Weaver, S C; Watts, D M; Smith, J F
1998-01-01
Venezuelan equine encephalitis (VEE) virus was isolated in 1993, 1994, and 1995 from human cases of acute, undifferentiated, febrile illness in the Peruvian Amazon Basin. Two virus isolates were recovered in 1994 from Peruvian soldiers at a jungle outpost near Pantoja in northern Peru, and 10 isolates were obtained from military personnel and civilians in 1993-1995 in Iquitos, an urban center in northeastern Peru. The genetic relationship of these isolates to other VEE virus strains was determined by sequencing 856-867 nucleotide reverse transcription-polymerase chain reaction fragments derived from the PE2 glycoprotein gene. The sequences were compared with those of other VEE virus strains, including representatives of the IAB, IC, ID, IE, II, and IIIC subtypes. The two Pantoja isolates were most closely related to subtype IC and ID viruses previously isolated in Colombia and Venezuela, and to the ID viruses isolated during the 1970s in Iquitos. All of the recent Iquitos isolates were similar to one another, but they were more closely related to Panamanian ID strains than to isolates previously obtained in Iquitos, Peru, or in Colombia and Venezuela. The recent Iquitos VEE viral isolates were the first Panama-genotype VEE ID virus strains identified outside of the Republic of Panama.
Online data handling and storage at the CMS experiment
International Nuclear Information System (INIS)
Andre, J-M; Andronidis, A; Chaze, O; Deldicque, C; Dobson, M; Dupont, A; Gigi, D; Glege, F; Hegeman, J; Jimenez-Estupiñán, R; Masetti, L; Meijers, F; Behrens, U; Branson, J; Cittolin, S; Holzner, A; Darlea, G-L; Demiragli, Z; Gómez-Ceballos, G; Erhan, S
2015-01-01
During the LHC Long Shutdown 1, the CMS Data Acquisition (DAQ) system underwent a partial redesign to replace obsolete network equipment, use more homogeneous switching technologies, and support new detector back-end electronics. The software and hardware infrastructure to provide input, execute the High Level Trigger (HLT) algorithms and deal with output data transport and storage has also been redesigned to be completely file- based. All the metadata needed for bookkeeping are stored in files as well, in the form of small documents using the JSON encoding. The Storage and Transfer System (STS) is responsible for aggregating these files produced by the HLT, storing them temporarily and transferring them to the T0 facility at CERN for subsequent offline processing. The STS merger service aggregates the output files from the HLT from ∼62 sources produced with an aggregate rate of ∼2GB/s. An estimated bandwidth of 7GB/s in concurrent read/write mode is needed. Furthermore, the STS has to be able to store several days of continuous running, so an estimated of 250TB of total usable disk space is required. In this article we present the various technological and implementation choices of the three components of the STS: the distributed file system, the merger service and the transfer system. (paper)
OpenID Connect as a security service in cloud-based medical imaging systems.
Ma, Weina; Sartipi, Kamran; Sharghigoorabi, Hassan; Koff, David; Bak, Peter
2016-04-01
The evolution of cloud computing is driving the next generation of medical imaging systems. However, privacy and security concerns have been consistently regarded as the major obstacles for adoption of cloud computing by healthcare domains. OpenID Connect, combining OpenID and OAuth together, is an emerging representational state transfer-based federated identity solution. It is one of the most adopted open standards to potentially become the de facto standard for securing cloud computing and mobile applications, which is also regarded as "Kerberos of cloud." We introduce OpenID Connect as an authentication and authorization service in cloud-based diagnostic imaging (DI) systems, and propose enhancements that allow for incorporating this technology within distributed enterprise environments. The objective of this study is to offer solutions for secure sharing of medical images among diagnostic imaging repository (DI-r) and heterogeneous picture archiving and communication systems (PACS) as well as Web-based and mobile clients in the cloud ecosystem. The main objective is to use OpenID Connect open-source single sign-on and authorization service and in a user-centric manner, while deploying DI-r and PACS to private or community clouds should provide equivalent security levels to traditional computing model.
STS-95 crew members Duque and Mukai check out slidewire basket
1998-01-01
At Launch Pad 39-B, STS-95 Mission Specialist Pedro Duque of Spain (left) and Payload Specialist Chiaki Mukai look over the gate for the slidewire basket, part of the emergency egress system on the pad. Mukai represents the National Space Development Agency of Japan (NASDA), and Duque the European Space Agency (ESA). The STS-95 crew are at KSC to participate in a Terminal Countdown Demonstration Test (TCDT) which includes mission familiarization activities, emergency egress training, and a simulated main engine cut-off exercise. Other STS-95 crew members are Mission Specialist Stephen K. Robinson, Mission Commander Curtis L. Brown, Pilot Steven W. Lindsey, Payload Specialists John H. Glenn Jr., senator from Ohio, and Mission Specialist Scott E. Parazynski. The STS-95 mission, targeted for liftoff on Oct. 29, includes research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. Following the TCDT, the crew will be returning to Houston for final flight preparations.
STS-93 M.S. Michel Tognini suits up before launch
1999-01-01
For the third time, in the Operations and Checkout Building, STS- 93 Mission Specialist Michel Tognini of France, who represents the Centre National d'Etudes Spatiales (CNES), waves after donning his launch and entry suit during final launch preparations. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Tognini. Collins is the first woman to serve as commander of a shuttle mission.
International Nuclear Information System (INIS)
Nakagawa, Tsuneo
1995-01-01
In JENDL-3,2, the data on all the reactions having significant cross section over the neutron energy from 0.01 meV to 20 MeV are given for 340 nuclides. The object range of application extends widely, such as the neutron engineering, shield and others of fast reactors, thermal neutron reactors and nuclear fusion reactors. This is a general purpose data file. On the contrary to this, the file in which only the data required for a specific application field are collected is called special purpose file. The file for dosimetry is a typical special purpose file. The Nuclear Data Center, Japan Atomic Energy Research Institute, is making ten kinds of JENDL special purpose files. The files, of which the working groups of Sigma Committee are in charge, are listed. As to the format of the files, ENDF format is used similarly to JENDL-3,2. Dosimetry file, activation cross section file, (α, n) reaction data file, fusion file, actinoid file, high energy data file, photonuclear data file, PKA/KERMA file, gas production cross section file and decay data file are described on their contents, the course of development and their verification. Dosimetry file and gas production cross section file have been completed already. As for the others, the expected time of completion is shown. When these files are completed, they are opened to the public. (K.I.)
STS-95 Mission Specialist Duque suits up during TCDT
1998-01-01
STS-95 Mission Specialist Pedro Duque of Spain, representing the European Space Agency, suits up in the Operations and Checkout Building prior to his trip to Launch Pad 39-B. Duque and the rest of the STS-95 crew are at KSC to participate in the Terminal Countdown Demonstration Test (TCDT) which includes mission familiarization activities, emergency egress training, and a simulated main engine cutoff. The other crew members are Payload Specialist Chiaki Mukai (M.D., Ph.D.), representing the National Space Development Agency of Japan (NASDA), Pilot Steven W. Lindsey, Mission Specialist Scott E. Parazynski, Mission Specialist Stephen K. Robinson, Payload Specialist John H. Glenn Jr., senator from Ohio, and Mission Commander Curtis L. Brown. The STS-95 mission, targeted for liftoff on Oct. 29, includes research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. Following the TCDT, the crew will be returning to Houston for final flight preparations.
Qing, Miao; Yongge, Liu; Wei, Xu; Yan, Wang; Zhen, Li; Yixin, Ren; Hui, Guan; Li, Xiang
2018-03-31
To investigate whether there were differences in Th17 cells mediated immunological responses among asthmatics with or without allergic rhinitis. A case-control comparison was conducted in a cohort of 67 children with asthma (AS), 50 children with allergic rhinitis (AR), 52 children with both AS and AR (ASR), 25 infectious rhinitis (IR), and 55 healthy controls (HC). The percentages of circulating Th17 cells were determined by flow cytometry. The Th2- and Th17-related cytokines in plasma and culture supernatants were measured by enzyme-linked immunosorbent assay. The effect of proinflammation cytokine IL-17E on Th2 cytokines production from human T helper (Th) lymphocytes was analyzed. (1) A inter-group comparison revealed that Th17 cells levels were highest in ASR group [(0.89% ± 0.27) %], following by AS group [(0.82 ± 0.29) %] and AR group[(0.78 ± 0.17) %] (Pimmunological characteristics among asthmatic children with or without allergic rhinitis.
Prevention of Crevice Corrosion of STS 304 Stainless Steel by a Mg-alloy Galvanic Anode
International Nuclear Information System (INIS)
Lim, U. J.; Yun, B. D.; Kim, J. J.
2006-01-01
Prevention of crevice corrosion was studied for STS 304 stainless steel using a Mg-alloy galvanic anode in solutions with various specific resistivity. The crevice corrosion and corrosion protection characteristics of the steel was investigated by the electrochemical polarization and galvanic corrosion tests. Experimental results show that the crevice corrosion of STS 304 stainless steel does not occur in solutions of high specific resistivity, but it occurs in solutions of low specific resistivity like in solutions with resistivities of 30, 60 and 115 Ω · m. With decreasing specific resistivity of the solution, the electrode potential of STS 304 stainless steel in the crevice is lowered. The potential of STS 304 stainless steel in the crevice after coupling is cathodically polarized more by decreasing specific resistivity indicating that the crevice corrosion of STS 304 stainless steel is prevented by the Mg-alloy galvanic anode
Angiotensin-I converting enzyme gene and I/D polymorphism ...
Indian Academy of Sciences (India)
Angiotensin-I converting enzyme gene and I/D polymorphism distribution in the Greek population and a comparison with other European populations. Sekerli Eleni Katsanidis Dimitrios Papadopoulou Vaya Makedou Areti Vavatsi Norma Gatzola Magdalini. Research Note Volume 87 Issue 1 April 2008 pp 91-93 ...
Angiotensin-converting enzyme gene I/D polymorphism in Pakistani ...
African Journals Online (AJOL)
hope&shola
two were the cases of antiphospholipid syndrome. Parsa et al. (2002) conducted an association of 3 polymor- phisms in angiotensin-converting enzyme including I/D polymorphism and 2 polymorphisms were associated with systemic lupus erythematosus and Lupus Nephritis among non-Caucasians that includes Hispanic, ...
STS-30 Pilot Ronald J. Grabe during preflight press conference at JSC
1989-01-01
During preflight press conference, STS-30 Pilot Ronald J. Grabe answers a question from the news media. The event was held in the JSC Auditorium and Public Affairs Facility Bldg 2 briefing room. STS-30 mission will fly onboard Atlantis, Orbiter Vehicle (OV) 104, and is scheduled for an April 28 liftoff.
Lifescience Database Archive (English)
Full Text Available I11|MDTH_CITK8 Multidrug resistance protein mdtH OS=Citrob... 30 9.4 >sp|Q80W93|HYDIN_MOUSE Hydrocephalus-in.........done Score E Sequences producing significant alignments: (bits) Value sp|Q80W93|HYDIN_MOUSE Hydrocep...(release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q80W93 Definition sp|Q80W93|HYDIN_MOUSE Hydroc...ephalus-inducing protein OS=Mus musculus Align length 89 Score (bit) 35.4 E-value 0...halus-inducing protein OS=Mus musc... 35 0.17 sp|Q726E5|Y3208_DESVH UPF0078 membran
Pätid võtsid varastatud ID-kaardiga kiirlaene / Põim Kama
Kama, Põim, 1985-
2008-01-01
ID-kaardi vargusega seotud pettusjuhtumist ning jaanuaris jõustunud rahapesu ja terrorismi rahastamise tõkestamise seaduse sättest, mis kohustab laenufirmasid esimese tehingu sooritamisel kliendiga silmast silma kohtuma. Lisatud: kiirlaenufirmad vilistavad seadusele
Directory of Open Access Journals (Sweden)
Wasinee Wongkummool
2017-04-01
Full Text Available Hemoglobin Constant Spring (HbCS, HBA2: c.427T>C is a common nondeletional α-thalassemia resulting from a nucleotide substitution at the termination codon of the HBA2 gene. Homozygosity for HbCS is characterized with mild anemia, jaundice, and splenomegaly. In this study, the human induced pluripotent stem cell line MUi017-A was successfully generated from peripheral blood CD34+ hematopoietic progenitors of a 52 year old female with homozygous HbCS. The MUi017-A cell line exhibited embryonic stem cell characteristics with consistent expression of specific pluripotency markers and the capability of differentiating into the three germ layers. The cell line may be used for the disease modeling.
Rodriguez Viales, Rebecca; Diotel, Nicolas; Ferg, Marco; Armant, Olivier; Eich, Julia; Alunni, Alessandro; März, Martin; Bally-Cuif, Laure; Rastegar, Sepand; Strähle, Uwe
2015-03-01
The teleost brain has the remarkable ability to generate new neurons and to repair injuries during adult life stages. Maintaining life-long neurogenesis requires careful management of neural stem cell pools. In a genome-wide expression screen for transcription regulators, the id1 gene, encoding a negative regulator of E-proteins, was found to be upregulated in response to injury. id1 expression was mapped to quiescent type I neural stem cells in the adult telencephalic stem cell niche. Gain and loss of id1 function in vivo demonstrated that Id1 promotes stem cell quiescence. The increased id1 expression observed in neural stem cells in response to injury appeared independent of inflammatory signals, suggesting multiple antagonistic pathways in the regulation of reactive neurogenesis. Together, we propose that Id1 acts to maintain the neural stem cell pool by counteracting neurogenesis-promoting signals. © 2014 AlphaMed Press.
Chen, B; Han, B H; Sun, X H; Lim, R W
1997-01-15
We have examined the role of an Id-like protein, Id3 (also known as HLH462), in the regulation of muscle-specific gene expression. Id proteins are believed to block expression of muscle-specific genes by preventing the dimerization between ubiquitous bHLH proteins (E proteins) and myogenic bHLH proteins such as MyoD. Consistent with its putative role as an inhibitor of differentiation, Id3 mRNA was detected in proliferating skeletal muscle cells, was further induced by basic fibroblast growth factor (bFGF) and was down-regulated in differentiated muscle cultures. Overexpression of Id3 efficiently inhibited the MyoD-mediated activation of the muscle-specific creatine kinase (MCK) reporter gene. Deletion analysis indicated that the C-terminal 15 amino acids of Id3 are critical for the full inhibitory activity while deleting up to 42 residues from the C-terminus of the related protein, Id2, did not affect its ability to inhibit the MCK reporter gene. Chimeric protein containing the N-terminal region of Id3 and the C-terminus of Id2 was also non-functional in transfected cells. In contrast, wild-type Id3, the C-terminal mutants, and the Id3/Id2 chimera could all interact with the E-protein E47in vitro. Additional studies indicated that truncation of the Id3 C-terminus might have adversely affected the expression level of the mutant proteins but the Id3/Id2 chimera was stably expressed. Taken together, our results revealed a more complex requirement for the expression and proper function of the Id family proteins than was hitherto expected.
DEFF Research Database (Denmark)
Fyhrquist, Frej; Eriksson, Anders; Saijonmaa, Outi
2013-01-01
INTRODUCTION: Short telomeres are often associated with cardiovascular risk factors and age-related diseases, while the angiotensin converting enzyme (ACE) gene insertion/deletion polymorphism (DD, ID, II) has shown such associations less consistently. We hypothesized that telomere length...... and association of telomere length with cardiovascular risk is affected by ACE (I/D) genotype. METHODS: We measured leucocyte telomere length (LTL) by Southern blot and analysed ACE I/D genotypes in 1249 subjects with hypertension and left ventricular hypertrophy (LVH). We examined interactions of ACE I...
11 CFR 100.19 - File, filed or filing (2 U.S.C. 434(a)).
2010-01-01
... a facsimile machine or by electronic mail if the reporting entity is not required to file..., including electronic reporting entities, may use the Commission's website's on-line program to file 48-hour... the reporting entity is not required to file electronically in accordance with 11 CFR 104.18. [67 FR...
2011-08-03
...-Challis National Forest, ID; Upper North Fork HFRA Ecosystem Restoration Project Environmental Impact... improve the health of the ecosystem and reach the desired future condition. DATES: Comments concerning the... Ecosystem Restoration Project EIS, P.O. Box 180, 11 Casey Rd., North Fork, ID 83466. Comments may also be...
Storage of sparse files using parallel log-structured file system
Bent, John M.; Faibish, Sorin; Grider, Gary; Torres, Aaron
2017-11-07
A sparse file is stored without holes by storing a data portion of the sparse file using a parallel log-structured file system; and generating an index entry for the data portion, the index entry comprising a logical offset, physical offset and length of the data portion. The holes can be restored to the sparse file upon a reading of the sparse file. The data portion can be stored at a logical end of the sparse file. Additional storage efficiency can optionally be achieved by (i) detecting a write pattern for a plurality of the data portions and generating a single patterned index entry for the plurality of the patterned data portions; and/or (ii) storing the patterned index entries for a plurality of the sparse files in a single directory, wherein each entry in the single directory comprises an identifier of a corresponding sparse file.
Weight Percentage of Calcium Carbonate for 17 Equatorial Pacific Cores from Brown University
National Oceanic and Atmospheric Administration, Department of Commerce — Weight percentages of calcium carbonate in this file were compiled by J. Farrell and W. L. Prell of Brown University for 17 equatorial Pacific Ocean sediment cores....
Energy Technology Data Exchange (ETDEWEB)
Liu, Chen; Jin, Rong [Department of Immunology, Peking University Health Science Center, Beijing (China); Wang, Hong-Cheng [Oklahoma Medical Research Foundation, Oklahoma City, OK (United States); Tang, Hui; Liu, Yuan-Feng; Qian, Xiao-Ping; Sun, Xiu-Yuan; Ge, Qing [Department of Immunology, Peking University Health Science Center, Beijing (China); Sun, Xiao-Hong, E-mail: sunx@omrf.org [Oklahoma Medical Research Foundation, Oklahoma City, OK (United States); Zhang, Yu, E-mail: zhangyu007@bjmu.edu.cn [Department of Immunology, Peking University Health Science Center, Beijing (China)
2013-06-21
Highlights: •Id1 expression enables naïve T cell proliferation without anti-CD28 co-stimulation. •Id1 expression facilitates T cells survival when stimulated with anti-CD3. •Elevation of IL-2 production by Id1 contributes increased proliferation and survival. •Id1 potentiates NF-κB activation by anti-CD3 stimulation. -- Abstract: Although the role of E proteins in the thymocyte development is well documented, much less is known about their function in peripheral T cells. Here we demonstrated that CD4 promoter-driven transgenic expression of Id1, a naturally occurring dominant-negative inhibitor of E proteins, can substitute for the co-stimulatory signal delivered by CD28 to facilitate the proliferation and survival of naïve CD4{sup +} cells upon anti-CD3 stimulation. We next discovered that IL-2 production and NF-κB activity after anti-CD3 stimulation were significantly elevated in Id1-expressing cells, which may be, at least in part, responsible for the augmentation of their proliferation and survival. Taken together, results from this study suggest an important role of E and Id proteins in peripheral T cell activation. The ability of Id proteins to by-pass co-stimulatory signals to enable T cell activation has significant implications in regulating T cell immunity.
1994-01-01
This STS-68 patch was designed by artist Sean Collins. Exploration of Earth from space is the focus of the design of the insignia, the second flight of the Space Radar Laboratory (SRL-2). SRL-2 was part of NASA's Mission to Planet Earth (MTPE) project. The world's land masses and oceans dominate the center field, with the Space Shuttle Endeavour circling the globe. The SRL-2 letters span the width and breadth of planet Earth, symbolizing worldwide coverage of the two prime experiments of STS-68: The Shuttle Imaging Radar-C and X-Band Synthetic Aperture Radar (SIR-C/X-SAR) instruments; and the Measurement of Air Pollution from Satellites (MAPS) sensor. The red, blue, and black colors of the insignia represent the three operating wavelengths of SIR-C/X-SAR, and the gold band surrounding the globe symbolizes the atmospheric envelope examined by MAPS. The flags of international partners Germany and Italy are shown opposite Endeavour. The relationship of the Orbiter to Earth highlights the usefulness of human space flights in understanding Earth's environment, and the monitoring of its changing surface and atmosphere. In the words of the crew members, the soaring Orbiter also typifies the excellence of the NASA team in exploring our own world, using the tools which the Space Program developed to explore the other planets in the solar system.
File Type Identification of File Fragments using Longest Common Subsequence (LCS)
Rahmat, R. F.; Nicholas, F.; Purnamawati, S.; Sitompul, O. S.
2017-01-01
Computer forensic analyst is a person in charge of investigation and evidence tracking. In certain cases, the file needed to be presented as digital evidence was deleted. It is difficult to reconstruct the file, because it often lost its header and cannot be identified while being restored. Therefore, a method is required for identifying the file type of file fragments. In this research, we propose Longest Common Subsequences that consists of three steps, namely training, testing and validation, to identify the file type from file fragments. From all testing results we can conlude that our proposed method works well and achieves 92.91% of accuracy to identify the file type of file fragment for three data types.
1985-01-01
The crew assigned to the STS-61B mission included (kneeling left to right) Bryan D. O'conner, pilot; and Brewster H. Shaw, commander. On the back row, left to right, are Charles D. Walker, payload specialist; mission specialists Jerry L. Ross, Mary L. Cleave, and Sherwood C. Spring; and Rodolpho Neri Vela, payload specialist. Launched aboard the Space Shuttle Atlantis November 28, 1985 at 7:29:00 pm (EST), the STS-61B mission's primary payload included three communications satellites: MORELOS-B (Mexico); AUSSAT-2 (Autralia); and SATCOM KU-2 (RCA Americom. Two experiments were conducted to test assembling erectable structures in space: EASE (Experimental Assembly of Structures in Extravehicular Activity), and ACCESS (Assembly Concept for Construction of Erectable Space Structure). In a joint venture between NASA/Langley Research Center in Hampton, VA and Marshall Space Flight Center (MSFC), the Assembly Concept for Construction of Erectable Space Structures (ACCESS) was developed and demonstrated at MSFC's Neutral Buoyancy Simulator (NBS). The primary objective of this experiment was to test the ACCESS structural assembly concept for suitability as the framework for larger space structures and to identify ways to improve the productivity of space construction.
49 CFR 564.5 - Information filing; agency processing of filings.
2010-10-01
... 49 Transportation 6 2010-10-01 2010-10-01 false Information filing; agency processing of filings... HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REPLACEABLE LIGHT SOURCE INFORMATION (Eff. until 12-01-12) § 564.5 Information filing; agency processing of filings. (a) Each manufacturer...
HOST payload for STS-95 being moved into SSPF
1998-01-01
The Hubble Space Telescope Orbiting Systems Test (HOST) is checked out by technicians in the Space Shuttle Processing Facility. One of the payloads on the STS-95 mission, the HOST platform is carrying four experiments to validate components planned for installation during the third Hubble Space Telescope servicing mission and to evaluate new technologies in an earth orbiting environment. The STS-95 mission is scheduled to launch Oct. 29. It will carry three other payloads: the Spartan solar- observing deployable spacecraft, the International Extreme Ultraviolet Hitchhiker, and the SPACEHAB single module with experiments on space flight and the aging process.
STS-103 Pilot Scott Kelly during TCDT activities
1999-01-01
STS-103 Pilot Scott J. Kelly is ready to take his turn at driving a small armored personnel carrier that is part of emergency egress training during Terminal Countdown Demonstration Test (TCDT) activities. Behind him (left) is Mission Specialist Jean-Frangois Clervoy of France, who is with the European Space Agency. At right is Mission Specialist Steven L. Smith. The tracked vehicle could be used by the crew in the event of an emergency at the pad during which the crew must make a quick exit from the area. The TCDT also provides simulated countdown exercises and opportunities to inspect the mission payloads in the orbiter's payload bay. STS-103 is a 'call-up' mission due to the need to replace and repair portions of the Hubble Space Telescope. Although Hubble is operating normally and conducting its scientific observations, only three of its six gyroscopes are working properly. Four EVA's are planned to make the necessary repairs and replacements on the telescope. The other STS-103 crew members are Commander Curtis L. Brown Jr. and Mission Specialists C. Michael Foale (Ph.D.), John M. Grunsfeld (Ph.D.), and Claude Nicollier of Switzerland, who also is with the European Space Agency. The mission is targeted for launch Dec. 6 at 2:37 a.m. EST.
Generation of SCALE 6 Input Data File for Cross Section Library of PWR Spent Fuel
International Nuclear Information System (INIS)
Jeong, Chang Joon; Cho, Dong Keun
2010-11-01
In order to obtain the cross section libraries of the Korean Pressurized water reactor (PWR) spent fuel (SF), SCALE 6 code input files have been generated. The PWR fuel data were obtained from the nuclear design report (NDR) of the current operating PWRs. The input file were prepared for 16 fuel types such as 4 types of Westinghouse 14x14, 3 types of OPR-1000 16x16, 4 types of Westinghouse 16x16, and 6 types of Westinghouse 17x17. For each fuel type, 5 kinds of fuel enrichments have been considered such as 1.5, 2.0 ,3.0, 4.0 and 5.0 wt%. In the SCALE 6 calculation, a ENDF-V 44 group was used. The 25 burnup step until 72000 MWD/T was used. A 1/4 symmetry model was used for 16x16 and 17x17 fuel assembly, and 1/2 symmetry model was used for 14x14 fuel assembly The generated cross section libraries will be used for the source-term analysis of the PWR SF
Revocable ID-Based Signature with Short Size over Lattices
Directory of Open Access Journals (Sweden)
Ying-Hao Hung
2017-01-01
Full Text Available In the past, many ID-based signature (IBS schemes based on the integer factorization or discrete logarithm problems were proposed. With the progress on the development of quantum technology, IBS schemes mentioned above would become vulnerable. Recently, several IBS schemes over lattices were proposed to be secure against attacks in the quantum era. As conventional public-key settings, ID-based public-key settings have to offer a revocation mechanism to revoke misbehaving or malicious users. However, in the past, little work focuses on the revocation problem in the IBS schemes over lattices. In this article, we propose a new revocable IBS (RIBS scheme with short size over lattices. Based on the short integer solution (SIS assumption, we prove that the proposed RIBS scheme provides existential unforgeability against adaptive chosen-message attacks. As compared to the existing IBS schemes over lattices, our RIBS scheme has better performance in terms of signature size, signing key size, and the revocation mechanism with public channels.
2013-05-23
qualitatively and quantitatively comparable to the other five billion inhabitants on the planet . He argued most of 26Ibid. 27Hillary R...www.reuters.com/article/2012/05/17/mali-gold-idUSL5E8GHH1X20120517 (accessed April 4, 2013); Human Rights Watch, A Poisonous Mix: Child Labor, Mercury ...Poisonous Mix: Child Labor, Mercury , and Artisanal Gold Mining in Mali. Washington, DC: Human Rights Watch, 2011. http://www.hrw.org/sites/default/files
VizieR Online Data Catalog: RV and [Fe/H] in 5 open clusters (Carrera+, 2015)
Carrera, R.; Casamiquela, L.; Ospina, N.; Balaguer-Nunez, L.; Jordi, C.; Monteagudo, L.
2015-05-01
Medium-resolution spectra in the region of the near-infrared CaII triplet (CaT) at ~8500Å were obtained using the Intermediate Dispersion Spectrograph (IDS) mounted at the Cassegrain focus of the 2.5m Isaac Newton Telescope (INT) located at Roque de los Muchachos Observatory, Spain. Berkeley 23 was observed in service mode on 2013 January 17 and 18, and the other clusters were observed on 2014 July 18 and 19. (1 data file).
17 CFR 249.331 - Form N-CSR, certified shareholder report.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-CSR, certified... Required Under Sections 13 and 15(d) of the Securities Exchange Act of 1934 § 249.331 Form N-CSR, certified shareholder report. This form shall be used by registered management investment companies to file reports...
17 CFR 229.1012 - (Item 1012) The solicitation or recommendation.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1012) The solicitation or recommendation. 229.1012 Section 229.1012 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY AND CONSERVATION...
2010-04-01
... filing with respect to proposed rule changes by all self-regulatory organizations. 249.819 Section 249..., SECURITIES EXCHANGE ACT OF 1934 Forms for Self-Regulatory Organization Rule Changes and Forms for....819 Form 19b-4, for electronic filing with respect to proposed rule changes by all self-regulatory...
Assessment of the relationship between ACE I/D gene polymorphism and renal allograft survival.
Yang, Chun-Hua; Lu, Yi; Chen, Xue-Xia; Xian, Wen-Feng; Tu, Wei-Feng; Li, Hong-Yan
2015-12-01
The relationship between the angiotensin-converting enzyme (ACE) insertion/deletion (I/D) gene polymorphism and renal allograft survival after renal transplantation from the published reports are still debatable. This study was performed to evaluate the relationship between the ACE I/D gene polymorphism and renal allograft survival after renal transplantation using meta-analysis. Eligible studies were identified from PubMed and Cochrane Library on 1 November 2014, and eligible studies were recruited and synthesized using a meta-analysis methodology. Twelve investigations were included in this meta-analysis for the assessment of the relationship between the ACE I/D gene polymorphism and renal allograft survival. In this meta-analysis, the ACE I/D gene polymorphism was not associated with renal allograft survival after renal transplantation for overall populations, Caucasians, Brazilians and Africans. Interestingly, the ACE D allele and DD genotype were associated with renal allograft survival after renal transplantation in the Asian population. ACE D allele and DD genotype were associated with renal allograft survival after renal transplantation in the Asian population. However, more studies should be performed to confirm this association. © The Author(s) 2015.
Identification of clinical yeasts by Vitek MS system compared with API ID 32 C.
Durán-Valle, M Teresa; Sanz-Rodríguez, Nuria; Muñoz-Paraíso, Carmen; Almagro-Moltó, María; Gómez-Garcés, José Luis
2014-05-01
We performed a clinical evaluation of the Vitek MS matrix-assisted laser desorption ionization-time-of-flight mass spectrometry (MALDI-TOF MS) system with the commercial database version 2.0 for rapid identification of medically important yeasts as compared with the conventional phenotypic method API ID 32 C. We tested 161 clinical isolates, nine isolates from culture collections and five reference strains. In case of discrepant results or no identification with one or both methods, molecular identification techniques were employed. Concordance between both methods was observed with 160/175 isolates (91.42%) and misidentifications by both systems occurred only when taxa were not included in the respective databases, i.e., one isolate of Candida etchellsii was identified as C. globosa by Vitek MS and two isolates of C. orthopsilosis were identified as C. parapsilosis by API ID 32 C. Vitek MS could not identify nine strains (5.14%) and API ID 32 C did not identify 13 (7.42%). Vitek MS was more reliable than API ID 32 C and reduced the time required for the identification of clinical isolates to only a few minutes.
DEFF Research Database (Denmark)
Gibbs-Seymour, Ian; Oka, Yasuyoshi; Rajendra, Eeson
2015-01-01
We show that central components of the Fanconi anemia (FA) DNA repair pathway, the tumor suppressor proteins FANCI and FANCD2 (the ID complex), are SUMOylated in response to replication fork stalling. The ID complex is SUMOylated in a manner that depends on the ATR kinase, the FA ubiquitin ligase...
A new Master Events Controller is prepared for installation in STS-99 Endeavour
2000-01-01
A new Enhanced Main Events Controller (E-MEC) for Shuttle Endeavour sits on a table in a Quality trailer in the Launch Pad 39B area. The original E-MEC in Endeavour became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. The E-MECs are located in the orbiter's aft compartment and both are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. Before workers can begin E-MEC replacement efforts at the launch pad, cryogenic reactants must be offloaded from the orbiter and Space Shuttle ordnance disconnected. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.
Cut-and-Paste file-systems: integrating simulators and file systems
Bosch, H.G.P.; Mullender, Sape J.
1995-01-01
We have implemented an integrated and configurable file system called the Pegasus filesystem (PFS) and a trace-driven file-system simulator called Patsy. Patsy is used for off-line analysis of file-systemalgorithms, PFS is used for on-line file-systemdata storage. Algorithms are first analyzed in
Pedro Duque arrives at KSC for the STS-95 launch
1998-01-01
STS-95 Mission Specialist Pedro Duque, with the European Space Agency (ESA), arrives at Kennedy Space Center's Shuttle Landing Facility aboard a T-38 jet as part of final preparations for launch. The STS-95 mission, targeted for liftoff at 2 p.m. on Oct. 29, includes research payloads such as the Spartan solar- observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. The mission is expected to last 8 days, 21 hours and 49 minutes, and return to KSC on Nov. 7. The other STS-95 crew members are Mission Commander Curtis L. Brown Jr., Pilot Steven W. Lindsey, Mission Specialist Scott E. Parazynski, Mission Specialist Stephen K. Robinson, Payload Specialist John H. Glenn Jr., senator from Ohio, and Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA).
STS-26 MS Lounge in fixed based (FB) shuttle mission simulator (SMS)
1988-01-01
STS-26 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) John M. Lounge, wearing comunications kit assembly headset and crouched on the aft flight deck, performs checklist inspection during training session. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.
Pandith, Arshad A; Qasim, Iqbal; Zahoor, Wani; Shah, Parveen; Bhat, Abdul R
2018-01-10
ACE I/D and MTHFR C677T gene polymorphisms can be seen as candidate genes for glioma on the basis of their biological functions and their involvement in different cancers. The aim of this study was to analyze potential association and overall survival between MTHFR C677T and ACE I/D polymorphism in glioma patients in our population. We tested genotype distribution of 112 glioma patients against 141 cancer-free controls from the same region. Kaplan-Meier survival analysis was performed to evaluate overall survival of patients for both genes. No significant differences were found among MTHFR C677T wild type C and variant genotypes CT/TT with glioma patients. In ACE, the distribution of variant ID and DD was found to be significantly higher in glioma cases as compared to controls (pACE DD genotypes were highly presented in glioma cases 26.8% versus 10.6% in controls (pACE DD genotypes had the least estimated overall survival of 13.4months in comparison to 21. 7 and 17.6months for ACE II and I/D genotypes respectively. We conclude ACE I/D polymorphism plays a vital role in predisposition of higher risk for glioma. We also suggest that ACE DD genotypes may act as an important predictive biomarker for overall survival of glioma patients. Copyright © 2017. Published by Elsevier B.V.
Wiring Damage Analyses for STS OV-103
Thomas, Walter, III
2006-01-01
This study investigated the Shuttle Program s belief that Space Transportation System (STS) wiring damage occurrences are random, that is, a constant occurrence rate. Using Problem Reporting and Corrective Action (PRACA)-derived data for STS Space Shuttle OV-103, wiring damage was observed to increase over the vehicle s life. Causal factors could include wiring physical deterioration, maintenance and inspection induced damage, and inspection process changes resulting in more damage events being reported. Induced damage effects cannot be resolved with existent data. Growth analysis (using Crow-AMSAA, or CA) resolved maintenance/inspection effects (e.g., heightened awareness) on all wire damages and indicated an overall increase since Challenger Return-to-Flight (RTF). An increasing failure or occurrence rate per flight cycle was seen for each wire damage mode; these (individual) rates were not affected by inspection process effects, within statistical error.
1993-01-01
Greg Vogt, NASA Headquarters Education Specialist, and Carolyn Sumners, Houston Museum of Natural Science, give an overview of the spaceborne experiments that will take place on the STS-54 Endeavour mission. Mr. Vogt discusses the objectives and procedures of the experiments, which are structured around using toys to show the effects of microgravity. Mr. Vogt and Ms. Sumners then answer questions from the press.
Engaging boundary objects in OMS and STS? Exploring the subtleties of layered engagement
Zeiss, R.; Groenewegen, P.
2009-01-01
This paper considers STS aspirations to engage with the field of Organization and Management Studies (OMS). It does so by investigating the employability of the concept of boundary object in OMS. Through an extensive literature review, the paper shows that rather than a simple engagement between STS
The Danish eID Case: Twenty years of Delay
DEFF Research Database (Denmark)
Hoff, Jens Villiam; Hoff, Frederik Villiam
2010-01-01
the technological, organizational and legal dimensions of eID in Denmark, and comparing these with a number of other European countries made it possible to explain this paradox. Thus, the three main reasons for the special route development has taken in Denmark seems to be concerns over privacy, lack...
STS-86 crew addresses the press during TCDT activities at LC 39A
1997-01-01
STS-86 Commander James D. Wetherbee, with microphone, and other crew members of the Space Shuttle Atlantis speak to media representatives and other onlookers at Launch Pad 39A during the Terminal Countdown Demonstration Test (TCDT), a dress rehearsal for launch From right, after Wetherbee, are Pilot Michael J. Bloomfield, Mission Specialist Vladimir Georgievich Titov of the Russian Space Agency, Mission Specialist Scott E. Parazynski, Mission Specialist Jean-Loup J.M. Chretien of the French Space Agency, CNES, and Mission Specialists Wendy B. Lawrence and David A. Wolf. STS-86 will be the seventh docking of the Space Shuttle with the Russian Space Station Mir. During the docking, Wolf will transfer to the orbiting Russian station and become a member of the Mir 24 crew, replacing U.S. astronaut C. Michael Foale, who has been on the Mir since the last docking mission, STS-84, in May. Launch of Mission STS-86 aboard the Space Shuttle Atlantis is targeted for Sept. 25.