FDIC Institution Directory (ID) -- Insured Insitution Download File
Federal Deposit Insurance Corporation — The FDIC's Institution Directory (ID) download file provides a list of all FDIC-insured institutions. The file includes demographic information related to the...
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Definitions. 161.153 Section 161.153 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS DATA REQUIREMENTS..., destroy, repel or mitigate any pest, or that functions as a plant regulator, desiccant, or defoliant...
40 CFR 161.340 - Toxicology data requirements.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Toxicology data requirements. 161.340... Toxicology data requirements. (a) Table. Sections 161.100 through 161.102 describe how to use this table to determine the toxicology data requirements and the substance to be tested. Kind of data required (b) Notes...
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Minor uses. 161.60 Section 161.60 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS DATA REQUIREMENTS... until it is applied to the major use registrations. (3) EPA will accept extrapolations and regional data...
40 CFR 161.490 - Wildlife and aquatic organisms data requirements.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Wildlife and aquatic organisms data... § 161.490 Wildlife and aquatic organisms data requirements. (a) Table. Sections 161.100 through 161.102 describe how to use this table to determine the wildlife and aquatic organisms data requirements and the...
40 CFR 161.35 - Flexibility of the data requirements.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Flexibility of the data requirements. 161.35 Section 161.35 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE... periodically to reflect new scientific knowledge, new trends in pesticide development, and new Agency policies...
10 CFR 2.302 - Filing of documents.
2010-01-01
... this part shall be electronically transmitted through the E-Filing system, unless the Commission or... all methods of filing have been completed. (e) For filings by electronic transmission, the filer must... digital ID certificates, the NRC permits participants in the proceeding to access the E-Filing system to...
Directory of Open Access Journals (Sweden)
Hendro Agus Prakoso
2016-09-01
berita kedua media tersebut. Frekuensi berita berjumlah 107 di Republika.co.id dan 51 berita di Tempo.co.id Ragam berita Republika.co.id didominasi konsep Spesialisasi sebesar 22,4% dari 107 berita, sedangkan pada Tempo.co.id didominasi konsep Nama baik sebesar 23,5% dari 51 berita. Sumber berita pada Republika.co.id mayoritas berasal dari Liputan langsung sebesar 42,9% dari 107 berita sedangkan pada Tempo.co.id mayoritas berasal dari Intelektual sebesar 54,9% dari 51 berita.
Causes of Mortality in Older People with Intellectual Disability: Results from the HA-ID Study
Oppewal, Alyt; Schoufour, Josje D.; van der Maarl, Hanne J. K.; Evenhuis, Heleen M.; Hilgenkamp, Thessa I. M.; Festen, Dederieke A.
2018-01-01
We aim to provide insight into the cause-specific mortality of older adults with intellectual disability (ID), with and without Down syndrome (DS), and compare this to the general population. Immediate and primary cause of death were collected through medical files of 1,050 older adults with ID, 5 years after the start of the Healthy Ageing and…
Development of data file system for cardiovascular nuclear medicine
International Nuclear Information System (INIS)
Hayashida, Kohei; Nishimura, Tsunehiko; Uehara, Toshiisa; Nisawa, Yoshifumi.
1985-01-01
A computer-assisted filing system for storing and processing data from cardiac pool scintigraphy and myocardial scintigraphy has been developed. Individual patient data are stored with his (her) identification number (ID) into floppy discs successively in order of receiving scintigraphy. Data for 900 patients can be stored per floppy disc. Scintigraphic findings can be outputted in a uniform file format, and can be used as a reporting format. Output or retrieval of filed individual patient data is possible according to each examination, disease code or ID. This system seems to be used for prospective study in patients with cardiovascular diseases. (Namekawa, K.)
STS-26 Commander Hauck in fixed based (FB) shuttle mission simulator (SMS)
1988-01-01
STS-26 Discovery, Orbiter Vehicle (OV) 103, Commander Frederick H. Hauck, wearing comunications kit assembly headset and seated in the commanders seat on forward flight deck, looks over his shoulder toward the aft flight deck. A flight data file (FDF) notebook rests on his lap. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.
Identification of clinical yeasts by Vitek MS system compared with API ID 32 C.
Durán-Valle, M Teresa; Sanz-Rodríguez, Nuria; Muñoz-Paraíso, Carmen; Almagro-Moltó, María; Gómez-Garcés, José Luis
2014-05-01
We performed a clinical evaluation of the Vitek MS matrix-assisted laser desorption ionization-time-of-flight mass spectrometry (MALDI-TOF MS) system with the commercial database version 2.0 for rapid identification of medically important yeasts as compared with the conventional phenotypic method API ID 32 C. We tested 161 clinical isolates, nine isolates from culture collections and five reference strains. In case of discrepant results or no identification with one or both methods, molecular identification techniques were employed. Concordance between both methods was observed with 160/175 isolates (91.42%) and misidentifications by both systems occurred only when taxa were not included in the respective databases, i.e., one isolate of Candida etchellsii was identified as C. globosa by Vitek MS and two isolates of C. orthopsilosis were identified as C. parapsilosis by API ID 32 C. Vitek MS could not identify nine strains (5.14%) and API ID 32 C did not identify 13 (7.42%). Vitek MS was more reliable than API ID 32 C and reduced the time required for the identification of clinical isolates to only a few minutes.
Applying Open Researchers and Contributors ID in scholarly journals
Directory of Open Access Journals (Sweden)
Jeonghee Im
2015-02-01
Full Text Available Open Researchers and Contributors ID (ORCID launched its registry services in October 2012. Consequently, adding personal information to the ORCID registry became routine work for researchers. To add ORCID to an online article, the tag needs to be included in the Journal Article Tag Suite extensible markup language file, if such a file has been produced by the publisher. Subsequently, all co-authors’ ORCID can be easily and conveniently collected and then integrated into the manuscript management system. In the current age of information and the Internet, journals need to keep pace with the surge of new standards and technologies. Editors should be able to accept and apply these new systems rapidly.
77 FR 26538 - Vigue, Peter A.; Notice of Filing
2012-05-04
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6627-001] Vigue, Peter A.; Notice of Filing Take notice that on April 26, 2012, Peter A. Vigue submitted for filing, a supplement to the application for authority to hold interlocking positions filed on March 6, 2012, pursuant to...
76 FR 63291 - Combined Notice Of Filings #1
2011-10-12
... filing per 35: MBR Tariff to be effective 9/23/2011. Filed Date: 09/23/2011. Accession Number: 20110923.... submits tariff filing per 35: MBR Tariff to be effective 9/23/2011. Filed Date: 09/23/2011. Accession.... submits tariff filing per 35: MBR Tariff to be effective 9/23/2011. Filed Date: 09/23/2011. Accession...
International Nuclear Information System (INIS)
Sharma, Pankaj; Patel, Divya; Chaudhary, Jaideep
2012-01-01
As transcriptional regulators of basic helix–oop–helix (bHLH) transcription and non-bHLH factors, the inhibitor of differentiation (Id1, Id2, Id3, and Id4) proteins play a critical role in coordinated regulation of cell growth, differentiation, tumorigenesis, and angiogenesis. Id1 regulates prostate cancer (PCa) cell proliferation, apoptosis, and androgen independence, but its clinical significance in PCa remains controversial. Moreover, there is lack of evidence on the expression of Id2 and Id3 in PCa progression. In this study we investigated the expression of Id2 and Id3 and reevaluated the expression of Id1 in PCa. We show that increased Id1 and Id3 protein expression is strongly associated with increasing grade of PCa. At the molecular level, we report that silencing either Id1 or Id3 attenuates cell cycle. Although structurally and mechanistically similar, our results show that both these proteins are noncompensatory at least in PCa progression. Moreover, through gene silencing approaches we show that Id1 and Id3 primarily attenuates CDKN1A (p21) and CDKN1B (p27), respectively. We also demonstrate that silencing Id3 alone significantly attenuates proliferation of PCa cells as compared with Id1. We propose that increased Id1 and Id3 expression attenuates all three cyclin-dependent kinase inhibitors (CDKN2B, -1A, and -1B) resulting in a more aggressive PCa phenotype
Moreaux, G.; Lemoine, F. G.; Argus, D. F.; Santamaria-Gomez, A.; Willis, P.; Soudarin, L.; Gravelle, M.; Ferrage, P.
2016-01-01
In the context of the 2014 realization of the International Terrestrial Reference Frame (ITRF2014), the International DORIS Service (IDS) has delivered to the IERS a set of 1140 weekly SINEX files including station coordinates and Earth orientation parameters, covering the time period from 1993.0 to 2015.0. From this set of weekly SINEX files, the IDS Combination Center estimated a cumulative DORIS position and velocity solution to obtain mean horizontal and vertical motion of 160 stations at 71 DORIS sites. The main objective of this study is to validate the velocities of the DORIS sites by comparison with external models or time series. Horizontal velocities are compared with two recent global plate models (GEODVEL 2010 and NNR-MORVEL56). Prior to the comparisons, DORIS horizontal velocities were corrected for Global Isostatic Adjustment (GIA) from the ICE-6G (VM5a) model. For more than half of the sites, the DORIS horizontal velocities differ from the global plate models by less than 2-3 mm/yr. For five of the sites (Arequipa, Dionysos/Gavdos, Manila, Santiago) with horizontal velocity differences wrt these models larger than 10 mm/yr, comparisons with GNSS estimates show the veracity of the DORIS motions. Vertical motions from the DORIS cumulative solution are compared with the vertical velocities derived from the latest GPS cumulative solution over the time span 1995.0-2014.0 from the University of La Rochelle (ULR6) solution at 31 co-located DORIS-GPS sites. These two sets of vertical velocities show a correlation coefficient of 0.83. Vertical differences are larger than 2 mm/yr at 23 percent of the sites. At Thule the disagreement is explained by fine-tuned DORIS discontinuities in line with the mass variations of outlet glaciers. Furthermore, the time evolution of the vertical time series from the DORIS station in Thule show similar trends to the GRACE equivalent water height.
Moreaux, G.; Lemoine, F. G.; Argus, D. F.; Santamaría-Gómez, A.; Willis, P.; Soudarin, L.; Gravelle, M.; Ferrage, P.
2016-10-01
In the context of the 2014 realization of the International Terrestrial Reference Frame, the International DORIS (Doppler Orbitography Radiopositioning Integrated by Satellite) Service (IDS) has delivered to the IERS a set of 1140 weekly SINEX files including station coordinates and Earth orientation parameters, covering the time period from 1993.0 to 2015.0. From this set of weekly SINEX files, the IDS combination centre estimated a cumulative DORIS position and velocity solution to obtain mean horizontal and vertical motion of 160 stations at 71 DORIS sites. The main objective of this study is to validate the velocities of the DORIS sites by comparison with external models or time-series. Horizontal velocities are compared with two recent global plate models (GEODVEL 2010 and NNR-MORVEL56). Prior to the comparisons, DORIS horizontal velocities were corrected for Global Isostatic Adjustment from the ICE-6G (VM5a) model. For more than half of the sites, the DORIS horizontal velocities differ from the global plate models by less than 2-3 mm yr-1. For five of the sites (Arequipa, Dionysos/Gavdos, Manila and Santiago) with horizontal velocity differences with respect to these models larger than 10 mm yr-1, comparisons with GNSS estimates show the veracity of the DORIS motions. Vertical motions from the DORIS cumulative solution are compared with the vertical velocities derived from the latest GPS cumulative solution over the time span 1995.0-2014.0 from the University of La Rochelle solution at 31 co-located DORIS-GPS sites. These two sets of vertical velocities show a correlation coefficient of 0.83. Vertical differences are larger than 2 mm yr-1 at 23 percent of the sites. At Thule, the disagreement is explained by fine-tuned DORIS discontinuities in line with the mass variations of outlet glaciers. Furthermore, the time evolution of the vertical time-series from the DORIS station in Thule show similar trends to the GRACE equivalent water height.
75 FR 4061 - Favinger, Thomas; Notice of Filing
2010-01-26
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6223-000] Favinger, Thomas; Notice of Filing January 19, 2010. Take notice that on January 15, 2010, Mr. Thomas G. Favinger filed an application for authority to hold interlocking positions, pursuant to section 305(b) of the...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 35647 was deployed in the region of American Samoa to assess ocean currents and sea surface temperature. SVP drifter data files contain...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 35649 was deployed in the region of American Samoa to assess ocean currents and sea surface temperature. SVP drifter data files contain...
CRED APEX Drifting Buoy Argos_ID 26070 Data in the NW Hawaiian Islands, the Pacific Ocean
National Oceanic and Atmospheric Administration, Department of Commerce — CRED APEX drifter Argos_ID 26070 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. APEX drifter data files...
75 FR 68350 - Fischer, Thomas J.; Notice of Filing
2010-11-05
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6422-000] Fischer, Thomas J.; Notice of Filing October 29, 2010. Take notice that on October 29, 2010, Thomas J. Fischer filed an Application for Authorization to Hold Interlocking Positions as Director of Wisconsin Electric...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI
STS-69 Flight Day 9 Video File
1995-01-01
The song, 'He's A Tramp', from the Walt Disney cartoon movie, 'Lady and the Tramp', awakened the astronauts, Cmdr. Dave Walker, Pilot Ken Cockrell, and Mission Specialists Jim Voss, Jim Newman, and Mike Gernhardt, on the ninth day of the STS-69 mission. The Wake Shield Facility (WSF) was again unberthed from the shuttle cargo bay and , using the shuttle's robot arm, held over the side of the shuttle for five hours where it collected data on the electrical field build-up around the spacecraft as part of the Charging Hazards and Wake Studies Experiment (CHAWS). Voss and Gernhardt rehearsed their Extravehicular Activity (EVA) spacewalk, which was planned for the next day. Earth views included cloud cover, a hurricane, and its eye.
EuroSCORE II and STS as mortality predictors in patients undergoing TAVI
Directory of Open Access Journals (Sweden)
Vitor Emer Egypto Rosa
2016-02-01
Full Text Available SUMMARY Introduction: the EuroSCORE II and STS are the most used scores for surgical risk stratification and indication of transcatheter aortic valve implantation (TAVI. However, its role as a tool for mortality prediction in patients undergoing TAVI is still unclear. Objective: to evaluate the performance of the EuroSCORE II and STS as predictors of in-hospital and 30-day mortality in patients undergoing TAVI. Methods: we included 59 symptomatic patients with severe aortic stenosis that underwent TAVI between 2010 and 2014. The variables were analyzed using Student's t-test and Fisher's exact test and the discriminative power was evaluated using receiver operating characteristic curve (ROC and area under the curve (AUC with a 95% confidence interval. Results: mean age was 81±7.3 years, 42.3% men. The mean EuroSCORE II was 7.6±7.3 % and STS was 20.7±10.3%. Transfemoral procedure was performed in 88.13%, transapical in 3.38% and transaortic in 8.47%. In-hospital mortality was 10.1% and 30-day mortality was 13.5%. Patients who died had EuroSCORE II and STS higher than the survivors (33.7±16.7vs. 18.6±7.3% p=0,0001 for STS and 13.9±16.1 vs. 4.8±3.8% p=0.0007 for EuroSCORE II. The STS showed an AUC of 0.81 and the EuroSCORE II of 0.77 and there were no differences in the discrimination ability using ROC curves (p=0.72. Conclusion: in this cohort, the STS and EuroSCORE II were predictors of in-hospital and 30-days mortality in patients with severe aortic stenosis undergoing TAVI.
75 FR 10244 - Ellsworth, David C.; Notice of Filing
2010-03-05
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-3716-001] Ellsworth, David C.; Notice of Filing February 25, 2010. Take notice that on February 12, 2010, David C. Ellsworth filed an informational report for authority to hold interlocking positions, pursuant to section 45.9 of...
76 FR 9012 - Favinger, Thomas G.; Notice of Filing
2011-02-16
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6223-002] Favinger, Thomas G.; Notice of Filing Take notice that on January 31, 2011 Thomas G. Favinger submitted for filing, an application for authority to hold interlocking positions, pursuant to Section 305(b) of the...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 35651 was deployed in the region of American Samoa to assess ocean currents and sea surface temperature. SVP drifter data files contain...
Now called RSA SecurID, SecurID is a mechanism developed by Security Dynamics that allows two-factor authentication for a user on a network resource. It works on the principle of the unique password mode, based on a shared secret. Every sixty seconds, the component generates a new six-digit token on the screen. The latter comes from the current time (internal clock) and the seed (SecurID private key that is available on the component, and is also from the SecurID server). During an authentication request, the SecurID server will check the entered token by performing exactly the same calculation as that performed by your component. The server knows the two information required for this calculation: the current time and the seed of your component. Access is allowed if the token calculated by the server matches the token you specified.
7 CFR 1427.161 - Administration.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1427.161 Section 1427.161 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS COTTON Recourse Seed Cotton Loans § 1427.161 Administration...
77 FR 21555 - Manning, Richard W.; Notice of Filing
2012-04-10
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6835-001] Manning, Richard W.; Notice of Filing Take notice that on April 2, 2012, Richard W. Manning submitted for filing... not serve to make protestants parties to the proceeding. Any person wishing to become a party must...
76 FR 21889 - Lasky, Charles D.; Notice of Filing
2011-04-19
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-4962-007] Lasky, Charles D.; Notice of Filing Take notice that on April 12, 2011, Charles D. Lasky submitted for filing an... the Commission's Rules of Practice and Procedure (18 CFR 385.211, 385.214). Protests will be...
Evaluation of sodium-23 neutron capture cross section data for the ENDF/B V-III file
International Nuclear Information System (INIS)
Paik, N.C.; Pitterle, T.A.
1975-01-01
The evaluation of neutron cross sections of 23 Na, material number 1156, for the ENDF/B File is described. Cross sections were evaluated between 10 -5 eV and 15 MeV. Experimental data available up to March 1971 were included in the evaluation
77 FR 14773 - Vigue, Peter A.; Notice of Filing
2012-03-13
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6627-001] Vigue, Peter A.; Notice of Filing Take notice that on March 6, 2012, Peter A. Vigue submitted for filing, an application for authority to hold interlocking positions, pursuant to section 305(b) of the Federal Power Act, 16...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 28638 was deployed in the region of Marianas Archipelago to assess ocean currents and sea surface temperature. SVP drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 29099 was deployed in the region of Marianas Archipelago to assess ocean currents and sea surface temperature. SVP drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED APEX drifter Argos_ID 25321 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. APEX drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 30291 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED APEX drifter Argos_ID 24963 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. APEX drifter data files...
76 FR 19350 - Truax, Hal D.; Notice of Filing
2011-04-07
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6528-000] Truax, Hal D.; Notice of Filing Take notice that on April 1, 2011, Hal D. Truax submitted for filing, an application for authority to hold interlocking positions, pursuant to section 305(b) of the Federal Power Act, 16 U.S.C...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC161 (Link to dictyBase) - - - Contig-U15456-1 VFC161P (Link... to Original site) VFC161F 564 VFC161Z 562 VFC161P 1126 - - Show VFC161 Library VF (Link to library) Clone ID VFC161 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...Value N Y16962 |Y16962.1 Dictyostelium discoideum mRNA for cathepsin D. 1025 0.0 5 AJ243946 |AJ243946.1 Dict...plasma membrane 4.0 %: vesicles of secretory system >> prediction for VFC161 is nuc 5' end seq. ID VFC161F 5
1996-01-01
The STS-84 emblem depicts the Space Shuttle Atlantis launching into Earth orbit to join the Russian Space Station Mir as part of Phase One of the International Space Station program. The names of the eight astronauts who flew onboard Atlantis, including the two who changed their positions onboard Mir for a long duration flight, are shown along the border of the patch. The STS-84/Mir-23 team will transfer 7,000 pounds of experiments, Station hardware, food and clothing to and from Mir during the five-day period of docking. The Phase One program is represented by the rising Sun and by the Greek letter Phi followed by one star. This sixth Shuttle-Mir docking mission is symbolized by the six stars surrounding the word Mir in Cyrillic characters. Combined, the seven stars symbolize the current configuration of Mir, composed of six modules launched by the Russians and one module brought up by Atlantis on a previous docking flight.
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 29103 was deployed in the region of Marianas Archipelago to assess ocean currents and sea surface temperature. SVP drifter data files...
Fiocco, Ugo; Stramare, Roberto; Martini, Veronica; Coran, Alessandro; Caso, Francesco; Costa, Luisa; Felicetti, Mara; Rizzo, Gaia; Tonietto, Matteo; Scanu, Anna; Oliviero, Francesca; Raffeiner, Bernd; Vezzù, Maristella; Lunardi, Francesca; Scarpa, Raffaele; Sacerdoti, David; Rubaltelli, Leopoldo; Punzi, Leonardo; Doria, Andrea; Grisan, Enrico
2017-02-01
To develop quantitative imaging biomarkers of synovial tissue perfusion by pixel-based contrast-enhanced ultrasound (CEUS), we studied the relationship between CEUS synovial vascular perfusion and the frequencies of pathogenic T helper (Th)-17 cells in psoriatic arthritis (PsA) joints. Eight consecutive patients with PsA were enrolled in this study. Gray scale CEUS evaluation was performed on the same joint immediately after joint aspiration, by automatic assessment perfusion data, using a new quantification approach of pixel-based analysis and the gamma-variate model. The set of perfusional parameters considered by the time intensity curve includes the maximum value (peak) of the signal intensity curve, the blood volume index or area under the curve, (BVI, AUC) and the contrast mean transit time (MTT). The direct ex vivo analysis of the frequencies of SF IL17A-F + CD161 + IL23 + CD4 + T cells subsets were quantified by fluorescence-activated cell sorter (FACS). In cross-sectional analyses, when tested for multiple comparison setting, a false discovery rate at 10%, a common pattern of correlations between CEUS Peak, AUC (BVI) and MTT parameters with the IL17A-F + IL23 + - IL17A-F + CD161 + - and IL17A-F + CD161 + IL23 + CD4 + T cells subsets, as well as lack of correlation between both peak and AUC values and both CD4 + T and CD4 + IL23 + T cells, was observed. The pixel-based CEUS assessment is a truly measure synovial inflammation, as a useful tool to develop quantitative imaging biomarker for monitoring target therapeutics in PsA.
ID Barrel installed in cryostat
Apsimon, R.; Romaniouk, A.
Wednesday 23rd August was a memorable day for the Inner Detector community as they witnessed the transport and installation of the central part of the inner detector (ID-barrel) into the ATLAS detector. Many members of the collaboration gathered to witness this moment at Point 1. After years of design, construction and commissioning, the outer two detectors (TRT and SCT) of the ID barrel were moved from the SR1 cleanroom to the ATLAS cavern. The barrel was moved across the car park from building 2175 to SX1. Although only a journey of about 100 metres, this required weeks of planning and some degree of luck as far as the weather was concerned. Accelerometers were fitted to the barrel to provide real-time monitoring and no values greater than 0.1 g were recorded, fully satisfying the transport specification for this extremely precise and fragile detector. Muriel, despite her fear of heights, bravely volunteered to keep a close eye on the detector. Swapping cranes to cross the entire parking lot, while Mur...
76 FR 73610 - Combined Notice of Filings #1
2011-11-29
... that the Commission received the following electric corporate filings: Docket Numbers: EC12-33-000... electric rate filings: Docket Numbers: ER11-3876-003; ER11-2044-004; ER10-2611-002. Applicants: MidAmerican.... Docket Numbers: ER12-431-000. Applicants: NedPower Mount Storm, LLC. Description: Compliance Filing...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 44770 was deployed in the region of American Samoa to assess ocean currents and sea surface temperature. SVP drifter data files contain...
76 FR 76710 - Merritt, Beck C.; Notice of Filing
2011-12-08
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6730-000] Merritt, Beck C.; Notice of Filing Take notice that on December 1, 2011, Beck C. Merritt submitted for filing, an..., 16 U.S.C. 825d (b) and Part 45 of Title 18 of the Code of Federal Regulations, 18 CFR part 45. Any...
78 FR 12307 - Taylor, G. Tom; Notice of Filing
2013-02-22
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-5705-001] Taylor, G. Tom; Notice of Filing Take notice that on February 14, 2013, G. Tom Taylor filed an application to hold interlocking positions pursuant to section 305(b) of the Federal Power Act, 16 U.S.C. 825d(b), Part 45 of the...
Alía, P; Mañá, J; Capdevila, O; Alvarez, A; Navarro, M A
2005-01-01
Serum angiotensin converting enzyme (SACE) concentration is considered a marker of sarcoidosis activity. This concentration is influenced by an insertion/deletion (I/D) polymorphism of the ACE gene, such that SACE levels follow the pattern DD>ID>II. The aim of our work was to study the relationship between I/D polymorphism and susceptibility to sarcoidosis, as well as the relation between this polymorphism and the clinical presentation and evolution of the disease in 177 sarcoidosis patients. A group of 104 individuals without sarcoidosis was included as control. Genotyping was done by a polymerase chain reaction (PCR) method, and SACE concentration at diagnosis was determined by a kinetic method. No differences were observed in genotype or allele distributions between patients and controls, nor between patients considering the type of presentation (Löfgren versus non-Löfgren) and evolution of the disease (acute versus chronic). As reported for healthy populations, SACE concentrations followed the pattern DD>ID>II in sarcoidosis patients, but significant differences between genotypes existed only in the Löfgren group (p = 0.003) and in acute patients (p = 0.02). SACE concentrations at diagnosis were lower in acute patients (p = 0.05) and in Löfgren's syndrome (p = 0.04), but this seemed to occur only in ID individuals (p = 0.02 and p = 0.01, respectively). No relation was thus found between I/D polymorphism and susceptibility to sarcoidosis, but ACE I/D genotyping may improve the assessment of disease activity, both at diagnosis and during the follow-up of treated and untreated patients.
Directory of Open Access Journals (Sweden)
Maho Nagasawa
2017-08-01
Full Text Available Innate lymphoid cells (ILCs have emerged as a key cell type involved in surveillance and maintenance of mucosal tissues. Mouse ILCs rely on the transcriptional regulator Inhibitor of DNA-binding protein 2 (Id2 for their development. Here, we show that Id2 also drives development of human ILC because forced expression of Id2 in human thymic progenitors blocked T cell commitment, upregulated CD161 and promyelocytic leukemia zinc finger (PLZF, and maintained CD127 expression, markers that are characteristic for human ILCs. Surprisingly CD5 was also expressed on these in vitro generated ILCs. This was not an in vitro artifact because CD5 was also found on ex vivo isolated ILCs from thymus and from umbilical cord blood. CD5 was also expressed on small proportions of ILC2 and ILC3. CD5+ ILCs were functionally immature, but could further differentiate into mature CD5− cytokine-secreting ILCs. Our data show that Id2 governs human ILC development from thymic progenitor cells toward immature CD5+ ILCs.
77 FR 59920 - Combined Notice of Filings #2
2012-10-01
... electric rate filings: Docket Numbers: ER10-2074-003; ER10-2097-005. Applicants: Kansas City Power & Light Company, KCP&L Greater Missouri Operations Company. Description: Notice of Change in Status of Kansas City... tariff filing per: OATT Attachment N Deficiency Response to be effective N/A. Filed Date: 9/21/12...
77 FR 9912 - Combined Notice of Filings #1
2012-02-21
.... Docket Numbers: ER12-75-003. Applicants: Public Power, LLC. Description: Compliance Filing for MBR Tariff... Energy MBR Tariff to be effective 2/1/2012. Filed Date: 2/10/12. Accession Number: 20120210-5132... Cancellation of MBR Tariff to be effective 2/10/2012. Filed Date: 2/10/12. Accession Number: 20120210-5153...
Interfacial scanning tunneling spectroscopy (STS) of chalcogenide/metal hybrid nanostructure
Energy Technology Data Exchange (ETDEWEB)
Saad, Mahmoud M.; Abdallah, Tamer [Physics Department, Faculty of Science, Ain Shams University, Abbassia, Cairo (Egypt); Easawi, Khalid; Negm, Sohair [Department of Physics and Mathematics, Faculty of Engineering (Shoubra), Benha University (Egypt); Talaat, Hassan, E-mail: hassantalaat@hotmail.com [Physics Department, Faculty of Science, Ain Shams University, Abbassia, Cairo (Egypt)
2015-05-15
Graphical abstract: - Highlights: • Comparing band gaps values obtained optically with STS. • Comparing direct imaging with calculated dimensions. • STS determination of the interfacial band bending of metal/chalcogenide. - Abstract: The electronic structure at the interface of chalcogenide/metal hybrid nanostructure (CdSe–Au tipped) had been studied by UHV scanning tunneling spectroscopy (STS) technique at room temperature. This nanostructure was synthesized by a phase transfer chemical method. The optical absorption of this hybrid nanostructure was recorded, and the application of the effective mass approximation (EMA) model gave dimensions that were confirmed by the direct measurements using the scanning tunneling microscopy (STM) as well as the high-resolution transmission electron microscope (HRTEM). The energy band gap obtained by STS agrees with the values obtained from the optical absorption. Moreover, the STS at the interface of CdSe–Au tipped hybrid nanostructure between CdSe of size about 4.1 ± 0.19 nm and Au tip of size about 3.5 ± 0.29 nm shows a band bending about 0.18 ± 0.03 eV in CdSe down in the direction of the interface. Such a result gives a direct observation of the electron accumulation at the interface of CdSe–Au tipped hybrid nanostructure, consistent with its energy band diagram. The presence of the electron accumulation at the interface of chalcogenides with metals has an important implication for hybrid nanoelectronic devices and the newly developed plasmon/chalcogenide photovoltaic solar energy conversion.
7 CFR 1717.161 - Application process.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Application process. 1717.161 Section 1717.161 Agriculture Regulations of the Department of Agriculture (Continued) RURAL UTILITIES SERVICE, DEPARTMENT OF... Consolidations of Electric Borrowers § 1717.161 Application process. (a) Borrowers are responsible for ensuring...
46 CFR 161.012-7 - Construction.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Construction. 161.012-7 Section 161.012-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Personal Flotation Device Lights § 161.012-7 Construction. (a...
46 CFR 161.012-9 - Performance.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 161.012-9 Section 161.012-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Personal Flotation Device Lights § 161.012-9 Performance. (a) If...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BR23 (Link to dictyBase) - - - Contig-U15008-1 FC-BR23Z (Li...nk to Original site) - - FC-BR23Z 641 - - - - Show FC-BR23 Library FC (Link to library) Clone ID FC-BR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR23Q.Seq.d/ Representative seq. ID FC-BR2...3Z (Link to Original site) Representative DNA sequence >FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR23Q.Seq....9 0.0 SLA211 (SLA211Q) /CSM/SL/SLA2-A/SLA211Q.Seq.d/ 1029 0.0 FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR2
Midro, Alina T; Zollino, Marcella; Wiland, Ewa; Panasiuk, Barbara; Iwanowski, Piotr S; Murdolo, Marina; Śmigiel, Robert; Sąsiadek, Maria; Pilch, Jacek; Kurpisz, Maciej
2016-02-01
The purpose of this study was to compare meiotic segregation in sperm cells from two carriers with t(4;8)(p16;p23.1) reciprocal chromosome translocations (RCTs), differing in localization of the breakpoint positions at the 4p subband-namely, 4p16.3 (carrier 1) and 4p16.1 (carrier 2)-and to compare data of the pedigree analyses performed by direct method. Three-color fluorescent in situ hybridization (FISH) on sperm cells and FISH mapping for the evaluation of the breakpoint positions, data from pedigrees, and direct segregation analysis of the pedigrees were performed. Similar proportions of normal/balanced and unbalanced sperm cells were found in both carriers. The most common was an alternate type of segregation (about 52 % and about 48 %, respectively). Unbalanced adjacent I and adjacent II karyotypes were found in similar proportions about 15 %. The direct segregation analysis (following Stengel-Rutkowski) of the pedigree of carriers of t(4;8)(p16.1;p23.1) was performed and results were compared with the data of the pedigree segregation analysis obtained earlier through the indirect method. The probability of live-born progeny with unbalanced karyotype for carriers of t(4;8)(p16.1;p23.1) was moderately high at 18.8 %-comparable to the value obtained using the indirect method for the same carriership, which was 12 %. This was, however, markedly lower than the value of 41.2 % obtained through the pedigree segregation indirect analysis estimated for carriers of t(4;8)(p16.3;p23.1), perhaps due to the unique composition of genes present within the 4p16.1-4p 16.3 region. Revealed differences in pedigree segregation analysis did not correspond to the very similar profile of meiotic segregation patterns presented by carrier 1 and carrier 2. Most probably, such discordances may be due to differences in embryo survival rates arising from different genetic backgrounds.
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 29105 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Training plans; time of submission; where filed... Surface Mines and Surface Areas of Underground Mines § 48.23 Training plans; time of submission; where... surface mine shall have an MSHA-approved plan containing programs for training new miners, training...
21 CFR 161.136 - Olympia oysters.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Olympia oysters. 161.136 Section 161.136 Food and... oysters. Olympia oysters, raw Olympia oysters, shucked Olympia oysters, are of the species Ostrea lurida and conform to the definition and standard of identity prescribed for oysters in § 161.130. ...
Lifescience Database Archive (English)
Full Text Available List Contact us BodyParts3D Table of 3D organ model IDs and organ names (PART-OF Tree) Data detail Data name Table of 3D org...an model IDs and organ names (PART-OF Tree) DOI 10.18908/lsdba.nbdc00837-002 Description of ...data contents List of downloadable 3D organ models in a tab-delimited text file format, describing the correspondence between 3D org...an model IDs and organ names available in PART-OF Tree. D...atabase Site Policy | Contact Us Table of 3D organ model IDs and organ names (PART-OF Tree) - BodyParts3D | LSDB Archive ...
STS-93 Commander Collins suits up for launch
1999-01-01
During the third launch preparations in the Operations and Checkout Building, STS-93 Commander Eileen M. Collins waves while having her launch and entry suit checked. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
International Nuclear Information System (INIS)
Azmairit Aziz; Nana Suherman
2015-01-01
Currently cancer patients are increasing every year in Indonesia and become the third leading cause of death after heart disease and high blood pressure. Terbium-161 ( 161 Tb) is a low β- emitter (E β - = 0.155 MeV, T 1/2 = 6.9 d) and very similar to 177 Lu in terms of half-life, E β - energy and chemical properties.However, 161 Tb also ejects internal conversion electrons and Auger electrons which can provide a greater therapeutic effect than 177 Lu. Radioisotope of 161 Tb can be produced as a carrier-free for use in labeling of biomolecules as a targeted radiopharmaceutical for cancer therapy. 161 Tb was obtained through 160 Gd(n,γ) 161 Tb nuclear reaction by thermal neutron bombardment on 100 mg of natural gadolinium oxide target in RSG-G.A. Siwabessy at a thermal neutron flux of ~10 14 n.cm -2 .s -1 and followed by radiochemical separation of 161 Tb from Gd isotopes using extraction chromatography method. The physico-chemical characterization of 161 TbCl 3 solution was studied by determination of its radionuclide purity by means of a γ-rays spectrometry with HP-Ge detector coupled to a multichannel analyzer (MCA). Radiochemical purity was determined using paper chromatography and paper electrophoresis methods. The results showed that 161 TbCl 3 radioisotope has a pH of 2, radiochemical purity of 99.64 ± 0.34%, radionuclide purity of 99.69 ± 0.20%, specific activity and radioactive concentration at the end of irradiation (EOI) of 2.26 – 5.31 Ci/mg and 3.84 – 9.03 mCi/mL, respectively. 161 TbCl 3 solution stable for 3 weeks at room temperature with a radiochemical purity of 98.41 ± 0.42%. 161 TbCl 3 solution from irradiated natural gadolinium oxide target has the physico-chemical characteristic that meets the requirements for use as a precursor in preparation of radiopharmaceuticals. (author)
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 24955 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 24946 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 30111 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Policy. 161.2 Section 161.2 Foreign Relations... environmental review procedures with the Department's decisionmaking process; (d) Invite and facilitate, when appropriate, Federal, State and local governmental authorities and public involvement in decisions which...
Pengalaman Komunikasi Pelanggan Zalora.co.id (Studi Fenomenologi Pelanggan Zalora.co.id)
Aji, Widya Andhika; Pradekso, Tandiyo; Ulfa, Nurist Surayya
2013-01-01
1PENGALAMAN KOMUNIKASI PELANGGAN ZALORA.CO.ID(Studi Fenomenologi Pelanggan Zalora.co.id)Oleh:Widya Andhika AjiFakultas Ilmu Sosial dan Ilmu PolitikUniversitas Diponegoro SemarangABSTRAKPenelitian ini bertujuan untuk menganalisis pengalaman komunikasi danpemahaman penerimaan konsumen terkait pesan komunikasi pemasaran dalamberbelanja di Zalora.co.id. Dengan menggunakan sampel pada lima informandan metode wawancara, dapat ditarik kesimpulan: Pelanggan Zalora.co.idmemiliki pengalaman komunikasi ...
STS-93 Pilot Ashby suits up for launch
1999-01-01
In the Operations and Checkout Building during final launch preparations for the third time, STS-93 Pilot Jeffrey S. Ashby pulls on his glove, part of his launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen Collins, Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
The Effect of Autoclaving on Torsional Moment of Two Nickel-Titanium Endodontic Files
2012-01-01
titanium endodontic files 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) J. B. King, H. W. Roberts, B. E... Endodontic Journal, doi:10.1111/j.1365- 2591.2011.01958.x 45, 156–161, 2012 doi:10.1111/j.1365-2591.2011.01958.x Wiley Blackwell Publishing, 111 River...autoclaving on torsional strength of two nickel–titanium (NiTi) rotary endodontic files: Twisted Files (SybronEndo, Orange, CA, USA) and GT Series X
2012-02-15
... expenses as ``other'' (miscellaneous), a very general categorization that provides FINRA limited visibility... supplemental filing would play with respect to a broker-dealer's annual audit.\\28\\ \\26\\ CAI. \\27\\ Id. \\28\\ Id... any future schedules or reports be done through the more typical self- regulatory organization (``SRO...
36 CFR 406.161-406.169 - [Reserved
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.161-406.169 Section 406.161-406.169 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.161-406.169 [Reserved] ...
77 FR 43070 - Combined Notice of Filings #2
2012-07-23
...; ER10-2752-003. Applicants: Bangor Hydro Electric Company. Description: Notice of Changes in Status of Bangor Hydro Electric Company, et al. Filed Date: 7/16/12. Accession Number: 20120716-5085. Comments Due... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Combined Notice of Filings 2 Take notice...
STS-84 M.S. Kondakova with husband Ryumin at SLF
1997-01-01
STS-84 Mission Specialist Elena V. Kondakova, a cosmonaut with the Russian Space Agency, and her husband, Valery Ryumin, greet press represenatives and other well wishers after her arrival at KSCs Shuttle Landing Facility. Ryumin is director of the Mir- Shuttle program for RSC Energia in Russia. This will be Kondakovas first flight on a U.S. Space Shuttle, but her second trip into space. She spent 169 days in space as flight engineer of the 17th main mission on Mir from October 1994 to March 1995. STS-84 will be the sixth docking of the Space Shuttle with the Russian Space Station Mir. During the docking, STS-84 Mission Specialist C. Michael Foale will transfer to the Russian space station to become a member of the Mir 23 crew, replacing U.S. astronaut Jerry M. Linenger, who will return to Earth on Atlantis. Foale is scheduled to remain on Mir about four months until his replacement arrives on STS-86 in September.
Id-1 and Id-2 genes and products as markers of epithelial cancer
Desprez, Pierre-Yves [El Cerrito, CA; Campisi, Judith [Berkeley, CA
2008-09-30
A method for detection and prognosis of breast cancer and other types of cancer. The method comprises detecting expression, if any, for both an Id-1 and an Id-2 genes, or the ratio thereof, of gene products in samples of breast tissue obtained from a patient. When expressed, Id-1 gene is a prognostic indicator that breast cancer cells are invasive and metastatic, whereas Id-2 gene is a prognostic indicator that breast cancer cells are localized and noninvasive in the breast tissue.
2013-02-08
... SECURITIES AND EXCHANGE COMMISSION [File No. 500-1] Advance Nanotech, Inc., Advanced ID Corp., Aeon Holdings, Inc. (n/k/a BCM Energy Partners, Inc.), ANTS Software, Inc., Beauty Brands Group, Inc... current and accurate information concerning the securities of Advanced Nanotech, Inc. because it has not...
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Injunctions. 1.61 Section 1.61 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL PROCEDURES... believe that it would be to the interest of the public, the Commission will apply to the courts for...
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 24953 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
45 CFR 2490.161-2490.169 - [Reserved
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.161-2490.169 Section 2490.161-2490.169 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.161-2490.169 [Reserved] ...
STS-93 Commander Eileen Collins suits up for launch
1999-01-01
For the third time, in the Operations and Checkout Building, STS- 93 Commander Eileen M. Collins tries on her helmet with her launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
28 CFR 39.161-39.169 - [Reserved
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.161-39.169 Section 39.161-39.169 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.161-39.169 [Reserved] ...
75 FR 54607 - Combined Notice of Filings #1
2010-09-08
..., September 17, 2010. Docket Numbers: ER00-107-005. Applicants: La Paloma Generating Company, LLC. Description: Supplemental Information of La Paloma Generating Company, LLC. Filed Date: 08/27/2010. Accession Number...: ER07-232-004; ER07-374-003; ER05-1316-003. Applicants: Aragonne Wind LLC; Buena Vista Energy, LLC...
75 FR 28602 - Corning Natural Gas Corporation; Notice of Compliance Filing
2010-05-21
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR09-30-003] Corning Natural Gas Corporation; Notice of Compliance Filing May 17, 2010. Take notice that on May 10, 2010, Corning Natural Gas Corporation, (Corning) filed a corrected rate sheet to replace the rate sheet filed with its...
46 CFR 161.013-11 - Prototype test.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Prototype test. 161.013-11 Section 161.013-11 Shipping...: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Electric Distress Light for Boats § 161.013-11 Prototype test. (a) Each manufacturer must test a prototype light identical to the lights to be certified prior to...
7 CFR 1789.161 - Conflicts of interest.
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false Conflicts of interest. 1789.161 Section 1789.161... Consultant Services Funded by Borrowers-General § 1789.161 Conflicts of interest. The standard for determining organizational conflicts of interest shall be as set forth in the FAR subpart 9.5 (48 CFR part 9...
49 CFR 28.161-28.169 - [Reserved
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.161-28.169 Section 28.161-28.169 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.161-28.169 [Reserved] ...
STANEF, ENDF/B Book-keeping Operations for ENDF Format Files
International Nuclear Information System (INIS)
Dunford, Charles L.
2007-01-01
1 - Description of program or function: STANEF performs bookkeeping operations on a data file containing one or more material evaluations in ENDF format. Version 7.01 (Feb 2005): set success flag when done added new element roentgenium (rg) corrected symbol generation for second third metastable state (Kellett, NEA) added symbol nn for neutron in symbol generation and xx for unnamed elements corrections for fact that some compilers do not recognize the intrinsic function jfix 2 - Method of solution: STANEF operations include: Creation or modification of a 'tape ID' record, Creation or update of the directory in MT=451, Create or modify special Hollerith ID records in MT=451 (ENDF-6 only), Re-sequencing, Conversion of integer and floating point fields to standard format, Creation of a binary (ENDF alternate format) file
21 CFR 161.170 - Canned Pacific salmon.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned Pacific salmon. 161.170 Section 161.170... § 161.170 Canned Pacific salmon. (a) Identity. (1) Canned Pacific salmon is the food prepared from one... forms of canned Pacific salmon are processed from fish prepared by removing the head, gills, and tail...
Angiotensin-converting enzyme I/D polymorphism in chronic obstructive pulmonary disease
Directory of Open Access Journals (Sweden)
Pabst S
2009-12-01
Full Text Available Abstract Study objective The etiology of chronic obstructive lung disease (COPD is unclear. It is supposed to be the product of an exogenous antigenic stimulus, such as tobacco smoke, and an endogenous genetic susceptibility. The angiotensin-converting enzyme (ACE gene contains a polymorphism based on the presence (insertion [I] or absence (deletion [D] of a 287-bp nonsense domain, resulting in three different genotypes (II, ID and DD. The aim of the study was to find out whether the ACE gene polymorphism can determine the course of COPD. Patients and design We genotyped 152 Caucasian patients with COPD and 158 healthy controls for the ACE (I/D polymorphism. We divided the COPD group into one group of 64 patients with a stable course of disease, defined as less than three hospitalizations over the last three years due to COPD, and another group of 88 patients with an instable course with more than three hospitalizations. Results The I-allele was significantly associated with an increased risk for COPD in a dominant model (OR 1.67 (95% CI 1.00 to 2.78, p = 0.048, but not in a recessive or co-dominant model. Moreover, the I-allele of ACE (I/D was significantly increased in patients with a stable course of COPD (p = 0.012 compared with controls. In a dominant model (II/ID v DD we found an even stronger association between the I-allele and a stable course of COPD (OR 3.24 (95% CI 1.44 to 7.31, p = 0.003. Conclusion These data suggest that the presence of an ACE I-allele determines a stable course of COPD.
28 CFR 16.1 - General provisions.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false General provisions. 16.1 Section 16.1 Judicial Administration DEPARTMENT OF JUSTICE PRODUCTION OR DISCLOSURE OF MATERIAL OR INFORMATION... administration of the Department of Justice. ...
STS-93 Mission Specialist Hawley suits up for launch
1999-01-01
For the third time, during final launch preparations in the Operations and Checkout Building, STS-93 Mission Specialist Steven A. Hawley (Ph.D.) waves after donning his launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Hawley, Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
National Oceanic and Atmospheric Administration, Department of Commerce — CRED SVP drifter Argos_ID 24949 was deployed in the region of NW Hawaiian Islands to assess ocean currents and sea surface temperature. SVP drifter data files...
STS-93 Mission Specialist Cady Coleman suits up for launch
1999-01-01
For the third time, during final launch preparations in the Operations and Checkout Building, STS-93 Mission Specialist Catherine G. Coleman (Ph.D.) dons her launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Coleman, and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
Directory of Open Access Journals (Sweden)
Zimri S Yaseen
Full Text Available BACKGROUND: The greatly increased risk of suicide after psychiatric hospitalization is a critical problem, yet we are unable to identify individuals who would attempt suicide upon discharge. The Suicide Trigger Scale v.3 (STS-3, was designed to measure the construct of an affective 'suicide trigger state' hypothesized to precede a suicide attempt (SA. This study aims to test the predictive validity of the STS-3 for post-discharge SA on a high-risk psychiatric-inpatient sample. METHODS: The STS-3, and a psychological test battery measuring suicidality, mood, impulsivity, trauma history, and attachment style were administered to 161 adult psychiatric patients hospitalized following suicidal ideation (SI or SA. Receiver Operator Characteristic and logistic regression analyses were used to assess prediction of SA in the 6-month period following discharge from hospitalization. RESULTS: STS-3 scores for the patients who made post-discharge SA followed a bimodal distribution skewed to high and low scores, thus a distance from median transform was applied to the scores. The transformed score was a significant predictor of post-discharge SA (AUC 0.731, and a subset of six STS-3 scale items was identified that produced improved prediction of post-discharge SA (AUC 0.814. Scores on C-SSRS and BSS were not predictive. Patients with ultra-high (90(th percentile STS-3 scores differed significantly from ultra-low (10(th percentile scorers on measures of affective intensity, depression, impulsiveness, abuse history, and attachment security. CONCLUSION: STS-3 transformed scores at admission to the psychiatric hospital predict suicide attempts following discharge among the high-risk group of suicidal inpatients. Patients with high transformed scores appear to comprise two clinically distinct groups; an impulsive, affectively intense, fearfully attached group with high raw STS-3 scores and a low-impulsivity, low affect and low trauma-reporting group with low raw
Evaluation of STS 430 and STS 444 for SOFC Interconnect Applications
International Nuclear Information System (INIS)
Kim, S. H.; Huh, J. Y.; Jun, J. H.; Kim, D. H.; Jun, J. H.
2007-01-01
Ferritic stainless steels for the SOFC interconnect applications are required to possess not only a good oxidation resistance, but also a high electrical conductivity of te oxide scale that forms during exposure at the SOFC operating environment. In order to understand the effects of alloying elements on the oxidation behavior of ferritic stainless steels and on the electrical properties of oxide scales, two kinds of commercial ferritic stainless steels, STS 430 and STS 444, were investigated by performing isothermal oxidations at 800 .deg. C in a wet air containing 3% H 2 O. The results showed that STS 444 was superior to STS 430 in both of the oxidation resistance and the area specific resistance. Although STS 444 contained a less amount of Mn for the (Mn, Cr) 3 O 4 spinel formation than STS 430, the minor alloying elements of Al and Mo in STS 444, which were accumulated in the base metal region adjacent the scale, were suggested to reduce the scale growth rate and to enhance the scale adherence to the base metal
ID-kaart on mugav ja praktiline dokument / Heiki Raudla
Raudla, Heiki, 1949-
2001-01-01
Ilmunud ka: Severnoje Poberezhje 12. okt., lk. 2; Lääne Elu 13. okt., lk. 2; Hiiumaa 13. okt., lk. 2; Koit 16. okt., lk. 6; Nädaline 16. okt., lk. 4; Sakala 18. okt., lk. 2; Valgamaalane 18. okt., lk. 2; Pjarnuskii Ekspress 12. okt., lk. 2; Meie Maa 19. okt., lk. 2; Hiiu Leht 23. okt., lk. 2; Järva Teataja 30. okt., lk. 2. Siseministri nõunik Heiki Raudla ID-kaardist
A functionally significant polymorphism in ID3 is associated with human coronary pathology.
Directory of Open Access Journals (Sweden)
Ani Manichaikul
Full Text Available We previously identified association between the ID3 SNP rs11574 and carotid intima-media thickness in the Diabetes Heart Study, a predominantly White diabetic population. The nonsynonymous SNP rs11574 results in an amino acid substitution in the C-terminal region of ID3, attenuating the dominant negative function of ID3 as an inhibitor of basic HLH factor E12-mediated transcription. In the current investigation, we characterize the association between the functionally significant polymorphism in ID3, rs11574, with human coronary pathology.The Multi-Ethnic Study of Atherosclerosis (MESA is a longitudinal study of subclinical cardiovascular disease, including non-Hispanic White (n = 2,588, African American (n = 2,560 and Hispanic (n = 2,130 participants with data on coronary artery calcium (CAC. The Coronary Assessment in Virginia cohort (CAVA included 71 patients aged 30-80 years, undergoing a medically necessary cardiac catheterization and intravascular ultrasound (IVUS at the University of Virginia. ID3 SNP rs11574 risk allele was associated with the presence of CAC in MESA Whites (P = 0.017. In addition, the risk allele was associated with greater atheroma burden and stenosis in the CAVA cohort (P = 0.003, P = 0.04 respectively. The risk allele remained predictive of atheroma burden in multivariate analysis (Model 1: covariates age, gender, and LDL, regression coefficient = 9.578, SE = 3.657, p = 0.0110; Model 2: covariates Model 1, presence of hypertension, presence of diabetes, regression coefficient = 8.389, SE = 4.788, p = 0.0163.We present additional cohorts that demonstrate association of ID3 SNP rs11574 directly with human coronary artery pathology as measured by CAC and IVUS: one a multiethnic, relatively healthy population with low levels of diabetes and the second a predominantly White population with a higher incidence of T2DM referred for cardiac catheterization.
Transition rates in {sup 161}Dy
Energy Technology Data Exchange (ETDEWEB)
Berg, V; Malmskog, S G
1969-06-15
The decay of {sup 161}Tb has been studied using a high resolution Ge(Li)-detector. Five new transitions were observed and fitted into the earlier proposed decay scheme. The half-life of the 131.8 keV level in {sup 161}Dy was determined in a delayed coincidence measurement to be 145 {+-} 15 psec. The low level scheme in {sup 161}Dy is discussed within a quasi-particle model allowing for Coriolis mixing. Special attention is given to the strongly retarded, K-allowed 131.8 keV E1 transition with a retardation factor F{sub W} > 1.5 x 10{sup 8}.
33 CFR 161.18 - Reporting requirements.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Reporting requirements. 161.18 Section 161.18 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... call. H HOTEL Date, time and point of entry system Entry time expressed as in (B) and into the entry...
14 CFR 406.161 - Witness fees.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Witness fees. 406.161 Section 406.161 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... the same fees and mileage expenses as are paid to a witness in a court of the United States in...
STS-93 M.S. Michel Tognini suits up before launch
1999-01-01
For the third time, in the Operations and Checkout Building, STS- 93 Mission Specialist Michel Tognini of France, who represents the Centre National d'Etudes Spatiales (CNES), waves after donning his launch and entry suit during final launch preparations. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Tognini. Collins is the first woman to serve as commander of a shuttle mission.
2010-02-09
... Hydroelectric Limited Partnership; Notice of Application Accepted for Filing and Soliciting Motions To Intervene and Protests February 2, 2010. Take notice that the following hydroelectric application has been filed... License b. Project No.: P-12740-003 c. Date filed: July 13, 2009 d. Applicant: Jordan Hydroelectric...
Beam transport radiation shielding for branch lines 2-ID-B and 2-ID-C
International Nuclear Information System (INIS)
Feng, Y.P.; Lai, B.; McNulty, I.; Dejus, R.J.; Randall, K.J.; Yun, W.
1995-01-01
The x-ray radiation shielding requirements beyond the first optics enclosure have been considered for the beam transport of the 2-ID-B and 2-ID-C branch lines of Sector 2 (SRI-CAT) of the APS. The first three optical components (mirrors) of the 2-ID-B branch are contained within the shielded first optics enclosure. Calculations indicate that scattering of the primary synchrotron beam by beamline components outside the enclosure, such as apertures and monochromators, or by gas particles in case of vacuum failure is within safe limits for this branch. A standard 2.5-inch-diameter stainless steel pipe with 1/16-inch-thick walls provides adequate shielding to reduce the radiation dose equivalent rate to human tissue to below the maximum permissible limit of 0.25 mrem/hr. The 2-ID-C branch requires, between the first optics enclosure where only two mirrors are used and the housing for the third mirror, additional lead shielding (0.75 mm) and a minimum approach distance of 2.6 cm. A direct beam stop consisting of at least 4.5 mm of lead is also required immediately downstream of the third mirror for 2-ID-C. Finally, to stop the direct beam from escaping the experimental station, a beam stop consisting of at least 4-mm or 2.5-mm steel is required for the 2-ID-B or 2-ID-C branches, respectively. This final requirement can be met by the vacuum chambers used to house the experiments for both branch lines
STS-98 U.S. Lab Destiny rests in Atlantis' payload bay
2001-01-01
KENNEDY SPACE CENTER, Fla. -- The U.S. Lab Destiny rests in the payload bay of Space Shuttle Atlantis. A key element in the construction of the International Space Station, Destiny is 28 feet long and weighs 16 tons. This research and command-and-control center is the most sophisticated and versatile space laboratory ever built. It will ultimately house a total of 23 experiment racks for crew support and scientific research. Destiny will fly on STS-98, the seventh construction flight to the ISS. Launch of STS-98 is scheduled for Jan. 19 at 2:11 a.m. EST.
7 CFR 1260.161 - Establishment and membership.
2010-01-01
....161 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Beef Promotion Operating Committee § 1260.161...
40 CFR 161.55 - Agricultural vs. non-agricultural pesticides.
2010-07-01
... pesticides. 161.55 Section 161.55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS DATA REQUIREMENTS FOR REGISTRATION OF ANTIMICROBIAL PESTICIDES General Provisions § 161.55 Agricultural vs. non-agricultural pesticides. Section 25(a)(1) of FIFRA instructs the...
Globus File Transfer Services | High-Performance Computing | NREL
installed on the systems at both ends of the data transfer. The NREL endpoint is nrel#globus. Click Login on the Globus web site. On the login page select "Globus ID" as the login method and click Login to the Globus website. From the Manage Data drop down menu, select Transfer Files. Then click Get
A proposed HTTP service based IDS
Directory of Open Access Journals (Sweden)
Mohamed M. Abd-Eldayem
2014-03-01
Full Text Available The tremendous growth of the web-based applications has increased information security vulnerabilities over the Internet. Security administrators use Intrusion-Detection System (IDS to monitor network traffic and host activities to detect attacks against hosts and network resources. In this paper IDS based on Naïve Bayes classifier is analyzed. The main objective is to enhance IDS performance through preparing the training data set allowing to detect malicious connections that exploit the http service. Results of application are demonstrated and discussed. In the training phase of the proposed IDS, at first a feature selection technique based on Naïve Bayes classifier is used, this technique identifies the most important HTTP traffic features that can be used to detect HTTP attacks. In the testing and running phases proposed IDS classifies the network traffic based on the requested service, then based on the selected features Naïve Bayes classifier is used to analyze the HTTP service based traffic and identifies the HTTP normal connections and attacks. The performance of the IDS is measured through experiments using NSL-KDD data set. The results show that the detection rate of the IDS is about 99%, the false-positive rate is about 1%, and the false-negative rate is about 0.25%; therefore, proposed IDS holds the highest detection rate and the lowest false alarm compared with other leading IDS. In addition, the proposed IDS based on Naïve Bayes is used to classify network connections as a normal or attack. And it holds a high detection rate and a low false alarm.
22 CFR 161.10 - Non-Federal applicants for permits.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Non-Federal applicants for permits. 161.10 Section 161.10 Foreign Relations DEPARTMENT OF STATE ENVIRONMENTAL PROTECTION REGULATIONS FOR IMPLEMENTATION OF THE NATIONAL ENVIRONMENTAL POLICY ACT (NEPA) Coordination of Other Requirements of NEPA § 161...
46 CFR 163.003-15 - Performance.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 163.003-15 Section 163.003-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be...
MED23-associated intellectual disability in a non-consanguineous family.
Trehan, Aditi; Brady, Jacqueline M; Maduro, Valerie; Bone, William P; Huang, Yan; Golas, Gretchen A; Kane, Megan S; Lee, Paul R; Thurm, Audrey; Gropman, Andrea L; Paul, Scott M; Vezina, Gilbert; Markello, Thomas C; Gahl, William A; Boerkoel, Cornelius F; Tifft, Cynthia J
2015-06-01
Intellectual disability (ID) is a heterogeneous condition arising from a variety of environmental and genetic factors. Among these causes are defects in transcriptional regulators. Herein, we report on two brothers in a nonconsanguineous family with novel compound heterozygous, disease-segregating mutations (NM_015979.3: [3656A > G];[4006C > T], NP_057063.2: [H1219R];[R1336X]) in MED23. This gene encodes a subunit of the Mediator complex that modulates the expression of RNA polymerase II-dependent genes. These brothers, who had profound ID, spasticity, congenital heart disease, brain abnormalities, and atypical electroencephalography, represent the first case of MED23-associated ID in a non-consanguineous family. They also expand upon the clinical features previously reported for mutations in this gene. © 2015 Wiley Periodicals, Inc.
KungFQ: a simple and powerful approach to compress fastq files.
Grassi, Elena; Di Gregorio, Federico; Molineris, Ivan
2012-01-01
Nowadays storing data derived from deep sequencing experiments has become pivotal and standard compression algorithms do not exploit in a satisfying manner their structure. A number of reference-based compression algorithms have been developed but they are less adequate when approaching new species without fully sequenced genomes or nongenomic data. We developed a tool that takes advantages of fastq characteristics and encodes them in a binary format optimized in order to be further compressed with standard tools (such as gzip or lzma). The algorithm is straightforward and does not need any external reference file, it scans the fastq only once and has a constant memory requirement. Moreover, we added the possibility to perform lossy compression, losing some of the original information (IDs and/or qualities) but resulting in smaller files; it is also possible to define a quality cutoff under which corresponding base calls are converted to N. We achieve 2.82 to 7.77 compression ratios on various fastq files without losing information and 5.37 to 8.77 losing IDs, which are often not used in common analysis pipelines. In this paper, we compare the algorithm performance with known tools, usually obtaining higher compression levels.
Tinjauan Desain Website Kemlu.Go.Id
Danu Widhyatmoko
2013-01-01
Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007). At the end of the article, several recommendations in developing kemlu.go.id website are...
Thais, Savannah Jennifer; The ATLAS collaboration
2018-01-01
Efficient and accurate electron identification is of critical importance to measuring many physics processes with leptons in the final state, including H->4l, dark vector boson searches, and various SUSY searches. This poster will describe the current status of the Likelihood driven Electron ID, highlighting the recent move from a MC driven ID to a data-driven ID. It will include the most recent identification efficiency and scale-factor measurements. Additionally, it will describe continued improvements for Run 2 electron ID, highlighting improvements in the low pt region and potential Machine Learning improvements.
Tinjauan Desain Website Kemlu.Go.Id
Directory of Open Access Journals (Sweden)
Danu Widhyatmoko
2013-04-01
Full Text Available Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007. At the end of the article, several recommendations in developing kemlu.go.id website are presented to create better appearance.
Barron, Paul E.
In the last half century, public awareness of issues such as population growth, environmental pollution and the threat of nuclear war has pressured science education to reform to increase student social responsibility. The emerging Science-Technology-Society (STS) movement addressed these concerns by developing numerous strategies and curricula. Considerable diagnostic research has been conducted on student knowledge of the nature of science, but not on the wider scope of STS content (e.g., the nature of science and technology and their interactions with society). However, researchers have not widely studied the impact of comprehensive STS curricula on students' knowledge of STS content nor the nature of STS teaching practice that influenced this knowledge gain. This study examined student success and teacher performance in a special STS course in Ontario, Canada. Research questions focused on the STS content knowledge gain by students completing this course and the impact of the STS teachers' teaching practices on this knowledge gain. Student data were collected using pre-course and post-course assessments of students' STS content knowledge. Teacher data were obtained using semi-structured interviews, classroom observations and videotapes. Statistical analysis indicated that, after completing the STS course, students significantly increased their STS content knowledge as measured by the Views on Science Technology Society instrument. Gender and academic achievement had no significant impact on this knowledge gain, implying that this course, as taught by these teachers, could appeal to a wide range of students as a general education course. The second part of the study indicated that detailed research is needed on the relationship between STS teaching practice and student STS content knowledge gain. The small sample size prevents generalizations but initial indications show that factors such constructivist teaching practices and strong teacher STS content knowledge
78 FR 41053 - Combined Notice of Filings #1
2013-07-09
... South, LLC, High Desert Power Project, LLC, New Mexico Electric Marketing, LLC, Tenaska Power Management...: Queue Position X3-003? Original Service Agreement No. 3583 to be effective 5/30/2013. Filed Date: 6/27...
International Nuclear Information System (INIS)
Kalinnikov, V.G.; Ibraheem, Y.S.; Stegailov, V.I.
2004-01-01
Full text: The study of odd-proton nuclei in rare-earth region has been performed to get more information on the nuclear structure of these nuclei. In the framework of a program at the ISOL complex of YASNAPP-2 at JINR to study the decay of odd-nuclei, 161 Er has been investigated. The experiments have been focused on the 161 Ho level scheme populated in the EC/β + decay of 161 Er for which a few results have been previously reported [1,2]. Spectra of single γ-ray, γ-γ coincidence and internal conversion electrons were measured. There are appreciable disagreements between results of some γ-ray intensities obtained by us and in [2]. The greatest difference was for relative γ-ray intensity of the 11.28 keV, which has reported value I γ ∼ 10 (I γ 211 =1000) in [2], but this leads to an overpopulation of the 211 keV level by 14% of the decay [3]. The relative intensities of transitions with Eγ γ211 =1000). Inaccuracy of Iγ in [2] is probably due to a sudden change in the efficiency curve of their Ge(Li) detector in the low energy region while our HPGe detector feature a much smoother variation in the efficiency curve in this γ-ray energy region. Besides, the levels earlier introduced by us in [4], three new levels in 161 Ho were proposed from γ-γ coincidences at energies 693.2 keV, 859.6 keV, and 957.97 keV. Spins, parities and Nilsson quantum characteristics of some 161 Ho levels were established
DEFF Research Database (Denmark)
Jensen, Tenna; Jespersen, Astrid Pernille; Grønnow, Liv Cæcilie
2015-01-01
Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune.......Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune....
33 CFR 161.20 - Position Report (PR).
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Position Report (PR). 161.20 Section 161.20 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... Report (PR). A vessel must report its name and position: (a) Upon point of entry into a VMRS area; (b) At...
STS-93 M.S. Michel Tognini in white room
1999-01-01
STS-93 Mission Specialist Michel Tognini of France is checked out by white room closeout crew members before entering the orbiter Columbia. Tognini is with the Centre National d'Etudes Spatiales (CNES). The white room is an environmental chamber at the end of the orbiter access arm that provides entry to the orbiter crew compartment. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. The target landing date is July 27 at 11:20 p.m. EDT.
2010-04-27
... Hydroelectric Company, LLC; Notice of Application Accepted for Filing and Soliciting Motions To Intervene and Protests April 20, 2010. Take notice that the following hydroelectric application has been filed with the.... Project No.: P-12478-003. c. Date filed: August 28, 2009. d. Applicant: Gibson Dam Hydroelectric Company...
24 CFR 982.161 - Conflict of interest.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Conflict of interest. 982.161... and PHA Administration of Program § 982.161 Conflict of interest. (a) Neither the PHA nor any of its... prospective interest to the PHA and HUD. (c) The conflict of interest prohibition under this section may be...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Use of wine. 1.61 Section..., NONINDUSTRIAL USE OF DISTILLED SPIRITS AND WINE, BULK SALES AND BOTTLING OF DISTILLED SPIRITS Nonindustrial Use of Distilled Spirits and Wine Uses Regarded As Industrial § 1.61 Use of wine. The following uses of...
Mlak, Radosław; Homa-Mlak, Iwona; Powrózek, Tomasz; Mackiewicz, Barbara; Michnar, Marek; Krawczyk, Paweł; Dziedzic, Marcin; Rubinsztajn, Renata; Chazan, Ryszarda; Milanowski, Janusz; Małecka-Massalska, Teresa
2016-04-01
Chronic obstructive pulmonary disease (COPD) affects more than 10% of the world's population over 40 years of age. The main exogenous risk factor is cigarette smoking; however, only 20% of smokers develop COPD, indicating that some other factors, e.g. genetic, may play an important role in the disease pathogenesis. Recent research indicates that ACE (angiotensin-converting enzyme) may be a susceptibility gene for asthma or COPD. The aim of our study was to determine the influence of I/D (insertion/deletion) polymorphism of the ACE gene (AluYa5, rs4646994) on the risk and course of COPD. We investigated ACE I/D polymorphism in 206 COPD and 165 healthy Caucasian subjects. In the generalized linear model (GLZ) analysis of the influence of selected factors on presence of COPD we found a significant independent effect for male sex (repeatedly increases the risk of COPD, OR = 7.7, p = 0.049), as well as smoking or lower body mass index, but only in combination with older age (OR = 0.96, p = 0.003 and OR = 1.005, p = 0.04 respectively). Interestingly, analysis of factors which may influence the risk of a higher number of exacerbations demonstrated that occurrence of DD genotype, but only in men, is associated with a lower risk (OR = 0.7, p = 0.03) of this complication. We suggest that ACE may not be a susceptibility gene for the origin of COPD but a disease-modifying gene. Since the impact of I/D polymorphism of the ACE gene on COPD risk is moderate or negligible, other molecular changes, that will help predict the development of this disease, should still be sought.
12 CFR 410.161-410.169 - [Reserved
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.161-410.169 Section 410.161-410.169 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...
2011-03-17
... Hydroelectric Company, LLC; Notice of Application Tendered for Filing With the Commission and Soliciting Additional Study Requests Take notice that the following hydroelectric application has been filed with the... No.: P-12757-003. c. Date filed: February 24, 2011. d. Applicant: BOST4 Hydroelectric Company, LLC...
2012-01-06
... Hydroelectric Company, LLC, (BOST5); Notice of Application Accepted for Filing and Soliciting Motions To Intervene and Protests Take notice that the following hydroelectric application has been filed with the... No.: P-12758-003. c. Date filed: March 28, 2011. d. Applicant: BOST5 Hydroelectric Company, LLC...
2011-04-19
... Hydroelectric Company, LLC; Notice of Application Tendered for Filing With the Commission and Soliciting Additional Study Requests Take notice that the following hydroelectric application has been filed with the... No.: P-12758-003. c. Date filed: March 28, 2011. d. Applicant: BOST5 Hydroelectric Company, LLC...
2012-01-06
... Hydroelectric Company, LLC, (BOST4); Notice of Application Accepted for Filing and Soliciting Motions To Intervene and Protests Take notice that the following hydroelectric application has been filed with the... No.: P-12757-003. c. Date filed: February 24, 2011. d. Applicant: BOST4 Hydroelectric Company, LLC...
33 CFR 161.60 - Vessel Traffic Service Prince William Sound.
2010-07-01
... William Sound. 161.60 Section 161.60 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Movement Reporting System Areas and Reporting Points § 161.60 Vessel Traffic Service Prince William Sound... Cape Hinchinbrook Light to Schooner Rock Light, comprising that portion of Prince William Sound between...
38 CFR 3.161 - Expedited Claims Adjudication Initiative-Pilot Program.
2010-07-01
... Adjudication Initiative-Pilot Program. 3.161 Section 3.161 Pensions, Bonuses, and Veterans' Relief DEPARTMENT... Claims § 3.161 Expedited Claims Adjudication Initiative—Pilot Program. Rules pertaining to the Expedited Claims Adjudication Initiative Pilot Program are set forth in part 20, subpart P, of this chapter...
2011-03-17
... Hydroelectric Company, LLC (BOST3); Notice of Application Accepted for Filing and Soliciting Motions To Intervene and Protests Take notice that the following hydroelectric application has been filed with the... No.: P-12756-003. c. Date filed: July 26, 2010. d. Applicant: BOST3 Hydroelectric Company, LLC (BOST3...
Facts about Infectious Diseases (ID)
... an ID Specialist? Facts about ID Pocketcard Infectious diseases are caused by microscopic organisms that penetrate the body’s natural ... from diseases such as AIDS or treatment of diseases such as cancer, may allow ... of contaminated food or water, bites from vectors such as ticks or mosquitoes ...
One ID Card for the Entire Campus.
Ridenour, David P.; Ferguson, Linda M.
1986-01-01
The implementation by Indiana State University of a machine-readable photo ID system for their food services prompted an investigation into the available alternatives and requirements for a more efficient all-University ID card system. The new ID system is described. (AUTHOR/MLW)
Desprez, Pierre-Yves; Campisi, Judith
2014-09-30
A method for treatment and amelioration of breast, cervical, ovarian, endometrial, squamous cells, prostate cancer and melanoma in a patient comprising targeting Id-1 or Id-2 gene expression with a delivery vehicle comprising a product which modulates Id-1 or Id-2 expression.
Gpr161 anchoring of PKA consolidates GPCR and cAMP signaling.
Bachmann, Verena A; Mayrhofer, Johanna E; Ilouz, Ronit; Tschaikner, Philipp; Raffeiner, Philipp; Röck, Ruth; Courcelles, Mathieu; Apelt, Federico; Lu, Tsan-Wen; Baillie, George S; Thibault, Pierre; Aanstad, Pia; Stelzl, Ulrich; Taylor, Susan S; Stefan, Eduard
2016-07-12
Scaffolding proteins organize the information flow from activated G protein-coupled receptors (GPCRs) to intracellular effector cascades both spatially and temporally. By this means, signaling scaffolds, such as A-kinase anchoring proteins (AKAPs), compartmentalize kinase activity and ensure substrate selectivity. Using a phosphoproteomics approach we identified a physical and functional connection between protein kinase A (PKA) and Gpr161 (an orphan GPCR) signaling. We show that Gpr161 functions as a selective high-affinity AKAP for type I PKA regulatory subunits (RI). Using cell-based reporters to map protein-protein interactions, we discovered that RI binds directly and selectively to a hydrophobic protein-protein interaction interface in the cytoplasmic carboxyl-terminal tail of Gpr161. Furthermore, our data demonstrate that a binary complex between Gpr161 and RI promotes the compartmentalization of Gpr161 to the plasma membrane. Moreover, we show that Gpr161, functioning as an AKAP, recruits PKA RI to primary cilia in zebrafish embryos. We also show that Gpr161 is a target of PKA phosphorylation, and that mutation of the PKA phosphorylation site affects ciliary receptor localization. Thus, we propose that Gpr161 is itself an AKAP and that the cAMP-sensing Gpr161:PKA complex acts as cilium-compartmentalized signalosome, a concept that now needs to be considered in the analyzing, interpreting, and pharmaceutical targeting of PKA-associated functions.
75 FR 22773 - PJM Interconnection, L.L.C.; Notice of Filing
2010-04-30
... Interconnection, L.L.C.; Notice of Filing April 23, 2010. Take notice that on April 22, 2010, PJM Interconnection, L.L.C. (PJM) filed revised tariff sheets to its Schedule 1 of the Amended and Restated Operating... (Commission) March 23, 2010 Order on Compliance Filing, PJM Interconnection, L.L.C., 130 FERC ] 61,230 (2010...
Pair-Production of W Bosons in $e^+ e^-$ Interactions at $\\sqrt{s}$ = 161 GeV
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alpat, B; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Antreasyan, D; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banicz, K; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Caria, M; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chan, A; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Choi, M T; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Fernández, D; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee Jae Sik; Lee, K Y; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lieb, E H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nagy, E; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Opitz, H; Organtini, G; Ostonen, R; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Ro, S; Robohm, A; Rodin, J; Rodríguez-Calonge, F J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Santocchia, A; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1997-01-01
We report on the measurement of W-boson pair-production with the L3 detector at LEP at a centre-of-mass energy of 161.34~\\GeV. In a data sample corresponding to a total luminosity of 11~pb$^{-1}$, we select four-fermion events with high invariant masses of pairs of hadronic jets or leptons. Combining all final states, the measured total cross section for W-pair production is: $\\SWW = 2.89^{+0.81}_{-0.70}~(stat.)\\pm0.14~(syst.)$~pb. Within the Standard Model, this corresponds to a mass of the W boson of: $\\MW = 80.80^{+0.48}_{-0.42}~(exp.)\\pm 0.03$~(LEP)~\\GeV. Limits on anomalous triple-vector-boson couplings are derived. \\end{abstract}
Babakhanyan, Anna; Leke, Rose G. F.; Salanti, Ali; Bobbili, Naveen; Gwanmesia, Philomina; Leke, Robert J. I.; Quakyi, Isabella A.; Chen, John J.; Taylor, Diane Wallace
2014-01-01
In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8–9% of males had antibodies to full-length VAR2CSA, but 90–96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a. PMID:24505415
Directory of Open Access Journals (Sweden)
Anna Babakhanyan
Full Text Available In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8-9% of males had antibodies to full-length VAR2CSA, but 90-96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a.
Evaluation of ID-PaGIA syphilis antibody test.
Naaber, Paul; Makoid, Ene; Aus, Anneli; Loivukene, Krista; Poder, Airi
2009-01-01
Laboratory diagnosis of syphilis is usually accomplished by serology. There are currently a large number of different commercial treponemal tests available that vary in format, sensitivity and specificity. To evaluate the ID-PaGIA Syphilis Antibody Test as an alternative to other specific treponemal tests for primary screening or confirmation of diagnosis. Serum samples from healthy adults (n = 100) were used for detection of specificity of ID-PaGIA. To evaluate sensitivity of ID-PaGIA serum samples (n = 101) from patients with confirmed or suspected syphilis were tested for syphilis antibodies with FTA-Abs IgM, ID-PaGIA, ELISA IgM and TPHA tests. No false-positive results were found with ID-PaGIA. Sensitivity of various treponemal tests was the following: FTA-Abs IgM: 95.5%, ID-PaGIA and ELISA IgM: 94%, and TPHA 75%. The positive and negative predictive values of ID-PaGIA were 100 and 89.5%, respectively. Compared with other treponemal tests ID-PaGIA has excellent sensitivity and specificity.
21 CFR 516.161 - Modifications to indexed drugs.
2010-04-01
... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Modifications to indexed drugs. 516.161 Section 516.161 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index...
12 CFR 563.161 - Management and financial policies.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Management and financial policies. 563.161... ASSOCIATIONS-OPERATIONS Financial Management Policies § 563.161 Management and financial policies. (a)(1) For... corporation must be well managed and operate safely and soundly. Each also must pursue financial policies that...
46 CFR 163.003-3 - ASTM standard.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false ASTM standard. 163.003-3 Section 163.003-3 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-3 ASTM standard. The following standard of the American Society for Testing and Materials (ASTM) is incorporated by reference into this subpart: ASTM D...
78 FR 7424 - Combined Notice of Filings #1
2013-02-01
.... Applicants: Public Service Company of New Mexico, Delta Person GP, LLC, BHB Power, LLC, Delta Person, Limited...-003. Applicants: Southwestern Public Service Company. Description: Supplement to June 29, 2012 Triennial Market Power Analysis of Southwestern Public Service Company. Filed Date: 1/24/13. Accession...
Measurement of 160Tb and 161Tb in nuclear forensics samples
International Nuclear Information System (INIS)
Jiang, J.; Davies, A.V.; Britton, R.E.
2017-01-01
160 Tb and 161 Tb are important radionuclides to measure when analysing a Nuclear Forensics sample. An analytical method for the measurement of both 160 Tb and 161 Tb was developed in this study. Terbium was separated and purified using exchange resin and TrisKem LN Resin. The purified fraction containing 160 Tb and 161 Tb was measured by gamma spectrometry and liquid scintillation counting. The counting efficiencies of 160 Tb and 161 Tb were determined using the CIEMAT/NIST efficiency tracing method. The LSC count rate ratio, R160 Tb /R161 Tb , on the reference date was determined by sequential counting and calculated using a custom script based on their half-lives. (author)
Directory of Open Access Journals (Sweden)
Chmaisse Hania
2009-01-01
Full Text Available Type-2 diabetes mellitus (T2DM is a chronic disorder characterized by a varying range of predominant insulin resistance with relative insulin deficiency, to predominant insulin secretory defect with or without insulin resistance. Familial clustering as well as epidemiological studies has shown that genetic factors play a role in the development and progression of the disease. Among the genetic factors found to be associated with development of T2DM is the angiotensin-I converting enzyme (ACE gene, which is located on chromosome 17q23. This study was conducted to study the association between ACE gene insertion/deletion (I/D polymorphism and T2DM in a Lebanese diabetic cohort. Fifty-one patients with T2DM and 40 control subjects from different parts of Lebanon underwent genotyping for the ACE I/D, which was performed by PCR using specific primers. Chi-square and analysis of variance (ANOVA were used for asso-ciation studies and to assess the differences in the values among the groups. The distribution of the genotypes in the patients was as follows: 15/51 (29.4% were homozygous for deletion allele (DD genotype, 24/51 (47.1% were heterozygous (ID genotype, and 12/51 (23.5% were homo-zygous for insertion allele (II genotype. Among the control subjects, 16/40 (40% were homo-zygous for deletion (DD genotype, 13/40 (32.5% were heterozygous (ID genotype, and 11/40 (27.5% were homozygous for insertion (II genotype. The prevalence of the D-allele in T2DM patients (52.9% was not significantly different from that in the controls (56.3%. Thus, ACE I/D dimorphism cannot be considered a risk factor for T2DM in the Lebanese population.
National Oceanic and Atmospheric Administration, Department of Commerce — Site - French Frigate Shoals, NWHI (23.85678, -166.27183 ) ARGOS ID 261-003 Time series data from this mooring provide high resolution sea surface temperature, and...
43 CFR 23.9 - Performance bond.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Performance bond. 23.9 Section 23.9 Public... LANDS § 23.9 Performance bond. (a)(1) Upon approval of an exploration plan or mining plan, the operator shall be required to file a suitable performance bond of not less than $2,000 with satisfactory surety...
Turning to Ontology in STS? Turning to STS through ‘Ontology’
van Heur, B.; Leydesdorff, L.; Wyatt, S.
2012-01-01
We examine the evidence for the claim of an ‘ontological turn’ in science and technology studies (STS). Despite an increase in references to ‘ontology’ in STS since 1989, we show that there has not so much been an ontological turn as multiple discussions deploying the language of ontology,
30 CFR 75.161 - Plans for training programs.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Plans for training programs. 75.161 Section 75... Provision] § 75.161 Plans for training programs. Each operator must submit to the district manager, of the Coal Mine Safety and Health District in which the mine is located, a program or plan setting forth what...
21 CFR 161.175 - Frozen raw breaded shrimp.
2010-04-01
... additives as defined in section 201(s) of the Federal Food, Drug, and Cosmetic Act; or if they are food... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Frozen raw breaded shrimp. 161.175 Section 161.175 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD...
Virtual file system on NoSQL for processing high volumes of HL7 messages.
Kimura, Eizen; Ishihara, Ken
2015-01-01
The Standardized Structured Medical Information Exchange (SS-MIX) is intended to be the standard repository for HL7 messages that depend on a local file system. However, its scalability is limited. We implemented a virtual file system using NoSQL to incorporate modern computing technology into SS-MIX and allow the system to integrate local patient IDs from different healthcare systems into a universal system. We discuss its implementation using the database MongoDB and describe its performance in a case study.
STS-93 M.S. Stephen Hawley in the White Room
1999-01-01
STS-93 Mission Specialist Stephen A. Hawley (Ph.D.) is checked out by white room closeout crew members before entering the orbiter Columbia. In the background is Mission Specialist Michel Tognini of France, waiting to enter Columbia. The white room is an environmental chamber at the end of the orbiter access arm that provides entry to the orbiter crew compartment. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. The target landing date is July 27 at 11:20 p.m. EDT.
2010-10-01
... Bluefish Fishery § 648.161 Closures. (a) EEZ closure. NMFS shall close the EEZ to fishing for bluefish by... dealer permit holders that no commercial quota is available for landing bluefish in that state. ...
77 FR 33206 - Combined Notice of Filings #1
2012-06-05
... Reliability Standard CIP- 006--Cyber Security--Physical Security of Critical Cyber Assets. Filed Date: 5/23/12... Commission received the following electric securities filings: Docket Numbers: ES12-31-000. Applicants...
Williams, Emily L; Jones, Hollie S; Andy Sparks, S; Marchant, David C; Midgley, Adrian W; Mc Naughton, Lars R
2015-07-01
Whilst the presence of a competitor has been found to improve performance, the mechanisms influencing the change in selected work rates during direct competition have been suggested but not specifically assessed. The aim was to investigate the physiological and psychological influences of a visual avatar competitor during a 16.1-km cycling time trial performance, using trained, competitive cyclists. Randomised cross-over design. Fifteen male cyclists completed four 16.1km cycling time trials on a cycle ergometer, performing two with a visual display of themselves as a simulated avatar (FAM and SELF), one with no visual display (DO), and one with themselves and an opponent as simulated avatars (COMP). Participants were informed the competitive avatar was a similar ability cyclist but it was actually a representation of their fastest previous performance. Increased performance times were evident during COMP (27.8±2.0min) compared to SELF (28.7±1.9min) and DO (28.4±2.3min). Greater power output, speed and heart rate were apparent during COMP trial than SELF (pperformance. Competitive cyclists performed significantly faster during a 16.1-km competitive trial than when performing maximally, without a competitor. The improvement in performance was elicited due to a greater external distraction, deterring perceived exertion. Copyright © 2014 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.
48 CFR 32.003 - Simplified acquisition procedures financing.
2010-10-01
... procedures financing. 32.003 Section 32.003 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 32.003 Simplified acquisition procedures financing. Unless agency regulations otherwise permit, contract financing shall not be provided for...
7 CFR 1150.161 - Promotion, research and nutrition education.
2010-01-01
... 7 Agriculture 9 2010-01-01 2009-01-01 true Promotion, research and nutrition education. 1150.161... MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE DAIRY PROMOTION PROGRAM Dairy Promotion and Research Order Promotion, Research and Nutrition Education § 1150.161 Promotion...
48 CFR 1532.003 - Simplified acquisition procedures financing.
2010-10-01
... procedures financing. 1532.003 Section 1532.003 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 1532.003 Simplified acquisition procedures financing. (a) Scope. This subpart provides for authorization of advance and interim payments on...
Kloos, W E; George, C G
1991-01-01
The accuracies of the MicroScan Pos ID and Rapid Pos ID panel systems (Baxter Diagnostic Inc., MicroScan Division, West Sacramento, Calif.) were compared with each other and with the accuracies of conventional methods for the identification of 25 Staphylococcus species and 4 subspecies. Conventional methods included those used in the original descriptions of species and subspecies and DNA-DNA hybridization. The Pos ID panel uses a battery of 18 tests, and the Rapid Pos ID panel uses a battery of 42 tests for the identification of Staphylococcus species. The Pos ID panel has modified conventional and chromogenic tests that can be read after 15 to 48 h of incubation; the Rapid Pos ID panel has tests that use fluorogenic substrates or fluorometric indicators, and test results can be read after 2 h of incubation in the autoSCAN-W/A. Results indicated that both MicroScan systems had a high degree of congruence (greater than or equal to 90%) with conventional methods for the species S. capitis, S. aureus, S. auricularis, S. saprophyticus, S. cohnii, S. arlettae, S. carnosus, S. lentus, and S. sciuri and, in particular, the subspecies S. capitis subsp. capitis and S. cohnii subsp. cohnii. The Rapid Pos ID panel system also had greater than or equal to 90% congruence with conventional methods for S. epidermidis, S. caprae, S. warneri subsp. 2, S. xylosus, S. kloosii, and S. caseolyticus. For both MicroScan systems, congruence with conventional methods was 80 to 90% for S. haemolyticus subsp. 1, S. equorum, S. intermedius, and S. hyicus; and in addition, with the Rapid Pos ID panel system congruence was 80 to 89% for S. capitis subsp. ureolyticus, S. warneri subsp. 1, S. hominis, S. cohnii subsp. urealyticum, and S. simulans. The MicroScan systems identified a lower percentage (50 to 75%) of strains of S. lugdunensis, S. gallinarum, S. schleiferi, and S. chromogenes, although the addition of specific tests to the systems might increase the accuracy of identification
48 CFR 432.003 - Simplified acquisition procedures financing.
2010-10-01
... procedures financing. 432.003 Section 432.003 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 432.003 Simplified acquisition procedures financing. (a) The chief of the contracting office may approve contract financing on a contract to be...
48 CFR 1332.003 - Simplified acquisition procedures financing.
2010-10-01
... procedures financing. 1332.003 Section 1332.003 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 1332.003 Simplified acquisition procedures financing. Contract financing may be provided for purchases made under the authority of FAR Part 13. Contract...
Analysis of Sodium-23 Data Cross-Sections for Coolant on Generation IV Reactor - SFR
International Nuclear Information System (INIS)
Suwoto; Zuhair
2009-01-01
The integral tests of sodium-23 neutron cross-sections for coolant contained in JENDL-3.3, ENDF/B-VII.0, BROND-2.2 and JEFF-3.1 files have been performed. Cross-sections analysis of sodium-23 such as total cross-sections, elastic scattering, in-elastic scattering and radiative capture cross-sections for several temperature i.e. 300K, 800K and 1500K. The sodium-23 total cross-sections analysis based on MAEKER, R.E. experimental result through Broomstick experiment calculation. Differences between among other evaluated nuclear data file for elastic scattering, in-elastic scattering and radiative capture cross-sections were done analyzed and compared to ENDF/B-VII.0 as standard reference. Analysis of total cross-sections sodium-23 through broomstick calculation show JENDL-3.3 file give the best result on C/E statistical average value is 1.1043 compared to another nuclear data files. Differences sodium-23 total cross-sections on JEFF-3.1 file for all temperature work specially for energy 40keV and 1MeV-2MeV is about 0.2%. Meanwhile, relative small differences on in-elastic total scattering cross-sections are shown for all temperatures are about ±0.1% in JENDL-3.3. On the other hand, BROND-2.2 file give ±6% higher on sodium-23 in-elastic total scattering cross sections for energy range 450keV-550keV. Clearly significant differences on sodium-23 radiative capture cross sections for BROND-2.2 file especially in energy 109.659keV is somewhat higher than 446%, otherwise JENDL-3.3 and JEFF-3.1 give 16% higher than ENDF/B-VII.0 file. Overall result show that JENDL-3.3, ENDFB-VII.0, BROND-2.2 and JEFF-3.1 have little bit differences in total, elastic scattering, in-elastic scattering total cross sections, except BROND-2.2 file due to radiative capture cross-sections with larger discrepancies. (author)
STS-98 Destiny in Atlantis's payload bay
2001-01-01
KENNEDY SPACE CENTER, Fla. -- The U.S. Laboratory Destiny rests once again in Atlantis'''s payload bay, at Launch Pad 39A. Closing of the payload bay doors is imminent. Destiny, a key element in the construction of the International Space Station, is 28 feet long and weighs 16 tons. This research and command-and-control center is the most sophisticated and versatile space laboratory ever built. It will ultimately house a total of 23 experiment racks for crew support and scientific research. Destiny will be launched Feb. 7 on STS-98, the seventh construction flight to the ISS.
48 CFR 3032.003 - Simplified acquisition procedures financing.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Simplified acquisition procedures financing. 3032.003 Section 3032.003 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND... FINANCING Scope of Part 3032.003 Simplified acquisition procedures financing. Contract financing may be...
Directory of Open Access Journals (Sweden)
Jinlin Miao
2015-01-01
Full Text Available Objective. CD161 has been identified as a marker of human IL-17-producing T cells that are implicated in the pathogenesis of rheumatoid arthritis (RA. This study aimed to investigate the potential link between the percentage of CD161+ T cells and disease activity in RA patients. Methods. Peripheral blood (PB from 54 RA patients and 21 healthy controls was evaluated. Paired synovial fluid (SF (n = 17 was analyzed. CD161 expression levels on CD4+, CD8+, and CD4−CD8− T cells were assessed by flow cytometry. Results. The percentage of CD4+CD161+ T cells in RA SF was higher than RA PB, and it was positively correlated with DAS28, erythrocyte sedimentation rate (ESR, and C-reactive protein (CRP. CD4−CD8−CD161+ T cell percentage was decreased in RA PB and was further reduced in RA SF, and its level in SF was inversely correlated with DAS28, ESR, and CRP. However, CD8+CD161+ T cell percentage was neither changed in RA PB and SF nor correlated with disease activity indices. Conclusion. An increased CD4+CD161+ T cell percentage and a decreased CD4−CD8−CD161+ T cell percentage are present in RA SF and are associated with disease activity, and the accumulation of CD4+CD161+ T cells in SF may contribute to the local inflammation of RA.
2010-03-05
... Hydropower, LLC; Notice of Application Accepted for Filing and Soliciting Motions To Intervene and Protests... No.: P-12783-003. c. Date filed: July 22, 2009. d. Applicant: Inglis Hydropower, LLC. e. Name of Project: Inglis Hydropower Project. f. Location: The proposed project would be located at the existing...
29 CFR 1910.161 - Fixed extinguishing systems, dry chemical.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Fixed extinguishing systems, dry chemical. 1910.161 Section... § 1910.161 Fixed extinguishing systems, dry chemical. (a) Scope and application. This section applies to all fixed extinguishing systems, using dry chemical as the extinguishing agent, installed to meet a...
22 CFR 161.11 - Environmental review and consultation requirements.
2010-04-01
... requirements. 161.11 Section 161.11 Foreign Relations DEPARTMENT OF STATE ENVIRONMENTAL PROTECTION REGULATIONS FOR IMPLEMENTATION OF THE NATIONAL ENVIRONMENTAL POLICY ACT (NEPA) Coordination of Other Requirements... comments. (d) Fish and Wildlife Coordination Act, 16 U.S.C. 661 et seq. (e) Section 309 of the Clean Air...
Evaluation of ACE gene I/D polymorphism in Iranian elite athletes.
Shahmoradi, Somayeh; Ahmadalipour, Ali; Salehi, Mansoor
2014-01-01
Angiotensin converting enzyme (ACE) is an important gene, which is associated with the successful physical activity. The ACE gene has a major polymorphism (I/D) in intron 16 that determines its plasma and tissue levels. In this study, we aimed to determine whether there is an association between this polymorphism and sports performance in our studied population including elite athletes of different sports disciplines. We investigated allele frequency and genotype distribution of the ACE gene in 156 Iranian elite athletes compared to 163 healthy individuals. We also investigated this allele frequency between elite athletes in three functional groups of endurance, power, and mixed sports performances. DNA was extracted from peripheral blood, and polymerase chain reaction (PCR) method was performed on intron 16 of the ACE gene. The ACE genotype was determined for each subject. Statistical analysis was performed by SPSS 15, and results were analyzed by Chi-Square test. There was a significant difference in genotype distribution and allele frequency of the ACE gene in athletes and control group (P = 0.05, P = 0.03, respectively). There was also a significant difference in allele frequency of the ACE gene in 3 groups of athletes with different sports disciplines (P = 0.045). Proportion of the ACE gene D allele was greater in elite endurance athletes (37 high-distance cyclists) than two other groups. Findings of the present study demonstrated that there is an association between the ACE gene I/D polymorphism and sports performance in Iranian elite athletes.
Commissioning of the IDS Neutron Detector and $\\beta$-decay fast-timing studies at IDS
Piersa, Monika
2016-01-01
The following report describes my scientific activities performed during the Summer Student Programme at ISOLDE. The main part of my project was focused on commissioning the neutron detector dedicated to nuclear decay studies at ISOLDE Decay Station (IDS). I have participated in all the steps needed to make it operational for the IS609 experiment. In the testing phase, we obtained expected detector response and calibrations confirmed its successful commissioning. The detector was mounted in the desired geometry at IDS and used in measurements of the beta-delayed neutron emission of $^8$He. After completing aforementioned part of my project, I became familiar with the fast-timing method. This technique was applied at IDS in the IS610 experiment performed in June 2016 to explore the structure of neutron-rich $^{130-134}$Sn nuclei. Since the main part of my PhD studies will be the analysis of data collected in this experiment, the second part of my project was dedicated to acquiring knowledge about technical de...
Application of the Levenshtein Distance Metric for the Construction of Longitudinal Data Files
Doran, Harold C.; van Wamelen, Paul B.
2010-01-01
The analysis of longitudinal data in education is becoming more prevalent given the nature of testing systems constructed for No Child Left Behind Act (NCLB). However, constructing the longitudinal data files remains a significant challenge. Students move into new schools, but in many cases the unique identifiers (ID) that should remain constant…
12 CFR 908.23 - Good faith certification.
2010-01-01
... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Good faith certification. 908.23 Section 908.23... OPERATIONS RULES OF PRACTICE AND PROCEDURE IN HEARINGS ON THE RECORD General Rules § 908.23 Good faith... filing or submission of record is well-grounded in fact and is warranted by existing law or a good faith...
Directory of Open Access Journals (Sweden)
Sinem Nalbantoglu
2013-01-01
Full Text Available Henoch-Schönlein purpura (HSP is a small-vessel vasculitis of autoimmune hypersensitivity, and renin-angiotensin system (RAS regulates vascular homeostasis and inflammation with activation of cytokine release. Thus, we aimed to investigate the association between HSP and ACE I/D and AGT M235T polymorphisms. Genotyping was determined by allele specific PCR and PCR-RFLP. We obtained a significant difference in genotype distribution (p = 0.003 and allele frequencies (p 0.05 and allele frequencies (p > 0.05 of the AGT M235T polymorphism. Risk assessment showed significant risk for HSP in the subjects both with the ID + DD genotype (p = 0.019, OR: 2.288, 95% CI: 1.136–4.609 and D allele (OR: D vs. I: 2.0528, 95% CI: 1.3632–3.0912, p = 0.001 while no significant risk was obtained for HSP in the subjects both with the MT + TT genotype (p = 0.312, OR: 1.3905, 95% CI: 0.7326–2.6391 and T allele (OR: T vs. M: 1.065, 95% CI: 0.729–1.557, p = 0.743. Furthermore, when patients were stratified by the presence of certain systemic complications of HSP, no significant association was detected with ACE I/D, and AGT M235T polymorphisms. Our findings suggest that ACE I/D polymorphism is significantly associated with HSP susceptibility.
Expression of Id2 in the Second Heart Field and Cardiac Defects in Id2 Knock-Out Mice
Jongbloed, M. R. M.; Vicente-Steijn, R.; Douglas, Y. L.; Wisse, L. J.; Mori, K.; Yokota, Y.; Bartelings, M. M.; Schalij, M. J.; Mahtab, E. A.; Poelmann, R. E.; Gittenberger-De Groot, A. C.
2011-01-01
The inhibitor of differentiation Id2 is expressed in mesoderm of the second heart field, which contributes myocardial and mesenchymal cells to the primary heart tube. The role of Id2 in cardiac development is insufficiently known. Heart development was studied in sequential developmental stages in
2010-04-01
... water. Before packing into the containers for shipment or other delivery for consumption the oysters are... FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION FISH AND SHELLFISH Requirements for Specific Standardized Fish and Shellfish § 161.130 Oysters. (a...
2010-04-01
....161 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE... organized to enable appropriate TTB officers to trace each operation or transaction, monitor compliance with... invoices and cost accounting records, are acceptable if they show the required information or are annotated...
2010-07-01
... FOR REGISTRATION OF ANTIMICROBIAL PESTICIDES Product Chemistry Data Requirements § 161.150 General. (a) Applicability. This subpart describes the product chemistry data that are required to support the registration... characteristics must be considered. (iv) Certain data are needed as basic or supportive evidence in initiating or...
43 CFR 16.1 - Agreements to dispose of helium in natural gas.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Agreements to dispose of helium in natural gas. 16.1 Section 16.1 Public Lands: Interior Office of the Secretary of the Interior CONSERVATION OF HELIUM § 16.1 Agreements to dispose of helium in natural gas. (a) Pursuant to his authority and...
28 CFR 35.161 - Telecommunication devices for the deaf (TDD's).
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Telecommunication devices for the deaf (TDD's). 35.161 Section 35.161 Judicial Administration DEPARTMENT OF JUSTICE NONDISCRIMINATION ON THE... devices for the deaf (TDD's). Where a public entity communicates by telephone with applicants and...
21 CFR 150.161 - Artificially sweetened fruit preserves and jams.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Artificially sweetened fruit preserves and jams. 150.161 Section 150.161 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... karaya, gum tragacanth, algin (sodium alginate), sodium carboxymethylcellulose (cellulose gum...
ASSOCIATION OF ACTN3 R577X AND ACE I/D POLYMORPHISMS IN BRAZILIANS WRESTLERS
Directory of Open Access Journals (Sweden)
Marcelo Romanovitch Ribas
Full Text Available ABSTRACT Introduction: By associating genetics and sport, it is possible to identify subjects with greater capacity to adapt to training, and lower chances of injury. Objective: The investigation evaluated the genotypic and allelic distribution of ACTN3 R577X and ACE I/D polymorphisms in Brazilian high-performance athletes in wrestling and percussion combat sports. Methods: The study included 37 male athletes ranked from first to third place in world scenarios, divided into two groups: wrestling (23 wrestlers, being 11 of Judo, 4 of Greco-Roman style, 8 of Brazilian Jiu Jitsu, with mean age of 27.3 ± 6.9 years and percussion combat sports (14 athletes with a mean age of 25.7±4.4 years, being 6 of Karate, 3 of Muay Thai, 4 of Taekwondo, 1 Boxing. Genotyping of ACTN3 and ACE I/D polymorphisms was performed by polymerase chain reaction (PCR from the genomic DNA. Genotypic and allelic distributions were compared with control populations and athletes by Chi-square test and Fisher’s exact test; all analyzes considered p ≤ 0.05. Results: The genotypic distributions and allelic frequencies of ACTN3 RR=46%, RX=38% and XX=16%; R=65% and X=35%, and ACE I/D DD=47.7%, ID=34.3% and II=20%; D=62.9% and I=37.1% did not differ from the control population; however, when compared with wrestling athletes a significant difference was observed. Conclusion: These results suggest an association of ACTN3 R577X and ACE I/D genes with Brazilian high-performance wrestling athletes.
Endurance test of DUPIC irradiation test rig-003
Energy Technology Data Exchange (ETDEWEB)
Moon, J.S; Yang, M.S.; Lee, C.Y.; Ryu, J.S.; Jeon, H.G
2001-04-01
This report presents the pressure drop, vibration and endurance test results for DUPIC Irradiation Test Rig-003 which was design and fabricated by KAERI. From the pressure drop and vibration test results, it is verified that DUPIC Irradiation Test Rig-003 satisfied the limit conditions of HANARO. And, remarkable wear is not observed in DUPIC Irradiation Test Rig-003 during 40 endurance test days.
STS-98 U.S. Lab Destiny rests in Atlantis' payload bay
2001-01-01
KENNEDY SPACE CENTER, Fla. -- The U.S. Lab Destiny rests in the payload bay of Space Shuttle Atlantis before closure of the doors. A key element in the construction of the International Space Station, Destiny is 28 feet long and weighs 16 tons. Destiny will be attached to the Unity node on the ISS using the Shuttle'''s robot arm, seen here on the left side, with the help of an elbow camera attached to the arm (near the upper end of the lab in the photo). This research and command-and-control center is the most sophisticated and versatile space laboratory ever built. It will ultimately house a total of 23 experiment racks for crew support and scientific research. Destiny will fly on STS-98, the seventh construction flight to the ISS. Launch of STS-98 is scheduled for Jan. 19 at 2:11 a.m. EST.
34 CFR 668.161 - Scope and purpose (cash management rules).
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Scope and purpose (cash management rules). 668.161... POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cash Management § 668.161 Scope and purpose (cash management rules). (a) General. (1) This subpart establishes the rules and...
2012-01-12
... reasons. The Exchange believes that it is a more straightforward way to communicate floating volume tiers... Rates'' at http://www.nasdaqtrader.com/Trader.aspx?id=PriceListTrading2#rebates , and EDGX Exchange Fee... SECURITIES AND EXCHANGE COMMISSION [Release No. 34-66115; File No. SR-NYSEArca-2011-101] Self...
46 CFR 161.002-15 - Sample extraction smoke detection systems.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Sample extraction smoke detection systems. 161.002-15..., CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Fire-Protective Systems § 161.002-15 Sample extraction smoke detection systems. The smoke detecting system must consist of a means for...
76 FR 56191 - Combined Notice of Filings #2
2011-09-12
... on Friday, September 23, 2011. Docket Numbers: ER11-4431-000. Applicants: Lucky Lady Oil Company. Description: Lucky Lady Oil Company Cancellation Notice. Filed Date: 09/02/2011. Accession Number: 20110902... that the Commission received the following electric rate filings: Docket Numbers: ER11-2970-001. [[Page...
77 FR 47831 - Combined Notice of Filings #1
2012-08-10
... Corporation for Approval of an Interpretation to Reliability Standard CIP-004-4--Personnel and Training. Filed... Due: 5 p.m. ET 8/23/12. Take notice that the Commission received the following electric reliability filings. Docket Numbers: RD12-5-000. Applicants: North American Electric Reliability Corporation...
Directory of Open Access Journals (Sweden)
Anukriti Singh
2018-04-01
Full Text Available Renin angiotensin system (RAS comprising Angiotensin converting enzyme (ACE, Angiotensin II (Ang II and its receptor Angiotensin II receptor type I (AGTR1, plays a critical role in several diseases including cancer. A single nucleotide polymorphism (SNP A1166C located in 3′ untranslated region (UTR of AGTR1 and an insertion/deletion (I/D polymorphism present in intron 16 of ACE gene have been associated with many diseases, but their association with Breast cancer (BCa is still debatable. Here, we for the first time investigated the association of these polymorphisms in a North Indian BCa cohort including 161 patients and 152 healthy women. The polymorphisms were evaluated by polymerase chain reaction (PCR and restriction fragment length polymorphism (RFLP respectively. The association between these polymorphisms and BCa risk was estimated by calculating Odds Ratio (OR and chi-square (χ2 test. The DD genotype/D allele of ACE (I/D polymorphism and “AC and CC” genotype/C allele of AGTR1 (A1166C polymorphism were associated with higher risk of BCa when evaluated independently. Furthermore, interaction analysis of “AC and CC” and DD genotype and combination of “C and D” alleles of both polymorphisms revealed significantly greater BCa risk than that observed independently. Conclusively, women harboring “AC or CC” genotype/C allele for AGTR1 (A1166C polymorphism and DD genotype/D allele for ACE (I/D polymorphisms have a predisposition to develop more aggressive disease with advanced staging and larger tumor size. Our study indicates importance of genetic screening based on these polymorphisms for women, who may have higher risk of BCa.
25 CFR 1000.161 - What is a self-governance compact?
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false What is a self-governance compact? 1000.161 Section 1000... EDUCATION ACT Negotiation Process for Annual Funding Agreements Negotiating A Self-Governance Compact § 1000.161 What is a self-governance compact? A self-governance compact is an executed document that affirms...
Cyclin D1, Id1 and EMT in breast cancer
International Nuclear Information System (INIS)
Tobin, Nicholas P; Sims, Andrew H; Lundgren, Katja L; Lehn, Sophie; Landberg, Göran
2011-01-01
Cyclin D1 is a well-characterised cell cycle regulator with established oncogenic capabilities. Despite these properties, studies report contrasting links to tumour aggressiveness. It has previously been shown that silencing cyclin D1 increases the migratory capacity of MDA-MB-231 breast cancer cells with concomitant increase in 'inhibitor of differentiation 1' (ID1) gene expression. Id1 is known to be associated with more invasive features of cancer and with the epithelial-mesenchymal transition (EMT). Here, we sought to determine if the increase in cell motility following cyclin D1 silencing was mediated by Id1 and enhanced EMT-features. To further substantiate these findings we aimed to delineate the link between CCND1, ID1 and EMT, as well as clinical properties in primary breast cancer. Protein and gene expression of ID1, CCND1 and EMT markers were determined in MDA-MB-231 and ZR75 cells by western blot and qPCR. Cell migration and promoter occupancy were monitored by transwell and ChIP assays, respectively. Gene expression was analysed from publicly available datasets. The increase in cell migration following cyclin D1 silencing in MDA-MB-231 cells was abolished by Id1 siRNA treatment and we observed cyclin D1 occupancy of the Id1 promoter region. Moreover, ID1 and SNAI2 gene expression was increased following cyclin D1 knock-down, an effect reversed with Id1 siRNA treatment. Similar migratory and SNAI2 increases were noted for the ER-positive ZR75-1 cell line, but in an Id1-independent manner. In a meta-analysis of 1107 breast cancer samples, CCND1 low /ID1 high tumours displayed increased expression of EMT markers and were associated with reduced recurrence free survival. Finally, a greater percentage of CCND1 low /ID1 high tumours were found in the EMT-like 'claudin-low' subtype of breast cancer than in other subtypes. These results indicate that increased migration of MDA-MB-231 cells following cyclin D1 silencing can be mediated by Id
49 CFR 173.161 - Chemical kits and first aid kits.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Chemical kits and first aid kits. 173.161 Section... Class 7 § 173.161 Chemical kits and first aid kits. (a) Chemical kits and First aid kits must conform to... 10 kg. (b) Chemical kits and First aid kits are excepted from the specification packaging...
Sabolčák, Peter
2006-01-01
FlowIDS is system which can detect some of the undesirable traffi c in computer networks (undesirable traffic could be also ie. virus activity or overloading of network) and mostly doing counteraction which are set by administrator. Information about data ows are provided by hardware of network infrastructure, eliminitaion of undesirable activity is done through changes in network hardware settings. Regarding the quantity of solution which are provided on market, I decided to focus on Cisco n...
37 CFR 360.23 - Content of notices regarding independent administrators.
2010-07-01
... independent administrators. 360.23 Section 360.23 Patents, Trademarks, and Copyrights COPYRIGHT ROYALTY BOARD, LIBRARY OF CONGRESS SUBMISSION OF ROYALTY CLAIMS FILING OF CLAIMS TO ROYALTY FEES COLLECTED UNDER COMPULSORY LICENSE Digital Audio Recording Devices and Media Royalty Claims § 360.23 Content of notices...
STS-93 crew have breakfast before launch in O&C Building
1999-01-01
The STS-93 crew gathers a third time for a pre-launch breakfast in the Operations and Checkout Building before suiting up for launch. After Space Shuttle Columbia's July 22 launch attempt was scrubbed due to the weather, the launch was rescheduled for Friday, July 23, at 12:24 a.m. EDT. Seated from left are Mission Specialists Catherine G. Coleman (Ph.D.) and Steven A. Hawley (Ph.D.); Commander Eileen M. Collins; Mission Specialist Michel Tognini, of France, who represents the Centre National d'Etudes Spatiales (CNES); and Pilot Jeffrey S. Ashby. STS-93 is a five- day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. Collins is the first woman to serve as commander of a Shuttle mission. The target landing date is July 27, 1999, at 11:20 p.m. EDT.
2010-10-01
..., DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Personal Flotation Device Lights § 161.012-1 Scope. (a) This subpart... approving personal flotation device lights fitted on Coast Guard approved life preservers, bouyant vests...
Kanabus, Benoît; Popa, Délia
2017-01-01
Dès lors, on entend mieux la question sur laquelle se referment les mille pages du Marx : « La pensée de Marx nous place devant la question abyssale : qu’est-ce que la vie » ? Cette question peut être reposée à nouveaux frais à l’âge du capitalisme avancé, où, comme le notait Adorno, la vie est devenue « l’idéologie de sa propre absence ». La recherche d’un autre rapport à l’idéologie vient alors prendre le relais de la lutte anti-idéologique de la théorie critique. Cette recherche part du po...
26 CFR 1.501(c)(16)-1 - Corporations organized to finance crop operations.
2010-04-01
... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Corporations organized to finance crop operations. 1.501(c)(16)-1 Section 1.501(c)(16)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Exempt Organizations § 1.501(c)(16)-1 Corporations organized to finance crop...
ID3 contributes to cerebrospinal fluid seeding and poor prognosis in medulloblastoma
International Nuclear Information System (INIS)
Phi, Ji Hoon; Choi, Seung Ah; Lim, Sang-Hee; Lee, Joongyub; Wang, Kyu-Chang; Park, Sung-Hye; Kim, Seung-Ki
2013-01-01
The inhibitor of differentiation (ID) genes have been implicated as promoters of tumor progression and metastasis in many human cancers. The current study investigated the expression and functional roles of ID genes in seeding and prognosis of medulloblastoma. ID gene expression was screened in human medulloblastoma tissues. Knockdown of ID3 gene was performed in medulloblastoma cells in vitro. The expression of metastasis-related genes after ID3 knockdown was assessed. The effect of ID3 knockdown on tumor seeding was observed in an animal model in vivo. The survival of medulloblastoma patients was plotted according to the ID3 expression levels. Significantly higher ID3 expression was observed in medulloblastoma with cerebrospinal fluid seeding than tumors without seeding. Knockdown of ID3 decreased proliferation, increased apoptosis, and suppressed the migration of D283 medulloblastoma cells in vitro. In a seeding model of medulloblastoma, ID3 knockdown in vivo with shRNA inhibited the growth of primary tumors, prevented the development of leptomeningeal seeding, and prolonged animal survival. High ID3 expression was associated with shorter survival of medulloblastoma patients, especially in Group 4 medulloblastomas. High ID3 expression is associated with medullolbastoma seeding and is a poor prognostic factor, especially in patients with Group 4 tumors. ID3 may represent the metastatic/ aggressive phenotype of a subgroup of medulloblastoma
46 CFR 161.012-3 - Definitions.
2010-10-01
... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Personal Flotation Device Lights § 161.012-3 Definitions. (a) As used in this subpart, PFD means Coast Guard approved personal flotation device. (b) For the purpose of...
50 CFR 14.161 - Primary enclosures.
2010-10-01
... Wild Mammals and Birds to the United States Specifications for Other Terrestrial Mammals § 14.161... primary enclosure shall provide adequate space for the animal to stand upright in a normal posture with... lie in a full prone position. Specifications for Birds ...
ID-pilet teeb Tallinnas võidukäiku / Anneli Lepp
Lepp, Anneli
2006-01-01
Vt. ka Postimees : na russkom jazõke 12. jaan. lk 3. Tallinna transpordiameti peaökonomisti Mart Moosuse sõnul moodustas ID-pilet 60,7% ühistranspordi piletituludest, Tartus oli vastav näitaja aga alla 1%. Tartut teenindava bussifirma AS Connex Eesti finantsjuht Tiina Telling peab suure erinevuse põhjuseks asjaolu, et Tallinnas on ID-pilet paberpiletist 40-88% soodsam, Tartus hinnavahe aga puudub või on lausa negatiivne ID-pileti kahjuks. Lisa: ID-pilet
Mimouni-Bloch, Aviva; Yeshaya, Josepha; Kahana, Sarit; Maya, Idit; Basel-Vanagaite, Lina
2015-11-01
Microdeletions of various sizes in the 2p16.1-p15 chromosomal region have been grouped together under the 2p16.1-p15 microdeletion syndrome. Children with this syndrome generally share certain features including microcephaly, developmental delay, facial dysmorphism, urogenital and skeletal abnormalities. We present a child with a de-novo interstitial 1665 kb duplication of 2p16.1-p15. Clinical features of this child are distinct from those of children with the 2p16.1-p15 microdeletion syndrome, specifically the head circumference which is within the normal range and mild intellectual disability with absence of autistic behaviors. Microduplications many times bear milder clinical phenotypes in comparison with corresponding microdeletion syndromes. Indeed, as compared to the microdeletion syndrome patients, the 2p16.1-p15 microduplication seems to have a milder cognitive effect and no effect on other body systems. Limited information available in genetic databases about cases with overlapping duplications indicates that they all have abnormal developmental phenotypes. The involvement of genes in this location including BCL11A, USP34 and PEX13, affecting fundamental developmental processes both within and outside the nervous system may explain the clinical features of the individual described in this report. Copyright © 2015 European Paediatric Neurology Society. Published by Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Macé, Aurélien; Tuke, Marcus A; Deelen, Patrick
2017-01-01
There are few examples of robust associations between rare copy number variants (CNVs) and complex continuous human traits. Here we present a large-scale CNV association meta-analysis on anthropometric traits in up to 191,161 adult samples from 26 cohorts. The study reveals five CNV associations......-scale genome-wide meta-analysis of structural variation and find rare CNVs associated with height, weight and BMI with large effect sizes.......)). Burden analysis shows a 0.41 cm decrease in height, a 0.003 increase in waist-to-hip ratio and increase in BMI by 0.14 kg/m(2) for each Mb of total deletion burden (P = 2.5 × 10(-10), 6.0 × 10(-5), and 2.9 × 10(-3)). Our study provides evidence that the same genes (e.g., MC4R, FIBIN, and FMO5) harbor...
2010-07-01
... CHEMICAL INVENTORY REGULATIONS 2002 Inventory Update Reporting § 710.23 Definitions. In addition to the... part. Master Inventory File means EPA's comprehensive list of chemical substances which constitute the Chemical Substances Inventory compiled under section 8(b) of the Act. It includes substances reported under...
Epigenetic inactivation of inhibitor of differentiation 4 (Id4) correlates with prostate cancer
International Nuclear Information System (INIS)
Sharma, Pankaj; Chinaranagari, Swathi; Patel, Divya; Carey, Jason; Chaudhary, Jaideep
2012-01-01
The inhibitor of DNA-binding (Id) proteins, Id1–4 are negative regulators of basic helix-loop-helix (bHLH) transcription factors. As key regulators of cell cycle and differentiation, expression of Id proteins are increasingly observed in many cancers and associated with aggressiveness of the disease. Of all the four Id proteins, the expression of Id1, Id2, and to a lesser extent, Id3 in prostate cancer and the underlying molecular mechanism is relatively well known. On the contrary, our previous results demonstrated that Id4 acts as a potential tumor suppressor in prostate cancer. In the present study, we extend these observations and demonstrate that Id4 is down-regulated in prostate cancer due to promoter hypermethylation. We used prostate cancer tissue microarrays to investigate Id4 expression. Methylation specific PCR on bisulfite treated DNA was used to determine methylation status of Id4 promoter in laser capture micro-dissected normal, stroma and prostate cancer regions. High Id4 expression was observed in the normal prostate epithelial cells. In prostate cancer, a stage-dependent decrease in Id4 expression was observed with majority of high grade cancers showing no Id4 expression. Furthermore, Id4 expression progressively decreased in prostate cancer cell line LNCaP and with no expression in androgen-insensitive LNCaP-C81 cell line. Conversely, Id4 promoter hypermethylation increased in LNCaP-C81 cells suggesting epigenetic silencing. In prostate cancer samples, loss of Id4 expression was also associated with promoter hypermethylation. Our results demonstrate loss of Id4 expression in prostate cancer due to promoter hypermethylation. The data strongly support the role of Id4 as a tumor suppressor
75 FR 37789 - Orlando Utilities Commission; Notice of Filing
2010-06-30
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. NJ10-2-000] Orlando Utilities Commission; Notice of Filing June 23, 2010. Take notice that on June 11, 2010, the Orlando Utilities Commission filed, pro forma revised tariff sheets for inclusion in its open access transmission...
Schieve, Laura A.; Clayton, Heather B.; Durkin, Maureen S.; Wingate, Martha S.; Drews-Botsch, Carolyn
2015-01-01
While studies report associations between perinatal outcomes and both autism spectrum disorder (ASD) and intellectual disability (ID), there has been little study of ASD with versus without co-occurring ID. We compared perinatal risk factors among 7547 children in the 2006-2010 Autism and Developmental Disability Monitoring Network classified as…
Achieving Payoffs from an Industry Cloud Ecosystem at BankID
DEFF Research Database (Denmark)
Eaton, Ben; Hallingby, Hanne Kristine; Nesse, Per-Jonny
2014-01-01
BankID is an industry cloud owned by Norwegian banks. It provides electronic identity, authentication and electronic signing capabilities for banking, merchant and government services. More than 60% of the population uses BankID services. As the broader ecosystem around BankID evolved, challenges......—arising from tensions between different parts of the ecosystem—had to be resolved. The four lessons learned from the BankID case will help others to build an industry cloud and establish a healthy ecosystem to service a broad user base....
46 CFR 161.006-1 - Applicable specifications.
2010-10-01
... Nickel Plus Chromium and Nickel Plus Chromium—161.006-4 You may obtain these standards from The American...) Underwriters' Laboratories, Inc.: Standard for flexible cord and fixture wire, third edition, October, 1935. (b...
IMI's CANCER-ID: Status of liquid biopsy standardization
Pantel, Klaus; Terstappen, Leon W. M. M.; Baggiani, Barbara; Krahn, Thomas; Schlange, Thomas
The CANCER-ID (www.cancer-id.eu) consortium was established in early 2015 with more than 30 partners as part of the Innovative Medicines Initiative (IMI), Europe's largest public-private partnership funded in equal parts by the European Union and the European Federation of Pharmaceutical Industries
Security analysis for biometric data in ID documents
Schimke, S.; Kiltz, S.; Vielhauer, C.; Kalker, A.A.C.M.
2005-01-01
In this paper we analyze chances and challenges with respect to the security of using biometrics in ID documents. We identify goals for ID documents, set by national and international authorities, and discuss the degree of security, which is obtainable with the inclusion of biometric into documents
36 CFR 13.161 - Permit application.
2010-07-01
... Section 13.161 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR... blueprint, sketch or photograph of the cabin or structure; (d) A map that shows the geographic location of... cabin or structure. All information may be provided orally except the cabin blueprint, sketch or...
Lynch, Michael
2017-08-01
This essay takes up a series of questions about the connection between 'symmetry' in Science and Technology Studies (STS) and 'post-truth' in contemporary politics. A recent editorial in this journal by Sergio Sismondo argues that current discussions of 'post-truth' have little to do with conceptions of 'symmetry' or with concerns about 'epistemic democracy' in STS, while others, such as Steve Fuller and Harry Collins, insist that there are such connections. The present essay discusses a series of questions about the meaning of 'post-truth' and 'symmetry', and the connections of those concepts to each other and to 'epistemic democracy'. The essay ends with a series of other questions about STS and contemporary politics, and an invitation to further discussions.
A brief review of revocable ID-based public key cryptosystem
Directory of Open Access Journals (Sweden)
Tsu-Yang Wu
2016-03-01
Full Text Available The design of ID-based cryptography has received much attention from researchers. However, how to revoke the misbehaviour/compromised user in ID-based public key cryptosystem becomes an important research issue. Recently, Tseng and Tsai proposed a novel public key cryptosystem called revocable ID-based public key cryptosystem (RIBE to solve the revocation problem. Later on, numerous research papers based on the Tseng-Tsai key RIBE were proposed. In this paper, we brief review Tseng and Tsai's RIBE. We hope this review can help the readers to understand the Tseng and Tsai's revocable ID-based public key cryptosystem.
Id1 represses osteoclast-dependent transcription and affects bone formation and hematopoiesis.
Directory of Open Access Journals (Sweden)
April S Chan
2009-11-01
Full Text Available The bone-bone marrow interface is an area of the bone marrow microenvironment in which both bone remodeling cells, osteoblasts and osteoclasts, and hematopoietic cells are anatomically juxtaposed. The close proximity of these cells naturally suggests that they interact with one another, but these interactions are just beginning to be characterized.An Id1(-/- mouse model was used to assess the role of Id1 in the bone marrow microenvironment. Micro-computed tomography and fracture tests showed that Id1(-/- mice have reduced bone mass and increased bone fragility, consistent with an osteoporotic phenotype. Osteoclastogenesis and pit formation assays revealed that loss of Id1 increased osteoclast differentiation and resorption activity, both in vivo and in vitro, suggesting a cell autonomous role for Id1 as a negative regulator of osteoclast differentiation. Examination by flow cytometry of the hematopoietic compartment of Id1(-/- mice showed an increase in myeloid differentiation. Additionally, we found increased expression of osteoclast genes, TRAP, Oscar, and CTSK in the Id1(-/- bone marrow microenvironment. Lastly, transplantation of wild-type bone marrow into Id1(-/- mice repressed TRAP, Oscar, and CTSK expression and activity and rescued the hematopoietic and bone phenotype in these mice.In conclusion, we demonstrate an osteoporotic phenotype in Id1(-/- mice and a mechanism for Id1 transcriptional control of osteoclast-associated genes. Our results identify Id1 as a principal player responsible for the dynamic cross-talk between bone and bone marrow hematopoietic cells.
Measurement and interpretation of the W-pair cross-section in $e^+ e^-$ interactions at 161 GeV
Abreu, P; Adye, T; Adzic, P; Ajinenko, I; Alekseev, G D; Alemany, R; Allport, P P; Almehed, S; Amaldi, Ugo; Amato, S; Andreazza, A; Andrieux, M L; Antilogus, P; Apel, W D; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbi, M S; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Bärring, O; Barrio, J A; Bartl, Walter; Bates, M J; Battaglia, Marco; Baubillier, M; Baudot, J; Becks, K H; Begalli, M; Beillière, P; Belokopytov, Yu A; Belous, K S; Benvenuti, Alberto C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bianchi, F; Bigi, M; Bilenky, S M; Billoir, P; Bizouard, M A; Bloch, D; Blume, M; Bolognese, T; Bonesini, M; Bonivento, W; Booth, P S L; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Bozzo, M; Branchini, P; Brand, K D; Brenke, T; Brenner, R A; Bricman, C; Brown, R C A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camacho-Rozas, A J; Camporesi, T; Canale, V; Canepa, M; Cankocak, K; Cao, F; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chen, M; Chierici, R; Chliapnikov, P V; Chochula, P; Chorowicz, V; Chudoba, J; Cindro, V; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Dahl-Jensen, Erik; Dahm, J; D'Almagne, B; Dam, M; Damgaard, G; Dauncey, P D; Davenport, Martyn; Da Silva, W; Defoix, C; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Brabandere, S; De Clercq, C; La Vaissière, C de; De Lotto, B; De Min, A; De Paula, L S; De Saint-Jean, C; Dijkstra, H; Di Ciaccio, Lucia; Di Diodato, A; Djannati, A; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Drees, K A; Dris, M; Durand, J D; Edsall, D M; Ehret, R; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Elsing, M; Engel, J P; Erzen, B; Falk, E; Fanourakis, G K; Fassouliotis, D; Feindt, Michael; Ferrari, P; Ferrer, A; Fichet, S; Filippas-Tassos, A; Firestone, A; Fischer, P A; Föth, H; Fokitis, E; Fontanelli, F; Formenti, F; Franek, B J; Frenkiel, P; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gandelman, M; García, C; García, J; Gaspar, C; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerber, J P; Gerdyukov, L N; Gokieli, R; Golob, B; Gonçalves, P; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Graziani, E; Green, C; Grefrath, A; Gris, P; Grosdidier, G; Grzelak, K; Gumenyuk, S A; Gunnarsson, P; Günther, M; Guy, J; Hahn, F; Hahn, S; Hajduk, Z; Hallgren, A; Hamacher, K; Harris, F J; Hedberg, V; Henriques, R P; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Hilke, Hans Jürgen; Hill, T S; Holmgren, S O; Holt, P J; Holthuizen, D J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, L B; Jönsson, P E; Joram, Christian; Juillot, P; Kaiser, M; Kapusta, F; Karafasoulis, K; Karlsson, M; Katsanevas, S; Katsoufis, E C; Keränen, R; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; King, B J; Kjaer, N J; Klapp, O; Klein, H; Klovning, A; Kluit, P M; Knoblauch, D; Kokkinias, P; Konoplyannikov, A K; Koratzinos, M; Korcyl, K; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kreuter, C; Kronkvist, I J; Krumshtein, Z; Krupinski, W; Kubinec, P; Kucewicz, W; Kurvinen, K L; Lacasta, C; Laktineh, I; Lamsa, J; Lanceri, L; Lane, D W; Langefeld, P; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Legan, C K; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Libby, J; Liko, D; Lindner, R; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Maehlum, G; Mahon, J R; Maio, A; Malmgren, T G M; Malychev, V; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Masik, J; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; Medbo, J; Merk, M; Meroni, C; Meyer, S; Meyer, W T; Michelotto, M; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Møller, R; Mönig, K; Monge, M R; Morettini, P; Müller, H; Münich, K; Mulders, M; Mundim, L M; Murray, W J; Muryn, B; Myatt, Gerald; Naraghi, F; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Neumann, W; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nieuwenhuizen, M; Nikolaenko, V; Niss, P; Nomerotski, A; Normand, Ainsley; Oberschulte-Beckmann, W; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganini, P; Paganoni, M; Pagès, P; Pain, R; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Passeri, A; Pegoraro, M; Peralta, L; Pernegger, H; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Piana, G; Pierre, F; Pimenta, M; Podobnik, T; Podobrin, O; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Reale, M; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Richardson, J; Rídky, J; Rinaudo, G; Ripp, I; Romero, A; Roncagliolo, I; Ronchese, P; Roos, L; Rosenberg, E I; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ruiz, A; Rybicki, K; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sahr, O; Sajot, G; Salt, J; Sánchez, J; Sannino, M; Schneider, H; Schwickerath, U; Schyns, M A E; Sciolla, G; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seitz, A; Sekulin, R L; Serbelloni, L; Shellard, R C; Siegrist, P; Silvestre, R; Simonetti, S; Simonetto, F; Sissakian, A N; Sitár, B; Skaali, T B; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Sokolov, A; Solovyanov, O; Sosnowski, R; Souza-Santos, D; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stampfer, D; Stanescu, C; Stanic, S; Stapnes, Steinar; Stavitski, I; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Tavernet, J P; Terranova, F; Thomas, J; Tilquin, A; Timmermans, J; Tkatchev, L G; Todorov, T; Todorova, S; Toet, D Z; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tranströmer, G; Treille, D; Tristram, G; Trombini, A; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tyndel, M; Tzamarias, S; Überschär, B; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; Van der Velde, C; van Apeldoorn, G W; van Dam, P; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Vilanova, D; Vincent, P; Vitale, L; Vlasov, E; Vodopyanov, A S; Vrba, V; Wahlen, H; Walck, C; Waldner, F; Weilhammer, Peter; Weiser, C; Wetherell, Alan M; Wicke, D; Wickens, J H; Wielers, M; Wilkinson, G R; Williams, W S C; Winter, M; Witek, M; Wlodek, T; Woschnagg, K; Yip, K; Yushchenko, O P; Zach, F; Zaitsev, A; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zito, M; Zontar, D; Zucchelli, G C; Zumerle, G
1997-01-01
In 1996 LEP ran at a centre-of-mass energy of 161~GeV, just above the threshold of W-pair production. DELPHI accumulated data corresponding to an integrated luminosity of $9.93 {\\mathrm{~pb^{-1}}}$, and observed 29 events that are considered as candidates for W-pair production. From these, a cross-section for the doubly resonant $e^+e^-\\to\\mathrm{WW}$ process of $3.67~^{+0.97}_{-0.85} \\pm 0.19{\\mathrm{~pb}}$ has been measured. Within the Standard Model, this cross-section corresponds to a mass of the W-boson of ${\\mathrm{80.40~\\pm~0.44~(stat.)~\\pm~0.09~(syst.) ~\\pm 0.03~(LEP)~GeV}}/c^2$. Alternatively, if $m_{\\mathrm{W}}$ is held fixed at its current value determined by other experiments, the observed cross-section is used to obtain limits on trilinear ${\\mathrm{WWV (V \\equiv \\gamma, Z)}}$ couplings.
La certificazione professionale I&D in Europa
Franco, Augusta
2003-01-01
The statement points out the activity of I&D European associations in the field of competences' certification, in ECIA federation's area as well as in the national one. In the statement there are references on history and outcomes of DECIDoc project; objectives and operative stages of CERTIDoc project, promoted by ECIA; and enterprises of I&D associations in France, Spain, Germany and Italy. Secondly, it is illustrated the activity of Italian librarians and archivists associatio...
Ning, Nian-Zhi; Liu, Xiong; Bao, Chun-Mei; Chen, Su-Ming; Cui, En-Bo; Zhang, Ju-Ling; Huang, Jie; Chen, Fang-Hong; Li, Tao; Qu, Fen; Wang, Hui
2017-01-05
Carbapenem-resistant Acinetobacter baumannii poses a significant threat to hospitalized patients, as few therapeutic options remain. Thus, we investigated the molecular epidemiology and mechanism of resistance of carbapenem-resistant A.baumannii isolates in Beijing, China. Carbapenem-resistant A.baumannii isolates (n = 101) obtained between June 2009 and November 2014 were used. Multilocus sequence typing (MLST) and PCR assays for class C and D β-lactamase were performed on all isolates. S1 nuclease pulsed-field gel electrophoresis (PFGE) and Southern blot hybridization were performed to identify the resistance gene location. All 101 A.baumannii isolates were highly resistant to frequently used antimicrobials, and were considered multidrug resistant. A total of 12 sequence types (STs) were identified, including 10 reported STs and 2 novel STs. Eighty-seven isolates were classified to clonal complex 92 (CC92), among which ST191 and ST195 were the most common STs. The bla OXA-23 gene was positive in most (n = 95) of the A.baumannii isolates. Using S1-nuclease digestion PFGE and Southern blot hybridization, 3 patterns of plasmids carrying bla OXA-23 were confirmed. ST191 and ST195 (both harboring bla OXA-23 ) caused outbreaks during the study period, and this is the first report of outbreaks caused by ST191 and ST195 in north China. bla OXA-23 -producing A.baumannii ST191 and ST 195 isolates can disseminate in a hospital and are potential nosocomial outbreak strains. Surveillance of imipenem-resistant A.baumannii and antimicrobial stewardship should be strengthened.
Directory of Open Access Journals (Sweden)
Nicolai J. Wewer Albrechtsen
2017-11-01
Full Text Available Glucagon is secreted from pancreatic α cells, and hypersecretion (hyperglucagonemia contributes to diabetic hyperglycemia. Molecular heterogeneity in hyperglucagonemia is poorly investigated. By screening human plasma using high-resolution-proteomics, we identified several glucagon variants, among which proglucagon 1-61 (PG 1-61 appears to be the most abundant form. PG 1-61 is secreted in subjects with obesity, both before and after gastric bypass surgery, with protein and fat as the main drivers for secretion before surgery, but glucose after. Studies in hepatocytes and in β cells demonstrated that PG 1-61 dose-dependently increases levels of cAMP, through the glucagon receptor, and increases insulin secretion and protein levels of enzymes regulating glycogenolysis and gluconeogenesis. In rats, PG 1-61 increases blood glucose and plasma insulin and decreases plasma levels of amino acids in vivo. We conclude that glucagon variants, such as PG 1-61, may contribute to glucose regulation by stimulating hepatic glucose production and insulin secretion.
Highlights of SPring-8 BL23SU in 2001
Agui, A; Nakatani, T; Yokoya, A; Yoshigoe, A
2002-01-01
BL23SU in SPring-8 is a soft x-ray beamline for the material science project in JAERI. The insertion device, monochromator and other beamline equipments have been installed or developed. The beamline maintenance has also been continued. We report highlights of these activities for the BL23SU in 2001. Specially, it has proceeded with the countermeasure against the rise in the maximum radiant power, toward the low-energy operation realization. And, improvement in that precision proceeds through the COD correlation to the ID drive as well.
People with ID as interviewers and co-researchers: experiences and reflection.
Lieshout, H. van
2012-01-01
Aim: To share the experience of working with people with intellectual disabilities (ID) as interviewers in a qualitative study about community participation of people with ID. We reflect on two perspectives: the interviewers and the researchers. Method: Eighteen people with ID were interviewed by
An online ID identification system for liquefied-gas cylinder plant
He, Jin; Ding, Zhenwen; Han, Lei; Zhang, Hao
2017-11-01
An automatic ID identification system for gas cylinders' online production was developed based on the production conditions and requirements of the Technical Committee for Standardization of Gas Cylinders. A cylinder ID image acquisition system was designed to improve the image contrast of ID regions on gas cylinders against the background. Then the ID digits region was located by the CNN template matching algorithm. Following that, an adaptive threshold method based on the analysis of local average grey value and standard deviation was proposed to overcome defects of non-uniform background in the segmentation results. To improve the single digit identification accuracy, two BP neural networks were trained respectively for the identification of all digits and the easily confusable digits. If the single digit was classified as one of confusable digits by the former BP neural network, it was further tested by the later one, and the later result was taken as the final identification result of this single digit. At last, the majority voting was adopted to decide the final identification result for the 6-digit cylinder ID. The developed system was installed on a production line of a liquefied-petroleum-gas cylinder plant and worked in parallel with the existing weighing step on the line. Through the field test, the correct identification rate for single ID digit was 94.73%, and none of the tested 2000 cylinder ID was misclassified through the majority voting.
Hindered El Transitions in Eu155 and Tb161
International Nuclear Information System (INIS)
Malmskog, Sven G.
1965-02-01
The absolute E1 transition probabilities from the 3/2 + (411), 5/2 - (532) and 7/2 - (523) single particle levels in Eu 155 and Tb 161 have been measured by the method of delayed coincidences. This gave half lives of T 1/2 1/2 = (1.38 ± 0.06) ns for the 104.4 and 246 keV levels in Eu 155 . T 1/2 = (0.84 ± 0.04) ns and T 1/2 161 . The result has been compared with the calculations of a single particle in a deformed potential made by Nilsson
2013-07-24
... Transmission Vegetation Management Reliability Standard; Notice of Compliance Filing Take notice that on July 12, 2013, the North American Electric Reliability Corporation (NERC), pursuant to Order No. 777 \\1... Reliability Standard FAC-003-2 to its Web site. \\1\\ Revisions to Reliability Standard for Transmission...
77 FR 31841 - Hope Gas, Inc.; Notice of Baseline Filing
2012-05-30
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR12-23-001] Hope Gas, Inc.; Notice of Baseline Filing Take notice that on May 16, 2012, Hope Gas, Inc. (Hope Gas) submitted a revised baseline filing of their Statement of Operating Conditions for services provided under Section 311 of the...
77 FR 26535 - Hope Gas, Inc.; Notice of Baseline Filing
2012-05-04
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR12-23-000] Hope Gas, Inc.; Notice of Baseline Filing Take notice that on April 26, 2012, Hope Gas, Inc. (Hope Gas) submitted a baseline filing of their Statement of Operating Conditions for services provided under Section 311 of the...
Supporting co-creation with software, the idSpace platform
Van Rosmalen, Peter; Boon, Jo; Bitter-Rijpkema, Marlies; Sie, Rory; Sloep, Peter
2014-01-01
Innovation, in general, requires teamwork among specialist of different disciplines. The idSpace project developed ideas on how teams of collaborating innovators could best be supported. These ideas were embodied in a platform that the project developed. This idSpace platform allows its users to
Experiment information - GRIPDB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us GRI...a.nbdc01665-002 Description of data contents Experimentally identified GPCR interaction regions Data file File name: gri...pdb_exp_info.zip File URL: ftp://ftp.biosciencedbc.jp/archive/gripdb/LATEST/gripdb_exp_info.zip ...File size: 6.2 KB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/gri...es Data item Description ID Experiment information ID GRIP ID1 GRIP ID related wigh the experiment GRIP ID2 No. in GRI
14 CFR 61.161 - Aeronautical experience: Rotorcraft category and helicopter class rating.
2010-01-01
... category and helicopter class rating. 61.161 Section 61.161 Aeronautics and Space FEDERAL AVIATION... helicopter class rating. (a) A person who is applying for an airline transport pilot certificate with a rotorcraft category and helicopter class rating, must have at least 1,200 hours of total time as a pilot that...
Reference: 161 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available ids, based on thin layer chromatography. The identity of the Ala, Asp, Phe, and T...rp conjugates was verified by gas chromatography-mass spectrometry. Insertional mutations in GH3.1, GH3.2, G
A Contextual Model for Identity Management (IdM) Interfaces
Fuller, Nathaniel J.
2014-01-01
The usability of Identity Management (IdM) systems is highly dependent upon design that simplifies the processes of identification, authentication, and authorization. Recent findings reveal two critical problems that degrade IdM usability: (1) unfeasible techniques for managing various digital identifiers, and (2) ambiguous security interfaces.…
DEFF Research Database (Denmark)
Schøsler, Jørn
2013-01-01
Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer.......Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer....
How to save distressed IDS-physician marriages: a case study.
Collins, H; Johnson, B A
1998-04-01
A hospital-driven IDS that encounters serious problems resulting from ownership of a physician practice should address those problems by focusing on three core areas: vision and leadership, effectiveness of operations, and physician compensation arrangements. If changes in these areas do not lead to improvements, the IDS may need to consider organizational restructuring. In one case study, a hospital-driven IDS faced the problem of owning a poorly performing MSO with a captive physician group. The IDS's governing board determined that the organization lacked effective communication with the physicians and that realization of the organization's vision would require greater physician involvement in organizational decision making. The organization is expected to undergo some corporate reorganization in which physicians will acquire an equity interest in the enterprise.
A Good IDS Response Protocol of MANET Containment Strategies
Cheng, Bo-Chao; Chen, Huan; Tseng, Ryh-Yuh
Much recent research concentrates on designing an Intrusion Detection System (IDS) to detect the misbehaviors of the malicious node in MANET with ad-hoc and mobility natures. However, without rapid and appropriate IDS response mechanisms performing follow-up management services, even the best IDS cannot achieve the desired primary goal of the incident response. A competent containment strategy is needed to limit the extent of an attack in the Incident Response Life Cycle. Inspired by the T-cell mechanisms in the human immune system, we propose an efficient MANET IDS response protocol (T-SecAODV) that can rapidly and accurately disseminate alerts of the malicious node attacks to other nodes so as to modify their AODV routing tables to isolate the malicious nodes. Simulations are conducted by the network simulator (Qualnet), and the experiment results indicate that T-SecAODV is able to spread alerts steadily while greatly reduce faulty rumors under simultaneous multiple malicious node attacks.
DEFF Research Database (Denmark)
Wewer Albrechtsen, Nicolai J.; Kuhre, Rune E.; Hornburg, Daniel
2017-01-01
that PG 1-61 dose-dependently increases levels of cAMP, through the glucagon receptor, and increases insulin secretion and protein levels of enzymes regulating glycogenolysis and gluconeogenesis. In rats, PG 1-61 increases blood glucose and plasma insulin and decreases plasma levels of amino acids in......Glucagon is secreted from pancreatic α cells, and hypersecretion (hyperglucagonemia) contributes to diabetic hyperglycemia. Molecular heterogeneity in hyperglucagonemia is poorly investigated. By screening human plasma using high-resolution-proteomics, we identified several glucagon variants, among...... which proglucagon 1-61 (PG 1-61) appears to be the most abundant form. PG 1-61 is secreted in subjects with obesity, both before and after gastric bypass surgery, with protein and fat as the main drivers for secretion before surgery, but glucose after. Studies in hepatocytes and in β cells demonstrated...
78 FR 6316 - Enterprise Texas Pipeline LLC; Notice of Compliance Filing
2013-01-30
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR13-23-000] Enterprise Texas Pipeline LLC; Notice of Compliance Filing Take notice that on January 17, 2013, Enterprise Texas Pipeline LLC filed a revised Statement of Operating Conditions to comply with a Commission order issued in...
Ekspert : mobiil-ID kasutamine valimistel turvariske ei tekita / Holger Roonemaa
Roonemaa, Holger
2008-01-01
E-valimiste projektijuhi Taavi Martensi väitel pole põhjust kahelda mobiil-ID turvalisuses. Valimiskomisjoni esimehe Heiki Sibula meelest peaks m-ID kaarte välja andma kodakondsus- ja migratsiooniamet
Lehenberger, Silvia; Barkhausen, Christoph; Cohrs, Susan; Fischer, Eliane; Grünberg, Jürgen; Hohn, Alexander; Köster, Ulli; Schibli, Roger; Türler, Andreas; Zhernosekov, Konstantin
2011-08-01
The low-energy β(-) emitter (161)Tb is very similar to (177)Lu with respect to half-life, beta energy and chemical properties. However, (161)Tb also emits a significant amount of conversion and Auger electrons. Greater therapeutic effect can therefore be expected in comparison to (177)Lu. It also emits low-energy photons that are useful for gamma camera imaging. The (160)Gd(n,γ)(161)Gd→(161)Tb production route was used to produce (161)Tb by neutron irradiation of massive (160)Gd targets (up to 40 mg) in nuclear reactors. A semiautomated procedure based on cation exchange chromatography was developed and applied to isolate no carrier added (n.c.a.) (161)Tb from the bulk of the (160)Gd target and from its stable decay product (161)Dy. (161)Tb was used for radiolabeling DOTA-Tyr3-octreotate; the radiolabeling profile was compared to the commercially available n.c.a. (177)Lu. A (161)Tb Derenzo phantom was imaged using a small-animal single-photon emission computed tomography camera. Up to 15 GBq of (161)Tb was produced by long-term irradiation of Gd targets. Using a cation exchange resin, we obtained 80%-90% of the available (161)Tb with high specific activity, radionuclide and chemical purity and in quantities sufficient for therapeutic applications. The (161)Tb obtained was of the quality required to prepare (161)Tb-DOTA-Tyr3-octreotate. We were able to produce (161)Tb in n.c.a. form by irradiating highly enriched (160)Gd targets; it can be obtained in the quantity and quality required for the preparation of (161)Tb-labeled therapeutic agents. Copyright © 2011 Elsevier Inc. All rights reserved.
Picture This: How to Establish an Effective School ID Card Program
Finkelstein, David
2013-01-01
Most school districts do not have an ID card policy that everyone knows and follows, yet. many school districts are implementing ID card programs to address concerns about safety, efficiency, and convenience. A well-thought-out ID card program leads to greater security and smoother operations throughout the school and should thus be a priority.…
Inhibitor of differentiation 4 (Id4) is a potential tumor suppressor in prostate cancer
International Nuclear Information System (INIS)
Carey, Jason PW; Asirvatham, Ananthi J; Galm, Oliver; Ghogomu, Tandeih A; Chaudhary, Jaideep
2009-01-01
Inhibitor of differentiation 4 (Id4), a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH) transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP) analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS), expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR), p21, p27 and p53 expression in DU145 cells. The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously silenced tumor suppressors
Id-1 is not expressed in the luminal epithelial cells of mammary glands
International Nuclear Information System (INIS)
Uehara, Norihisa; Chou, Yu-Chien; Galvez, Jose J; Candia, Paola de; Cardiff, Robert D; Benezra, Robert; Shyamala, Gopalan
2003-01-01
The family of inhibitor of differentiation/DNA binding (Id) proteins is known to regulate development in several tissues. One member of this gene family, Id-1, has been implicated in mammary development and carcinogenesis. Mammary glands contain various cell types, among which the luminal epithelial cells are primarily targeted for proliferation, differentiation and carcinogenesis. Therefore, to assess the precise significance of Id-1 in mammary biology and carcinogenesis, we examined its cellular localization in vivo using immunohistochemistry. Extracts of whole mammary glands from wild type and Id-1 null mutant mice, and tissue sections from paraffin-embedded mouse mammary glands from various developmental stages and normal human breast were subjected to immunoblot and immunohistochemical analyses, respectively. In both these procedures, an anti-Id-1 rabbit polyclonal antibody was used for detection of Id-1. In immunoblot analyses, using whole mammary gland extracts, Id-1 was detected. In immunohistochemical analyses, however, Id-1 was not detected in the luminal epithelial cells of mammary glands during any stage of development, but it was detected in vascular endothelial cells. Id-1 is not expressed in the luminal epithelial cells of mammary glands
Eestist osaleb rahvusvahelisel reklaamifestivalil 161 reklaami / Sergo Selder
Selder, Sergo
2005-01-01
Riias toimuvast kuuendast Baltimaade reklaamifestivalist "Kuldne haamer" ("Golden Hammer"). Eestist on esitatud 161 reklaami. Žüriisse kuulub eestlastest Jaanus Vahtra reklaamifirmast Saatchi & Saatchi, kelle Diseli õllereklaam võitis möödunud aastal telereklaamide Kuldhaamri
Discussion on some issues for HAF003 revision
International Nuclear Information System (INIS)
Huang Chaoyun, Wang Xiaotao; Duan Hongwei; Tian Feng
2013-01-01
This paper describes some key issues which should be considered during the revision of safety code Quality Assurance for Nuclear Power Plant (HAF003), based on the comparatively analysis and research on the quality assurance practice for nuclear power. It covers about 24 issues including management responsibilities, independent assessment, design control and procurement control etc. and is expected to provide some reference and proposal for HAF003 revision activities organized by National Nuclear Safety Agency (NNSA). (authors)
1985-01-01
The crew assigned to the STS-51B mission included (seated left to right) Robert F. Overmyer, commander; and Frederick D. Gregory, pilot. Standing, left to right, are Don L. Lind, mission specialist; Taylor G. Wang, payload specialist; Norman E. Thagard, mission specialist; William E. Thornton, mission specialist; and Lodewijk van den Berg, payload specialist. Launched aboard the Space Shuttle Challenger on April 29, 1985 at 12:02:18 pm (EDT), the STS-51A mission's primary payload was the Spacelab-3.
STS-82 Pilot Scott Horowitz at SLF
1997-01-01
STS-82 Pilot Scott J. 'Doc' Horowitz flashes a wide grin for photographers after he lands his T-38 jet at KSCs Shuttle Landing Facility. Horowitz and the other six members of the STS-82 crew came from their home base at Johnson Space Center in Houston, TX, to spend the last few days before launch at KSC. STS-82 is scheduled for liftoff on Feb. 11 during a 65-minute launch window which opens at 3:56 a.m. EST. The 10-day flight aboard the Space Shuttle Discovery will be the second Hubble Space Telescope servicing mission.
Hmimech, Wiam; Idrissi, Hind Hassani; Diakite, Brehima; Korchi, Farah; Baghdadi, Dalila; Tahri Joutey Hassani Idrissi, Hind; Haboub, Meriem; Habbal, Rachida; Nadifi, Sellama
2017-12-21
Our case-control study aimed to access the potential association of insertion/deletion (I/D) ACE (angiotensin converting enzyme) gene polymorphism with myocardial infarction (MI) risk of occurrence among a sample of Moroccan patients, especially young ones. Distribution of I/D ACE gene variant among cases vs controls, showed that healthy controls carried out higher frequency of wild type allele I compared to cases (23.5% vs 21.79% respectively), when cases were carrying higher frequency of mutant allele D (78.21% vs 76.5% for controls). Patients were-after this- divided into two groups of 55 years of age, to investigate whether or not younger patients carried out higher frequency of the mutant allele D, than older ones. As expected, ACE polymorphism may be associated with MI occurrence among younger patients (< 45 years of age).
Inhibitor of differentiation 4 (Id4 is a potential tumor suppressor in prostate cancer
Directory of Open Access Journals (Sweden)
Carey Jason PW
2009-06-01
Full Text Available Abstract Background Inhibitor of differentiation 4 (Id4, a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Methods Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS, expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Results Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR, p21, p27 and p53 expression in DU145 cells. Conclusion The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously
33 CFR 161.12 - Vessel operating requirements.
2010-07-01
....0′ N. extending eastward through the Golden Gate, and the navigable waters of San Francisco Bay and... safety beyond that provided by other means. The bridge-to-bridge navigational frequency, 156.650 MHz (Ch... Measures, and Operating Requirements § 161.12 Vessel operating requirements. (a) Subject to the exigencies...
Prediction information - GRIPDB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us GRI...a.nbdc01665-004 Description of data contents Predicted GPCR interaction regions Data file File name: gripdb_...predicted_info.zip File URL: ftp://ftp.biosciencedbc.jp/archive/gripdb/LATEST/gripdb_predicted_info.zip File... size: 219 KB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/gripdb...entries Data item Description ID Prediction information ID GRIP ID GRIP ID related wigh the prediction Predi
Directory of Open Access Journals (Sweden)
van Karnebeek Clara D M
2012-07-01
Full Text Available Abstract Background Intellectual disability (ID is a devastating and frequent condition, affecting 2-3% of the population worldwide. Early recognition of treatable underlying conditions drastically improves health outcomes and decreases burdens to patients, families and society. Our systematic literature review identified 81 such inborn errors of metabolism, which present with ID as a prominent feature and are amenable to causal therapy. The WebAPP translates this knowledge of rare diseases into a diagnostic tool and information portal. Methods & results Freely available as a WebAPP via http://www.treatable-id.org and end 2012 via the APP store, this diagnostic tool is designed for all specialists evaluating children with global delay / ID and laboratory scientists. Information on the 81 diseases is presented in different ways with search functions: 15 biochemical categories, neurologic and non-neurologic signs & symptoms, diagnostic investigations (metabolic screening tests in blood and urine identify 65% of all IEM, therapies & effects on primary (IQ/developmental quotient and secondary outcomes, and available evidence For each rare condition a ‘disease page’ serves as an information portal with online access to specific genetics, biochemistry, phenotype, diagnostic tests and therapeutic options. As new knowledge and evidence is gained from expert input and PubMed searches this tool will be continually updated. The WebAPP is an integral part of a protocol prioritizing treatability in the work-up of every child with global delay / ID. A 3-year funded study will enable an evaluation of its effectiveness. Conclusions For rare diseases, a field for which financial and scientific resources are particularly scarce, knowledge translation challenges are abundant. With this WebAPP technology is capitalized to raise awareness for rare treatable diseases and their common presenting clinical feature of ID, with the potential to improve health outcomes
2012-01-01
Background Intellectual disability (ID) is a devastating and frequent condition, affecting 2-3% of the population worldwide. Early recognition of treatable underlying conditions drastically improves health outcomes and decreases burdens to patients, families and society. Our systematic literature review identified 81 such inborn errors of metabolism, which present with ID as a prominent feature and are amenable to causal therapy. The WebAPP translates this knowledge of rare diseases into a diagnostic tool and information portal. Methods & results Freely available as a WebAPP via http://www.treatable-id.org and end 2012 via the APP store, this diagnostic tool is designed for all specialists evaluating children with global delay / ID and laboratory scientists. Information on the 81 diseases is presented in different ways with search functions: 15 biochemical categories, neurologic and non-neurologic signs & symptoms, diagnostic investigations (metabolic screening tests in blood and urine identify 65% of all IEM), therapies & effects on primary (IQ/developmental quotient) and secondary outcomes, and available evidence For each rare condition a ‘disease page’ serves as an information portal with online access to specific genetics, biochemistry, phenotype, diagnostic tests and therapeutic options. As new knowledge and evidence is gained from expert input and PubMed searches this tool will be continually updated. The WebAPP is an integral part of a protocol prioritizing treatability in the work-up of every child with global delay / ID. A 3-year funded study will enable an evaluation of its effectiveness. Conclusions For rare diseases, a field for which financial and scientific resources are particularly scarce, knowledge translation challenges are abundant. With this WebAPP technology is capitalized to raise awareness for rare treatable diseases and their common presenting clinical feature of ID, with the potential to improve health outcomes. This innovative digital
ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells
International Nuclear Information System (INIS)
Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep
2016-01-01
Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.
ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells
Energy Technology Data Exchange (ETDEWEB)
Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep, E-mail: jchaudhary@cau.edu
2016-09-09
Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.
75 FR 81417 - Airworthiness Directives; Piper Aircraft, Inc. Model PA-28-161 Airplanes
2010-12-28
... Airworthiness Directives; Piper Aircraft, Inc. Model PA-28-161 Airplanes AGENCY: Federal Aviation Administration... new airworthiness directive (AD): 2010-26-04 Piper Aircraft, Inc: Amendment 39-16543; Docket No. FAA... times may be Airplane approved for this part. Maintenance Manual Piper PA28-161 TAE 125-01, Doc. No...
Guinea pig ID-like families of SINEs.
Kass, David H; Schaetz, Brian A; Beitler, Lindsey; Bonney, Kevin M; Jamison, Nicole; Wiesner, Cathy
2009-05-01
Previous studies have indicated a paucity of SINEs within the genomes of the guinea pig and nutria, representatives of the Hystricognathi suborder of rodents. More recent work has shown that the guinea pig genome contains a large number of B1 elements, expanding to various levels among different rodents. In this work we utilized A-B PCR and screened GenBank with sequences from isolated clones to identify potentially uncharacterized SINEs within the guinea pig genome, and identified numerous sequences with a high degree of similarity (>92%) specific to the guinea pig. The presence of A-tails and flanking direct repeats associated with these sequences supported the identification of a full-length SINE, with a consensus sequence notably distinct from other rodent SINEs. Although most similar to the ID SINE, it clearly was not derived from the known ID master gene (BC1), hence we refer to this element as guinea pig ID-like (GPIDL). Using the consensus to screen the guinea pig genomic database (Assembly CavPor2) with Ensembl BlastView, we estimated at least 100,000 copies, which contrasts markedly to just over 100 copies of ID elements. Additionally we provided evidence of recent integrations of GPIDL as two of seven analyzed conserved GPIDL-containing loci demonstrated presence/absence variants in Cavia porcellus and C. aperea. Using intra-IDL PCR and sequence analyses we also provide evidence that GPIDL is derived from a hystricognath-specific SINE family. These results demonstrate that this SINE family continues to contribute to the dynamics of genomes of hystricognath rodents.
The Self-Identity Protein IdsD Is Communicated between Cells in Swarming Proteus mirabilis Colonies.
Saak, Christina C; Gibbs, Karine A
2016-12-15
Proteus mirabilis is a social bacterium that is capable of self (kin) versus nonself recognition. Swarming colonies of this bacterium expand outward on surfaces to centimeter-scale distances due to the collective motility of individual cells. Colonies of genetically distinct populations remain separate, while those of identical populations merge. Ids proteins are essential for this recognition behavior. Two of these proteins, IdsD and IdsE, encode identity information for each strain. These two proteins bind in vitro in an allele-restrictive manner. IdsD-IdsE binding is correlated with the merging of populations, whereas a lack of binding is correlated with the separation of populations. Key questions remained about the in vivo interactions of IdsD and IdsE, specifically, whether IdsD and IdsE bind within single cells or whether IdsD-IdsE interactions occur across neighboring cells and, if so, which of the two proteins is exchanged. Here we demonstrate that IdsD must originate from another cell to communicate identity and that this nonresident IdsD interacts with IdsE resident in the recipient cell. Furthermore, we show that unbound IdsD in recipient cells does not cause cell death and instead appears to contribute to a restriction in the expansion radius of the swarming colony. We conclude that P. mirabilis communicates IdsD between neighboring cells for nonlethal kin recognition, which suggests that the Ids proteins constitute a type of cell-cell communication. We demonstrate that self (kin) versus nonself recognition in P. mirabilis entails the cell-cell communication of an identity-encoding protein that is exported from one cell and received by another. We further show that this intercellular exchange affects swarm colony expansion in a nonlethal manner, which adds social communication to the list of potential swarm-related regulatory factors. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Événement, idéologie et utopie
Directory of Open Access Journals (Sweden)
Jean-Luc AMALRIC
2014-12-01
Full Text Available RESUMEL’hypothèse que tente d’esquisser cet article est que l’idée ricœurienne d’une médiatisation dynamique des contradictions de l’imaginaire social présuppose une corrélation originaire de l’idéologie et de l’utopie qui ne peut elle-même être comprise qu’à partir de l’événement de l’institution d’un imaginaire social constituant. Dans un premier temps, l’article s’efforce de cerner ce qui fait la spécificité de la théorie ricœurienne de l’idéologie et de l’utopie comme « pratiques imaginatives », en soulignant à ce titre l’influence déterminante des thèses de Jacques Ellul sur l’idéologie. Puis, dans un second temps, il s’engage dans une analyse régressive qui conduit de la réappropriation ricœurienne de la conception dialectique de l’idéologie et de l’utopie exposée par Mannheim à l’idée d’un fondement événementiel de ces deux formes opposées de l’imaginaire social.Mots-Clés : Evénement, idéologie, utopie, Ellul, Mannheim. ABSTRACTThis paper attempts to sketch out the hypothesis that the Ricœurian conception of a dynamic mediatization of the contradictions of the social imaginary presupposes an original correlation between ideology and utopia, which can itself be understood only from the event that institutes a constitutive social imaginary. The first part of the paper marks out the specificity of the Ricœurian theory of ideology and utopia in terms of “imaginative practices”, underlining the determining influence of Jacques Ellul’s theses on ideology. The second part tries to develop a regressive argument, starting from the Ricœurian re-appropriation of Mannheim’s dialectical conception of ideology and utopia, and leading back to the idea of an event foundation for these two opposed forms of the social imaginary.Keywords : Event, Ideology, Utopia, Ellul, Mannheim
75 FR 61655 - Airworthiness Directives; Piper Aircraft, Inc. Model PA-28-161 Airplanes
2010-10-06
...-1006; Directorate Identifier 2009-CE-057-AD] RIN 2120-AA64 Airworthiness Directives; Piper Aircraft... airworthiness directive (AD) for all Piper Aircraft, Inc. (Piper) Model PA-28-161 airplanes equipped with.... Piper Model PA-28-161 airplanes modified by STC No. SA03303AT have a similar unsafe design feature that...
L-Area STS MTR/NRU/NRX Grapple Assembly Closure Mechanics Review
International Nuclear Information System (INIS)
Huizenga, D. J.
2016-01-01
A review of the closure mechanics associated with the Shielded Transfer System (STS) MTR/NRU/NRX grapple assembly utilized at the Savannah River Site (SRS) was performed. This review was prompted by an operational event which occurred at the Canadian Nuclear Laboratories (CNL) utilizing a DTS-XL grapple assembly which is essentially identical to the STS MTR/NRU/NRX grapple assembly used at the SRS. The CNL operational event occurred when a NRU/NRX fuel basket containing spent nuclear fuel assemblies was inadvertently released by the DTS-XL grapple assembly during a transfer. The SM review of the STS MTR/NRU/NRX grapple assembly will examine the operational aspects of the STS and the engineered features of the STS which prevent such an event at the SRS. The design requirements for the STS NRU/NRX modifications and the overall layout of the STS are provided in other documents.
Gayibova, Ülkü; Dalyan Cılo, Burcu; Ağca, Harun; Ener, Beyza
2014-07-01
.kefyr), however it was 38.7% for the rarely isolated ones (C.krusei, C.lusitaniae, C.inconspicua/C.norvagensis, C.catenulata), representing statistical significance (p= 0.034; x2 test). Although not significant (p= 0.31; x2 test), the rate of concordance was increased (88.1%), when adding the morphological findings to the identification process. Of 211 isolates 37 (17.5%), 50 (23.7%) and 124 (58.8%) were identified according to their growth characteristics on chromogenic agar, blood agar and SDA, respectively, indicating no statistically significant difference between the media (p> 0.05). Although genotypic identification is essential, phenotypic methods are more commonly used in routine laboratories for the identification of yeast species. However, since genotypic identification could not be performed in this study, none of the systems were accepted as the standard method and therefore the sensitivity and specificity of the systems were not calculated. On the other hand, our data indicated that the two identification systems were comparable and careful observation of yeast morphology could add confidence to the identification. In conclusion, since the Phoenix™ Yeast ID system was found more practical with easier interpretation, and the results were obtained earlier than those of the API® ID 32C system (16 hours versus 48 hours), it was thought that Phoenix™ Yeast ID system may be used reliably in the routine laboratories. However, as none of the methods evaluated was completely reliable as a stand-alone, careful evaluation is necessary for species identification.
2010-07-14
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 12642-003] Wilkesboro Hydropower, LLC; Notice of Application Accepted for Filing and Soliciting Motions To Intervene and Protests..., LLC. e. Name of Project: W. Kerr Scott Hydropower Project. f. Location: The proposed project would be...
The development of STS payload environmental engineering standards
Bangs, W. F.
1982-01-01
The presently reported effort to provide a single set of standards for the design, analysis and testing of Space Transportation System (STS) payloads throughout the NASA organization must be viewed as essentially experimental, since the concept of incorporating the diverse opinions and experiences of several separate field research centers may in retrospect be judged too ambitious or perhaps even naive. While each STS payload may have unique characteristics, and the project should formulate its own criteria for environmental design, testing and evaluation, a reference source document providing coordinated standards is expected to minimize the duplication of effort and limit random divergence of practices among the various NASA payload programs. These standards would provide useful information to all potential STS users, and offer a degree of standardization to STS users outside the NASA organization.
Regulation of Id2 expression in EL4 T lymphoma cells overexpressing growth hormone.
Weigent, Douglas A
2009-01-01
In previous studies, we have shown that overexpression of growth hormone (GH) in cells of the immune system upregulates proteins involved in cell growth and protects from apoptosis. Here, we report that overexpression of GH in EL4 T lymphoma cells (GHo) also significantly increased levels of the inhibitor of differentiation-2 (Id2). The increase in Id2 was suggested in both Id2 promoter luciferase assays and by Western analysis for Id2 protein. To identify the regulatory elements that mediate transcriptional activation by GH in the Id2 promoter, promoter deletion analysis was performed. Deletion analysis revealed that transactivation involved a 301-132bp region upstream to the Id2 transcriptional start site. The pattern in the human GHo Jurkat T lymphoma cell line paralleled that found in the mouse GHo EL4 T lymphoma cell line. Significantly less Id2 was detected in the nucleus of GHo EL4 T lymphoma cells compared to vector alone controls. Although serum increased the levels of Id2 in control vector alone cells, no difference was found in the total levels of Id2 in GHo EL4 T lymphoma cells treated with or without serum. The increase in Id2 expression in GHo EL4 T lymphoma cells measured by Id2 promoter luciferase expression and Western blot analysis was blocked by the overexpression of a dominant-negative mutant of STAT5. The results suggest that in EL4 T lymphoma cells overexpressing GH, there is an upregulation of Id2 protein that appears to involve STAT protein activity.
Best practices for the implementation of the REAL ID Act.
2015-10-01
The REAL ID Act specifies the minimum standards that must be used to produce and issue drivers license and : identification cards that are REAL ID compliant. Beginning in 2020, if a person does not possess a form of : identification that meets REA...
76 FR 30934 - Combined Notice of Filings #1
2011-05-27
... 19, 2011. Docket Numbers: EC11-84-000. Applicants: Montgomery L'Energia Power Partners LP, Tanner... Montgomery L'Energia Power Partners LP, et. al. Filed Date: 05/23/2011. Accession Number: 20110523-5016...
ID card number detection algorithm based on convolutional neural network
Zhu, Jian; Ma, Hanjie; Feng, Jie; Dai, Leiyan
2018-04-01
In this paper, a new detection algorithm based on Convolutional Neural Network is presented in order to realize the fast and convenient ID information extraction in multiple scenarios. The algorithm uses the mobile device equipped with Android operating system to locate and extract the ID number; Use the special color distribution of the ID card, select the appropriate channel component; Use the image threshold segmentation, noise processing and morphological processing to take the binary processing for image; At the same time, the image rotation and projection method are used for horizontal correction when image was tilting; Finally, the single character is extracted by the projection method, and recognized by using Convolutional Neural Network. Through test shows that, A single ID number image from the extraction to the identification time is about 80ms, the accuracy rate is about 99%, It can be applied to the actual production and living environment.
STS and Researcher Intervention Strategies
Directory of Open Access Journals (Sweden)
Brian Martin
2016-06-01
Full Text Available When I learned about a concerted campaign against Australian vaccination critics, I decided to intervene in the debate. As a result, some proponents of vaccination turned on me, making abusive comments and complaining to university officials. At several points in this experience, I had to make choices about how to intervene or respond. STS perspectives offered valuable insights for understanding the dynamics of the controversy but provided little guidance for making decisions. Some reasons are offered for why STS lacks tools for guiding practical action in such situations.
STS-93 crew heads out of O&C for ride to launch pad
1999-01-01
The STS-93 crew wave and smile at onlookers as they walk out of the Operations and Checkout Building for the third time enroute to Launch Pad 39-B and liftoff of Space Shuttle Columbia. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. The target landing date is July 27, 1999, at 11:20 p.m. EDT. In their orange launch and entry suits, they are (starting at rear, left to right) Mission Specialists Michel Tognini of France, who represents the Centre National d'Etudes Spatiales (CNES), and Catherine G. Coleman (Ph.D.); Pilot Jeffrey S. Ashby; Mission Specialist Stephen A. Hawley (Ph.D.); and Commander Eileen M. Collins. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. Collins is the first woman to serve as commander of a Shuttle mission.
An Amphiphysin-Like Domain in Fus2p Is Required for Rvs161p Interaction and Cortical Localization
Directory of Open Access Journals (Sweden)
Richard A. Stein
2016-02-01
Full Text Available Cell–cell fusion fulfils essential roles in fertilization, development and tissue repair. In the budding yeast, Saccharomyces cerevisiae, fusion between two haploid cells of opposite mating type generates the diploid zygote. Fus2p is a pheromone-induced protein that regulates cell wall removal during mating. Fus2p shuttles from the nucleus to localize at the shmoo tip, bound to Rvs161p, an amphiphysin. However, Rvs161p independently binds a second amphiphysin, Rvs167p, playing an essential role in endocytosis. To understand the basis of the Fus2p–Rvs161p interaction, we analyzed Fus2p structural domains. A previously described N-terminal domain (NTD is necessary and sufficient to regulate nuclear/cytoplasmic trafficking of Fus2p. The Dbl homology domain (DBH binds GTP-bound Cdc42p; binding is required for cell fusion, but not localization. We identified an approximately 200 amino acid region of Fus2p that is both necessary and sufficient for Rvs161p binding. The Rvs161p binding domain (RBD contains three predicted alpha-helices; structural modeling suggests that the RBD adopts an amphiphysin-like structure. The RBD contains a 13-amino-acid region, conserved with Rvs161p and other amphiphysins, which is essential for binding. Mutations in the RBD, predicted to affect membrane binding, abolish cell fusion without affecting Rvs161p binding. We propose that Fus2p/Rvs161p form a novel heterodimeric amphiphysin required for cell fusion. Rvs161p binding is required but not sufficient for Fus2p localization. Mutations in the C-terminal domain (CTD of Fus2p block localization, but not Rvs161p binding, causing a significant defect in cell fusion. We conclude that the Fus2p CTD mediates an additional, Rvs161p-independent interaction at the shmoo tip.
2010-07-01
... Guidance and Counseling Programs? 403.161 Section 403.161 Education Regulations of the Offices of the... the Special Programs? Comprehensive Career Guidance and Counseling Programs § 403.161 How must funds be used under the Comprehensive Career Guidance and Counseling Programs? (a) A State shall use not...
REFORMASI PEMAHAMAN TEORI MAQᾹṢID SYARIAH Analisis Pendekatan Sistem Jasser Auda
Directory of Open Access Journals (Sweden)
Muhammad Iqbal Fasa
2016-12-01
Full Text Available This paper attempts to offer reform ideas Jasser Auda thought related reforms theoretical understanding of maqᾱṣid sharia. The systems approach is done by Auda critize the theory of classical maqᾱṣid more likely to hierarchical and narrow mindset. The classical maqᾱṣid pressure a point more on protection and preservation. Whereas the new maqᾱṣid theory emphasizes development (construction, development and rights (rights. Thus, Auda developed the concept of human development as the main target of maslahah (public interest. Auda offers the systems approach, namely: cognitive nature; interrelated; wholeness; openness; multi dimentionality and purposefulness. At the end of the discussion in this paper, the authors develop the idea of Jasser Auda by offering Sharia Maqᾱṣid concept in the context of Islamic Economics
Efecto in vitro del D-003 sobre la actividad enzimática de la 5-lipoxigenasa (5-LOX
Directory of Open Access Journals (Sweden)
Yohani Pérez Guerra
Full Text Available Introducción: el D-003, mezcla de ácidos alifáticos primarios superiores purificada de la cera de la caña, inhibe la síntesis de colesterol. Trabajos recientes han demostrado que el D-003 resulta efectivo en modelos experimentales de osteoartritis y que inhibe la actividad de las enzimas COX1 y COX2, preferentemente la COX1, sin producir gastrotoxicidad. Ha sido referido que los inhibidores duales de las enzimas COX y 5-LOX presentan efectos antinflamatorios desprovistos de gastrotoxicidad o que incluso, pueden resultar gastroprotectores. De acuerdo con estos antecedentes, el D-003 podría ser un inhibidor dual de dichas enzimas. Objetivo: investigar el efecto in vitro del D-003 sobre la actividad enzimática de la 5-LOX, utilizando la fracción citosólica de leucocitos polimorfonucleares de ratas. Métodos: se utilizaron las condiciones de ensayo siguientes: fracción citosólica (50 µg de proteína disuelta en solución reguladora borato 0,2 mol/L (pH 9 y ácido linoleico (7,8-250 mmol/L como sustrato, ensayándose muestras paralelas incubadas con Tween-20/H2O (2 % (vehículo, D-003 (0,6-6 000 µg/mL o extracto de Perna canaliculus (50 µg/mL (sustancia de referencia. Se evaluó la actividad enzimática mediante el cambio de absorbancia a 234 nm producido por la formación de dienos conjugados y medido en espectrofotómetro UV-visible. Resultados: la adición de D-003 produjo una inhibición dosis dependiente de la actividad enzimática de la 5-LOX (r= 0,975; p< 0,05 (CI50= 23,06 µg/mL in vitro. La magnitud de esta inhibición fue moderada, ya que la inhibición máxima, alcanzada a partir de 1 250 µg/mL, resultó de solo un 30 %. Conclusiones: el estudio demuestra que el D-003 es capaz de inhibir la actividad enzimática de la 5-LOX in vitro, pero moderadamente.
25 CFR 152.23 - Applications for sale, exchange or gift.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Applications for sale, exchange or gift. 152.23 Section..., Exchanges and Conveyances of Trust Or Restricted Lands § 152.23 Applications for sale, exchange or gift. Applications for the sale, exchange or gift of trust or restricted land shall be filed in the form approved by...
Interoperability for electronic ID
Zygadlo, Zuzanna
2009-01-01
Electronic Business, including eBanking, eCommerce and eGovernmental services, is today based on a large variety of security solutions, comprising electronic IDs provided by a broad community of Public Key Infrastructure (PKI) vendors. Significant differences in implementations of those solutions introduce a problem of lack of interoperability in electronic business, which have not yet been resolved by standardization and interoperability initiatives based on existing PKI trust models. It i...
33 CFR 165.161 - Safety zones: Coast Guard Captain of the Port New York annual fireworks displays.
2010-07-01
... of the Port New York annual fireworks displays. 165.161 Section 165.161 Navigation and Navigable... Coast Guard District § 165.161 Safety zones: Coast Guard Captain of the Port New York annual fireworks displays. (a) Safety zones. The following areas are designated safety zones: (1) Bar Beach fireworks...
Psychometrics and latent structure of the IDS and QIDS with young adult students.
González, David Andrés; Boals, Adriel; Jenkins, Sharon Rae; Schuler, Eric R; Taylor, Daniel
2013-07-01
Students and young adults have high rates of suicide and depression, thus are a population of interest. To date, there is no normative psychometric information on the IDS and QIDS in these populations. Furthermore, there is equivocal evidence on the factor structure and subscales of the IDS. Two samples of young adult students (ns=475 and 1681) were given multiple measures to test the psychometrics and dimensionality of the IDS and QIDS. The IDS, its subscales, and QIDS had acceptable internal consistencies (αs=.79-90) and favorable convergent and divergent validity correlations. A three-factor structure and two Rasch-derived subscales best fit the IDS. The samples were collected from one university, which may influence generalizability. The IDS and QIDS are desirable measures of depressive symptoms when studying young adult students. Copyright © 2013 Elsevier B.V. All rights reserved.
78 FR 65555 - Establishment of Class E Airspace; Salmon, ID
2013-11-01
...-0531; Airspace Docket No. 13-ANM-20] Establishment of Class E Airspace; Salmon, ID AGENCY: Federal... at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules (IFR) aircraft under control of Salt Lake...
33 CFR 161.4 - Requirement to carry the rules.
2010-07-01
... (CONTINUED) PORTS AND WATERWAYS SAFETY VESSEL TRAFFIC MANAGEMENT Vessel Traffic Services General Rules § 161... the Local Notice to Mariners. The VTS User's Manual and the World VTS Guide, an International Maritime...
CASK inhibits ECV304 cell growth and interacts with Id1
International Nuclear Information System (INIS)
Qi Jie; Su Yongyue; Sun Rongju; Zhang Fang; Luo Xiaofeng; Yang Zongcheng; Luo Xiangdong
2005-01-01
Calcium/calmodulin-dependent serine protein kinase (CASK) is generally known as a scaffold protein. Here we show that overexpression of CASK resulted in a reduced rate of cell growth, while inhibition of expression of endogenous CASK via RNA-mediated interference resulted in an increased rate of cell growth in ECV304 cells. To explore the molecular mechanism, we identified a novel CASK-interacting protein, inhibitor of differentiation 1 (Id1) with a yeast two-hybrid screening. Furthermore, endogenous CASK and Id1 proteins were co-precipitated from the lysates of ECV304 cells by immunoprecipitation. Mammalian two-hybrid protein-protein interaction assays indicated that CASK possessed a different binding activity for Id1 and its alternative splicing variant. It is known that Id proteins play important roles in regulation of cell proliferation and differentiation. Thus, we speculate that the regulation of cell growth mediated by CASK may be involved in Id1. Our findings indicate a novel function of CASK, the mechanism that remains to be further investigated
29 CFR 2700.23 - Review of a subsequent citation or order.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Review of a subsequent citation or order. 2700.23 Section... COMMISSION PROCEDURAL RULES Contests of Citations and Orders § 2700.23 Review of a subsequent citation or order. (a) The contesting party shall file any subsequent citation or order that modifies or terminates...
Areva - First quarter 2009 revenue climbs 8.5% to 3.003 billion euros
International Nuclear Information System (INIS)
2009-04-01
First quarter 2009 revenue was up 8.5% compared with the same period last year, to 3.003 billion euros. At constant exchange rates and consolidation scope, growth came to 3.9%. Currency translation had a positive impact of 57 million euros over the quarter. Changes in the consolidation scope had an impact of 66 million euros, primarily due to the consolidation of acquisitions made in 2008 in Transmission and Distribution and in Renewable Energies. The growth engines for first quarter revenue were the Reactors and Services division and the Transmission and Distribution division, with growth of 9.2% and 16.1% respectively. Outside France, revenue rose to 2.032 billion euros, compared with 1.857 billion euros in the first quarter of 2008, and represents 68% of total revenue. Orders were steady in the first quarter, particularly in the Front End, which posted several significant contracts with US and Asian utilities, and in Transmission and Distribution, with orders up sharply in Asia and South America. As of March 31, 2009, the group's backlog reached 49.5 billion euros, for 28.3% growth year-on-year, including 31.3% growth in Nuclear and 10.2% in Transmission and Distribution. For the year as a whole, the group confirms its outlook for backlog and revenue growth as well as rising operating income It should be noted that revenue may vary significantly from one quarter to the next in nuclear operations. Accordingly, quarterly data cannot be viewed as a reliable indicator of annual trends
idRHa+ProMod - Rail Hardening Control System
International Nuclear Information System (INIS)
Ferro, L
2016-01-01
idRHa+ProMod is the process control system developed by Primetals Technologies to foresee the thermo-mechanical evolution and micro-structural composition of rail steels subjected to slack quenching into idRHa+ Rail Hardening equipments in a simulation environment. This tool can be used both off-line or in-line, giving the user the chance to test and study the best cooling strategies or letting the automatic control system free to adjust the proper cooling recipe. Optimization criteria have been tailored in order to determine the best cooling conditions according to the metallurgical requirements imposed by the main rail standards and also taking into account the elastoplastic bending phenomena occurring during all stages of the head hardening process. The computational core of idRHa+ProMod is a thermal finite element procedure coupled with special algorithms developed to work out the main thermo-physical properties of steel, to predict the non-isothermal austenite decomposition into all the relevant phases and subsequently to evaluate the amount of latent heat of transformation released, the compound thermal expansion coefficient and the amount of plastic deformation in the material. Air mist and air blades boundary conditions have been carefully investigated by means of pilot plant tests aimed to study the jet impingement on rail surfaces and the cooling efficiency at all working conditions. Heat transfer coefficients have been further checked and adjusted directly on field during commissioning. idRHa+ is a trademark of Primetals Technologies Italy Srl (paper)
idRHa+ProMod - Rail Hardening Control System
Ferro, L.
2016-03-01
idRHa+ProMod is the process control system developed by Primetals Technologies to foresee the thermo-mechanical evolution and micro-structural composition of rail steels subjected to slack quenching into idRHa+ Rail Hardening equipments in a simulation environment. This tool can be used both off-line or in-line, giving the user the chance to test and study the best cooling strategies or letting the automatic control system free to adjust the proper cooling recipe. Optimization criteria have been tailored in order to determine the best cooling conditions according to the metallurgical requirements imposed by the main rail standards and also taking into account the elastoplastic bending phenomena occurring during all stages of the head hardening process. The computational core of idRHa+ProMod is a thermal finite element procedure coupled with special algorithms developed to work out the main thermo-physical properties of steel, to predict the non-isothermal austenite decomposition into all the relevant phases and subsequently to evaluate the amount of latent heat of transformation released, the compound thermal expansion coefficient and the amount of plastic deformation in the material. Air mist and air blades boundary conditions have been carefully investigated by means of pilot plant tests aimed to study the jet impingement on rail surfaces and the cooling efficiency at all working conditions. Heat transfer coefficients have been further checked and adjusted directly on field during commissioning. idRHa+ is a trademark of Primetals Technologies Italy Srl
2011-05-02
.... The existing Fire Mountain Lodge project consists of: (1) A 265- foot-long earth and concrete filled... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 1992-003] Fire Mountain.... Date filed: April 25, 2008. d. Applicant: Mr. Ken Willis. e. Name of Project: Fire Mountain Lodge. f...
78 FR 13871 - Combined Notice of Filings #1
2013-03-01
.... ET 3/14/13. Docket Numbers: ER13-964-000. Applicants: EquiPower Resources Management, LLC...: Original Service Agreement No. 3488; Queue No. Y1-012 to be effective 1/23/2013. Filed Date: 2/21/13...
ID.alistic: identificatie met een touch voor de patiënt
M. Wilschut; M. Zijlmans; Dr. L.S.G.L Wauben
2017-01-01
ID.alistic is een conceptuele patiëntidentificatie methode (middels een vingerafdrukscanner), ter vervanging van het polsbandjessysteem van het Albert Schweitzer ziekenhuis (ASz) dialysecentrum. Dit onderzoek bepaalt de implementeerbaarheid van ID.alistic binnen het dialysecentrum door
DEFF Research Database (Denmark)
Babakhanyan, Anna; Leke, Rose G F; Salanti, Ali
2014-01-01
In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women natura...
Internal validation of the RapidHIT® ID system.
Wiley, Rachel; Sage, Kelly; LaRue, Bobby; Budowle, Bruce
2017-11-01
Traditionally, forensic DNA analysis has required highly skilled forensic geneticists in a dedicated laboratory to generate short tandem repeat (STR) profiles. STR profiles are routinely used either to associate or exclude potential donors of forensic biological evidence. The typing of forensic reference samples has become more demanding, especially with the requirement in some jurisdictions to DNA profile arrestees. The Rapid DNA (RDNA) platform, the RapidHIT ® ID (IntegenX ® , Pleasanton, CA), is a fully automated system capable of processing reference samples in approximately 90min with minimal human intervention. Thus, the RapidHIT ID instrument can be deployed to non-laboratory environments (e.g., booking stations) and run by trained atypical personnel such as law enforcement. In order to implement the RapidHIT ID platform, validation studies are needed to define the performance and limitations of the system. Internal validation studies were undertaken with four early-production RapidHIT ID units. Reliable and concordant STR profiles were obtained from reference buccal swabs. Throughout the study, no contamination was observed. The overall first-pass success rate with an "expert-like system" was 72%, which is comparable to another current RDNA platform commercially available. The system's second-pass success rate (involving manual interpretation on first-pass inconclusive results) increased to 90%. Inhibitors (i.e., coffee, smoking tobacco, and chewing tobacco) did not appear to affect typing by the instrument system; however, substrate (i.e., swab type) did impact typing success. Additionally, one desirable feature not available with other Rapid systems is that in the event of a system failed run, a swab can be recovered and subsequently re-analyzed in a new sample cartridge. Therefore, rarely should additional sampling or swab consumption be necessary. The RapidHIT ID system is a robust and reliable tool capable of generating complete STR profiles within
Bio-fortification and shelf-life extension of idli batter using curry leaves (Murraya koenigii).
Chelliah, R; Ramakrishnan, S R; Premkumar, D; Antony, U
2016-06-01
Among several traditional foods of India, idli is one of the most popular and commonly consumed steamed products. A new method of adding Murraya koenigii (curry leaves) to idli batter as a vehicle for fortification and extension of shelf-life has been developed. Dried curry leaves powder was incorporated with other ingredients like rice and dehusked black gram in different proportions to optimize the most palatable formulation. Rate of fermentation and microbial changes in the batter; nutritional qualities, texture and sensory properties of the prepared product were assessed. Incorporation of curry leaves powder (5 %) in idli batter increased the shelf-life and also increased the flavour, texture and appearance of the idli. The calcium content of the prepared idli was 10 times more than that of the control idli, while dietary fiber content increased by 18.6 %. Anti-microbial activity of the curry leaves in idli batter extended the shelf-life from 2 to 5 days when stored at 30 °C.
González-Hernández, Y; Pedraza-Sánchez, S; Blandón-Vijil, V; del Río-Navarro, B E; Vaughan, G; Moreno-Lafont, M; Escobar-Gutiérrez, A
2007-04-01
In humans, T cells expressing the CD161 molecule NKR-P1A constitute around 20% of the circulating CD3(+) cells and are potentially immunoregulatory in several diseases. Their role in asthma is not well known, but they could participate in asthma attacks. To determinate whether activation of CD161(+) T cells and their cytokine production correlate with clinical status of asthma, we analysed blood samples from asthma attack patients (AAP) and stable asthma patients (SAP) in comparison with healthy non-atopic controls (HC). There was a significant higher baseline expression of CD69 on T cells from AAP and the difference was more notorious on CD161(+) T cells; upregulation of CD69 was observed on both CD161(-) and CD161(+) T cells driven by Dermatophagoides pteronyssinus crude extract, whereas polyclonal stimulation with phorbol 12-myristate 13-acetate plus ionomycin predominantly induced IFN-gamma but no IL-4, IL-5 and IL-13 by CD161(+) T cells in all groups; upon polyclonal stimulation, there were more CD161(+) T cells producing IFN-gamma and less CD161(-) T cells producing this cytokine, contrasting with the opposite results observed in SAP and HC groups. Our results indicate that, during asthma attack, CD161(+) T cells are activated and are able to produce predominantly IFN-gamma but no Th2 cytokines. We hypothesize that during an asthma attack, IFN-gamma produced by CD161(+) T cells could help to reestablish the Th1/Th2 equilibrium. These observations may contribute to the understanding of the immune mechanisms involved in asthma attacks.
To ID or Not to ID? Changes in Classification Rates of Intellectual Disability Using "DSM-5"
Papazoglou, Aimilia; Jacobson, Lisa A.; McCabe, Marie; Kaufmann, Walter; Zabel, T. Andrew
2014-01-01
The "Diagnostic and Statistical Manual of Mental Disorders-Fifth Edition" ("DSM-5") diagnostic criteria for intellectual disability (ID) include a change to the definition of adaptive impairment. New criteria require impairment in one adaptive domain rather than two or more skill areas. The authors examined the diagnostic…
2012-03-01
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 13124-003] Copper Valley Electric Association, Inc.; Notice of Extension of Time for Filing of Comments, Final Terms and Conditions, Recommendations, and Prescriptions As stated in a letter dated January 27, 2012, in this proceeding by the...
Lv, Minghua; Miao, Jinlin; Zhao, Peng; Luo, Xing; Han, Qing; Wu, Zhenbiao; Zhang, Kui; Zhu, Ping
2018-01-01
CD161 is used as a surrogate marker for Th17 cells, which are implicated in the pathogenesis of rheumatoid arthritis (RA). In this study, we evaluated the percentage, clinical significance, and CD98 and CD147 expression of CD4 + CD161 + T cells. The potential role of CD147 and CD98 in cyclophilin A-induced chemotaxis of CD4 + CD161 + T cells was analyzed. Thirty-seven RA patients, 15 paired synovial fluid (SF) of RA, and 22 healthy controls were recruited. The cell populations and surface expression of CD98 and CD147 were analyzed by flow cytometry. Spearman's rank correlation coefficient and multiple linear regression were applied to calculate the correlations. Chemotaxis assay was used to investigate CD4 + CD161 + T cell migration. We found that the percentage of CD4 + CD161 + T cells and their expression of CD147 and CD98 in SF were higher than in the peripheral blood of RA patients. Percentage of SF CD4 + CD161 + T cells was positively correlated with 28-Joint Disease Activity Score (DAS28). CD147 monoclonal antibody (HAb18) attenuated the chemotactic ability of CD4 + CD161 + T cells. An increased CD4 + CD161 + T cell percentage and expression of CD147 and CD98 were shown in RA SF. Percentage of SF CD4 + CD161 + T cells can be used as a predictive marker of disease activity in RA. CD147 block significantly decreased the chemotactic index of CD4 + CD161 + cells induced by cyclophilin A (CypA). These results imply that the accumulation of CD4 + CD161 + T cells in SF and their high expression of CD147 may be associated with CypA-mediated chemotaxis and contribute to local inflammation in RA.
STS-93 crew cheers as they near the van for ride to launch pad
1999-01-01
The STS-93 crew wave and cheer as they head for the 'Astrovan' a third time to take them to Launch Pad 39-B and liftoff of Space Shuttle Columbia. In their orange launch and entry suits, they are (starting at rear, left to right) Mission Specialists Michel Tognini of France, who represents the Centre National d'Etudes Spatiales (CNES), Catherine G. Coleman (Ph.D.), and Stephen A. Hawley (Ph.D.); Pilot Jeffrey S. Ashby; and Commander Eileen M. Collins. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. The target landing date is July 27 at 11:20 p.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. Collins is the first woman to serve as commander of a Shuttle mission.
ACE I/D genotype, adiposity, and blood pressure in children
Directory of Open Access Journals (Sweden)
Rothschild Max
2009-03-01
Full Text Available Abstract Background Angiotensin converting enzyme (ACE is a possible candidate gene that may influence both body fatness and blood pressure. Although several genetic studies have been conducted in adults, relatively few studies have examined the contribution of potential candidate genes, and specifically ACE I/D, on adiposity and BP phenotypes in childhood. Such studies may prove insightful for the development of the obesity-hypertension phenotype early in life. The purpose of this study was to examine differences in body fatness and resting blood pressure (BP by ACE I/D genotype, and determine if the association between adiposity and BP varies by ACE I/D genotype in children. Methods 152 children (75 girls, 77 boys were assessed for body composition (% body fat using dual energy x-ray absorbtiometry and resting BP according to American Heart Association recommendations. Buccal cell samples were genotyped using newly developed PCR-RFLP tests for two SNPs (rs4341 and rs4343 in complete linkage disequilibrium with the ACE I/D polymorphism. Partial correlations were computed to assess the ociations between % body fat and BP in the total sample and by genotype. ANCOVA was used to examine differences in resting BP by ACE I/D genotype and fatness groups. Results Approximately 39% of youth were overfat based on % body fat (>30% fat in girls, 25% fat in boys. Body mass, body mass index, and fat-free mass were significantly higher in the ACE D-carriers compared to the II group (p Conclusion ACE D-carriers are heavier than ACE II children; however, BP did not differ by ACE I/D genotype but was adversely influenced in the overfat D-carriers. Further studies are warranted to investigate the genetics of fatness and BP phenotypes in children.
Id3 induces an Elk-1–caspase-8-dependent apoptotic pathway in squamous carcinoma cells
International Nuclear Information System (INIS)
Chen, You-Shin; Aubee, Joseph; DiVito, Kyle A; Zhou, Hengbo; Zhang, Weiyi; Chou, Fen-Pi; Simbulan-Rosenthal, Cynthia M; Rosenthal, Dean S
2015-01-01
Inhibitor of differentiation/DNA-binding (Id) proteins are helix–loop–helix (HLH) transcription factors. The Id protein family (Id1–Id4) mediates tissue homeostasis by regulating cellular processes including differentiation, proliferation, and apoptosis. Ids typically function as dominant negative HLH proteins, which bind other HLH proteins and sequester them away from DNA promoter regions. Previously, we have found that Id3 induced apoptosis in immortalized human keratinocytes upon UVB exposure, consistent with its role as a tumor suppressor. To investigate the role of Id3 in malignant squamous cell carcinoma (SCC) cells (A431), a tetracycline-regulated inducible system was used to induce Id3 in cell culture and mouse xenograft models. We found that upon Id3 induction, there was a decrease in cell number under low serum conditions, as well as in soft agar. Microarray, RT-PCR, immunoblot, siRNA, and inhibitor studies revealed that Id3 induced expression of Elk-1, an E-twenty-six (ETS)-domain transcription factor, inducing procaspase-8 expression and activation. Id3 deletion mutants revealed that 80 C-terminal amino acids, including the HLH, are important for Id3-induced apoptosis. In a mouse xenograft model, Id3 induction decreased tumor size by 30%. Using immunofluorescent analysis, we determined that the tumor size decrease was also mediated through apoptosis. Furthermore, we show that Id3 synergizes with 5-FU and cisplatin therapies for nonmelanoma skin cancer cells. Our studies have shown a molecular mechanism by which Id3 induces apoptosis in SCC, and this information can potentially be used to develop new treatments for SCC patients
Grant, Sheena; Cross, Elaine; Wraith, James Edmond; Jones, Simon; Mahon, Louise; Lomax, Michelle; Bigger, Brian; Hare, Dougal
2013-03-01
Mucopolysaccharidosis type III (MPS III, Sanfilippo syndrome) is a lysosomal storage disorder, caused by a deficiency in one of four enzymes involved in the catabolism of the glycosaminoglycan heparan sulphate. It is a degenerative disorder, with a progressive decline in children's intellectual and physical functioning. There is currently no cure for the disorder. To date there is a paucity of research on how this disorder impacts parents psychological functioning. Specifically, research in the area has failed to employ adequate control groups to assess if the impact of this disorder on parents psychological functioning differs from parenting a child with intellectual disability (ID). The current study examined child behaviour and parental psychological functioning in 23 parents of children with MPS III and 23 parents of children with ID. Parents completed postal questionnaires about their child's behaviour and abilities and their own psychological functioning. Parents of children with MPS III reported fewer behavioural difficulties as their child aged, more severe level of intellectual disability, and similar levels of perceived social support, coping techniques, stress, anxiety and depression levels as parents of children with ID. Both groups of parents scored above the clinical cut off for anxiety and depression. Parents of children with MPS III rated themselves as significantly less future-orientated and goal directed than parents of children with ID. Services should develop support packages for parents of children with MPS III that incorporate an understanding of the unique stressors and current-difficulty approach of this population. Future research should examine gender differences between parental psychological functioning, using mixed qualitative and quantitative approaches, and utilise matched developmental level and typically developing control groups.
21 CFR 161.30 - Declaration of quantity of contents on labels for canned oysters.
2010-04-01
... canned oysters. 161.30 Section 161.30 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH....30 Declaration of quantity of contents on labels for canned oysters. (a) For many years packers of canned oysters in the Gulf area of the United States have labeled their output with a declaration of the...
Expression of LLT1 and its receptor CD161 in lung cancer is associated with better clinical outcome.
Braud, Véronique M; Biton, Jérôme; Becht, Etienne; Knockaert, Samantha; Mansuet-Lupo, Audrey; Cosson, Estelle; Damotte, Diane; Alifano, Marco; Validire, Pierre; Anjuère, Fabienne; Cremer, Isabelle; Girard, Nicolas; Gossot, Dominique; Seguin-Givelet, Agathe; Dieu-Nosjean, Marie-Caroline; Germain, Claire
2018-01-01
Co-stimulatory and inhibitory receptors expressed by immune cells in the tumor microenvironment modulate the immune response and cancer progression. Their expression and regulation are still not fully characterized and a better understanding of these mechanisms is needed to improve current immunotherapies. Our previous work has identified a novel ligand/receptor pair, LLT1/CD161, that modulates immune responses. Here, we extensively characterize its expression in non-small cell lung cancer (NSCLC). We show that LLT1 expression is restricted to germinal center (GC) B cells within tertiary lymphoid structures (TLS), representing a new hallmark of the presence of active TLS in the tumor microenvironment. CD161-expressing immune cells are found at the vicinity of these structures, with a global enrichment of NSCLC tumors in CD161 + CD4 + and CD8 + T cells as compared to normal distant lung and peripheral blood. CD161 + CD4 + T cells are more activated and produce Th1-cytokines at a higher frequency than their matched CD161-negative counterparts. Interestingly, CD161 + CD4 + T cells highly express OX40 co-stimulatory receptor, less frequently 4-1BB, and display an activated but not completely exhausted PD-1-positive Tim-3-negative phenotype. Finally, a meta-analysis revealed a positive association of CLEC2D (coding for LLT1) and KLRB1 (coding for CD161) gene expression with favorable outcome in NSCLC, independently of the size of T and B cell infiltrates. These data are consistent with a positive impact of LLT1/CD161 on NSCLC patient survival, and make CD161-expressing CD4 + T cells ideal candidates for efficient anti-tumor recall responses.
STS 63: Post flight presentation
1995-02-01
At a post flight conference, Captain Jim Wetherbee, of STS Flight 63, introduces each of the other members of the STS 63 crew (Eileen Collins, Pilot; Dr. Bernard Harris, Payload Commander; Dr. Michael Foale, Mission Specialist from England; Dr. Janice Voss, Mission Specialist; and Colonel Vladimir Titor, Mission Specialist from Russia), gave a short autobiography of each member and a brief description of their assignment during this mission. A film was shown that included the preflight suit-up, a view of the launch site, the actual night launch, a tour of the Space Shuttle and several of the experiment areas, several views of earth and the MIR Space Station and cosmonauts, the MlR-Space Shuttle rendezvous, the deployment of the Spartan Ultraviolet Telescope, Foale and Harris's EVA and space walk, the retrieval of Spartan, and the night entry home, including the landing. Several spaceborne experiments were introduced: the radiation monitoring experiment, environment monitoring experiment, solid surface combustion experiment, and protein crystal growth and plant growth experiments. This conference ended with still, color pictures, taken by the astronauts during the entire STS 63 flight, being shown.
2013-02-06
... Services Group, Inc., Commercial/Actuarial/ Information Delivery Services (IDS)/Corporate & Financial... workers and former workers of Hartford Financial Services Group, Inc., Commercial/Actuarial/Information Delivery Services (IDS)/Corporate & Financial Reporting group, Hartford, Connecticut (The Hartford-IDS...
2012-01-03
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 13022-003] Barren River Lake Hydro LLC; Notice of Application Tendered for Filing With the Commission, Soliciting Additional Study Requests, and Establishing Procedural Schedule for Licensing and a Deadline for Submission of Final Amendments Take notice that the following...
76 FR 76711 - DCP Raptor Pipeline, LLC; Notice of Motion for Extension of Rate Case Filing Deadline
2011-12-08
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR09-32-003] DCP Raptor..., 2011, DCP Raptor Pipeline, LLC (Raptor) filed a request for an extension consistent with the Commission... pipelines to extend the cycle for such reviews from three to five years.\\1\\ Therefore, Raptor requests that...
1995-01-01
On this eighth day of the STS-84 mission, the flight crew, Cmdr. Charles J. Precourt, Pilot Eileen M. Collins, Payload Cmdr, Jean-Francois Clervoy (ESA), Mission Specialists Edward T. Lu, Carlos I. Noriega, Elena V. Kondakova, Jerry M. Linenger (download), and C. Michael Foale (upload) sing 'The Cosmonauts' Song' to Mir-23 crew members Vasily Tsibliev, Alexander Lazutkin and astronaut Mike Foale, who is beginning his four-month research mission on Mir. Foale and his new crewmates played music as Atlantis departed following the joint phase of the flight. Atlantis' undocking from Mir was modified from previous joint missions in that a flyaround of the station for photographic purposes was not conducted. Instead, Pilot Eileen Collins guided Atlantis below the Mir after the two spacecraft completed their physical separation, stopping three times at distances of 90, 300 and 1,500 feet to collect data from a European sensor device designed to assist future rendezvous of a proposed European Space Agency resupply vehicle with the International Space Station. Once the data collection was completed, the shuttle took advantage of natural orbital mechanics to drift beneath and out in front of Mir.
Identity Management ToolKit (IdM TK)
Department of Veterans Affairs — With the IdM TK, authorized users can search and view identity and exception information from the Administrative Data Repository (ADR). Specifically, users can view...
Op. No A4495 Columbia, STS-93 Chandra - Breakfast, Suiting, and Walkout
1999-01-01
The primary objective of the STS-93 mission was to deploy the Advanced X-ray Astrophysical Facility, which had been renamed the Chandra X-ray Observatory in honor of the late Indian-American Nobel Laureate Subrahmanyan Chandrasekhar. The mission was launched at 12:31 on July 23, 1999 onboard the space shuttle Columbia. The mission was led by Commander Eileen Collins. The crew was Pilot Jeff Ashby and Mission Specialists Cady Coleman, Steve Hawley and Michel Tognini from the Centre National d'Etudes Spatiales (CNES). This videotape shows the astronauts after breakfast getting into spacesuits, walking out to board the bus, and boarding the bus prior to launch.
African Journals Online (AJOL)
a tu N = 30 oca a una ve. Ref. 12. 164.3. 102.8". 182.28. 160.8. 99 1". 162.09. 104.1. 154.7. 104.0. 120.3. 128.3. 16.0. 161.I. 116.0. 128.3. 165.0. 103.5. 183.0. 161.9. 99.7. 162.7. 104.8. 155.3. 104.5. 120.8. 129.1. 116.6. 161.4. 116.6. 129.1. Chemical shifts with the same subscript are interchangeable. The 'H NMR spectrum ...
12 CFR 16.1 - Authority, purpose, and scope.
2010-01-01
....1 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY SECURITIES OFFERING DISCLOSURE RULES § 16.1 Authority, purpose, and scope. (a) Authority. This part is issued under the general... 12 U.S.C. 93a. (b) Purpose. This part sets forth rules governing the offer and sale of securities...
Security and Privacy Improvements for the Belgian eID Technology
Verhaeghe, Pieter; Lapon, Jorn; de Decker, Bart; Naessens, Vincent; Verslype, Kristof
The Belgian Electronic Identity Card enables Belgian citizens to prove their identity digitally and to sign electronic documents. At the end of 2009, every Belgian citizen older than 12 years will have such an eID card. In the future, usage of the eID card may be mandatory. However, irresponsible use of the card may cause harm to individuals.
Energy Technology Data Exchange (ETDEWEB)
Jared Verba; Michael Milvich
2008-05-01
Current Intrusion Detection System (IDS) technology is not suited to be widely deployed inside a Supervisory, Control and Data Acquisition (SCADA) environment. Anomaly- and signature-based IDS technologies have developed methods to cover information technology-based networks activity and protocols effectively. However, these IDS technologies do not include the fine protocol granularity required to ensure network security inside an environment with weak protocols lacking authentication and encryption. By implementing a more specific and more intelligent packet inspection mechanism, tailored traffic flow analysis, and unique packet tampering detection, IDS technology developed specifically for SCADA environments can be deployed with confidence in detecting malicious activity.
2013-04-29
... SECURITIES AND EXCHANGE COMMISSION [Release No. 34-69362A; File No. 600-23] Self-Regulatory Organizations; Fixed Income Clearing Corporation; Notice of Filing of Amended Application for Registration as a Clearing Agency; Correction AGENCY: Securities and Exchange Commission. ACTION: Notice; correction. SUMMARY...
78 FR 25406 - Proposed Modification of Class E Airspace; Twin Falls, ID
2013-05-01
...) Global Positioning System (GPS) and the Instrument Landing System (ILS) or Localizer (LOC) standard... the earth. * * * * * ANM ID E5 Twin Falls, ID [Modified] Twin Falls Joslin Field-Magic Valley Regional...
77 FR 27221 - Combined Notice of Filings #2
2012-05-09
.... ET 5/23/12. Docket Numbers: ER12-1698-000. Applicants: New Mexico Renewable Energy Transmission..., LLC, New Mexico Renewable Energy Transmission Authority. Description: Request for Limited Waiver of... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Combined Notice of Filings 2 Take notice...
78 FR 45478 - Proposed Establishment of Class E Airspace; Salmon, ID
2013-07-29
...-0531; Airspace Docket No. 13-ANM-20] Proposed Establishment of Class E Airspace; Salmon, ID AGENCY... action proposes to establish Class E airspace at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules...
Muon Identification performance: hadron mis-Id measurements and RPC Muon selections
CMS Collaboration
2014-01-01
Pion, kaon, proton mis-identification probabilities as muons have been measured for different Muon ID algorithms. Results from two independent analyses are presented. The performance of a new muon ID algorithm based on matching of inner tracks with hits in muon RPC chambers is also presented.
JENDL gas-production cross section file
International Nuclear Information System (INIS)
Nakagawa, Tsuneo; Narita, Tsutomu
1992-05-01
The JENDL gas-production cross section file was compiled by taking cross-section data from JENDL-3 and by using the ENDF-5 format. The data were given to 23 nuclei or elements in light nuclei and structural materials. Graphs of the cross sections and brief description on their evaluation methods are given in this report. (author)
Directory of Open Access Journals (Sweden)
Finn Hedefalk
2014-09-01
Full Text Available The Intermediate Data Structure (IDS is a standardised database structure for longitudinal historical databases. Such a common structure facilitates data sharing and comparative research. In this study, we propose an extended version of IDS, named IDS-Geo, that also includes geographic data. The geographic data that will be stored in IDS-Geo are primarily buildings and/or property units, and the purpose of these geographic data is mainly to link individuals to places in space. When we want to assign such detailed spatial locations to individuals (in times before there were any detailed house addresses available, we often have to create tailored geographic datasets. In those cases, there are benefits of storing geographic data in the same structure as the demographic data. Moreover, we propose the export of data from IDS-Geo using an eXtensible Markup Language (XML Schema. IDS-Geo is implemented in a case study using historical property units, for the period 1804 to 1913, stored in a geographically extended version of the Scanian Economic Demographic Database (SEDD. To fit into the IDS-Geo data structure, we included an object lifeline representation of all of the property units (based on the snapshot time representation of single historical maps and poll-tax registers. The case study verifies that the IDS-Geo model is capable of handling geographic data that can be linked to demographic data.
ACE insertion/deletion (I/D) polymorphism and diabetic nephropathy.
Rahimi, Zohreh
2012-10-01
Angiotensin converting enzyme (ACE) gene encodes ACE, a key component of renin angiotensin system (RAS), plays an important role in blood pressure homeostasis by generating the vasoconstrictor peptide angiotensin II. Directory of Open Access Journals (DOAJ), Google Scholar, Pubmed (NLM), LISTA (EBSCO) and Web of Science have been searched. The presence of ACE insertion/deletion (I/D) polymorphism affects the plasma level of ACE. ACE DD genotype is associated with the highest systemic and renal ACE levels compared with the lowest ACE activity in carriers of II genotype. In this review focus has been performed on the study of ACE I/D polymorphism in various populations and its influence on the risk of onset and progression of diabetic nephropathy. Also, association between ACE I/D polymorphism and response to ACE inhibitor and angiotensin II receptor antagonists will be reviewed. Further, synergistic effect of this polymorphism and variants of some genes on the risk of development of diabetic nephropathy will be discussed.
Independence Day 2004 (ID04) / Raul Hindov
Hindov, Raul
2004-01-01
Ülevaade 20.-22. veebruarini 2004 toimunud kaugluurepatrullide rännaku ja sõdurioskuste kompleksõppusest ID04 (Independence Day 2004 - Iseseisvuspäev 2004), millel osales 25 patrullvõistlusteks valmistuvat meest ja naist
STS-100 MS Parazynski looks over Destiny in SSPF
2000-01-01
In the Space Station Processing Facility, STS-100 Mission Specialist Scott Parazynski looks over part of the U.S. Lab, Destiny. Mission STS-100 will be the ninth construction flight for the International Space Station. It is scheduled to launch April 19, 2001.
sY116, a human Y-linked polymorphic STS
Indian Academy of Sciences (India)
linked STS, showed different electrophoretic mobilities in three males, two infertile and one fertile. A study of this STS among 35 other normal males showed that this locus is polymorphic. sY116 has a poly A-rich stretch whose instability ...
STS-93 Commander Eileen Collins waves to her family
1999-01-01
STS-93 Commander Eileen M. Collins waves to her family nearby, a last meeting before launch of mission STS-93 on July 20. Liftoff is scheduled for 12:36 a.m. EDT. The primary mission of STS-93 is the release of the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X- ray telescope and is expected to unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Steven A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
International Nuclear Information System (INIS)
Noetzel, Erik; Veeck, Jürgen; Niederacher, Dieter; Galm, Oliver; Horn, Felicitas; Hartmann, Arndt; Knüchel, Ruth; Dahl, Edgar
2008-01-01
Inhibitor of DNA binding/Inhibitor of differentiation 4 (ID4) is a critical factor for cell proliferation and differentiation in normal vertebrate development. ID4 has regulative functions for differentiation and growth of the developing brain. The role of ID1, ID2 and ID3 are expected to be oncogenic due to their overexpression in pancreatic cancer and colorectal adenocarcinomas, respectively. Aside from these findings, loss of ID3 expression was demonstrated in ovarian cancer. The aim of the present study was to reveal the factual role of ID4 in carcinogenesis in more detail, since its role for the pathogenesis of human breast cancer has been discussed controversially, assigning both oncogenic and tumour suppressive functions. ID4 promoter methylation, ID4 mRNA expression and ID4 protein expression were analysed in primary human breast cancer specimens using methylation-specific PCR (MSP) (n=170), semiquantitative realtime RT-PCR (n=46) and immunhistochemistry (n=3), respectively. In order to demonstrate a functional association of ID4 promoter methylation with its gene silencing, we performed DNA demethylation analysis with four human breast cell lines using MSP and semiquantitative realtime RT-PCR. In addition, we performed correlations of ID4 promoter methylation with ID4 mRNA and ID4 protein expression in matched samples of breast tumour and corresponding normal tissue. We carried out statistical analyses in order to find correlations between ID4 promoter methylation and clinicopathological parameters. Frequent ID4 promoter methylation was observed in primary breast cancer samples (69%, 117/170). We found a tight correlation (P<0.0001) between ID4 promoter methylation and loss of ID4 expression in primary breast cancer 3 specimens. Demethylating treatment with breast cancer cell lines was associated with clear ID4 mRNA re-expression. Tumours with ID4 promoter methylation showed distinct loss of ID4 expression on both transcription and protein level
Increased Inhibitor of Differentiation 4 (Id4 Expression in Glioblastoma: A Tissue Microarray Study
Directory of Open Access Journals (Sweden)
Weifin Zeng, Elisabeth J. Rushing, Daniel P. Hartmann, Norio Azumi
2010-01-01
Full Text Available Background: The inhibitor of differentiation/DNA binding protein family (Id1-4 is involved in cell cycle control, tumorigenesis and angiogenesis through the negative regulation of helix-loop-helix transcription factors. Of these proteins, Id4 is known to play an important role in neural stem cell differentiation, and deregulation has been implicated in glial neoplasia. However, the expression and significance of Id4 in astrocytomas has not been fully addressed. Herein we report the differential expression of Id4 in astrocytomas of various grades using tissue microarrays (TMA and immunohistochemistry (IHC. Design: The GBM TMA was constructed from 53 archival cases at Georgetown University Hospital and a TMA with normal brain controls and grades II-III astrocytoma was obtained from Cybrdi (Rockville, MD. TMA sections were stained with Id4 antibody and the slides were scored according to the percentage of staining astrocytic nuclei (<9% -, 10-50% +, >51% ++. The Fisher Exact test was used to test for statistical significance. Results: Nuclear staining for Id4 was seen in 73.58% GBMs, 25% grade III, and 12.5% grade II astrocytomas; staining was absent in normal brain tissue. There was a statistically significant difference between GBM and grades II, III astrocytoma (p <0.01. Significant Id4 expression was not detected in normal brain. Conclusions: Our study confirms the frequent upregulation of Id4 expression in GBM, which lends support to its role in tumorigenesis, possibly in the transformation of low to high-grade astrocytoma (i.e. GBM. Further studies are warranted to determine the precise role of Id4 in glial neoplasia and its potential use in targeted therapy for GBM.
76 FR 18754 - J-W Pipeline Company; Notice of Motion for Extension of Rate Case Filing Deadline
2011-04-05
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR09-6-003] J-W Pipeline...-W Pipeline Company (J-W) filed a request for an extension consistent with the Commission's revised... extend the cycle for such reviews from three to five years.\\1\\ Therefore, J-W requests that the date for...
PILOTSTUDY TO EVALUATE THE EFFECT OF PHOSPHORUSBINDERS ON FGF23
Directory of Open Access Journals (Sweden)
A.Bouma de Krijger
2012-06-01
Results are as follows; phosphorus binding by sevelamer significantly lowered urinary phosphate excretion, from a median of 26.25 mmol/24 h to 17.5 mmol/l. Other parameters showed no sgnificant association with urinary phosphate excretion. The serum phosphate was unchanged during treatment. Creatinin clearance was significantly associated with FGF23 (p0.03. FGF23 did not change significant following phosphorus binding therapy. In conclusion; although 8 weeks sevelamer treatment significantly lowered 24 h urinary phosphate excretion, there was no reduction in FGF23 levels in this group of CKD stage 3 patients.
STS-87 Mission Specialist Winston E. Scott suits up
1997-01-01
STS-87 Mission Specialist Winston Scott dons his launch and entry suit with the assistance of a suit technician in the Operations and Checkout Building. This is Scotts second space flight. He and the five other crew members will depart shortly for Launch Pad 39B, where the Space Shuttle Columbia awaits liftoff on a 16-day mission to perform microgravity and solar research. Scott is scheduled to perform an extravehicular activity spacewalk with Mission Specialist Takao Doi, Ph.D., of the National Space Development Agency of Japan, during STS-87. He also performed a spacewalk on STS-72.
STS-99 workers carry new Master Events Controller to Endeavour
2000-01-01
Workers carry the replacement Enhanced Main Events Controller (E- MEC) to Shuttle Endeavour at Launch Pad 39A for installation in the aft compartment of the payload bay. The original E-MEC became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. Both E-MECs are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.
SH003 suppresses breast cancer growth by accumulating p62 in autolysosomes.
Choi, Youn Kyung; Cho, Sung-Gook; Choi, Yu-Jeong; Yun, Yee Jin; Lee, Kang Min; Lee, Kangwook; Yoo, Hye-Hyun; Shin, Yong Cheol; Ko, Seong-Gyu
2017-10-24
Drug markets revisits herbal medicines, as historical usages address their therapeutic efficacies with less adverse effects. Moreover, herbal medicines save both cost and time in development. SH003, a modified version of traditional herbal medicine extracted from Astragalus membranaceus (Am), Angelica gigas (Ag), and Trichosanthes Kirilowii Maximowicz (Tk) with 1:1:1 ratio (w/w) has been revealed to inhibit tumor growth and metastasis on highly metastatic breast cancer cells, both in vivo and in vitro with no toxicity. Meanwhile, autophagy is imperative for maintenance cellular homeostasis, thereby playing critical roles in cancer progression. Inhibition of autophagy by pharmacological agents induces apoptotic cell death in cancer cells, resulting in cancer treatment. In this study, we demonstrate that SH003-induced autophagy via inhibiting STAT3 and mTOR results in an induction of lysosomal p62/SQSTM1 accumulation-mediated reactive oxygen species (ROS) generation and attenuates tumor growth. SH003 induced autophagosome and autolysosome formation by inhibiting activation of STAT3- and mTOR-mediated signaling pathways. However, SH003 blocked autophagy-mediated p62/SQSTM1 degradation through reducing of lysosomal proteases, Cathepsins, resulting in accumulation of p62/SQSTM1 in the lysosome. The accumulation of p62/SQSTM1 caused the increase of ROS, which resulted in the induction of apoptotic cell death. Therefore, we conclude that SH003 suppresses breast cancer growth by inducing autophagy. In addition, SH003-induced p62/SQSTM1 could function as an important mediator for ROS generation-dependent cell death suggesting that SH003 may be useful for treating breast cancer.
Migraine headaches among university students using id migraine test as a screening tool
Directory of Open Access Journals (Sweden)
Caylan Ayse
2011-08-01
Full Text Available Abstract Background Migraine is a significant health problem, especially for the young people, due to its frequency and accompanying morbidity, causing disability and loss of performance. In this study, our aim was to determine the prevalence of migraine headaches among university students in Edirne, a Turkish city. Methods In this cross-sectional and descriptive study, study population was composed of students registered to Trakya University in the academic year of 2008-2009. Out of these, 3694 of them accepted to participate. Participants who had two or more headaches in the last 3 months formed the headache group. Afterwards, two preliminary questions were applied to the headache group and participants with at least one affirmative response were asked to perform the validated ID-Migraine™ test. Results The mean age of 3694 students participated in the study was 19.23 ± 1.84 (17-39 years, with adolescents:adult ratio being 2.5:1. 1613 students (43.7% did have at least two headaches in the last three months. Migraine-type headache was detected in 266 subjects (7.2% based on the ID-Migraine™ test. Of the migraine group, 72 were male (27.1% and 194 were female (72.9%. There was no significant difference in migraine prevalence between adolescent and adult age groups. Conclusions With a prevalence similar to adults, primary care physicians should be aware of the probability of migraine headaches in university students in order to maintain a successful school performance.
Enkripsi dan Dekripsi File dengan Algoritma Blowfish pada Perangkat Mobile Berbasis Android
Directory of Open Access Journals (Sweden)
Siswo Wardoyo
2016-03-01
Full Text Available Cryptography is one of the ways used to secure data in the form of a file with encrypt files so that others are not entitled to know the file is private and confidential. One method is the algorithm Blowfish Cryptography which is a symmetric key using the algorithm to perform encryption and decryption. Applications that are built can perform file encryption-shaped images, videos, and documents. These applications can be running on a mobile phone that has a minimal operating system Android version 2.3. The software used to build these applications is Eclipse. The results of this research indicate that applications built capable of performing encryption and decryption. The results file encryption makes files into another unknown meaning. By using the keys numbered 72 bits or 9 character takes 1,49x108 years to break it with the speed it’s computation is 106 key/sec.
Teacher beliefs about teaching science through Science-Technology-Society (STS)
Massenzio, Lynn
2001-07-01
Statement of the problem. As future citizens, students will have the enormous responsibility of making decisions that will require an understanding of the interaction of science and technology and its interface with society. Since many societal issues today are grounded in science and technology, learning science in its social context is vital to science education reform. Science-Technology-Society (STS) has been strongly identified with meeting this goal, but despite its benefits, putting theory into practice has been difficult. Research design and methodology. The purpose of this study was to explore teacher beliefs about teaching science through STS. The following broad research questions guided the study: (1) What are the participants' initial beliefs about teaching science through STS? (2) What beliefs emerge as participants reflect upon and share their STS instructional experiences with their peers? A social constructivist theoretical framework was developed to plan interactions and collect data. Within this framework, a qualitative methodology was used to interpret the data and answer the research questions. Three provisionally certified science teachers engaged in a series of qualitative tasks including a written essay, verbal STS unit explanation, reflective journal writings, and focus group interviews. After implementing their STS unit, the participants engaged in meaningful dialogue with their peers as they reflected upon, shared, and constructed their beliefs. Conclusions. The participants strongly believed in STS as a means for achieving scientific and technological literacy, developing cognition, enhancing scientific habits of mind and affective qualities, and fostering citizen responsibility. Four major assertions were drawn: (a) Participants' initial belief in teaching for citizen responsibility did not fully align with practice, (b) Educators at the administrative level should be made aware of the benefits of teaching science through STS, (c
Explorations of Tenth-Grade STS[E] Curricula across Three Provincial Political Landscapes
Phillips, Christina Ann
This thesis focuses on explorations of science, technology, society and the environment (i.e., STS[E]) outcomes/expectations in tenth-grade level science curricula across three Canadian provinces (i.e., Alberta, Manitoba & Ontario) with distinctive provincial political environments at the time of curriculum construction and/or implementation. Document analysis, discourse analysis and a range of theoretical frameworks (i.e., Levinson, 2010; Pedretti & Nazir, 2011 & Krathwohl, 2002) were used to aid in explorations of STS[E] curriculum segments and discourses in each provincial region. More detailed analysis and thematic exploration is presented for each unit associated with climate change as some interesting patterns emerged following initial analysis. My findings are presented as three comparative case studies and represent a small and original contribution to the large body of scholarly research devoted to studies of STS[E] education, where each province represents a unique case that has been explored regarding some aspects the STS[E] curriculum outcomes/expectations and general political culture as well as some other theoretical factors. Findings from this study indicate that Alberta's STS[E] outcomes may be related to Levinson's (2010) 'deliberative' citizenship focus. The following currents from Pedretti and Nazir (2011) appear to be emphasized: logical reasoning, historical, application & design and socio-cultural aligned outcomes when STS[E] is considered as an entity separate from the Alberta curriculum combination of STS and Knowledge. Ontario's STS[E] expectations may align with Levinson's (2010) 'deliberative' or in some select cases a 'deliberative'/'praxis' framework category with some emphasis related to logical reasoning and socio-cultural awareness (Pedretti & Nazir, 2011) in their STS[E] curriculum. The Manitoba STS[E] outcomes may be aligned with a more 'deliberative' approach with some associations that could intersect with the framework
Temple, V; Drummond, C; Valiquette, S; Jozsvai, E
2010-06-01
Video conferencing (VC) technology has great potential to increase accessibility to healthcare services for those living in rural or underserved communities. Previous studies have had some success in validating a small number of psychological tests for VC administration; however, VC has not been investigated for use with persons with intellectual disabilities (ID). A comparison of test results for two well known and widely used assessment instruments was undertaken to establish if scores for VC administration would differ significantly from in-person assessments. Nineteen individuals with ID aged 23-63 were assessed once in-person and once over VC using the Wechsler Abbreviated Scale of Intelligence (WASI) and the Beery-Buktenica Test of Visual-Motor Integration (VMI). Highly similar results were found for test scores. Full-scale IQ on the WASI and standard scores for the VMI were found to be very stable across the two administration conditions, with a mean difference of less than one IQ point/standard score. Video conferencing administration does not appear to alter test results significantly for overall score on a brief intelligence test or a test of visual-motor integration.
Directory of Open Access Journals (Sweden)
Cǎtǎlin NAE
2010-03-01
Full Text Available This paper is dedicated to a very specific type of analysis tool (VLM - Vortex Lattice Method to be integrated in a IDS - Integrated Design System, tailored for the usage of small aircraft industry. The major interest is to have the possibility to simulate at very low computational costs a preliminary set of aerodynamic characteristics for basic aerodynamic global characteristics (Lift, Drag, Pitching Moment and aerodynamic derivatives for longitudinal and lateral-directional stability analysis. This work enables fast investigations of the influence of configuration changes in a very efficient computational environment. Using experimental data and/or CFD information for a specific calibration of VLM method, reliability of the analysis may me increased so that a first type (iteration zero aerodynamic evaluation of the preliminary 3D configuration is possible. The output of this tool is basic state aerodynamic and associated stability and control derivatives, as well as a complete set of information on specific loads on major airframe components.The major interest in using and validating this type of methods is coming from the possibility to integrate it as a tool in an IDS system for conceptual design phase, as considered for development for CESAR project (IP, UE FP6.
Implementasi Cell ID dan GPS dalam Pencarian Lokasi Fasilitas Kesehatan Terdekat
Directory of Open Access Journals (Sweden)
Fahmi Candra Permana
2017-07-01
Full Text Available Cell ID dan GPS merupakan layanan berbasis lokasi dan teknologi yang banyak membantu manusia dalam hal navigasi dan penemuan tempat-tempat yang bermanfaat di sekitarnya. Salah satu komponen utama dari teknologi ini dapat diterapkan pada telepon seluler. Dalam penelitian ini, dirancang sebuah aplikasi dengan memanfaatkan teknologi berdasar implementasi dari Cell ID dan GPS untuk mengetahui posisi user dan lokasi fasilitas kesehatan terdekat di sekitar user dan penggunaan JSON sebagai sarana untuk menyimpan database pada web. Aplikasi ini diimplementasikan pada telepon seluler dengan sistem operasi Android. Hasil dari penelitian ini menunjukkan bahwa Cell ID dan GPS dapat diimplementasikan dengan baik dengan memanfaatkan akses Internet dan Google Maps untuk mencari fasilitas kesehatan terdekat dan menggambarkan daerah sekitar user.
Directory of Open Access Journals (Sweden)
Pillunat LE
2016-09-01
Full Text Available Lutz E Pillunat,1 Peter Eschstruth,2 Stefan Häsemeyer,3 Ulrich Thelen,4 Christian Foja,5 Richard Leaback,6 Stefan Pfennigsdorf7 1Department of Ophthalmology, University Hospital Carl Gustav Carus, Dresden, 2Ophthalmology Practice, Kiel, 3Eye Center Kraichgau, Wiesloch, 4Department of Ophthalmology, University of Münster, Münster, 5Ophthalmology Practice, Leipzig, Germany; 6Allergan Holdings Ltd., Marlow, UK; 7Ophthalmology Practice, Polch, Germany Background: Intraocular pressure (IOP-lowering medications for primary open-angle glaucoma and ocular hypertension commonly contain preservatives that can cause ocular surface damage in many patients. The purpose of this study was to evaluate the efficacy and tolerability of, and compliance to, preservative-free (PF bimatoprost 0.03% in patients with primary open-angle glaucoma or ocular hypertension (IOP ≥18 mmHg in a clinical practice setting. Methods: This open-label study observed patients who were switched to PF bimatoprost 0.03% for medical reasons. IOP was measured at baseline and ~12 weeks later at the final visit, and the change in IOP was calculated. Tolerability and continuation of therapy were assessed at two follow-up visits. Results: A total of 1,830 patients were included in the study, and complete IOP data were available for 1,543 patients. Mean IOP was reduced by 23% from 21.64 mmHg to 16.59 mmHg (P<0.0001. In subgroup analyses, the mean IOP was significantly reduced compared with baseline, regardless of prior therapy, including those previously treated with PF monotherapy. A total of 85.7% of physicians reported the IOP-lowering efficacy of PF bimatoprost 0.03% to be as expected or better than expected. Adverse events (AEs were experienced by 5.7% of patients, and there were no serious AEs reported. The most common AEs were eye irritation (1.7% and hyperemia (1.4%. Physician-reported treatment compliance was reported as better than (48.7% or equal to (43.6% prior treatment in
International Nuclear Information System (INIS)
Maw, Min Khine; Fujimoto, Jiro; Tamaya, Teruhiko
2009-01-01
The inhibitor of DNA-binding (ID) has been involved in cell cycle regulation, apoptosis and angiogenesis. This prompted us to study ID functions in tumor advancement of ovarian cancers. Sixty patients underwent surgery for ovarian cancers. In ovarian cancers, the levels of ID-1, ID-2 and ID-3 mRNAs were determined by real-time reverse transcription-polymerase chain reaction. The histoscore with the localization of ID-1 was determined by immunohistochemistry. Patient prognosis was analyzed with a 36-month survival rate. Microvessel counts were determined by immunohistochemistry for CD34 and factor VIII-related antigen. ID-1 histoscores and mRNA levels both significantly (p < 0.001) increased in ovarian cancers according to clinical stage, regardless of histopathological type. Furthermore, 30 patients with high ID-1 expression had a lower survival rate (53%) compared to patients with low ID-1 expression (80%). ID-1 histoscores and mRNA levels significantly (p < 0.0001) correlated with microvessel counts in ovarian cancers. ID-1 increased in ovarian cancer cells during tumor progression. Moreover, ID-1 expression levels correlated with microvessel counts. Therefore, ID-1 might work on tumor advancement via angiogenesis and is considered to be a candidate for a prognostic indicator in ovarian cancers
14 CFR 121.161 - Airplane limitations: Type of route.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane limitations: Type of route. 121... OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Aircraft Requirements § 121.161 Airplane... specifications, no certificate holder may operate a turbine-engine-powered airplane over a route that contains a...
Efficient coding and detection of ultra-long IDs for visible light positioning systems.
Zhang, Hualong; Yang, Chuanchuan
2018-05-14
Visible light positioning (VLP) is a promising technique to complement Global Navigation Satellite System (GNSS) such as Global positioning system (GPS) and BeiDou Navigation Satellite System (BDS) which features the advantage of low-cost and high accuracy. The situation becomes even more crucial for indoor environments, where satellite signals are weak or even unavailable. For large-scale application of VLP, there would be a considerable number of Light emitting diode (LED) IDs, which bring forward the demand of long LED ID detection. In particular, to provision indoor localization globally, a convenient way is to program a unique ID into each LED during manufacture. This poses a big challenge for image sensors, such as the CMOS camera in everybody's hands since the long ID covers the span of multiple frames. In this paper, we investigate the detection of ultra-long ID using rolling shutter cameras. By analyzing the pattern of data loss in each frame, we proposed a novel coding technique to improve the efficiency of LED ID detection. We studied the performance of Reed-Solomon (RS) code in this system and designed a new coding method which considered the trade-off between performance and decoding complexity. Coding technique decreases the number of frames needed in data processing, significantly reduces the detection time, and improves the accuracy of detection. Numerical and experimental results show that the detected LED ID can be much longer with the coding technique. Besides, our proposed coding method is proved to achieve a performance close to that of RS code while the decoding complexity is much lower.
Vibrational measurements in 3-ID-B
International Nuclear Information System (INIS)
Sutter, J.; Alp, E.; Barraza, J.; Shu, D.
1998-04-01
The authors have undertaken a series of vibrational measurements in hutch 3-ID-B. Their motivation was to compare two different methods of mounting an interferometer for effectiveness in vibrational isolation and stability. In addition they were able to compare the stability of the optical table with and without its eight large bolts inserted
International Nuclear Information System (INIS)
Kurooka, Hisanori; Sugai, Manabu; Mori, Kentaro; Yokota, Yoshifumi
2013-01-01
Highlights: •Sodium arsenite induces cytoplasmic accumulation of Id3. •Arsenite binds to closely spaced N-terminal cysteine residues of Id3. •N-terminal cysteines are essential for arsenite-induced nuclear export of Id3. •Nuclear export of Id3 counteracts its transcriptional repression activity. -- Abstract: Ids are versatile transcriptional repressors that regulate cell proliferation and differentiation, and appropriate subcellular localization of the Id proteins is important for their functions. We previously identified distinct functional nuclear export signals (NESs) in Id1 and Id2, but no active NES has been reported in Id3. In this study, we found that treatment with the stress-inducing metalloid arsenite led to the accumulation of GFP-tagged Id3 in the cytoplasm. Cytoplasmic accumulation was impaired by a mutation in the Id3 NES-like sequence resembling the Id1 NES, located at the end of the HLH domain. It was also blocked by co-treatment with the CRM1-specific nuclear export inhibitor leptomycin B (LMB), but not with the inhibitors for mitogen-activated protein kinases (MAPKs). Importantly, we showed that the closely spaced N-terminal cysteine residues of Id3 interacted with the arsenic derivative phenylarsine oxide (PAO) and were essential for the arsenite-induced cytoplasmic accumulation, suggesting that arsenite induces the CRM1-dependent nuclear export of Id3 via binding to the N-terminal cysteines. Finally, we demonstrated that Id3 significantly repressed arsenite-stimulated transcription of the immediate-early gene Egr-1 and that this repression activity was inversely correlated with the arsenite-induced nuclear export. Our results imply that Id3 may be involved in the biological action of arsenite
Toward operation of series IDs at BL43LXU of SPring-8
Energy Technology Data Exchange (ETDEWEB)
Baron, A. Q. R.; Tanaka, T.; Soutome, K.; Takao, M.; Nakamura, T.; Kobayashi, K.; Fujita, T.; Takahashi, S.; Aoyagi, H.; Shimosaki, Y.; Seike, T.; Uchiyama, H.; Ishikawa, D.; Chuang, T.-H.; Kimura, H.; Tanaka, H.; Kitamura, H.; Ishikawa, T. [SPring-8, 1-1-1 Kouto, Sayo, Hyogo, 679 (Japan)
2016-07-27
This paper discusses two issues relating to using 3 small gap insertion devices in series at BL43LXU of SPring-8 to make a uniquely powerful source in the 15-26 keV region of the x-ray spectrum. The issues discussed are (1) damage to the covers of the downstream IDs by radiation from the upstream IDs and (2) proper steering of the electron beam to get the best photon beam properties. After tests in several configurations, including one where an ID was run without an impedance-reducing cover, the damage issue was solved by installing a distributed absorber in the most downstream ID. The steering issues were mostly resolved by the introduction of appropriate corrector magnets and feedback. The paper is written from the viewpoint of an interested beamline scientist impressed with the cooperation of different groups to make a source for new science possible.
ID'ing innate and innate-like lymphoid cells.
Verykokakis, Mihalis; Zook, Erin C; Kee, Barbara L
2014-09-01
The immune system can be divided into innate and adaptive components that differ in their rate and mode of cellular activation, with innate immune cells being the first responders to invading pathogens. Recent advances in the identification and characterization of innate lymphoid cells have revealed reiterative developmental programs that result in cells with effector fates that parallel those of adaptive lymphoid cells and are tailored to effectively eliminate a broad spectrum of pathogenic challenges. However, activation of these cells can also be associated with pathologies such as autoimmune disease. One major distinction between innate and adaptive immune system cells is the constitutive expression of ID proteins in the former and inducible expression in the latter. ID proteins function as antagonists of the E protein transcription factors that play critical roles in lymphoid specification as well as B- and T-lymphocyte development. In this review, we examine the transcriptional mechanisms controlling the development of innate lymphocytes, including natural killer cells and the recently identified innate lymphoid cells (ILC1, ILC2, and ILC3), and innate-like lymphocytes, including natural killer T cells, with an emphasis on the known requirements for the ID proteins. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
African Journal of Drug & Alcohol Studies, 16(1), 2017 Copyright ...
African Journals Online (AJOL)
African Journal of Drug & Alcohol Studies, 16(1), 2017. Copyright © 2017 ... Linear regression showed that males are more likely to abuse alcohol than females. (β= -.17; t = -3.47; ..... gerians through depression, suicide, road traffic accidents ...
75 FR 38803 - Combined Notice of Filings #1
2010-07-06
... Tinker Gen Co.; Algonquin Energy Services Inc.; Algonquin Northern Maine Gen Co. Description: Algonquin Tinker Gen Co et al. resubmits Substitute Second et al. to FERC Electric Tariff, Fourth Revised Volume 1... X of the Midwest ISO's Open Access Transmission etc. Filed Date: 06/23/2010. Accession Number...
77 FR 14512 - Combined Notice of Filings #1
2012-03-12
... Company. Description: Schedule 4 & 10--Energy & Generator Imbalance Changes to be effective 3/5/2012... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Combined Notice of Filings 1 Take notice...: 5 p.m. ET 3/23/12. Docket Numbers: ER12-458-004. Applicants: Quantum Choctaw Power, LLC. Description...
Simulator testing system (STS)
International Nuclear Information System (INIS)
Miller, V.N.
1990-01-01
In recent years there has been a greater demand placed on the capabilities and time usage of real-time nuclear plant simulators due to NRC, INPO and utilities requirements. The requirements applied to certification, new simulators, upgrades, modifications, and maintenance of the simulators vary; however, they all require the capabilities of the simulator to be tested whether it is for NRC 10CFR55.45b requirements, ATP testing of new simulators, ATP testing of upgrades with or without panels, adding software/hardware due to plant modifications, or analyzing software/hardware problems on the simulator. This paper describes the Simulator Testing System (STS) which addresses each one of these requirements placed on simulators. Special attention will be given to ATP testing of upgrades without the use of control room panels. The capabilities and applications of the four parts of STS which are the Display Control Software (DCS), Procedure Control Software (PCS), Display Generator Software (DGS) and the Procedure Generator Software (PGS) will be reviewed
77 FR 68065 - Amendment of Class D and Class E Airspace; Lewiston, ID
2012-11-15
... Measuring Equipment (VOR/ DME), and the Lewiston-Nez Perce Instrument Landing System (ILS) Localizer... feet or more above the surface of the earth. * * * * * ANM ID E5 Lewiston, ID [Modified] Lewiston-Nez...
13 CFR 125.26 - What are the grounds for filing an SDVO SBC protest?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the grounds for filing an... GOVERNMENT CONTRACTING PROGRAMS Protests Concerning SDVO SBCs § 125.26 What are the grounds for filing an..., spouse or permanent caregiver of such veteran. [70 FR 14527, Mar. 23, 2005, as amended at 72 FR 50041...
78 FR 40382 - Modification of Class D and E Airspace; Twin Falls, ID
2013-07-05
... using the Navigation (RNAV) Global Positioning System (GPS) and the Instrument Landing System (ILS) or... or more above the surface of the earth. * * * * * ANM ID E5 Twin Falls, ID [Modified] Twin Falls...
Id2 reinforces TH1 differentiation and inhibits E2A to repress TFH differentiation.
Shaw, Laura A; Bélanger, Simon; Omilusik, Kyla D; Cho, Sunglim; Scott-Browne, James P; Nance, J Philip; Goulding, John; Lasorella, Anna; Lu, Li-Fan; Crotty, Shane; Goldrath, Ananda W
2016-07-01
The differentiation of helper T cells into effector subsets is critical to host protection. Transcription factors of the E-protein and Id families are important arbiters of T cell development, but their role in the differentiation of the TH1 and TFH subsets of helper T cells is not well understood. Here, TH1 cells showed more robust Id2 expression than that of TFH cells, and depletion of Id2 via RNA-mediated interference increased the frequency of TFH cells. Furthermore, TH1 differentiation was blocked by Id2 deficiency, which led to E-protein-dependent accumulation of effector cells with mixed characteristics during viral infection and severely impaired the generation of TH1 cells following infection with Toxoplasma gondii. The TFH cell-defining transcriptional repressor Bcl6 bound the Id2 locus, which provides a mechanism for the bimodal Id2 expression and reciprocal development of TH1 cells and TFH cells.
Hindered El Transitions in Eu{sup 155} and Tb{sup 161}
Energy Technology Data Exchange (ETDEWEB)
Malmskog, Sven G
1965-02-15
The absolute E1 transition probabilities from the 3/2{sup +} (411), 5/2{sup -} (532) and 7/2{sup -} (523) single particle levels in Eu{sup 155} and Tb{sup 161} have been measured by the method of delayed coincidences. This gave half lives of T{sub 1/2} < 0.2 ns and T{sub 1/2} = (1.38 {+-} 0.06) ns for the 104.4 and 246 keV levels in Eu{sup 155}. T{sub 1/2} = (0.84 {+-} 0.04) ns and T{sub 1/2} < 0. 2 ns for the 417.6 and 480.6 keV levels in Tb{sup 161}. The result has been compared with the calculations of a single particle in a deformed potential made by Nilsson.
Overestimation of the 25(OH)D serum concentration with the automated IDS EIA kit.
Cavalier, Etienne; Huberty, Véronique; Cormier, Catherine; Souberbielle, Jean-Claude
2011-02-01
We have recently observed an increasing number of patients presenting very high serum levels of 25-hydroxyvitamin D [25(OH)D] (> 150 ng/mL), which, in all cases, had been measured with the IDS EIA kit adapted on different "open" automated platforms. We performed a comparison between the IDS EIA kit adapted on two different "open"automated platforms and the DiaSorin RIA. We found a systematic bias (higher levels with the IDS EIA kit) for concentrations more than 50-60 ng/mL that was less obvious when the IDS EIA was used in its manual procedure. We thus suggest to use the IDS EIA kit in its manual procedure rather than to adapt it on an automated platform, and to interpret cautiously a 25(OH)D greater than 100 ng/mL with this kit. Copyright © 2011 American Society for Bone and Mineral Research.
Determination of local chromatin composition by CasID.
Schmidtmann, Elisabeth; Anton, Tobias; Rombaut, Pascaline; Herzog, Franz; Leonhardt, Heinrich
2016-09-02
Chromatin structure and function are determined by a plethora of proteins whose genome-wide distribution is typically assessed by immunoprecipitation (ChIP). Here, we developed a novel tool to investigate the local chromatin environment at specific DNA sequences. We combined the programmable DNA binding of dCas9 with the promiscuous biotin ligase BirA* (CasID) to biotinylate proteins in the direct vicinity of specific loci. Subsequent streptavidin-mediated precipitation and mass spectrometry identified both known and previously unknown chromatin factors associated with repetitive telomeric, major satellite and minor satellite DNA. With super-resolution microscopy, we confirmed the localization of the putative transcription factor ZNF512 at chromocenters. The versatility of CasID facilitates the systematic elucidation of functional protein complexes and locus-specific chromatin composition.
THE HOMOGENEOUS STUDY OF TRANSITING SYSTEMS (HoSTS). I. THE PILOT STUDY OF WASP-13
Energy Technology Data Exchange (ETDEWEB)
Gomez Maqueo Chew, Yilen; Cargile, Phillip; Hebb, Leslie; Stassun, Keivan G. [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States); Faedi, Francesca; Pollacco, Don [Department of Physics, University of Warwick, Coventry CV4 7AL (United Kingdom); Doyle, Amanda P.; Smalley, Barry [Astrophysics Group, Keele University, Staffordshire ST5 5BG (United Kingdom); Ghezzi, Luan; Cunha, Katia; Smith, Verne V. [Observatorio Nacional, Rua Gal. Jose Cristino 77, Rio de Janeiro, RJ 20921-400 (Brazil); Sousa, Sergio; Santos, Nuno C. [Centro de Astrofisica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Barros, Susana C. C. [LAM (Laboratoire d' Astrophysique de Marseille) UMR 7326, Aix Marseille Universite, CNRS, F-13388 Marseille (France); Schuler, Simon C. [Stewart Observatory, University of Arizona, Tucson, AZ 85721 (United States); Collier Cameron, Andrew, E-mail: yilen.gomez@vanderbilt.edu [School of Physics and Astronomy, University of St Andrews, St Andrews, Fife KY16 9SS (United Kingdom)
2013-05-01
We present the fundamental stellar and planetary properties of the transiting planetary system WASP-13 within the framework of the Homogeneous Study of Transiting Systems (HoSTS). HoSTS aims to derive the fundamental stellar (T{sub eff}, [Fe/H], M{sub *}, R{sub *}) and planetary (M{sub pl}, R{sub pl}, T{sub eq}) physical properties of known transiting planets using a consistent methodology and homogeneous high-quality data set. Four spectral analysis techniques are independently applied to a Keck+HIRES spectrum of WASP-13 considering two distinct cases: unconstrained parameters and constrained log g from transit light curves. We check the derived stellar temperature against that from a different temperature diagnostic based on an INT+IDS H{alpha} spectrum. The four unconstrained analyses render results that are in good agreement, and provide an improvement of 50% in the precision of T{sub eff}, and of 85% in [Fe/H] with respect to the WASP-13 discovery paper. The planetary parameters are then derived via the Monte Carlo Markov Chain modeling of the radial velocity and light curves, in iteration with stellar evolutionary models to derive realistic uncertainties. WASP-13 (1.187 {+-} 0.065 M{sub Sun }; 1.574 {+-} 0.048 R{sub Sun }) hosts a Saturn-mass, transiting planet (0.500 {+-} 0.037 M{sub Jup}; 1.407 {+-} 0.052 R{sub Jup}), and is at the end of its main-sequence lifetime (4-5.5 Gyr). Our analysis of WASP-13 showcases that both a detailed stellar characterization and transit modeling are necessary to well determine the fundamental properties of planetary systems, which are paramount in identifying and determining empirical relationships between transiting planets and their hosts.
The Implementation of C-ID, R2D2 Model on Learning Reading Comprehension
Rayanto, Yudi Hari; Rusmawan, Putu Ngurah
2016-01-01
The purposes of this research are to find out, (1) whether C-ID, R2D2 model is effective to be implemented on learning Reading comprehension, (2) college students' activity during the implementation of C-ID, R2D2 model on learning Reading comprehension, and 3) college students' learning achievement during the implementation of C-ID, R2D2 model on…
Anmeldung in ILIAS ohne Uni-Login-ID
Schanz, Nadja
2016-01-01
Gewusst wie...! Online-Tutorial der Universitätsbibliothek Tübingen. Erklärt die Anmeldung in Ilias zu Führungen ohne Uni-Login-ID Online Tutorial from university library tuebingen. teaches how to register in Ilias for courses and guided tours without university login
2012-04-10
... Organizations; The NASDAQ Stock Market LLC; Notice of Filing and Immediate Effectiveness of Proposed Rule Change To Modify NASDAQ's Transaction Execution Fee and Credit Schedule April 5, 2012. Pursuant to Section... hereby given that on March 23, 2012, The NASDAQ Stock Market LLC (``NASDAQ'' or the ``Exchange'') filed...
ASTER Orthorectified Digital Elevation Model (DEM) V003
National Aeronautics and Space Administration — The ASTER L3 DEM and Orthorectified Images form a multi-file product that contains both the Digital Elevation Model (DEM), and the Orthorectified Image products....
On the validity of Ksub(Id)-measurements in instrumented impact tests
International Nuclear Information System (INIS)
Kalthoff, J.F.; Winkler, S.; Klemm, W.; Beinert, J.
1979-01-01
The influence of inertia effects in determining the dynamic fracture toughness Ksub(Id) by instrumented impact testing is investigated. Model experiments in the brittle fracture regime are carried out with precracked bend specimens machined from the epoxy resin Araldite B. As is usual in these tests, the loads at the tup of the impinging striker are recorded as a function of time during the impact process. For reference purposes, the dynamic fracture toughness value Ksub(Id)sup(m1) is derived from the measured maximum load utilizing static stress intensity factor formulas. In addition to this conventional procedure, the actual stress intensity factors are measured directly at the tip of the crack by means of the shadow optical method of caustics applied in combination with high speed photography. The critical value of these optically measured stress intensity factors (for onset of crack propagation), Ksub(Id)sup(opt), is the true dynamic fracture toughness. In the experiments, the specimen size and the impact velocity were varied. In accordance with expectations, it is found that the hammer load signal is not correlated with the actual crack tip stress intensity factor values by a simple proportionality. The conventionally determined Ksub(Id)sup(m1)-value overestimates the true dynamic fracture toughness Ksub(Id)sup(opt). This overestimation becomes larger for larger specimen sizes and larger impact velocities. The results demonstrate the dominating influence inertia effects can have on hammer load measurements and emphasize the importance of eliminating these effects in order to determine non-erroneous dynamic fracture toughness values. (orig.)
International Nuclear Information System (INIS)
Zhang, Long; Shi, Songting; Zhang, Juan; Zhou, Fangfang; Dijke, Peter ten
2012-01-01
Highlights: ► Expression of Id3 but not Id1 is induced by Wnt3a stimulation in C2C12 cells. ► Wnt3a induces Id3 expression via canonical Wnt/β-catenin pathway. ► Wnt3a-induced Id3 expression does not depend on BMP signaling activation. ► Induction of Id3 expression is critical determinant in Wnt3a-induced cell proliferation and differentiation. -- Abstract: Canonical Wnt signaling plays important roles in regulating cell proliferation and differentiation. In this study, we report that inhibitor of differentiation (Id)3 is a Wnt-inducible gene in mouse C2C12 myoblasts. Wnt3a induced Id3 expression in a β-catenin-dependent manner. Bone morphogenetic protein (BMP) also potently induced Id3 expression. However, Wnt-induced Id3 expression occurred independent of the BMP/Smad pathway. Functional studies showed that Id3 depletion in C2C12 cells impaired Wnt3a-induced cell proliferation and alkaline phosphatase activity, an early marker of osteoblast cells. Id3 depletion elevated myogenin induction during myogenic differentiation and partially impaired Wnt3a suppressed myogenin expression in C2C12 cells. These results suggest that Id3 is an important Wnt/β-catenin induced gene in myoblast cell fate determination.
Directory of Open Access Journals (Sweden)
Fakhri Hassouneh
2017-06-01
Full Text Available Immunosenescence is a progressive deterioration of the immune system with aging. It affects both innate and adaptive immunity limiting the response to pathogens and to vaccines. As chronic cytomegalovirus (CMV infection is probably one of the major driving forces of immunosenescence, and its persistent infection results in functional and phenotypic changes to the T-cell repertoire, the aim of this study was to analyze the effect of CMV-seropositivity and aging on the expression of CD300a and CD161 inhibitory receptors, along with the expression of CD57 marker on CD4+, CD8+, CD8+CD56+ (NKT-Like and CD4−CD8− (DN T-cell subsets. Our results showed that, regardless of the T-cell subset, CD57−CD161−CD300a+ T-cells expand with age in CMV-seropositive individuals, whereas CD57−CD161+CD300a+ T-cells decrease. Similarly, CD57+CD161−CD300a+ T-cells expand with age in CMV-seropositive individuals in all subsets except in DN cells and CD57−CD161+CD300a− T-cells decrease in all T-cell subsets except in CD4+ T-cells. Besides, in young individuals, CMV latent infection associates with the expansion of CD57+CD161−CD300a+CD4+, CD57−CD161−CD300a+CD4+, CD57+CD161−CD300a+CD8+, CD57−CD161−CD300a+CD8+, CD57+CD161−CD300a+NKT-like, and CD57+CD161−CD300a+DN T-cells. Moreover, in young individuals, CD161 expression on T-cells is not affected by CMV infection. Changes of CD161 expression were only associated with age in the context of CMV latent infection. Besides, CD300a+CD57+CD161+ and CD300a−CD57+CD161+ phenotypes were not found in any of the T-cell subsets studied except in the DN subpopulation, indicating that in the majority of T-cells, CD161 and CD57 do not co-express. Thus, our results show that CMV latent infection impact on the immune system depends on the age of the individual, highlighting the importance of including CMV serology in any study regarding immunosenescence.
DNA origami-based shape IDs for single-molecule nanomechanical genotyping
Zhang, Honglu; Chao, Jie; Pan, Dun; Liu, Huajie; Qiang, Yu; Liu, Ke; Cui, Chengjun; Chen, Jianhua; Huang, Qing; Hu, Jun; Wang, Lianhui; Huang, Wei; Shi, Yongyong; Fan, Chunhai
2017-04-01
Variations on DNA sequences profoundly affect how we develop diseases and respond to pathogens and drugs. Atomic force microscopy (AFM) provides a nanomechanical imaging approach for genetic analysis with nanometre resolution. However, unlike fluorescence imaging that has wavelength-specific fluorophores, the lack of shape-specific labels largely hampers widespread applications of AFM imaging. Here we report the development of a set of differentially shaped, highly hybridizable self-assembled DNA origami nanostructures serving as shape IDs for magnified nanomechanical imaging of single-nucleotide polymorphisms. Using these origami shape IDs, we directly genotype single molecules of human genomic DNA with an ultrahigh resolution of ~10 nm and the multiplexing ability. Further, we determine three types of disease-associated, long-range haplotypes in samples from the Han Chinese population. Single-molecule analysis allows robust haplotyping even for samples with low labelling efficiency. We expect this generic shape ID-based nanomechanical approach to hold great potential in genetic analysis at the single-molecule level.
Chen, Hai-Jing; Xie, Wei-Yan; Hu, Fang; Zhang, Ying; Wang, Jun; Wang, Yun
2012-04-01
Our previous study identified Threonine 161 (Thr-161), located in the second intracellular loop of the δ-opioid receptor (DOR), as the only consensus phosphorylation site for cyclin-dependent kinase 5 (Cdk5). The aim of this study was to assess the function of DOR phosphorylation by Cdk5 in complete Freund's adjuvant (CFA)-induced inflammatory pain and morphine tolerance. Dorsal root ganglion (DRG) neurons of rats with CFA-induced inflammatory pain were acutely dissociated and the biotinylation method was used to explore the membrane localization of phosphorylated DOR at Thr-161 (pThr-161-DOR), and paw withdrawal latency was measured after intrathecal delivery of drugs or Tat-peptide, using a radiant heat stimulator in rats with CFA-induced inflammatory pain. Both the total amount and the surface localization of pThr-161-DOR were significantly enhanced in the ipsilateral DRG following CFA injection. Intrathecal delivery of the engineered Tat fusion-interefering peptide corresponding to the second intracellular loop of DOR (Tat-DOR-2L) increased inflammatory hypersensitivity, and inhibited DOR- but not µ-opioid receptor-mediated spinal analgesia in CFA-treated rats. However, intrathecal delivery of Tat-DOR-2L postponed morphine antinociceptive tolerance in rats with CFA-induced inflammatory pain. Phosphorylation of DOR at Thr-161 by Cdk5 attenuates hypersensitivity and potentiates morphine tolerance in rats with CFA-induced inflammatory pain, while disruption of the phosphorylation of DOR at Thr-161 attenuates morphine tolerance.
STS-82 Pilot Scott Horowitz arrives for TCDT
1997-01-01
STS-82 Pilot Scott J. 'Doc' Horowitz arrives at KSCs Shuttle Landing Facility in a T-38 jet from Houston, TX. Horowitz and the other six crew members are at KSC to participate in the Terminal Countdown Demonstration Test (TCDT), a dress rehearsal for launch. The crew aboard the Space Shuttle Discovery on STS-82 will conduct the second Hubble Space Telescope servicing mission. The 10-day flight is targeted for a Feb. 11 liftoff.
STS-99 workers move new Master Events Controller into aft compartment
2000-01-01
At Launch Pad 39A, workers move the replacement Enhanced Main Events Controller (E-MEC) into Shuttle Endeavour's aft compartment in the payload bay. The original E-MEC became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. Both E-MECs are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.
The faulty Master Events Controller is removed from STS-99 Endeavour
2000-01-01
Technicians remove a faulty Enhanced Main Events Controller (E- MEC) from Shuttle Endeavour at Launch Pad 39A. The E-MEC became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. Both E-MECs are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.
Role of ID Proteins in BMP4 Inhibition of Profibrotic Effects of TGF-β2 in Human TM Cells.
Mody, Avani A; Wordinger, Robert J; Clark, Abbot F
2017-02-01
Increased expression of TGF-β2 in primary open-angle glaucoma (POAG) aqueous humor (AH) and trabecular meshwork (TM) causes deposition of extracellular matrix (ECM) in the TM and elevated IOP. Bone morphogenetic proteins (BMPs) regulate TGF-β2-induced ECM production. The underlying mechanism for BMP4 inhibition of TGF-β2-induced fibrosis remains undetermined. Bone morphogenic protein 4 induces inhibitor of DNA binding proteins (ID1, ID3), which suppress transcription factor activities to regulate gene expression. Our study will determine whether ID1and ID3 proteins are downstream targets of BMP4, which attenuates TGF-β2 induction of ECM proteins in TM cells. Primary human TM cells were treated with BMP4, and ID1 and ID3 mRNA, and protein expression was determined by quantitative PCR (Q-PCR) and Western immunoblotting. Intracellular ID1 and ID3 protein localization was studied by immunocytochemistry. Transformed human TM cells (GTM3 cells) were transfected with ID1 or ID3 expression vectors to determine their potential inhibitory effects on TGF-β2-induced fibronectin and plasminogen activator inhibitor-I (PAI-1) protein expression. Basal expression of ID1-3 was detected in primary human TM cells. Bone morphogenic protein 4 significantly induced early expression of ID1 and ID3 mRNA (P protein in primary TM cells, and a BMP receptor inhibitor blocked this induction. Overexpression of ID1 and ID3 significantly inhibited TGF-β2-induced expression of fibronectin and PAI-1 in TM cells (P protein 4 induced ID1 and ID3 expression suppresses TGF-β2 profibrotic activity in human TM cells. In the future, targeting specific regulators may control the TGF-β2 profibrotic effects on the TM, leading to disease modifying IOP lowering therapies.
MED23-associated Intellectual Disability in a Non-consanguineous Family
Trehan, Aditi; Brady, Jacqueline M.; Maduro, Valerie; Bone, William; Huang, Yan; Golas, Gretchen A.; Kane, Megan; Lee, Paul R.; Thurm, Audrey; Gropman, Andrea L.; Paul, Scott M.; Vezina, Gilbert; Markello, Thomas C.; Gahl, William A.; Boerkoel, Cornelius F.
2015-01-01
Intellectual disability (ID) is a heterogeneous condition arising from a variety of environmental and genetic factors. Among these causes are defects in transcriptional regulators. Herein, we report two brothers in a non-consanguineous family with novel compound heterozygous, disease-segregating mutations (NM_015979.3: [3656A>G];[4006C>T], NP_057063.2: [H1219R];[R1336X]) in MED23. This gene encodes a subunit of the Mediator complex that modulates the expression of RNA polymerase II-dependent ...
An enhanced dynamic ID-based authentication scheme for telecare medical information systems
Directory of Open Access Journals (Sweden)
Ankita Chaturvedi
2017-01-01
Full Text Available The authentication schemes for telecare medical information systems (TMIS try to ensure secure and authorized access. ID-based authentication schemes address secure communication, but privacy is not properly addressed. In recent times, dynamic ID-based remote user authentication schemes for TMIS have been presented to protect user’s privacy. The dynamic ID-based authentication schemes efficiently protect the user’s privacy. Unfortunately, most of the existing dynamic ID-based authentication schemes for TMIS ignore the input verifying condition. This makes login and password change phases inefficient. Inefficiency of the password change phase may lead to denial of service attack in the case of incorrect input in the password change phase. To overcome these weaknesses, we proposed a new dynamic ID-based authentication scheme using a smart card. The proposed scheme can quickly detect incorrect inputs which makes the login and password change phase efficient. We adopt the approach with the aim to protect privacy, and efficient login and password change phases. The proposed scheme also resists off-line password guessing attack and denial of service attack. We also demonstrate the validity of the proposed scheme by utilizing the widely-accepted BAN (Burrows, Abadi, and Needham logic. In addition, our scheme is comparable in terms of the communication and computational overheads with relevant schemes for TMIS.
Automatic spent fuel ID number reader (I)
International Nuclear Information System (INIS)
Tanabe, S.; Kawamoto, H.; Fujimaki, K.; Kobe, A.
1991-01-01
An effective and efficient technique has been developed for facilitating identification works of LWR spent fuel stored in large scale spent fuel storage pools of such as processing plants. Experience shows that there are often difficulties in the implementation of operator's nuclear material accountancy and control works as well as safeguards inspections conducted on spent fuel assemblies stored in deep water pool. This paper reports that the technique is realized as an automatic spent fuel ID number reader system installed on fuel handling machine. The ID number reader system consists of an optical sub-system and an image processing sub-system. Thousands of spent fuel assemblies stored in under water open racks in each storage pool could be identified within relatively short time (e.g. within several hours) by using this combination. Various performance tests were carried out on image processing sub-system in 1990 using TV images obtained from different types of spent fuel assemblies stored in various storage pools of PWR and BWR power stations
Cloning and shake flask expression of hrIDS- Like in Pichia pastoris ...
African Journals Online (AJOL)
The human Iduronate-2-sulfate sulfatase (hIDS-Like) was cloned into the methylotrophic yeast Pichia pastoris under the control of alcohol oxidase promoter (AOX1) and the -mating factor signal peptide (a-factor). Six clones were identified by PCR. Using clone IDS28, the enzyme was secreted into the culture medium, ...
Decay data file based on the ENSDF file
Energy Technology Data Exchange (ETDEWEB)
Katakura, J. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1997-03-01
A decay data file with the JENDL (Japanese Evaluated Nuclear Data Library) format based on the ENSDF (Evaluated Nuclear Structure Data File) file was produced as a tentative one of special purpose files of JENDL. The problem using the ENSDF file as primary source data of the JENDL decay data file is presented. (author)
Cladding the inside surface of a 3 1/4 in. ID Zircaloy-2 pressure tube with 1S aluminum
International Nuclear Information System (INIS)
Watson, R.D.
1966-09-01
A hot-press sizing technique has been developed for cladding the inside surface of Zircaloy-2 pressure tubes with 1S aluminum. The process is performed in air with the Zircaloy-2 and aluminum at a temperature of approximately 950 o F. A controlled atmosphere is not required, either during preheating or while the cladding is being applied. Tubes 30 inches long and 3 1/4 inches ID have been coated with 1S aluminum in thicknesses ranging from 0.005 inches to more than 0.02 inches; tubes longer than 30 inches have not been attempted. The lining of aluminum is firmly attached to the Zircaloy-2 at all points in the tube but the bond strength varies considerably - from. 6500 to 28000 lbf/in 2 . This work is the subject of Canadian Patent Application No. 955,358 filed March 21, 1966. (author)
NCBI nr-aa BLAST: CBRC-GGAL-23-0008 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-23-0008 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
STS-114: Crew Interviews: 1. Jim Kelly 2. Charlie Camarda
2005-01-01
1) STS-114 Pilot James Kelly mentions his primary job as the Pilot is to back up Commander Eileen Collins all through the flight. James discusses in detail his robotics operations for all of the extravehicular activities and spacewalk work, as well as moving the logistics module back and forth, onto the station and back in the payload bay. He shares his thoughts on the Columbia, the STS-114 mission as a new chapter in space exploration, and the International Space Station. 2) STS-114 Mission Specialist Charlie Camarda discusses his major role in the mission, his feelings for this being his first Space Shuttle flight; shares his thoughts on the Columbia; mentioned that STS-114 is a baby step to what is needed to do for the next step in space exploration, and gave some examples on how the International Space Station can help pave the path to future space exploration.
Zircaloy cladding ID/OD oxidation studies. Final report
International Nuclear Information System (INIS)
Westerman, R.E.; Hesson, G.M.
1977-11-01
The ID/OD oxide ratio that forms on Zircaloy tubing at temperatures relevant to postulated LOCA conditions was measured as a function of time, temperature, and distance from the rupture. The average ratio at the rupture position was less than unity, and decreased with decreasing test time and increasing distance from the point of rupture. The maximum observed ID/OD oxide ratio was 1.4. Ratios in excess of unity were typically found to be a consequence of the OD oxide being thinner than would have been anticipated from the nominal test conditions. Confirmatory data were also obtained on the isothermal oxidation kinetics of Zircaloy. These data are in good agreement with those obtained by other investigators and confirm the conservative nature of the Baker-Just equation that is required for use in licensing calculations
Guzmán, Rodrigo Antonio; Prado, Hugo Enrique; Porcel Melián, Helvio; Cordier, Benoit
2009-01-01
The momentum of the upper body (UB) during transfer sit-to-stand (STS) could be sensitive to the deterioration of dynamic postural control, and also the risk of falls. The aim of this study is to quantify the differences in the momentum development on UB during the STS in a sample of fall and no-fall elderly subjects. MATERIAL AND MEHODS: The sample consisted of twenty three voluntary elderly subjects (n=23), six elderly adults with antecedents of frequent falls (more than two within a year period) and seventeen without histories of frequent falls. Through a motion analysis system we registered the kinematics of UB during STS, from which we calculated the momentum of UB. The determined analysis variables were: the maximum values of the vertical (P(V)M) and horizontal (P(H)M) lineal momenta, the minimum (L(Max)) and maximum (L(Min)) values of the angular momentum and maximum trunk flexion (thetaM(UB)). No difference was observed in P(H)M, L(Max) and L(Min) (P>0.05) between both groups. However, a significant difference was found for the variable P(V)M (P=0.03) and thetaM(UB) (P=0.03) between both groups. We can conclude that, for the sample studied, the frequent fall condition relates to a smaller capacity to develop vertical momentum and increase flexion of the upper body.
Identification of an active ID-like group of SINEs in the mouse.
Kass, David H; Jamison, Nicole
2007-09-01
The mouse genome consists of five known families of SINEs: B1, B2, B4/RSINE, ID, and MIR. Using RT-PCR we identified a germ-line transcript that demonstrates 92.7% sequence identity to ID (excluding primer sequence), yet a BLAST search identified numerous matches of 100% sequence identity. We analyzed four of these elements for their presence in orthologous genes in strains and subspecies of Mus musculus as well as other species of Mus using a PCR-based assay. All four analyzed elements were identified either only in M. musculus or exclusively in both M. musculus and M. domesticus, indicative of recent integrations. In conjunction with the identification of transcripts, we present an active ID-like group of elements that is not derived from the proposed BC1 master gene of ID elements. A BLAST of the rat genome indicated that these elements were not in the rat. Therefore, this family of SINEs has recently evolved, and since it has thus far been observed mainly in M. musculus, we refer to this family as MMIDL.
RPD: Reusable Pseudo-Id Distribution for a Secure and Privacy Preserving VANET
Directory of Open Access Journals (Sweden)
Sulaiman Ashraph
2013-08-01
Full Text Available In any VANET, security and privacy are the two fundamental issues. Obtaining efficient security in vehicular communication is essential without compromising privacy-preserving mechanisms. Designing a suitable protocol for VANET by having these two issues in mind is challenging because efficiency, unlinkablity and traceability are the three qualities having contradictions between them. In this paper, we introduce an efficient Reusable Pseudo-id Distribution (RPD scheme. The Trusted Authority (TA designating the Road Side Units (RSUs to generate n reusable pseudo ids and distribute them to the On Board Units (OBUs on request characterizes the proposed protocol. RSUs issue the aggregated hashes of all its valid pseudo-ids along with a symmetric shared key and a particular pseudo-id to each vehicle that enters into its coverage range. Through this the certificates attached to the messages can be eliminated and thus resulting in a significantly reduced packet size. The same anonymous keys can then be re-distributed by the RSUs episodically to other vehicles. We analyze the proposed protocol extensively to demonstrate its merits and efficiency.
Demonstrating idAnimate : a multi-touch system for sketching and rapidly manipulating animations
Quevedo Fernandez, Javier; Martens, J.B.O.S.
2012-01-01
This demonstration presents idAnimate, a multi-touch application for sketching animations. Thanks to the affordances provided by multitouch interfaces, idAnimate yields a novel, intuitive and easy to use animation technique named transformation-by-example, that allows users to author animations in
Directory of Open Access Journals (Sweden)
García-Carpintero, Esther
2014-06-01
Full Text Available The development and improvement of cooperation between the industrial sector and the public R&D system can produce competitive advantages for the companies. The present work describes experiences and perceptions of Spanish biotechnology companies in their collaboration with the public R&D system. Results show that almost all the biotechnological companies with R&D activities (93.6% have cooperated with the public R&D system. The main barriers found by the companies are the excess of bureaucracy and the slow response of public researchers. Results obtained also suggest the need to establish public policies and programmes to promote knowledge and technology transfer from public research centres to companies, with a special focus on encouraging researchers from the public R&D system and on improving how Technology Transfer Offices work.El desarrollo y la mejora de la cooperación entre el sector productivo y el sistema público de I+D puede generar un conjunto de ventajas competitivas para estas empresas. El presente trabajo describe las experiencias y percepciones de las empresas biotecnológicas españolas en su colaboración con el sistema público de I+D. Los resultados muestran que prácticamente la totalidad de empresas biotecnológicas españolas con actividades de I+D (un 93,6% han mantenido algún tipo de colaboración con el sistema público de I+D. Los principales obstáculos percibidos por estas empresas en su colaboración con el sistema público de I+D son el exceso de burocracia y la respuesta lenta de los investigadores. Los resultados obtenidos sugieren la conveniencia de establecer políticas y programas públicos para fomentar la transferencia de conocimiento y tecnología desde el sistema público de I+D a las empresas, fundamentalmente centrados en la necesidad de incentivar a los investigadores del sistema público de I+D y mejorar el funcionamiento de las Oficinas de Transferencia de Tecnología.
75 FR 76710 - Combined Notice of Filings No. 1
2010-12-09
...: Paradise Solar Urban Renewal, L.L.C. Description: Notice of Self-Certification of Exempt Wholesale Generator Status of Paradise Solar Urban Renewal, L.L.C. Filed Date: 11/23/2010. Accession Number: 20101123... on Tuesday, December 14, 2010. Docket Numbers: ER11-2020-001. Applicants: Domtar Paper Company, LLC...
75 FR 39225 - Combined Notice of Filings No. 1
2010-07-08
... Gas and Electric Company. Description: Notice of Termination of Certain Agreements with Big Creek... settlement procedures for the Meter Data Error Correction Request etc. Filed Date: 06/23/2010. Accession..., DC. There is an eSubscription link on the Web site that enables subscribers to receive e-mail...
2011-06-02
.... c. Date filed: July 23, 2010. d. Applicant: Jonathan and Jayne Chase. e. Name of Project: Troy Hydropower Project. f. Location: On the Missisquoi River, in the Town of Troy, Orleans County, Vermont. The... filing and is now ready for environmental analysis. l. Project Description: The Troy Project would...
STS-32 Commander Brandenstein adjusts IMAX camera during training session
1989-01-01
STS-32 Commander Daniel C. Brandenstein adjusts IMAX camera setting during briefing and training session as technician looks on. The session was conducted in the JSC Mockup and Integration Laboratory (MAIL) Bldg 9B. The IMAX camera will be used onboard Columbia, Orbiter Vehicle (OV) 102, during the STS-32 mission.
STS-9 crewmembers in training session in bldg 9A
1983-01-01
Members of the STS-9 crew discuss flight procedures with a trainer in bldg 9A before the STS-9 mission. From left to right are Brewster Shaw, pilot; John Young, crew commander; Robert Parker, mission specialist; and unidentified trainer. They are reviewing procedures manuals on the shuttle mock-up hatch.
The paradox of IDs: an account of an ethnographic experience in the US
Directory of Open Access Journals (Sweden)
Mariza Peirano
2008-01-01
Full Text Available In the modern world, IDs are indispensable objects, without which we cannot prove that we are who we say we are. We need material substantiation that attests to the authenticity of our self-identification. This paper is an account of an ethnographic experience about IDs and identification processes in the US, based on the examination of two events in which Eliot Spitzer, the New York State governor from January 2007 to March 2008, was a central figure. A comparison with the Brazilian scenario is present throughout the paper, and it ends by focusing on the ID theft phenomenon.
Reciprocal deletion and duplication at 2q23.1 indicates a role for MBD5 in autism spectrum disorder
Mullegama, S.V.; Rosenfeld, J.A.; Orellana, C.; Bon, B.W.M. van; Halbach, S.; Repnikova, E.A.; Brick, L.; Li, C.; Dupuis, L.; Rosello, M.; Aradhya, S.; Stavropoulos, D.J.; Manickam, K.; Mitchell, E.; Hodge, J.C.; Talkowski, M.E.; Gusella, J.F.; Keller, K.; Zonana, J.; Schwartz, S.; Pyatt, R.E.; Waggoner, D.J.; Shaffer, L.G.; Lin, A.E.; Vries, B. de; Mendoza-Londono, R.; Elsea, S.H.
2014-01-01
Copy number variations associated with abnormal gene dosage have an important role in the genetic etiology of many neurodevelopmental disorders, including intellectual disability (ID) and autism. We hypothesize that the chromosome 2q23.1 region encompassing MBD5 is a dosage-dependent region, wherein
Papaspyridonos, Marianna; Matei, Irina; Huang, Yujie; do Rosario Andre, Maria; Brazier-Mitouart, Helene; Waite, Janelle C; Chan, April S; Kalter, Julie; Ramos, Ilyssa; Wu, Qi; Williams, Caitlin; Wolchok, Jedd D; Chapman, Paul B; Peinado, Hector; Anandasabapathy, Niroshana; Ocean, Allyson J; Kaplan, Rosandra N; Greenfield, Jeffrey P; Bromberg, Jacqueline; Skokos, Dimitris; Lyden, David
2015-04-29
A central mechanism of tumour progression and metastasis involves the generation of an immunosuppressive 'macroenvironment' mediated in part through tumour-secreted factors. Here we demonstrate that upregulation of the Inhibitor of Differentiation 1 (Id1), in response to tumour-derived factors, such as TGFβ, is responsible for the switch from dendritic cell (DC) differentiation to myeloid-derived suppressor cell expansion during tumour progression. Genetic inactivation of Id1 largely corrects the myeloid imbalance, whereas Id1 overexpression in the absence of tumour-derived factors re-creates it. Id1 overexpression leads to systemic immunosuppression by downregulation of key molecules involved in DC differentiation and suppression of CD8 T-cell proliferation, thus promoting primary tumour growth and metastatic progression. Furthermore, advanced melanoma patients have increased plasma TGFβ levels and express higher levels of ID1 in myeloid peripheral blood cells. This study reveals a critical role for Id1 in suppressing the anti-tumour immune response during tumour progression and metastasis.
miR-342 regulates BRCA1 expression through modulation of ID4 in breast cancer.
Directory of Open Access Journals (Sweden)
Elisabetta Crippa
Full Text Available A miRNAs profiling on a group of familial and sporadic breast cancers showed that miRNA-342 was significantly associated with estrogen receptor (ER levels. To investigate at functional level the role of miR-342 in the pathogenesis of breast cancer, we focused our attention on its "in silico" predicted putative target gene ID4, a transcription factor of the helix-loop-helix protein family whose expression is inversely correlated with that of ER. ID4 is expressed in breast cancer and can negatively regulate BRCA1 expression. Our results showed an inverse correlation between ID4 and miR-342 as well as between ID4 and BRCA1 expression. We functionally validated the interaction between ID4 and miR-342 in a reporter Luciferase system. Based on these findings, we hypothesized that regulation of ID4 mediated by miR-342 could be involved in the pathogenesis of breast cancer by downregulating BRCA1 expression. We functionally demonstrated the interactions between miR-342, ID4 and BRCA1 in a model provided by ER-negative MDA-MB-231 breast cancer cell line that presented high levels of ID4. Overexpression of miR-342 in these cells reduced ID4 and increased BRCA1 expression, supporting a possible role of this mechanism in breast cancer. In the ER-positive MCF7 and in the BRCA1-mutant HCC1937 cell lines miR-342 over-expression only reduced ID4. In the cohort of patients we studied, a correlation between miR-342 and BRCA1 expression was found in the ER-negative cases. As ER-negative cases were mainly BRCA1-mutant, we speculate that the mechanism we demonstrated could be involved in the decreased expression of BRCA1 frequently observed in non BRCA1-mutant breast cancers and could be implicated as a causal factor in part of the familial cases grouped in the heterogeneous class of non BRCA1 or BRCA2-mutant cases (BRCAx. To validate this hypothesis, the study should be extended to a larger cohort of ER-negative cases, including those belonging to the BRCAx class.
Directory of Open Access Journals (Sweden)
Johanna Maria Eberhard
Full Text Available Mucosal-associated invariant T (MAIT cells are characterized by the combined expression of the semi-invariant T cell receptor (TCR Vα7.2, the lectin receptor CD161, as well as IL-18R, and play an important role in antibacterial host defense of the gut. The current study characterized CD161(+ MAIT and CD161-TCRVα7.2(+ T cell subsets within a large cohort of HIV patients with emphasis on patients with slow disease progression and elite controllers. Mononuclear cells from blood and lymph node samples as well as plasma from 63 patients and 26 healthy donors were analyzed by multicolor flow cytometry and ELISA for IL-18, sCD14 and sCD163. Additionally, MAIT cells were analyzed after in vitro stimulation with different cytokines and/or fixed E.coli. Reduced numbers of CD161(+ MAIT cells during HIV infection were detectable in the blood and lymph nodes of all patient groups, including elite controllers. CD161+ MAIT cell numbers did not recover even after successful antiretroviral treatment. The loss of CD161(+ MAIT cells was correlated with higher levels of MAIT cell activation; an increased frequency of the CD161-TCRVα7.2(+T cell subset in HIV infection was observed. In vitro stimulation of MAIT cells with IL-18 and IL-12, IL-7 and fixed E.coli also resulted in a rapid and additive reduction of the MAIT cell frequency defined by CD161, IL-18R and CCR6. In summary, the irreversible reduction of the CD161(+ MAIT cell subset seems to be an early event in HIV infection that is independent of later stages of the disease. This loss appears to be at least partially due to the distinctive vulnerability of MAIT cells to the pronounced stimulation by microbial products and cytokines during HIV-infection.
Id2 reinforces TH1 cell differentiation and inhibits E2A to repress TFH cell differentiation
Shaw, Laura A.; Bélanger, Simon; Omilusik, Kyla D.; Cho, Sunglim; Scott-Browne, James P.; Nance, J. Philip; Goulding, John; Lasorella, Anna; Lu, Li-Fan; Crotty, Shane; Goldrath, Ananda W.
2016-01-01
Differentiation of T helper (TH) effector subsets is critical for host protection. E protein transcription factors and Id proteins are important arbiters of T cell development, but their role in differentiation of TH1 and TFH cells is not well understood. TH1 cells showed robust Id2 expression compared to TFH cells, and RNAi depletion of Id2 increased TFH cell frequencies. Further, TH1 cell differentiation was blocked by Id2 deficiency, leading to E protein-dependent accumulation of effector cells with mixed characteristics during viral infection and severely impaired generation of TH1 cells following Toxoplasma gondii infection. The TFH-defining transcriptional repressor Bcl6 bound the Id2 locus, providing a mechanism for the bimodal Id2 expression and reciprocal development of TH1 and TFH cell fates. PMID:27213691
Toxicología subcrónica oral del D-003 en ratones NMRI
Gámez, Rafael; Noa, Miriam; Más, Rosa; Rodríguez, María; Rodeiro, Idania; Menéndez, Roberto; Hernández, Caridad; García, Haydée
2007-01-01
El D-003 es una mezcla de ácidos alifáticos primarios de muy alto peso molecular purificada de la cera de caña, con efectos hipolipemiante y antiagregante plaquetario demostrados experimental y clí- nicamente. Los estudios toxicológicos han investigado la toxicidad del D-003, administrado como dosis orales únicas y repetidas en ratas y perros. Este estudio investigó la toxicidad oral del D-003 administrado como dosis repetidas a ratones NMRI. Los animales se distribuyeron aleatoriamente en 4 ...
Screening for primary aldosteronism using the newly developed IDS-iSYS® automated assay system
Directory of Open Access Journals (Sweden)
P.M. OâShea
2017-04-01
Full Text Available Background: The recommended approach to screening for primary aldosteronism (PA in at-risk populations is to determine the ratio of aldosterone concentration (serum (SAC/plasma (PAC to renin measured in plasma as activity (PRA or concentration (DRC. However, lack of assay standardisation mandates the need for method-specific decision thresholds and clinical validation in the local population. Aim: The study objective was to establish method-specific aldosterone: renin ratio (ARR cut-offs for PA in men and women using the IDS-iSYS® assay system (IDS plc. Methods: A prospective cohort study design was used. PAC and DRC were measured immunochemically in ethylenediamine-tetraacetic acid (EDTA plasma on the IDS-iSYS® instrument. Results: A total of 437 subjects (218 men, 219 women were recruited including: healthy normotensive volunteers (n=266 and women taking the oral contraceptive pill (OCP; n=15; patients with essential hypertension (EH; n=128; confirmed PA (n=16; adrenal cortical carcinoma (ACC; n=3; Addison's disease (AD; n=4 and phaeochromocytoma/paraganglioma (PPGL; n=5. In this population, an ARR cut-off at >37.4 pmol/mIU provided 100% diagnostic sensitivity, 96% specificity and positive likelihood ratio for PA of 23:1. When the ARR decision threshold was stratified according to gender, a cut-off of >26.1 pmol/mIU in men and >113.6 pmol/mIU in women resulted in diagnostic sensitivity and specificity of 100%. Conclusion: This study demonstrates that decision thresholds for PA should not only be method-specific but also gender-specific. However, given the small number of PA patients (n=16, particularly women (n=4, further validation through a prospective study with a larger PA cohort is required before the thresholds presented here could be recommended for routine clinical use. Keywords: Primary aldosteronism, Renin, Aldosterone, Aldosterone: renin ratio (ARR, Sensitivity, Specificity
Science-Technology-Society (STS): A New Paradigm in Science Education
Mansour, Nasser
2009-01-01
Changes in the past two decades of goals for science education in schools have induced new orientations in science education worldwide. One of the emerging complementary approaches was the science-technology-society (STS) movement. STS has been called the current megatrend in science education. Others have called it a paradigm shift for the field…
49 CFR 1150.23 - Modified certificate of public convenience and necessity.
2010-10-01
... 49 Transportation 8 2010-10-01 2010-10-01 false Modified certificate of public convenience and..., ACQUIRE, OR OPERATE RAILROAD LINES Modified Certificate of Public Convenience and Necessity § 1150.23 Modified certificate of public convenience and necessity. (a) The operator must file a notice with the...
Eisenman, Laura T.; Farley-Ripple, Elizabeth; Culnane, Mary; Freedman, Brian
2013-01-01
Social networks of persons with intellectual disabilities (ID) have been characterized as smaller and less diverse than those of typical peers. Advocates have focused on strengthening those social networks by expanding circles of social support, protection, and friendship. As young adults with ID experience increasing levels of community…
2013-01-04
... Services Group, Inc., Commercial/Actuarial/ Information Delivery Services (IDS)/Corporate & Financial... Assistance (TAA) applicable to workers and former workers of Hartford Financial Services Group, Inc., Commercial/ Actuarial/Information Delivery Services (IDS)/Corporate & Financial Reporting group, Hartford...
Kang, Hui-Yuan; Wang, Xin-Rong; Gao, Li; Wang, Wei; Li, Mian-Yang; Wang, Li-Li; Wang, Cheng-Bin; Yu, Li
2015-04-01
To evaluate significance of ID4 gene mehtylation in demethylating myelodysplastic syndrome(MDS) cell Line MUTZ1 and 2 patients with MDS. The methylation-specific PCR (MS-PCR) and reverse transcription-PCR (RT-PCR) were applied to identify the methylation status and gene expression of ID4 gene in MDS cell line MUTZ1, a patient with aplastic anemia(AA) and a donor with normal bone marrow (NBM). RT-PCR was applied to detect the ID4 gene expression status in MUTZ1 cell line treated with decitabine at 3 different concentrations. Then bisulfite sequencing PCR (BSP) was applied to detect ID4 gene methylation status in 2 MDS parients treated with decitabine. The MDS cell line MUTZ-1 displayed a complete methylation of ID4 gene promoter with little mRNA expression. Inversely, bone marrow of an AA patient and NBM showed complete unmethylation of this gene with intensity mRNA expression. With the increase of decitabine concentration, ID4 gene mRNA expression was more and more increased. After decitabine treatment, ID4 gene methylation-positive frequencies of both the 2 MDS patients were much more decreased than that of the first treatment. So, ID4 gene mRNA expression inhibited by promoter hypemethylation could be recovered by using demethylation medicine. ID4 as a new potential anti-oncogene suggests that its methylation may become a marker for selection and assessment of therapeutic schedules in patients with MDS.
The faulty Master Events Controller is carried away from STS-99 Endeavour
2000-01-01
Workers carry away the faulty Enhanced Main Events Controller (E- MEC) from Shuttle Endeavour at Launch Pad 39A. The E-MEC became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. Both E-MECs are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.
Le traitement de l’idéologie dans la sociologie de Luc Boltanski
Directory of Open Access Journals (Sweden)
David Vrydaghs
2006-10-01
Full Text Available IntroductionLe concept d’idéologie apparaît dans la sociologie de Luc Boltanski à partir du Nouvel Esprit du capitalisme, publié en 1999. L’auteur y revient dans La Condition fœtale, paru en 2004. On aurait donc pu se contenter de ces ouvrages pour examiner le traitement réservé à l’idéologie dans la sociologie de Luc Boltanski. On préférera pourtant revenir aux travaux antérieurs du sociologue, et ce pour deux raisons.D’abord parce que le concept d’idéologie tel qu’il est employé dans Le Nou...
Suurnimed jäid müümata / Maria-Kristiina Soomre
Soomre, Maria-Kristiina, 1978-
2001-01-01
9. mai Christie' oksjonist, müümata jäänud Picasso, Degas', Cezanne'i tööd. 8. mai Sotheby oksjonist, kus edukalt müüdi töid S. J. Seegeri kogust, 3,85 miljoni dollari eest M. Beckmanni "Perseuse viimane katsumus". Sotheby kaasaegse kunsti oksjonil New Yorgis müüdi 5,6 miljoni dollari eest J. Koonsi skulptuur M. Jacksonist. Müümata jäid A. Warholi "Viis supipurki", A. Calderi 3 skulptuuri
DEFF Research Database (Denmark)
Johansen, P; Andersen, J D; Børsting, Claus
2013-01-01
on the peak height and the signal to noise data exported from the TYPER 4.0 software. With the forensic analysis parameters, all inconsistencies were eliminated in reactions with ≥10ng DNA. However, the average call rate decreased to 69.9%. The iPLEX(®) Sample ID Plus Panel was tested on 10 degraded samples......Sequenom launched the first commercial SNP typing kit for human identification, named the iPLEX(®) Sample ID Plus Panel. The kit amplifies 47 of the 52 SNPs in the SNPforID panel, amelogenin and two Y-chromosome SNPs in one multiplex PCR. The SNPs were analyzed by single base extension (SBE......) and Matrix Assisted Laser Desorption/Ionization-Time of Flight Mass Spectrometry (MALDI-TOF MS). In this study, we evaluated the accuracy and sensitivity of the iPLEX(®) Sample ID Plus Panel by comparing the typing results of the iPLEX(®) Sample ID Plus Panel with those obtained with our ISO 17025 accredited...
ACE Gene I/D Polymorphism and Obesity in 1,574 Patients with Type 2 Diabetes Mellitus.
Pan, Yan-Hong; Wang, Min; Huang, Yan-Mei; Wang, Ying-Hui; Chen, Yin-Ling; Geng, Li-Jun; Zhang, Xiao-Xi; Zhao, Hai-Lu
2016-01-01
Association between ACE gene I/D polymorphism and the risk of overweight/obesity remains controversial. We investigated the possible relationship between ACE gene I/D polymorphism and obesity in Chinese type 2 diabetes mellitus (T2DM) patients. In this study, obesity was defined as a body mass index (BMI) value ≥ 25 kg/m 2 and subjects were classified into 4 groups (lean, normal, overweight, and obese). PCR (polymerase chain reaction) was used to detect the ACE gene I/D polymorphism in T2DM patients. Metabolic measurements including blood glucose, lipid profile, and blood pressure were obtained. Frequencies of the ACE genotypes (DD, ID, and II) were not significant among the 4 groups of BMI-defined patients ( P = 0.679) while ACE II carriers showed higher systolic blood pressure (SBP) and pulse pressure (PP) (all P ACE gene I/D polymorphism with obesity is insignificant in Chinese patients with T2DM. SBP and PP might be higher in the ACE II carriers than in the DD and ID carriers.
International Nuclear Information System (INIS)
Mulmule, Manoj D.; Shimmy, Shankar M.; Bambole, Vaishali; Jamdar, Sahayog N.; Rawat, K.P.; Sarma, K.S.S.
2017-01-01
Idli, a steam-cooked breakfast food item consumed in India, is famous as a staple food for its spongy texture and unique fermented taste. Idli preparation is a time consuming process; although instant Idli pre-mixes as powder or batter are available in the market, they do not have the distinctive taste and aroma similar to the Idli prepared at home. Hence ready-to-eat (RTE) form of this food is in demand. Therefore, an attempt was made to prepare RTE Idli bearing similar taste as home-cooked Idli with an extended shelf-life of up to two months at an ambient temperature using Electron Beam Irradiation (EBI) at dosages 2.5 kGy, 5 kGy and 7.5 kGy and combination processing comprised of EBI dosage at 2.5 kGy and thermal treatment (80 °C for 20 min). The treated Idli's were microbiologically and sensorially evaluated at storage periods of zero day, 14 days, 30 days and 60 days. Idli's irradiated at 7.5 kGy and subjected to combination processing at 2.5 kGy and thermal treatment were shelf-stable for 60 days. 2.5 kGy and 5 kGy radiation dosages alone were not sufficient to preserve Idli samples for more than 14 days. Undesirable change in sensory properties of Idli was observed at an EBI dosage of 7.5 kGy. Sensory properties of combination processed Idli's were found to undergo minor change over the storage period. The present work suggests that lowest radiation dosage in combination with thermal treatment could be useful to achieve the extended shelf-life without considerably impairing the organoleptic quality of Ready-to-Eat Idli. - Highlights: • Idli (traditional Indian fermented food) was prepared in ready-to-eat (RTE) form. • Ready-to-eat Idli was then subjected to combination processing comprised of lowest irradiation dosage of 2.5 kGy with mild heat treatment to extend its shelf life. • Increase in hardness and decrease in brightness of combination processed Idli was observed. • Combination processed Idli was microbiologically safe and
STS-49 Endeavour/Intelsat Briefing
1992-01-01
Lak Virdee of Intelsat, summarizes Intelsat's role in the STS-49 Endeavour mission. He discusses the reboost hardware, giving details on the capture arm and docker adapter assembly. He describes the rendezvous between Intelsat and the Endeavour Orbiter. Mr. Virdee then answers questions from the press.
Teachers' learning on the workshop of STS approach as a way of enhancing inventive thinking skills
Ngaewkoodrua, Nophakun; Yuenyong, Chokchai
2018-01-01
To improve science teachers to develop the STS lesson plans for enhancing the students' inventive thinking skills, the workshop of improving science teachers to develop the STS lesson plans for enhancing the Inventive thinking skills were organized. The paper aimed to clarify what teachers learn from the workshop. The goal of the activity of the workshop aimed to: 1) improve participants a better understanding of the relationship between the Inquiry based learning with STS approach, 2) understand the meaning and importance of the STS approach and identify the various stages of Yuenyong (2006) STS learning process, 3) discuss what they learned from the examples of Yuenyong (2006) lesson plan, 4) develop some activities for each stage of Yuenyong (2006) STS approach, and 5) ideas of providing STS approach activities for enhancing inventive thinking skills. Participants included 3 science teachers who work in Khon Kaen, Thailand. Methodology regarded interpretive paradigm. Teachers' learning about pedagogy of enhancing the students' inventive thinking skills will be interpreted through participant observation, teachers' tasks, and interview. The finding revealed that all participants could demonstrate their ideas how to generate the STS lesson plans as a way of enhancing inventive thinking skills. Teachers could mention some element of inventive thinking skills which could be generated on their STS learning activities.
International Nuclear Information System (INIS)
Takahashi, Nobukazu; Mitani, Isao; Sumita, Shinichi
1998-01-01
Visual interpretation of iodine-123-beta-15-(p-iodophenyl)-3(R,S)-methyl-pentadecanoic acid ( 123 I-BMIPP) myocardial images cannot easily detect mild reduction in tracer uptake. Objective assessment of myocardial 123 I-BMIPP maldistributions at rest was attempted using a bull's-eye map and its normal data file for detecting myocardial damage in patients with mitochondrial encephalomyopathy. Six patients, two with Kearns-Sayre syndrome and four with mitochondrial myopathy, encephalopathy, lactic acidosis, and strokelike episodes (MELAS), and 10 normal subjects were studied. Fractional myocardial uptake of 1 23 I-BMIPP was also measured by dynamic static imaging to assess the global myocardial free fatty acid. These data were compared with the cardiothoracic ratio measured by chest radiography and left ventricular ejection fraction assessed by echocardiography. Abnormal cardiothoracic ratio and lower ejection fraction were detected in only one patient with Kearns-Sayre syndrome. Abnormal fractional myocardial uptake was detected in two patients (1.61%, 1.91%), whereas abnormal regional 123 I-BMIPP uptake assessed by the bull's-eye map was detected in five patients (83%). All patients showed abnormal uptake in the anterior portion, and one showed progressive atrioventricular conduction abnormality and systolic dysfunction with extended 123 I-BMIPP abnormal uptake. The results suggest that assessment based on the normal data file in a bull's-eye polar map is clinically useful for detection of myocardial damage in patients with mitochondrial encephalomyopathy. (author)
Reciprocal deletion and duplication at 2q23.1 indicates a role for MBD5 in autism spectrum disorder.
Mullegama, Sureni V; Rosenfeld, Jill A; Orellana, Carmen; van Bon, Bregje W M; Halbach, Sara; Repnikova, Elena A; Brick, Lauren; Li, Chumei; Dupuis, Lucie; Rosello, Monica; Aradhya, Swaroop; Stavropoulos, D James; Manickam, Kandamurugu; Mitchell, Elyse; Hodge, Jennelle C; Talkowski, Michael E; Gusella, James F; Keller, Kory; Zonana, Jonathan; Schwartz, Stuart; Pyatt, Robert E; Waggoner, Darrel J; Shaffer, Lisa G; Lin, Angela E; de Vries, Bert B A; Mendoza-Londono, Roberto; Elsea, Sarah H
2014-01-01
Copy number variations associated with abnormal gene dosage have an important role in the genetic etiology of many neurodevelopmental disorders, including intellectual disability (ID) and autism. We hypothesize that the chromosome 2q23.1 region encompassing MBD5 is a dosage-dependent region, wherein deletion or duplication results in altered gene dosage. We previously established the 2q23.1 microdeletion syndrome and report herein 23 individuals with 2q23.1 duplications, thus establishing a complementary duplication syndrome. The observed phenotype includes ID, language impairments, infantile hypotonia and gross motor delay, behavioral problems, autistic features, dysmorphic facial features (pinnae anomalies, arched eyebrows, prominent nose, small chin, thin upper lip), and minor digital anomalies (fifth finger clinodactyly and large broad first toe). The microduplication size varies among all cases and ranges from 68 kb to 53.7 Mb, encompassing a region that includes MBD5, an important factor in methylation patterning and epigenetic regulation. We previously reported that haploinsufficiency of MBD5 is the primary causal factor in 2q23.1 microdeletion syndrome and that mutations in MBD5 are associated with autism. In this study, we demonstrate that MBD5 is the only gene in common among all duplication cases and that overexpression of MBD5 is likely responsible for the core clinical features present in 2q23.1 microduplication syndrome. Phenotypic analyses suggest that 2q23.1 duplication results in a slightly less severe phenotype than the reciprocal deletion. The features associated with a deletion, mutation or duplication of MBD5 and the gene expression changes observed support MBD5 as a dosage-sensitive gene critical for normal development.
Directory of Open Access Journals (Sweden)
Retha Arjadi
Full Text Available Depression screening and examination in Indonesia are highly challenging due to the disproportionately low number of mental health professionals in comparison to the Indonesian population. Self-report questionnaires on depression are cost-effective and time-efficient. The current study investigates the psychometric properties of the Indonesian Inventory of Depressive Symptomatology Self Report (IDS-SR.The participants were 904 Indonesians (aged 16-61; 50.2% female, recruited via an online survey using Qualtrics. Confirmatory factor analysis of the one-factor, three-factor, and four-factor model were explored. Convergent and divergent validity of the total score of the Indonesian IDS-SR and each factor were examined, as well as the Cronbach's Alpha reliability. In addition, an optimal cut-off score for the Indonesian IDS-SR was established using ROC curve analysis.The three-factor model of "cognitive/mood", "anxiety/arousal", and "sleep disturbance" was the best fit with the Indonesian IDS-SR data. Convergent and divergent validity were good. Cronbach's Alpha reliability was excellent for the total score, good for the factors "cognitive/mood" and "anxiety/arousal", but insufficient for the factor "sleep disturbance". The optimal cut-off score of the Indonesian IDS-SR was 14, with 87% sensitivity and 86% specificity.As a multifactorial instrument to measure depression that has good validity and reliability, the Indonesian IDS-SR can be used to assess depressive symptoms for the purpose of research and clinical practice. The optimal cut-off score of the Indonesian IDS-SR is in accordance with the internationally used cut-off score.
Accessing files in an Internet: The Jade file system
Peterson, Larry L.; Rao, Herman C.
1991-01-01
Jade is a new distribution file system that provides a uniform way to name and access files in an internet environment. It makes two important contributions. First, Jade is a logical system that integrates a heterogeneous collection of existing file systems, where heterogeneous means that the underlying file systems support different file access protocols. Jade is designed under the restriction that the underlying file system may not be modified. Second, rather than providing a global name space, Jade permits each user to define a private name space. These private name spaces support two novel features: they allow multiple file systems to be mounted under one directory, and they allow one logical name space to mount other logical name spaces. A prototype of the Jade File System was implemented on Sun Workstations running Unix. It consists of interfaces to the Unix file system, the Sun Network File System, the Andrew File System, and FTP. This paper motivates Jade's design, highlights several aspects of its implementation, and illustrates applications that can take advantage of its features.
Accessing files in an internet - The Jade file system
Rao, Herman C.; Peterson, Larry L.
1993-01-01
Jade is a new distribution file system that provides a uniform way to name and access files in an internet environment. It makes two important contributions. First, Jade is a logical system that integrates a heterogeneous collection of existing file systems, where heterogeneous means that the underlying file systems support different file access protocols. Jade is designed under the restriction that the underlying file system may not be modified. Second, rather than providing a global name space, Jade permits each user to define a private name space. These private name spaces support two novel features: they allow multiple file systems to be mounted under one directory, and they allow one logical name space to mount other logical name spaces. A prototype of the Jade File System was implemented on Sun Workstations running Unix. It consists of interfaces to the Unix file system, the Sun Network File System, the Andrew File System, and FTP. This paper motivates Jade's design, highlights several aspects of its implementation, and illustrates applications that can take advantage of its features.
International Nuclear Information System (INIS)
Meng, Qingzhen; Jia, Zhuqing; Wang, Weiping; Li, Binhong; Ma, Kangtao; Zhou, Chunyan
2011-01-01
Highlights: → Id1 was upregulated during the cardiac differentiation process of P19CL6 cells. → Id1 upregulated expression of cardiac specific genes Gata4, α-MHC and ISL1. → Id1 promoted proliferation of P19CL6 cells. → Overexpression of Id1 increased activity of TOP flash. → Wnt3a or LiCl treatment promoted Id1 expression in P19CL6 cells. -- Abstract: The inhibitor of DNA binding (Id) family of genes encodes negative regulators of basic helix-loop-helix transcription factors and has been implicated in such diverse cellular processes as differentiation, proliferation, apoptosis and migration. Id knockout mouse embryos display multiple cardiac defects but the specific role of Id1 in cardiac differentiation is unclear. In the present study, we investigated the function of Id1 in DMSO-induced P19CL6 cells, a widely-accepted cell model of cardiac differentiation. We found that Id1 was upregulated during the cardiac differentiation of P19CL6 cells. The expression of cardiac specific marker genes, Gata4, α-MHC and ISL1, was upregulated in P19CL6 cells stably transfected with Id1 (P19CL6-Id1) during cardiac differentiation. The overexpression of Id1 reduced the number of cells in G1 phase and increased the cell population in G2, M and S phases, while knockdown of Id1 increased the number of cells in G1 phase from 48.6 ± 2.51% to 62.2 ± 1.52% at day 0 of cardiac induction, and from 52.5 ± 3.41% to 63.7 ± 1.02% at day 3 after cardiac induction, indicating that Id1 promoted proliferation of P19CL6 cells. Luciferase assays showed that the activity of TOP flash was higher in P19CL6-Id1 cells than wildtype P19CL6 cells, while Id1 expression was also upregulated in P19CL6 cells treated with Wnt3a or LiCl. This indicates that there may be positive feedback between Id1 and Wnt signaling which plays an important role in cardiac differentiation.
File list: His.Emb.05.AllAg.2-3h_embryos [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available His.Emb.05.AllAg.2-3h_embryos dm3 Histone Embryo 2-3h embryos SRX197563,SRX197566,S...RX197565,SRX197562,SRX197564 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/His.Emb.05.AllAg.2-3h_embryos.bed ...
File list: His.Emb.50.AllAg.2-3h_embryos [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available His.Emb.50.AllAg.2-3h_embryos dm3 Histone Embryo 2-3h embryos SRX197566,SRX197565,S...RX197563,SRX197562,SRX197564 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/His.Emb.50.AllAg.2-3h_embryos.bed ...
2010-07-01
... Deputy Attorney General or Associate Attorney General, as appropriate. 0.161 Section 0.161 Judicial... certain offers by the Deputy Attorney General or Associate Attorney General, as appropriate. (a) In all... § 0.160, the Assistant Attorney General concerned shall, when he is of the opinion that the proposed...
Directory of Open Access Journals (Sweden)
Joseph Dumit
2017-09-01
Full Text Available Game design offers a powerful pedagogical paradigm for engaging students in thinking and researching sociotechnical systems. Using the example of designing a game around fracking, this paper describes how game design grapples with emergent dynamic processes, and how students are drawn into becoming STS researchers.
Sorajja, Paul; Kodali, Susheel; Reardon, Michael J; Szeto, Wilson Y; Chetcuti, Stanley J; Hermiller, James; Chenoweth, Sharla; Adams, David H; Popma, Jeffrey J
2017-10-23
The authors sought to compare the outcomes of commercial transcatheter aortic valve replacement (TAVR) with the repositionable Evolut R platform to those observed with the CoreValve device in the Society of Thoracic Surgeons (STS)/American College of Cardiology (ACC) Transcatheter Valve Therapy (TVT) Registry. TAVR continues to evolve, with rapid adoption of iterative changes for commercial practice. Insight into the outcomes of this adoption is needed. Patients in the TVT Registry who had TAVR using a 23-, 26-, or 29-mm self-expanding prosthesis were enrolled. Site-reported events for procedural, in-hospital, and 30-day outcomes were examined. Between January 2014 and April 2016, 9,616 patients underwent TAVR with a self-expanding prosthesis with data entered in the TVT Registry. Compared with patients treated with CoreValve TAVR, those who received Evolut R TAVR had a lower STS-PROM score (8.0 ± 5.4% vs. 8.7 ± 5.3%; p < 0.001), more iliofemoral access (91.6% vs. 89.2%; p < 0.001), and more frequently had conscious sedation (27.4% vs. 12.7%; p < 0.001). With Evolut R TAVR, there was less need for a second prosthesis (2.2% vs. 4.5%; p < 0.001), less device migration (0.2% vs. 0.6%; p = 0.01), a lower incidence of moderate/severe paravalvular regurgitation (post-procedure, 4.4% vs. 6.2%; p < 0.001), and shorter median hospital stay (4.0 vs. 5.0 days; p < 0.001). Patients treated with Evolut R TAVR had greater device success (96.3% vs. 94.9%; p = 0.001). At 30 days, Evolut R patients had both lower mortality (3.7% vs. 5.3%; p < 0.001) and less need for a pacemaker (18.3% vs. 20.1%; p = 0.03). Commercial adoption of the Evolut R platform is associated with significant improvements in acute outcomes for patients undergoing TAVR for aortic stenosis. Copyright © 2017 American College of Cardiology Foundation. Published by Elsevier Inc. All rights reserved.
STS-110 Extravehicular Activity (EVA)
2002-01-01
STS-110 mission specialist Lee M.E. Morin carries an affixed 35 mm camera to record work which is being performed on the International Space Station (ISS). Working with astronaut Jerry L. Ross (out of frame), the duo completed the structural attachment of the S0 (s-zero) truss, mating two large tripod legs of the 13 1/2 ton structure to the station's main laboratory during a 7-hour, 30-minute space walk. The STS-110 mission prepared the Station for future space walks by installing and outfitting the 43-foot-long S0 truss and preparing the Mobile Transporter. The S0 Truss was the first of 9 segments that will make up the Station's external framework that will eventually stretch 356 feet (109 meters), or approximately the length of a football field. This central truss segment also includes a flatcar called the Mobile Transporter and rails that will become the first 'space railroad,' which will allow the Station's robotic arm to travel up and down the finished truss for future assembly and maintenance. The completed truss structure will hold solar arrays and radiators to provide power and cooling for additional international research laboratories from Japan and Europe that will be attached to the Station. Milestones of the S-110 mission included the first time the ISS robotic arm was used to maneuver space walkers around the Station and marked the first time all space walks were based out of the Station's Quest Airlock. It was also the first Shuttle to use three Block II Main Engines. The Space Shuttle Orbiter Atlantis, STS-110 mission, was launched April 8, 2002 and returned to Earth April 19, 2002.
International Nuclear Information System (INIS)
Fan, Chang-ling; Zhang, Ke-he; Han, Shao-chang
2013-01-01
Graphical abstract: Relationships between the conductivities of LFPC-2 cathode and the volume percentages of AB (a) and PAn (b). - Highlights: • LiFe 0.94 Mg 0.03 Cu 0.03 PO 4 /C is synthesized by adding glucose with two-step method. • Conductive polymer polyaniline is used to replace acetylene black. • The content of conductive additive is optimized by the percolation theory. • LFPC-2 cathode containing polyaniline possesses the excellent performance. - Abstract: Comprehensive methods were utilized to improve the electrochemical performances of LiFe 0.94 Mg 0.03 Cu 0.03 PO 4 /C (LFPC) composite cathode. Experimental results show that LFPC-2, prepared by adding glucose in two steps, possesses the effective incorporated of doping ions and well-distributed pyrolysis carbon. It possesses higher conductivity and discharge capacity. The percolation theory analysis shows that the conductivity of LFPC-2 cathode film reaches its maximum value at the mass content of 15 wt.%. The replacement of acetylene black with polyaniline can greatly improve the electrochemical performances of LFPC-2 cathode. Its discharge capacity is 85.3 mAh g −1 and its potential platform is as high as 3.2 V at the current density of 850 mA g −1 when 15 wt.% polyaniline is used. The cycle performance of LFPC-2 is improved when polyaniline is used as conductive additives. And the change of charge transfer resistance of LFPC-2 cathode containing polyaniline is very small after 24 cycles
STS-93 Commander Collins suits up before launch
1999-01-01
In the Operations and Checkout Building, STS-93 Commander Eileen M. Collins gets help donning her launch and entry suit. After Space Shuttle Columbia's July 20 launch attempt was scrubbed at the T-7 second mark in the countdown, the launch was rescheduled for Thursday, July 22, at 12:28 a.m. EDT. The target landing date is July 26, 1999, at 11:24 p.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X- ray telescope and is expected unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
Astronaut Heidemarie M. Stefanyshyn-Piper During STS-115 Training
2005-01-01
Wearing a training version of the shuttle launch and entry suit, STS-115 astronaut and mission specialist, Heidemarie M. Stefanyshyn-Piper, puts the final touches on her suit donning process prior to the start of a water survival training session in the Neutral Buoyancy Laboratory (NBL) near Johnson Space Center. Launched on September 9, 2006, the STS-115 mission continued assembly of the International Space Station (ISS) with the installation of the truss segments P3 and P4.
Relationship between major depressive disorder and ACE gene I/D polymorphism in a Turkish population
Directory of Open Access Journals (Sweden)
Sema Inanir
2016-04-01
Full Text Available Abstract Background Major depressive disorder (MDD is a complex disease and a significant health problem that is prevalent across the world. Angiotensin-converting enzyme (ACE has an important role in renin-angiotensin system (RAS and converts inactive angiotensin I to a potent vasopressor and aldosterone-stimulating peptide angiotensin II. Levels of ACE in plasma vary according to the insertion/deletion (I/D polymorphism of ACE gene. Objective The aim of the current study was to examine the influence ACE gene I/D variations on the risk of MDD. Methods In the present case-control study, we analyzed ACE I/D polymorphism in 346 MDD patients and 210 healthy subjects using polymerase chain reaction technique. Results Comparing the two groups, no significant difference was observed with regard to either genotype distributions or allele frequencies of the I/D polymorphism of ACE gene. Discussion Our findings suggest that the ACE I/D polymorphism is not associated with MDD in Turkish case-control study. Further studies are still needed.
Online data handling and storage at the CMS experiment
Andre, J.-M.; Andronidis, A.; Behrens, U.; Branson, J.; Chaze, O.; Cittolin, S.; Darlea, G.-L.; Deldicque, C.; Demiragli, Z.; Dobson, M.; Dupont, A.; Erhan, S.; Gigi, D.; Glege, F.; Gómez-Ceballos, G.; Hegeman, J.; Holzner, A.; Jimenez-Estupiñán, R.; Masetti, L.; Meijers, F.; Meschi, E.; Mommsen, RK; Morovic, S.; Nuñez-Barranco-Fernández, C.; O'Dell, V.; Orsini, L.; Paus, C.; Petrucci, A.; Pieri, M.; Racz, A.; Roberts, P.; Sakulin, H.; Schwick, C.; Stieger, B.; Sumorok, K.; Veverka, J.; Zaza, S.; Zejdl, P.
2015-12-01
During the LHC Long Shutdown 1, the CMS Data Acquisition (DAQ) system underwent a partial redesign to replace obsolete network equipment, use more homogeneous switching technologies, and support new detector back-end electronics. The software and hardware infrastructure to provide input, execute the High Level Trigger (HLT) algorithms and deal with output data transport and storage has also been redesigned to be completely file- based. All the metadata needed for bookkeeping are stored in files as well, in the form of small documents using the JSON encoding. The Storage and Transfer System (STS) is responsible for aggregating these files produced by the HLT, storing them temporarily and transferring them to the T0 facility at CERN for subsequent offline processing. The STS merger service aggregates the output files from the HLT from ∼62 sources produced with an aggregate rate of ∼2GB/s. An estimated bandwidth of 7GB/s in concurrent read/write mode is needed. Furthermore, the STS has to be able to store several days of continuous running, so an estimated of 250TB of total usable disk space is required. In this article we present the various technological and implementation choices of the three components of the STS: the distributed file system, the merger service and the transfer system.
Online Data Handling and Storage at the CMS Experiment
Energy Technology Data Exchange (ETDEWEB)
Andre, J. M.; et al.
2015-12-23
During the LHC Long Shutdown 1, the CMS Data Acquisition (DAQ) system underwent a partial redesign to replace obsolete network equipment, use more homogeneous switching technologies, and support new detector back-end electronics. The software and hardware infrastructure to provide input, execute the High Level Trigger (HLT) algorithms and deal with output data transport and storage has also been redesigned to be completely file- based. All the metadata needed for bookkeeping are stored in files as well, in the form of small documents using the JSON encoding. The Storage and Transfer System (STS) is responsible for aggregating these files produced by the HLT, storing them temporarily and transferring them to the T0 facility at CERN for subsequent offline processing. The STS merger service aggregates the output files from the HLT from ~62 sources produced with an aggregate rate of ~2GB/s. An estimated bandwidth of 7GB/s in concurrent read/write mode is needed. Furthermore, the STS has to be able to store several days of continuous running, so an estimated of 250TB of total usable disk space is required. In this article we present the various technological and implementation choices of the three components of the STS: the distributed file system, the merger service and the transfer system.
Enhancing privacy of users in eID schemes
Shrishak, Kris; Erkin, Z.; Schaar, Remco
2016-01-01
In todays world transactions are increasingly being performed over the internetbut require identication of users as in face-to-face transactions. In order to facilitate eGovernance as well as other eCommerce services Electronic Identiation(eID) schemes, which intend to provide unique and reliable
VizieR Online Data Catalog: Follow-up of probable young star ASASSN-15qi (Herczeg+, 2016)
Herczeg, G. J.; Dong, S.; Shappee, B. J.; Chen, P.; Hillenbrand, L. A.; Jose, J.; Kochanek, C. S.; Prieto, J. L.; Stanek, K. Z.; Kaplan, K.; Holoien, T.-S.; Mairs, S.; Johnstone, D.; Gully-Santiago, M.; Zhu, Z.; Smith, M. C.; Bersier, D.; Mulders, G. D.; Filippenko, A. V.; Ayani, K.; Brimacombe, J.; Brown, J. S.; Connelley, M.; Harmanen, J.; Itoh, R.; Kawabata, K. S.; Maehara, H.; Takata, K.; Yuk, H.; Zheng, W.
2017-02-01
The outburst of ASASSN-15qi (2MASS J22560882+5831040) occurred on JD2457298 (2015 October 2; UTC dates are used herein). The All-Sky Automated Survey for Supernovae (ASAS-SN) is an all-sky V-band transient survey with a limiting magnitude of ~17. ASAS-SN photometry of ASASSN-15qi was obtained from two different telescopes on Haleakala, Hawaii with intervals of one to three days. ASAS-SN photometry is listed in Table 2. Archival photometry, ground-based optical photometry with Las Cumbres Observatory Global Telescope Network (LCOGT) 1m telescope at McDonald Observatory between 2015 October 23 and December 23 and at the Liverpool Telescope on 2016 April 26 and June 11, Swift/UVOT photometry on 2015 October 12 (ID 00034098001) and 2015 December 27 (ID 00034098002), NIR photometry with the NOTCam camera at the Nordic Optical Telescope (NOT) on 2015 December 22 and Spitzer/IRAC MIR photometry on 2006 December 29 (Program ID 30734, PI Donald Figer) and James Clerk Maxwell Telescope (JCMT) SCUBA2 submillimeter observations of ASASSN-15qi on 2015 November 5 and optical and NIR spectroscopy observations are also described in section 2. (1 data file).
22 CFR 161.12 - Environmental effects abroad of major departmental actions.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Environmental effects abroad of major... Requirements of NEPA § 161.12 Environmental effects abroad of major departmental actions. Departmental officials shall analyze actions under their cognizance with due regard for the environmental effects in the...
STS-101 Crew Interview / Scott Horowitz
2000-01-01
Live footage of a preflight interview with Pilot Scott J. Horowitz is seen. The interview addresses many different questions including why Horowitz became an astronaut, the events that led to his interest, any role models that he had, and his inspiration. Other interesting information that this one-on-one interview discusses is the reaction and reasons for the splitting-up of the objectives for STS-101 with STS-106. Horowitz also mentions the scheduled space-walk, docking with the International Space Station (ISS), the new glass cockpit of Atlantis, the repairs of equipment and change of the batteries. Horowitz also discusses his responsibilities during the space-walk, and docking of the spacecraft. He stresses that he will have an added challenge during the space-walk, his inability to see where he needs to place the Extravehicular Activities (EVA) crew.
Mulmule, Manoj D.; Shimmy, Shankar M.; Bambole, Vaishali; Jamdar, Sahayog N.; Rawat, K. P.; Sarma, K. S. S.
2017-02-01
Idli, a steam-cooked breakfast food item consumed in India, is famous as a staple food for its spongy texture and unique fermented taste. Idli preparation is a time consuming process; although instant Idli pre-mixes as powder or batter are available in the market, they do not have the distinctive taste and aroma similar to the Idli prepared at home. Hence ready-to-eat (RTE) form of this food is in demand. Therefore, an attempt was made to prepare RTE Idli bearing similar taste as home-cooked Idli with an extended shelf-life of up to two months at an ambient temperature using Electron Beam Irradiation (EBI) at dosages 2.5 kGy, 5 kGy and 7.5 kGy and combination processing comprised of EBI dosage at 2.5 kGy and thermal treatment (80 °C for 20 min). The treated Idli's were microbiologically and sensorially evaluated at storage periods of zero day, 14 days, 30 days and 60 days. Idli's irradiated at 7.5 kGy and subjected to combination processing at 2.5 kGy and thermal treatment were shelf-stable for 60 days. 2.5 kGy and 5 kGy radiation dosages alone were not sufficient to preserve Idli samples for more than 14 days. Undesirable change in sensory properties of Idli was observed at an EBI dosage of 7.5 kGy. Sensory properties of combination processed Idli's were found to undergo minor change over the storage period. The present work suggests that lowest radiation dosage in combination with thermal treatment could be useful to achieve the extended shelf-life without considerably impairing the organoleptic quality of Ready-to-Eat Idli.
Ko, Jupil; Rosen, Adam B; Brown, Cathleen N
2017-09-12
To cross-culturally adapt the Identification Functional Ankle Instability for use with Korean-speaking participants. The English version of the IdFAI was cross-culturally adapted into Korean based on the guidelines. The psychometric properties in the Korean version of the IdFAI were measured for test-retest reliability, internal consistency, criterion-related validity, discriminative validity, and measurement error 181 native Korean-speakers. Intra-class correlation coefficients (ICC 2,1 ) between the English and Korean versions of the IdFAI for test-retest reliability was 0.98 (standard error of measurement = 1.41). The Cronbach's alpha coefficient was 0.89 for the Korean versions of IdFAI. The Korean versions of the IdFAI had a strong correlation with the SF-36 (r s = -0.69, p 10 was the optimal cutoff score to distinguish between the group memberships. The minimally detectable change of the Korean versions of the IdFAI score was 3.91. The Korean versions of the IdFAI have shown to be an excellent, reliable, and valid instrument. The Korean versions of the IdFAI can be utilized to assess the presence of Chronic Ankle Instability by researchers and clinicians working among Korean-speaking populations. Implications for rehabilitation The high recurrence rate of sprains may result into Chronic Ankle Instability (CAI). The Identification of Functional Ankle Instability Tool (IdFAI) has been validated and recommended to identify patients with Chronic Ankle Instability (CAI). The Korean version of the Identification of Functional Ankle Instability Tool (IdFAI) may be also recommend to researchers and clinicians for assessing the presence of Chronic Ankle Instability (CAI) in Korean-speaking population.
Screening of Lactobacillus plantarum isolated from fermented idli ...
African Journals Online (AJOL)
Probiotics are defined as live microorganisms which when administered in adequate amounts confer a health benefit on the host. The objective of this study was to screen eight potential probiotic Lactobacillus plantarum strains from fermented idli batter using in vitro assays such as bile tolerance, acid tolerance, transit ...
Next Generation Qualification: Kinemetrics STS-5A Seismometer Evaluation
Energy Technology Data Exchange (ETDEWEB)
Merchant, Bion John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Slad, George William [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-10-01
Sandia National Laboratories has tested and evaluated two seismometers, the STS-5A, manufactured by Kinemetrics. These seismometers measure three axes of broadband ground velocity using a UVW configuration with feedback control in a mechanically levelled borehole package. The purpose of the seismometer evaluation was to determine a measured sensitivity, response, self-noise, dynamic range, and self-calibration ability. The Kinemetrics STS-5A seismometers are being evaluated for the U.S. Air Force as part of their Next Generation Qualification effort.
Preti, Antonio; Sheehan, David V; Coric, Vladimir; Distinto, Marco; Pitanti, Mirko; Vacca, Irene; Siddi, Alessandra; Masala, Carmelo; Petretto, Donatella Rita
2013-10-01
The Sheehan Suicidality Tracking Scale (S-STS) is a patient self-report or clinician-administered rating scale that tracks spontaneous and treatment-emergent suicidal ideation and behaviors. This study set out to evaluate the reliability, convergent and divergent validity of the S-STS in a sample of college students, a population with a high risk of completed and attempted suicide. Cross-sectional, survey design. Participants (303 undergraduate students; males: 42%) completed several measures assessing psychological distress (General Health Questionnaire; GHQ); self-esteem (Rosenberg Self Esteem Scale; RSES); social support (Modified Social Support Survey; MOSSS); and suicidal behavior, including ideation and attempts (S-STS). Both internal consistency and test-retest stability were excellent for the S-STS-global score. The S-STS subscale on suicide ideation also showed good reliability, while the subscale on suicidal behavior showed some inconsistency at retest. Convergent and divergent validity of S-STS was confirmed. All S-STS items loaded on a single factor, which had an excellent fit for the unidimensional model, thus justifying the use of the S-STS as a screening tool. In a mediation model, self-esteem and social support explained 45% of the effects of psychological distress on suicide ideation and behavior as measured by the S-STS-global score. This study provided promising evidence on the convergent, divergent, internal consistency and test-retest stability of the Sheehan Suicidality Tracking Scale. The cross-sectional design and lack of measures of hopelessness and helplessness prevent any conclusion about the links of suicidal behavior with self-esteem and social support. Copyright © 2013 Elsevier Inc. All rights reserved.
Knoto-ID: a tool to study the entanglement of open protein chains using the concept of knotoids.
Dorier, Julien; Goundaroulis, Dimos; Benedetti, Fabrizio; Stasiak, Andrzej
2018-05-02
The backbone of most proteins forms an open curve. To study their entanglement, a common strategy consists in searching for the presence of knots in their backbones using topological invariants. However, this approach requires to close the curve into a loop, which alters the geometry of curve. Knoto-ID allows evaluating the entanglement of open curves without the need to close them, using the recent concept of knotoids which is a generalization of the classical knot theory to open curves. Knoto-ID can analyse the global topology of the full chain as well as the local topology by exhaustively studying all subchains or only determining the knotted core. Knoto-ID permits to localize topologically non-trivial protein folds that are not detected by informatics tools detecting knotted protein folds. Knoto-ID is written in C ++ and includes R (www.R-project.org) scripts to generate plots of projections maps, fingerprint matrices and disk matrices. Knoto-ID is distributed under the GNU General Public License (GPL), version 2 or any later version and is available at https://github.com/sib-swiss/Knoto-ID. A binary distribution for Mac OS X, Linux and Windows with detailed user guide and examples can be obtained from https://www.vital-it.ch/software/Knoto-ID. julien.dorier@sib.swiss.
Lifescience Database Archive (English)
Full Text Available 15546391 Signaling by IL-12 and IL-23 and the immunoregulatory roles of STAT4. Watf...ord WT, Hissong BD, Bream JH, Kanno Y, Muul L, O'Shea JJ. Immunol Rev. 2004 Dec;202:139-56. (.png) (.svg) (....html) (.csml) Show Signaling by IL-12 and IL-23 and the immunoregulatory roles of STAT4. PubmedID 15546391 T...itle Signaling by IL-12 and IL-23 and the immunoregulatory roles of STAT4. Author...s Watford WT, Hissong BD, Bream JH, Kanno Y, Muul L, O'Shea JJ. Publication Immunol Rev. 2004 Dec;202:139-56
Project W-320, operational test procedure OTP-320-003 test report
International Nuclear Information System (INIS)
Bevins, R.R.
1998-01-01
This report documents and summarizes the results of OTP-320-003 Project W-320 Operational Testing of the WRSS Supernate Transfer System. Project W-320 Operational Test OTP-320-003 was performed to verify components of the Waste Retrieval Sluicing System (WRSS) supernate transfer system functioned as designed following construction completion and turnover to operations. All equipment operation was performed by Tank Farms Operations personnel following the operational test procedure and referenced operating procedures. Supernate Transfer line Flushing System Testing was completed over the course of approximately 4 weeks as tank farm conditions and configuration, equipment availability, and operations resources allowed. All testing was performed with the 702-AZ ventilation system and the 296-P-16 ventilation systems in operation. Test procedure OTP-320-003 required two revisions during testing to incorporate Procedure Changes Authorizations (PCAs) necessary to facilitate testing. Various sections of testing are documented on each procedure revision. The completed test procedure is included as Attachment A. Exception Reports generated during the course of testing are included as Attachment B
A non-parametric peak calling algorithm for DamID-Seq.
Directory of Open Access Journals (Sweden)
Renhua Li
Full Text Available Protein-DNA interactions play a significant role in gene regulation and expression. In order to identify transcription factor binding sites (TFBS of double sex (DSX-an important transcription factor in sex determination, we applied the DNA adenine methylation identification (DamID technology to the fat body tissue of Drosophila, followed by deep sequencing (DamID-Seq. One feature of DamID-Seq data is that induced adenine methylation signals are not assured to be symmetrically distributed at TFBS, which renders the existing peak calling algorithms for ChIP-Seq, including SPP and MACS, inappropriate for DamID-Seq data. This challenged us to develop a new algorithm for peak calling. A challenge in peaking calling based on sequence data is estimating the averaged behavior of background signals. We applied a bootstrap resampling method to short sequence reads in the control (Dam only. After data quality check and mapping reads to a reference genome, the peaking calling procedure compromises the following steps: 1 reads resampling; 2 reads scaling (normalization and computing signal-to-noise fold changes; 3 filtering; 4 Calling peaks based on a statistically significant threshold. This is a non-parametric method for peak calling (NPPC. We also used irreproducible discovery rate (IDR analysis, as well as ChIP-Seq data to compare the peaks called by the NPPC. We identified approximately 6,000 peaks for DSX, which point to 1,225 genes related to the fat body tissue difference between female and male Drosophila. Statistical evidence from IDR analysis indicated that these peaks are reproducible across biological replicates. In addition, these peaks are comparable to those identified by use of ChIP-Seq on S2 cells, in terms of peak number, location, and peaks width.
A non-parametric peak calling algorithm for DamID-Seq.
Li, Renhua; Hempel, Leonie U; Jiang, Tingbo
2015-01-01
Protein-DNA interactions play a significant role in gene regulation and expression. In order to identify transcription factor binding sites (TFBS) of double sex (DSX)-an important transcription factor in sex determination, we applied the DNA adenine methylation identification (DamID) technology to the fat body tissue of Drosophila, followed by deep sequencing (DamID-Seq). One feature of DamID-Seq data is that induced adenine methylation signals are not assured to be symmetrically distributed at TFBS, which renders the existing peak calling algorithms for ChIP-Seq, including SPP and MACS, inappropriate for DamID-Seq data. This challenged us to develop a new algorithm for peak calling. A challenge in peaking calling based on sequence data is estimating the averaged behavior of background signals. We applied a bootstrap resampling method to short sequence reads in the control (Dam only). After data quality check and mapping reads to a reference genome, the peaking calling procedure compromises the following steps: 1) reads resampling; 2) reads scaling (normalization) and computing signal-to-noise fold changes; 3) filtering; 4) Calling peaks based on a statistically significant threshold. This is a non-parametric method for peak calling (NPPC). We also used irreproducible discovery rate (IDR) analysis, as well as ChIP-Seq data to compare the peaks called by the NPPC. We identified approximately 6,000 peaks for DSX, which point to 1,225 genes related to the fat body tissue difference between female and male Drosophila. Statistical evidence from IDR analysis indicated that these peaks are reproducible across biological replicates. In addition, these peaks are comparable to those identified by use of ChIP-Seq on S2 cells, in terms of peak number, location, and peaks width.
Liu, Kun; Liu, Yong; Yan, Jianchao; Sun, Zhenyuan
2018-03-25
Partial body weight support or loading sit-to-stand (STS) rehabilitation can be useful for persons with lower limb dysfunction to achieve movement again based on the internal residual muscle force and external assistance. To explicate how the muscles contribute to the kinetics and kinematics of STS performance by non-invasive in vitro detection and to nondestructively estimate the muscle contributions to STS training with different loadings, a wearable sensor system was developed with ground reaction force (GRF) platforms, motion capture inertial sensors and electromyography (EMG) sensors. To estimate the internal moments of hip, knee and ankle joints and quantify the contributions of individual muscle and gravity to STS movement, the inverse dynamics analysis on a simplified STS biomechanical model with external loading is proposed. The functional roles of the lower limb individual muscles (rectus femoris (RF), gluteus maximus (GM), vastus lateralis (VL), tibialis anterior (TA) and gastrocnemius (GAST)) during STS motion and the mechanism of the muscles' synergies to perform STS-specific subtasks were analyzed. The muscle contributions to the biomechanical STS subtasks of vertical propulsion, anteroposterior (AP) braking and propulsion for body balance in the sagittal plane were quantified by experimental studies with EMG, kinematic and kinetic data.
40 CFR 65.161 - Continuous records and monitoring system data handling.
2010-07-01
... section. (D) Owners and operators shall retain the current description of the monitoring system as long as... Routing to a Fuel Gas System or a Process § 65.161 Continuous records and monitoring system data handling...) Monitoring system breakdowns, repairs, preventive maintenance, calibration checks, and zero (low-level) and...
RNA-ID, a Powerful Tool for Identifying and Characterizing Regulatory Sequences.
Brule, C E; Dean, K M; Grayhack, E J
2016-01-01
The identification and analysis of sequences that regulate gene expression is critical because regulated gene expression underlies biology. RNA-ID is an efficient and sensitive method to discover and investigate regulatory sequences in the yeast Saccharomyces cerevisiae, using fluorescence-based assays to detect green fluorescent protein (GFP) relative to a red fluorescent protein (RFP) control in individual cells. Putative regulatory sequences can be inserted either in-frame or upstream of a superfolder GFP fusion protein whose expression, like that of RFP, is driven by the bidirectional GAL1,10 promoter. In this chapter, we describe the methodology to identify and study cis-regulatory sequences in the RNA-ID system, explaining features and variations of the RNA-ID reporter, as well as some applications of this system. We describe in detail the methods to analyze a single regulatory sequence, from construction of a single GFP variant to assay of variants by flow cytometry, as well as modifications required to screen libraries of different strains simultaneously. We also describe subsequent analyses of regulatory sequences. © 2016 Elsevier Inc. All rights reserved.
Fraudulent ID using face morphs: Experiments on human and automatic recognition.
Robertson, David J; Kramer, Robin S S; Burton, A Mike
2017-01-01
Matching unfamiliar faces is known to be difficult, and this can give an opportunity to those engaged in identity fraud. Here we examine a relatively new form of fraud, the use of photo-ID containing a graphical morph between two faces. Such a document may look sufficiently like two people to serve as ID for both. We present two experiments with human viewers, and a third with a smartphone face recognition system. In Experiment 1, viewers were asked to match pairs of faces, without being warned that one of the pair could be a morph. They very commonly accepted a morphed face as a match. However, in Experiment 2, following very short training on morph detection, their acceptance rate fell considerably. Nevertheless, there remained large individual differences in people's ability to detect a morph. In Experiment 3 we show that a smartphone makes errors at a similar rate to 'trained' human viewers-i.e. accepting a small number of morphs as genuine ID. We discuss these results in reference to the use of face photos for security.
STS-71 astronauts before egress training
1994-01-01
Astronaut Robert L. Gibson (left), STS-71 mission commander, converses with two crew mates prior to emergency egress training in the Systems Integration Facility at JSC. Astronaut Bonnie J. Dunbar and Gregory J. Harbaugh are attired in training versions o
Bi-phase CO{sub 2} cooling of the CBM STS detector
Energy Technology Data Exchange (ETDEWEB)
Lavrik, Evgeny [Physikalisches Institut der Universitaet Tuebingen (Germany); Collaboration: CBM-Collaboration
2016-07-01
The Compressed Baryonic Matter (CBM) experiment aims to study the properties of nuclear matter at high net-baryon densities. The Silicon Tracking System (STS) is the key detector to reconstruct charged particle tracks created in heavy-ion interactions. The foreseen interaction rate of up to 10 MHz requires radiation hard detectors as well as efficient cooling of the silicon sensors. To avoid thermal runaway the system must be kept at -5 C or below all the time. This is rather challenging because the overall thermal load in the 2 m{sup 3} STS enclosure is up to 40 kW. Because of these requirements liquid CO{sub 2} is used as a cooling agent as it is superior in terms of volumetric heat transfer coefficient compared to other agents. This contribution shows the thermal simulations and measurement results of the STS front-end electronic boxes as well as an overview of 1 kW TRACI-XL cooling plant developed at GSI and its use to perform thermal measurements of a fully heat loaded STS quarter station.
The sustainability paradigm and the STS approach: mediations for science education
Directory of Open Access Journals (Sweden)
Elizandra Rêgo de Vasconcelos
2012-12-01
Full Text Available The society has been confronted with issues that involve interactions between science, technology and society (STS, which reveal social, economic, environmental, ethical implications, among others. The sustainability paradigm occupies a prominent position in this area. We understand that the STS guidelines are an important instrument for building the concept of sustainability in science education, whose perspectives consistent with the formation of citizens with environmental sensitivity-citizens who are able to analyze and evaluate critically issues related to the social, environmental and economic field, among other aspects. We propose, in this article, to discuss the possible links between the sustainability paradigm, the STS approach and the process of teaching and learning in science. This articulation certainly helps to think the implications of the current development model and the relationships STS, inserted, for example, on various issues, contexts, dimensions, knowledge and teaching strategies. Certainly, we must undertake the effort to approximate the natural and social fields, in the apprehension of the complex reality as it stands nowadays
76 FR 82295 - Central Power & Lime LLC; Notice of Filing
2011-12-30
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket Nos. EL12-18-000; QF82-207-007] Central Power & Lime LLC; Notice of Filing December 23, 2011. Take notice that on December 22, 2011, Central Power & Lime LLC, pursuant to sections 18 CFR 292.205(c) and 385.207 of the Federal Energy...
2012-05-14
... DEPARTMENT OF LABOR Employee Benefits Security Administration 161st Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 161st open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans (also known as...
42 CFR 84.161 - Man test for gases and vapors; Type B and Type BE respirators; test requirements.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Man test for gases and vapors; Type B and Type BE respirators; test requirements. 84.161 Section 84.161 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Supplied-Air...
VizieR Online Data Catalog: RV and [Fe/H] in 5 open clusters (Carrera+, 2015)
Carrera, R.; Casamiquela, L.; Ospina, N.; Balaguer-Nunez, L.; Jordi, C.; Monteagudo, L.
2015-05-01
Medium-resolution spectra in the region of the near-infrared CaII triplet (CaT) at ~8500Å were obtained using the Intermediate Dispersion Spectrograph (IDS) mounted at the Cassegrain focus of the 2.5m Isaac Newton Telescope (INT) located at Roque de los Muchachos Observatory, Spain. Berkeley 23 was observed in service mode on 2013 January 17 and 18, and the other clusters were observed on 2014 July 18 and 19. (1 data file).
Long term file migration. Part I: file reference patterns
International Nuclear Information System (INIS)
Smith, A.J.
1978-08-01
In most large computer installations, files are moved between on-line disk and mass storage (tape, integrated mass storage device) either automatically by the system or specifically at the direction of the user. This is the first of two papers which study the selection of algorithms for the automatic migration of files between mass storage and disk. The use of the text editor data sets at the Stanford Linear Accelerator Center (SLAC) computer installation is examined through the analysis of thirteen months of file reference data. Most files are used very few times. Of those that are used sufficiently frequently that their reference patterns may be examined, about a third show declining rates of reference during their lifetime; of the remainder, very few (about 5%) show correlated interreference intervals, and interreference intervals (in days) appear to be more skewed than would occur with the Bernoulli process. Thus, about two-thirds of all sufficiently active files appear to be referenced as a renewal process with a skewed interreference distribution. A large number of other file reference statistics (file lifetimes, interference distributions, moments, means, number of uses/file, file sizes, file rates of reference, etc.) are computed and presented. The results are applied in the following paper to the development and comparative evaluation of file migration algorithms. 17 figures, 13 tables
46 CFR 163.003-27 - Production tests and examination.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Production tests and examination. 163.003-27 Section 163... examination. (a) General. Each ladder produced under Coast Guard approval must be tested in accordance with... for effective monitoring throughout the production schedule. (e) Visual examination. The visual...
Application of Sharī‘ah contracts in contemporary Islamic finance: A maqāṣid perspective
Directory of Open Access Journals (Sweden)
Younes Soualhi
2015-12-01
Full Text Available This research exposes the underlying maqāṣid embedded in Sharī‘ah contracts as applied in Islamic banking and finance. It addresses the problem of not observing maqāṣid in nominated and combined Sharī‘ah contracts as well as the problem of not sufficiently imbuing maqāṣid in products developed by Islamic financial institutions. As a benchmark of the maqāṣid of wealth, the research adopts Ibn ‘Āshūr’s classification of maqāṣid to evaluate the conformity of Sharī‘ah contracts to Maqāṣid al-Sharī‘ah namely, justice, circulation, transparency, and firmness. The study focuses on three markets related to the application of Sharī‘ah contracts, namely, banking, Islamic capital market, and takāful. The study concludes that, by and large, the application of Sharī‘ah contracts has observed Maqāṣid al-Sharī‘ah during its development and initial application stages of Islamic finance products; however, offering such products in the market has raised economic questions as to their viability and economic values. In addition, the malpractice of some Sharī‘ah contracts has long raised concerns as to the maqāṣid compliance of such products. The research recommends a de-sophistication of Islamic financial engineering to minimise the possibility of convergence with conventional finance. The research also emphasises product differentiation based on less complicated combined Sharī‘ah contracts.
Bimatoprost (0.03%)-induced accommodative spasm and pseudomyopia
Padhy, Debananda; Rao, Aparna
2015-01-01
Bimatoprost is a prostaglandin analogue used topically in the treatment of glaucoma. Commonly known side effects include eyelash growth, iris pigmentation and conjunctival hyperemia. While pseudomyopia is reported to be caused by parasympathomimetics, such an effect precipitated by bimatoprost has not yet been reported. We report a case demonstrating pseudomyopia and accommodative spasm caused after starting bimatoprost 0.03% in a young patient with glaucoma.
Views of STS-4 crew during a training session in the SMS
1982-01-01
Views of STS-4 crew during a training session in the Shuttle Mission Simulator (SMS) in bldg 5. Astronauts Thomas K. Mattingly, II. (left) and Henry W. Hartsfield, Jr., commander and pilot respectively for STS-4 get in some training time in the SMS.
Views of STS-5 crew during a training session in the SMS
1982-01-01
Views of STS-5 crew during a training session in the Shuttle Mission Simulator (SMS). Astronaut Robert F. Overmyer, STS-5 pilot, participates in training session wearing a communications kit assembly (ASSY). He is dressed in regular flight suit and is studying flight documentation.
Turtle, Cameron J; Delrow, Jeff; Joslyn, Rochelle C; Swanson, Hillary M; Basom, Ryan; Tabellini, Laura; Delaney, Colleen; Heimfeld, Shelly; Hansen, John A; Riddell, Stanley R
2011-09-08
Type 17 programmed CD161(hi)CD8α(+) T cells contribute to mucosal immunity to bacteria and yeast. In early life, microbial colonization induces proliferation of CD161(hi) cells that is dependent on their expression of a semi-invariant Vα7.2(+) TCR. Although prevalent in adults, CD161(hi)CD8α(+) cells exhibit weak proliferative and cytokine responses to TCR ligation. The mechanisms responsible for the dichotomous response of neonatal and adult CD161(hi) cells, and the signals that enable their effector function, have not been established. We describe acquired regulation of TCR signaling in adult memory CD161(hi)CD8α(+) T cells that is absent in cord CD161(hi) cells and adult CD161(lo) cells. Regulated TCR signaling in CD161(hi) cells was due to profound alterations in TCR signaling pathway gene expression and could be overcome by costimulation through CD28 or innate cytokine receptors, which dictated the fate of their progeny. Costimulation with IL-1β during TCR ligation markedly increased proinflammatory IL-17 production, while IL-12-induced Tc1-like function and restored the response to TCR ligation without costimulation. CD161(hi) cells from umbilical cord blood and granulocyte colony stimulating factor-mobilized leukaphereses differed in frequency and function, suggesting future evaluation of the contribution of CD161(hi) cells in hematopoietic stem cell grafts to transplant outcomes is warranted.
46 CFR 161.002-10 - Automatic fire detecting system control unit.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Automatic fire detecting system control unit. 161.002-10...-10 Automatic fire detecting system control unit. (a) General. The fire detecting system control unit... and the battery to be charged. (h) Automatic fire detecting system, battery charging and control—(1...
ACE I/D polymorphism in Indian patients with hypertrophic cardiomyopathy and dilated cardiomyopathy
DEFF Research Database (Denmark)
Rai, Taranjit Singh; Dhandapany, Perundurai Subramaniam; Ahluwalia, Tarun Veer Singh
2008-01-01
The study was carried to determine the association of angiotensin converting enzyme (ACE) insertion/deletion (I/D) polymorphism with the risk of hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy (DCM), and restrictive cardiomyopathy (RCM).......The study was carried to determine the association of angiotensin converting enzyme (ACE) insertion/deletion (I/D) polymorphism with the risk of hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy (DCM), and restrictive cardiomyopathy (RCM)....
ID-1 mass storage system for mainframe by using FDDI network
International Nuclear Information System (INIS)
Morita, Y.; Fujii, H.; Inoue, E.; Kodama, H. Manabe, A.; Miyamoto, A.; Nomachi, M.; Watase, Y.; Yasu, Y.
1994-01-01
The authors have developed an ID-1 mass storage system as a distributed data server for Fujitsu mainframe computers. The system consists of a SONY ID-1 recorder DIR-1000, a tape robot system DMS-24 and a SCSI-II interface DFC-1500, which are connected to Spar Station 10 with an FDDI interface. The maximum speed of 7.5 Mbytes/sec is achieved for data transfer between Sparc Station 10 memory and DIR-1000 with a buffer size of 1 Mbytes. The system has been used successfully since last October to migrate more than 1 Tbytes data
Evaluation of the Micro-ID system for the identification of Yersinia pestis.
Harrison, D N; Williams, J E
1985-01-01
One hundred isolates of Yersinia pestis identified by conventional means were tested by the Micro-ID system to assess its reliability for distinguishing Y. pestis from other members of the family Enterobacteriaceae. The Micro-ID system gave Y. pestis as a choice for the identification of 89 of these cultures, although not always as the first choice. Most nitrate-negative strains of Y. pestis keyed out with Yersinia pseudotuberculosis as first choice and Y. pestis as second or fourth choice.
Desprez, Pierre-Yves; Campisi, Judith
2014-08-19
A method for treatment of breast cancer and other types of cancer. The method comprises targeting and modulating Id-1 gene expression, if any, for the Id-1 gene, or gene products in breast or other epithelial cancers in a patient by delivering products that modulate Id-1 gene expression. When expressed, Id-1 gene is a prognostic indicator that cancer cells are invasive and metastatic.
STS-93 Pilot Ashby suits up before launch
1999-01-01
In the Operations and Checkout Building during final launch preparations for the second time, STS-93 Pilot Jeffrey S. Ashby waves after donning his launch and entry suit while a suit tech adjusts his boot. After Space Shuttle Columbia's July 20 launch attempt was scrubbed at the T-7 second mark in the countdown, the launch was rescheduled for Thursday, July 22, at 12:28 a.m. EDT. The target landing date is July 26, 1999, at 11:24 p.m. EDT. STS- 93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X-ray telescope and is expected unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Eileen M. Collins, Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.
Radikal konservativ idédebat og højreautoritær fascination i Danmark, ca. 1928-1940
DEFF Research Database (Denmark)
Holm, Adam
1999-01-01
Historie, Højreradikalisme, Konservatisme, Fascisme, Mellemkrigstid, Idéhistorie, Intellektuelle......Historie, Højreradikalisme, Konservatisme, Fascisme, Mellemkrigstid, Idéhistorie, Intellektuelle...
Energy Technology Data Exchange (ETDEWEB)
Lim, Il-Ho; Park, Chun-Kil; Kim, Hyung Sun; Jeong, Dea-Yong [Inha University, Incheon (Korea, Republic of); Lee, Yong-Seok [Sodoyeon Co., Yeoju (Korea, Republic of); Kong, Young-Min [University of Ulsan, Ulsan (Korea, Republic of); Kang, Kweon Ho [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2016-03-15
To improve the surface hardness of the STS304, Yttria stabilized zirconia (YSZ) films with nano-sized grain were deposited by an aerosol-deposition (AD) method. Coating layers showed dense structure and had -5µm thickness. When 3 mol% YSZ powders with tetragonal phase were deposited on STS304 substrate, tetragonal structure was transformed to cubic structure due to the high impact energy during the AD process. At the same time, strong impact by YSZ particles allowed the austenite phase in STS304 to be transformed into martensite phase. Surface hardness measured with nano indentor showed that YSZ coated film had 11.5 GPa, which is larger value than 7 GPa of STS304.
STS-76 Payload Cmdr Ronald Sega suits up
1996-01-01
STS-76 Payload Commander Ronald M. Sega is donning his launch/entry suit in the Operations and Checkout Building with assistance from a suit technician. The third docking between the Russian Space Station Mir and the U.S. Space Shuttle marks the second trip into space for Sega, who recently served a five-month assignment in Russia as operations director for NASA activities there. Once suitup activities are completed the six-member STS-76 flight crew will depart for Launch Pad 39B, where the Space Shuttle Atlantis is undergoing final preparations for liftoff during an approximately seven-minute launch window opening around 3:13 a.m. EST, March 22.
The ubiquitin ligase ASB4 promotes trophoblast differentiation through the degradation of ID2.
Directory of Open Access Journals (Sweden)
W H Davin Townley-Tilson
Full Text Available Vascularization of the placenta is a critical developmental process that ensures fetal viability. Although the vascular health of the placenta affects both maternal and fetal well being, relatively little is known about the early stages of placental vascular development. The ubiquitin ligase Ankyrin repeat, SOCS box-containing 4 (ASB4 promotes embryonic stem cell differentiation to vascular lineages and is highly expressed early in placental development. The transcriptional regulator Inhibitor of DNA binding 2 (ID2 negatively regulates vascular differentiation during development and is a target of many ubiquitin ligases. Due to their overlapping spatiotemporal expression pattern in the placenta and contrasting effects on vascular differentiation, we investigated whether ASB4 regulates ID2 through its ligase activity in the placenta and whether this activity mediates vascular differentiation. In mouse placentas, ASB4 expression is restricted to a subset of cells that express both stem cell and endothelial markers. Placentas that lack Asb4 display immature vascular patterning and retain expression of placental progenitor markers, including ID2 expression. Using JAR placental cells, we determined that ASB4 ubiquitinates and represses ID2 expression in a proteasome-dependent fashion. Expression of ASB4 in JAR cells and primary isolated trophoblast stem cells promotes the expression of differentiation markers. In functional endothelial co-culture assays, JAR cells ectopically expressing ASB4 increased endothelial cell turnover and stabilized endothelial tube formation, both of which are hallmarks of vascular differentiation within the placenta. Co-transfection of a degradation-resistant Id2 mutant with Asb4 inhibits both differentiation and functional responses. Lastly, deletion of Asb4 in mice induces a pathology that phenocopies human pre-eclampsia, including hypertension and proteinuria in late-stage pregnant females. These results indicate that
STS-95 Mission Specialist Pedro Duque in white room
1998-01-01
In the environmental chamber known as the white room, STS-95 Mission Specialist Pedro Duque of Spain, with the European Space Agency, is prepared by white room crew members Danny Wyatt (left) and Travis Thompson (right) for entry into the Space Shuttle Discovery for his first flight into space. The STS-95 mission, targeted for launch at 2 p.m. EST on Oct. 29, is expected to last 8 days, 21 hours and 49 minutes, and return to KSC at 11:49 a.m. EST on Nov. 7.
Bimatoprost (0.03%)-induced accommodative spasm and pseudomyopia.
Padhy, Debananda; Rao, Aparna
2015-11-23
Bimatoprost is a prostaglandin analogue used topically in the treatment of glaucoma. Commonly known side effects include eyelash growth, iris pigmentation and conjunctival hyperemia. While pseudomyopia is reported to be caused by parasympathomimetics, such an effect precipitated by bimatoprost has not yet been reported. We report a case demonstrating pseudomyopia and accommodative spasm caused after starting bimatoprost 0.03% in a young patient with glaucoma. 2015 BMJ Publishing Group Ltd.
Energy Technology Data Exchange (ETDEWEB)
Mueller, Cristina; Reber, Josefine; Haller, Stephanie [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger; Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Laboratory of Radiochemistry and Environmental Chemistry, Department of Chemistry and Biochemistry, Bern (Switzerland); Bernhardt, Peter [The Sahlgrenska Academy, University of Gothenburg, Department of Radiation Physics, Gothenburg (Sweden); Sahlgrenska University Hospital, Department of Medical Physics and Medical Bioengeneering, Gothenburg (Sweden); Zhernosekov, Konstantin [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)
2014-03-15
The radiolanthanide {sup 161}Tb (T{sub 1/2} = 6.90 days, Eβ{sup -}{sub av} = 154 keV) was recently proposed as a potential alternative to {sup 177}Lu (T{sub 1/2} = 6.71 days, Eβ{sup -}{sub av} = 134 keV) due to similar physical decay characteristics but additional conversion and Auger electrons that may enhance the therapeutic efficacy. The goal of this study was to compare {sup 161}Tb and {sup 177}Lu in vitro and in vivo using a tumour-targeted DOTA-folate conjugate (cm09). {sup 161}Tb-cm09 and {sup 177}Lu-cm09 were tested in vitro on folate receptor (FR)-positive KB and IGROV-1 cancer cells using a 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) viability assay. In vivo {sup 161}Tb-cm09 and {sup 177}Lu-cm09 (10 MBq, 0.5 nmol) were investigated in two different tumour mouse models with regard to the biodistribution, the possibility for single photon emission computed tomography (SPECT) imaging and the antitumour efficacy. Potentially undesired side effects were monitored over 6 months by determination of plasma parameters and examination of kidney function with quantitative SPECT using {sup 99m}Tc-dimercaptosuccinic acid (DMSA). To obtain half-maximal inhibition of tumour cell viability a 4.5-fold (KB) and 1.7-fold (IGROV-1) lower radioactivity concentration was required for {sup 161}Tb-cm09 (IC{sub 50} ∝0.014 MBq/ml and ∝2.53 MBq/ml) compared to {sup 177}Lu-cm09 (IC{sub 50} ∝0.063 MBq/ml and ∝4.52 MBq/ml). SPECT imaging visualized tumours of mice with both radioconjugates. However, in therapy studies {sup 161}Tb-cm09 reduced tumour growth more efficiently than {sup 177}Lu-cm09. These findings were in line with the higher absorbed tumour dose for {sup 161}Tb-cm09 (3.3 Gy/MBq) compared to {sup 177}Lu-cm09 (2.4 Gy/MBq). None of the monitored parameters indicated signs of impaired kidney function over the whole time period of investigation after injection of the radiofolates. Compared to {sup 177}Lu-cm09 we demonstrated equal imaging
CD3+CD8+CD161high Tc17 cells are depleted in HIV-infection
DEFF Research Database (Denmark)
Gaardbo, Julie Christine; Hartling, Hans Jakob; Thorsteinsson, Kristina
2012-01-01
CD8+ Tc17 cells with pro-inflammatory properties have only recently been acknowledged, and Tc17 cells in HIV-infection are undescribed. CD3+CD8+CD161 Tc17 cells and the production of Interleukin-17 were examined in untreated and treated HIV-infected patients, HIV-HCV co-infected patients...... and healthy controls. Depletion of CD3+CD8+CD161 Tc17 cells and diminished production of Interleukin-17 in HIV-infected patients was found. The level of Tc17 cells was associated with the level of the CD4+ count in treated patients....
Energy Technology Data Exchange (ETDEWEB)
Jiang, Chunyu; Wang, Jianbo, E-mail: a602131499@163.com [Shanghai Jiaotong University Affiliated Sixth People’s Hospital, Department of Radiology (China); Wang, Yonggang [Shanghai Jiaotong University Affiliated Sixth People’s Hospital, Department of Oncology (China); Zhao, Jungong; Zhu, Yueqi; Ma, Xu; Zhou, Jia [Shanghai Jiaotong University Affiliated Sixth People’s Hospital, Department of Radiology (China); Yan, Xuebing [Shanghai Jiaotong University Affiliated Sixth People’s Hospital, Department of General Surgery (China)
2016-10-15
PurposeTransarterial chemoembolization (TACE) is used to treat unresectable bone and soft tissue sarcoma (STS) and as a pre-surgical adjuvant treatment. However, its efficiency for advanced STS is undetermined. This study evaluated TACE’s efficiency in treating advanced STS and prognostic factors for patient survival.Materials and MethodsWe enrolled 39 patients with unresectable STS who underwent TACE as an alternative treatment during 2010–2014, with overall survival (OS) as the primary end point. Cancer pain was evaluated by visual analogue scores (VAS) before and after TACE procedures. Factors that affect survival were evaluated by multivariate analyses (Cox proportional hazard model).ResultsMean OS after TACE was 23.7 ± 2.1 months, with 1-year OS 71.5 %, 2-year OS 45.8 %, and 3-year OS 32.5 %. Lesion number and tumor stage were key predictors of survival. TACE was found to decrease cancer pain VAS and increase relapse interval. Size of polyvinyl alcohol (PVA) particle diameter (P = 0.03) and imaging response (P = 0.044) were also found to affect relapse interval.ConclusionTACE was an effective treatment for advanced STS, with a 32.5 % 3-year OS rate, and led to lower cancer pain VAS and longer relapse intervals than chemoinfusion only. Smaller PVA particles are preferable during the TACE procedure.
Group-ID based RFID Mutual Authentication
Directory of Open Access Journals (Sweden)
LEE, Y.
2013-11-01
Full Text Available For passive type RFID tags, EPCglobal Class 1 Generation-2 Revision is used widely as a de facto standard. As it was designed for low cost, it is quite vulnerable to security issues, such as privacy concerns. This paper presents a new RFID mutual authentication protocol, which is designed to be configured on EPC Gen2 platform and to meet various security requirements while providing efficiency using PRNG (Pseudo Random Number Generator. Group-ID is used to minimize the authentication time. Security analysis of the proposed protocol is discussed.
Directory of Open Access Journals (Sweden)
Gutmann Anja
2010-01-01
Full Text Available Abstract Background ID proteins are dominant negative inhibitors of basic helix-loop-helix transcription factors that have multiple functions during development and cellular differentiation. Ectopic (over-expression of ID1 extends the lifespan of primary human epithelial cells. High expression levels of ID1 have been detected in multiple human malignancies, and in some have been correlated with unfavorable clinical prognosis. ID1 protein is localized at the centrosomes and forced (over-expression of ID1 results in errors during centrosome duplication. Results Here we analyzed the steady state expression levels of the four ID-proteins in 18 tumor cell lines and assessed the number of centrosome abnormalities. While expression of ID1, ID2, and ID3 was detected, we failed to detect protein expression of ID4. Expression of ID1 correlated with increased supernumerary centrosomes in most cell lines analyzed. Conclusions This is the first report that shows that not only ectopic expression in tissue culture but endogenous levels of ID1 modulate centrosome numbers. Thus, our findings support the hypothesis that ID1 interferes with centrosome homeostasis, most likely contributing to genomic instability and associated tumor aggressiveness.
Directory of Open Access Journals (Sweden)
Farhaneen Afzal Mazlan
2015-10-01
Full Text Available Lactobacillus plantarum BET003 isolated from Momordica charantia fruit was used to ferment its juice. Momordica charantia fresh juice was able to support good growth of the lactic acid bacterium. High growth rate and cell viability were obtained without further nutrient supplementation. In stirred tank reactor batch fermentation, agitation rate showed significant effect on specific growth rate of the bacterium in the fruit juice. After the fermentation, initially abundant momordicoside 23-O-β-Allopyranosyle-cucurbita-5,24-dien-7α,3β,22(R,23(S-tetraol-3-O-β-allopyranoside was transformed into its corresponding aglycone in addition to the emergence of new metabolites. The fermented M. charantia juice consistently reduced glucose production by 27.2%, 14.5%, 17.1% and 19.2% at 15-minute intervals respectively, when compared against the negative control. This putative anti-diabetic activity can be attributed to the increase in availability and concentration of aglycones as well as other phenolic compounds resulting from degradation of glycosidic momordicoside. Biotransformation of M. charantia fruit juice via lactic acid bacterium fermentation reduced its bitterness, reduced its sugar content, produced aglycones and other metabolites as well as improved its inhibition of α-glucosidase activity compared with the fresh, non-fermented juice.
Mazlan, Farhaneen Afzal; Annuar, M Suffian M; Sharifuddin, Yusrizam
2015-01-01
Lactobacillus plantarum BET003 isolated from Momordica charantia fruit was used to ferment its juice. Momordica charantia fresh juice was able to support good growth of the lactic acid bacterium. High growth rate and cell viability were obtained without further nutrient supplementation. In stirred tank reactor batch fermentation, agitation rate showed significant effect on specific growth rate of the bacterium in the fruit juice. After the fermentation, initially abundant momordicoside 23-O-β-Allopyranosyle-cucurbita-5,24-dien-7α,3β,22(R),23(S)-tetraol-3-O-β-allopyranoside was transformed into its corresponding aglycone in addition to the emergence of new metabolites. The fermented M. charantia juice consistently reduced glucose production by 27.2%, 14.5%, 17.1% and 19.2% at 15-minute intervals respectively, when compared against the negative control. This putative anti-diabetic activity can be attributed to the increase in availability and concentration of aglycones as well as other phenolic compounds resulting from degradation of glycosidic momordicoside. Biotransformation of M. charantia fruit juice via lactic acid bacterium fermentation reduced its bitterness, reduced its sugar content, produced aglycones and other metabolites as well as improved its inhibition of α-glucosidase activity compared with the fresh, non-fermented juice.
Pre-STS-3 press conference held at the JSC public affairs facility
1982-01-01
Astronauts Jack R. Lousma, center, and C. Gordon Fullerton, left, respond to a visual display of the Columbia and its remote manipulator system in space during a pre-STS-3 press conference. Dr. John Lawrence, public information specialist, is at the far right (25903); Astronaut Lousma, listens as a newsman directs a question his way. In the background is the STS-3 mission logo (25904); Astronaut Fullerton uses an electronic pointer to localize an area on a prjected visual of the OSS payload package to be carried in the cargo bay of the Columbia on STS-3. On far right is Dr. Lawrence (25905).
Online data handling and storage at the CMS experiment
Andre, Jean-marc Olivier; Behrens, Ulf; Branson, James; Chaze, Olivier; Demiragli, Zeynep; Dobson, Marc; Dupont, Aymeric; Erhan, Samim; Gigi, Dominique; Glege, Frank; Gomez Ceballos, Guillelmo; Hegeman, Jeroen Guido; Holzner, Andre Georg; Jimenez Estupinan, Raul; Masetti, Lorenzo; Meijers, Franciscus; Meschi, Emilio; Mommsen, Remigius; Morovic, Srecko; Nunez Barranco Fernandez, Carlos; O'Dell, Vivian; Orsini, Luciano; Paus, Christoph Maria Ernst; Petrucci, Andrea; Pieri, Marco; Racz, Attila; Roberts, Penelope Amelia; Sakulin, Hannes; Schwick, Christoph; Stieger, Benjamin Bastian; Sumorok, Konstanty; Veverka, Jan; Zaza, Salvatore; Zejdl, Petr
2015-01-01
During the LHC Long Shutdown 1, the CMS Data Acquisition (DAQ) system underwent a partial redesign to replace obsolete network equipment, use more homogeneous switching technologies, and support new detector back-end electronics. The software and hardware infrastructure to provide input, execute the High Level Trigger (HLT) algorithms and deal with output data transport and storage has also been redesigned to be completely file- based. All the metadata needed for bookkeeping are stored in files as well, in the form of small 'documents' using the JSON encoding. The Storage and Transfer System (STS) is responsible for aggregating these files produced by the HLT, storing them temporarily and transferring them to the T0 facility at CERN for subsequent offline processing. The STS merger service aggregates the output files from the HLT from ~62 sources produced with an aggregate rate of ~2GB/s. An estimated bandwidth of 7GB/s in concurrent read/write mode is needed. Furthermore, the STS has to be able to store ...
Evaluation and application of the low energy electron emitter 161Tb
International Nuclear Information System (INIS)
Lehenberger, Silvia M.
2010-01-01
The low energy electron emitter 161 Tb was produced n.c.a. in quantities sufficient for therapeutic applications and successfully used for labeling of peptides and antibodies. Furthermore, these compounds have been compared to n.c.a. 177 Lu labeled mAbs via cell experiments, a radionuclide that is already used in clinical nuclear oncology.
27 CFR 31.161 - Conversion between metric and U.S. units.
2010-04-01
... Wholesale Dealers' Records and Reports § 31.161 Conversion between metric and U.S. units. When liters are... number of cases to be converted, as follows: (a) If the conversion from liters to U.S. units is made... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Conversion between metric...
Oberste, M S; Weaver, S C; Watts, D M; Smith, J F
1998-01-01
Venezuelan equine encephalitis (VEE) virus was isolated in 1993, 1994, and 1995 from human cases of acute, undifferentiated, febrile illness in the Peruvian Amazon Basin. Two virus isolates were recovered in 1994 from Peruvian soldiers at a jungle outpost near Pantoja in northern Peru, and 10 isolates were obtained from military personnel and civilians in 1993-1995 in Iquitos, an urban center in northeastern Peru. The genetic relationship of these isolates to other VEE virus strains was determined by sequencing 856-867 nucleotide reverse transcription-polymerase chain reaction fragments derived from the PE2 glycoprotein gene. The sequences were compared with those of other VEE virus strains, including representatives of the IAB, IC, ID, IE, II, and IIIC subtypes. The two Pantoja isolates were most closely related to subtype IC and ID viruses previously isolated in Colombia and Venezuela, and to the ID viruses isolated during the 1970s in Iquitos. All of the recent Iquitos isolates were similar to one another, but they were more closely related to Panamanian ID strains than to isolates previously obtained in Iquitos, Peru, or in Colombia and Venezuela. The recent Iquitos VEE viral isolates were the first Panama-genotype VEE ID virus strains identified outside of the Republic of Panama.
Online data handling and storage at the CMS experiment
International Nuclear Information System (INIS)
Andre, J-M; Andronidis, A; Chaze, O; Deldicque, C; Dobson, M; Dupont, A; Gigi, D; Glege, F; Hegeman, J; Jimenez-Estupiñán, R; Masetti, L; Meijers, F; Behrens, U; Branson, J; Cittolin, S; Holzner, A; Darlea, G-L; Demiragli, Z; Gómez-Ceballos, G; Erhan, S
2015-01-01
During the LHC Long Shutdown 1, the CMS Data Acquisition (DAQ) system underwent a partial redesign to replace obsolete network equipment, use more homogeneous switching technologies, and support new detector back-end electronics. The software and hardware infrastructure to provide input, execute the High Level Trigger (HLT) algorithms and deal with output data transport and storage has also been redesigned to be completely file- based. All the metadata needed for bookkeeping are stored in files as well, in the form of small documents using the JSON encoding. The Storage and Transfer System (STS) is responsible for aggregating these files produced by the HLT, storing them temporarily and transferring them to the T0 facility at CERN for subsequent offline processing. The STS merger service aggregates the output files from the HLT from ∼62 sources produced with an aggregate rate of ∼2GB/s. An estimated bandwidth of 7GB/s in concurrent read/write mode is needed. Furthermore, the STS has to be able to store several days of continuous running, so an estimated of 250TB of total usable disk space is required. In this article we present the various technological and implementation choices of the three components of the STS: the distributed file system, the merger service and the transfer system. (paper)
OpenID Connect as a security service in cloud-based medical imaging systems.
Ma, Weina; Sartipi, Kamran; Sharghigoorabi, Hassan; Koff, David; Bak, Peter
2016-04-01
The evolution of cloud computing is driving the next generation of medical imaging systems. However, privacy and security concerns have been consistently regarded as the major obstacles for adoption of cloud computing by healthcare domains. OpenID Connect, combining OpenID and OAuth together, is an emerging representational state transfer-based federated identity solution. It is one of the most adopted open standards to potentially become the de facto standard for securing cloud computing and mobile applications, which is also regarded as "Kerberos of cloud." We introduce OpenID Connect as an authentication and authorization service in cloud-based diagnostic imaging (DI) systems, and propose enhancements that allow for incorporating this technology within distributed enterprise environments. The objective of this study is to offer solutions for secure sharing of medical images among diagnostic imaging repository (DI-r) and heterogeneous picture archiving and communication systems (PACS) as well as Web-based and mobile clients in the cloud ecosystem. The main objective is to use OpenID Connect open-source single sign-on and authorization service and in a user-centric manner, while deploying DI-r and PACS to private or community clouds should provide equivalent security levels to traditional computing model.
STS-95 crew members Duque and Mukai check out slidewire basket
1998-01-01
At Launch Pad 39-B, STS-95 Mission Specialist Pedro Duque of Spain (left) and Payload Specialist Chiaki Mukai look over the gate for the slidewire basket, part of the emergency egress system on the pad. Mukai represents the National Space Development Agency of Japan (NASDA), and Duque the European Space Agency (ESA). The STS-95 crew are at KSC to participate in a Terminal Countdown Demonstration Test (TCDT) which includes mission familiarization activities, emergency egress training, and a simulated main engine cut-off exercise. Other STS-95 crew members are Mission Specialist Stephen K. Robinson, Mission Commander Curtis L. Brown, Pilot Steven W. Lindsey, Payload Specialists John H. Glenn Jr., senator from Ohio, and Mission Specialist Scott E. Parazynski. The STS-95 mission, targeted for liftoff on Oct. 29, includes research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. Following the TCDT, the crew will be returning to Houston for final flight preparations.
International Nuclear Information System (INIS)
Nakagawa, Tsuneo
1995-01-01
In JENDL-3,2, the data on all the reactions having significant cross section over the neutron energy from 0.01 meV to 20 MeV are given for 340 nuclides. The object range of application extends widely, such as the neutron engineering, shield and others of fast reactors, thermal neutron reactors and nuclear fusion reactors. This is a general purpose data file. On the contrary to this, the file in which only the data required for a specific application field are collected is called special purpose file. The file for dosimetry is a typical special purpose file. The Nuclear Data Center, Japan Atomic Energy Research Institute, is making ten kinds of JENDL special purpose files. The files, of which the working groups of Sigma Committee are in charge, are listed. As to the format of the files, ENDF format is used similarly to JENDL-3,2. Dosimetry file, activation cross section file, (α, n) reaction data file, fusion file, actinoid file, high energy data file, photonuclear data file, PKA/KERMA file, gas production cross section file and decay data file are described on their contents, the course of development and their verification. Dosimetry file and gas production cross section file have been completed already. As for the others, the expected time of completion is shown. When these files are completed, they are opened to the public. (K.I.)
Directory of Open Access Journals (Sweden)
Jin-xin Zheng
2018-02-01
Full Text Available Klebsiella pneumoniae bacteremia biofilm traits and distribution characteristics have not been clarified. This study aimed to determine the prevalence and characteristics of K. pneumoniae bacteremia biofilm formation (BF and to explore the virulence factors associated with K. pneumoniae BF. A total of 250 K. pneumoniae bacteremia isolates were collected from patients in Shenzhen and Shanghai, China. Virulence genes in their genomes were detected by PCR. The isolates were subjected to multilocus sequence typing (MLST and clonal complex (CC classification based on housekeeping genes. Biofilms were detected by crystal violet staining. Greater BF was observed in isolates from young adults (<40 years old than in those from seniors (≥65 years old; P = 0.002. MLST yielded 65 different sequence types (STs, with the most represented STs being ST11, ST23, and ST65, and the main CCs were CC23 and CC65; CC23 isolates exhibited greater BF than CC65 or ST11 isolates (both P < 0.001. BF was more pronounced among magA(K1, aero+, rmpA+, rmpA2+, allS+, wcaG+, and iutA+ isolates than in isolates that were negative for these virulence factors. Multivariate regression analysis revealed only wcaG as an independent risk factor for BF (odds ratio 11.426, P < 0.001, and BF was decreased when wcaG was silenced by antisense RNA. In conclusion, BF in K. pneumoniae bacteremia isolates was found to be associated with CC23 classification and the presence of the wcaG virulence factor gene.
STS-95 Mission Specialist Duque suits up during TCDT
1998-01-01
STS-95 Mission Specialist Pedro Duque of Spain, representing the European Space Agency, suits up in the Operations and Checkout Building prior to his trip to Launch Pad 39-B. Duque and the rest of the STS-95 crew are at KSC to participate in the Terminal Countdown Demonstration Test (TCDT) which includes mission familiarization activities, emergency egress training, and a simulated main engine cutoff. The other crew members are Payload Specialist Chiaki Mukai (M.D., Ph.D.), representing the National Space Development Agency of Japan (NASDA), Pilot Steven W. Lindsey, Mission Specialist Scott E. Parazynski, Mission Specialist Stephen K. Robinson, Payload Specialist John H. Glenn Jr., senator from Ohio, and Mission Commander Curtis L. Brown. The STS-95 mission, targeted for liftoff on Oct. 29, includes research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. Following the TCDT, the crew will be returning to Houston for final flight preparations.
Prevention of Crevice Corrosion of STS 304 Stainless Steel by a Mg-alloy Galvanic Anode
International Nuclear Information System (INIS)
Lim, U. J.; Yun, B. D.; Kim, J. J.
2006-01-01
Prevention of crevice corrosion was studied for STS 304 stainless steel using a Mg-alloy galvanic anode in solutions with various specific resistivity. The crevice corrosion and corrosion protection characteristics of the steel was investigated by the electrochemical polarization and galvanic corrosion tests. Experimental results show that the crevice corrosion of STS 304 stainless steel does not occur in solutions of high specific resistivity, but it occurs in solutions of low specific resistivity like in solutions with resistivities of 30, 60 and 115 Ω · m. With decreasing specific resistivity of the solution, the electrode potential of STS 304 stainless steel in the crevice is lowered. The potential of STS 304 stainless steel in the crevice after coupling is cathodically polarized more by decreasing specific resistivity indicating that the crevice corrosion of STS 304 stainless steel is prevented by the Mg-alloy galvanic anode
Angiotensin-I converting enzyme gene and I/D polymorphism ...
Indian Academy of Sciences (India)
Angiotensin-I converting enzyme gene and I/D polymorphism distribution in the Greek population and a comparison with other European populations. Sekerli Eleni Katsanidis Dimitrios Papadopoulou Vaya Makedou Areti Vavatsi Norma Gatzola Magdalini. Research Note Volume 87 Issue 1 April 2008 pp 91-93 ...
Angiotensin-converting enzyme gene I/D polymorphism in Pakistani ...
African Journals Online (AJOL)
hope&shola
two were the cases of antiphospholipid syndrome. Parsa et al. (2002) conducted an association of 3 polymor- phisms in angiotensin-converting enzyme including I/D polymorphism and 2 polymorphisms were associated with systemic lupus erythematosus and Lupus Nephritis among non-Caucasians that includes Hispanic, ...
STS-30 Pilot Ronald J. Grabe during preflight press conference at JSC
1989-01-01
During preflight press conference, STS-30 Pilot Ronald J. Grabe answers a question from the news media. The event was held in the JSC Auditorium and Public Affairs Facility Bldg 2 briefing room. STS-30 mission will fly onboard Atlantis, Orbiter Vehicle (OV) 104, and is scheduled for an April 28 liftoff.