Energy Technology Data Exchange (ETDEWEB)
Fonseca, Katia Aparecida
1997-07-01
The accurate knowledge of the gamma-ray emission probability per decay of radionuclides is important in several applications. In the case of {sup 126} I, its importance lies mainly in fast neutron dosimetry as well as in the production of {sup 125} I where {sup 126} I appears as an impurity. In the present work the gamma-ray emission probabilities per decay for the 388 and 666-KeV transitions of {sup 126} I have been measured. This radionuclide was obtained by means of the {sup 127} I(n, 2n){sup 126} I reaction in a fast neutron flux at the IPEN 2 MW research reactor. The methodology for the primary standardization of {sup 126} I is described. For this purpose, two different coincidence systems were used due to the complex decay scheme of this radionuclide. The {beta}branch measurement was carried out in a 4 {pi}(PC){beta}-{gamma} coincidence system consisting of a proportional counter, coupled to a pair of 3'x3' Na I (Tl) crystal. The electron capture branch was measured in a X-{gamma} coincidence system using two NaI(Tl) crystals. The gamma-ray measurements were performed in a HPGe system, previously calibrated by means of standard sources supplied by the International Atomic Energy Agency. All the uncertainties evolved were treated rigorously, by means of covariance analysis. (author)
Energy Technology Data Exchange (ETDEWEB)
Fonseca, Katia Aparecida
1997-07-01
The accurate knowledge of the gamma-ray emission probability per decay of radionuclides is important in several applications. In the case of {sup 126} I, its importance lies mainly in fast neutron dosimetry as well as in the production of {sup 125} I where {sup 126} I appears as an impurity. In the present work the gamma-ray emission probabilities per decay for the 388 and 666-KeV transitions of {sup 126} I have been measured. This radionuclide was obtained by means of the {sup 127} I(n, 2n){sup 126} I reaction in a fast neutron flux at the IPEN 2 MW research reactor. The methodology for the primary standardization of {sup 126} I is described. For this purpose, two different coincidence systems were used due to the complex decay scheme of this radionuclide. The {beta}branch measurement was carried out in a 4 {pi}(PC){beta}-{gamma} coincidence system consisting of a proportional counter, coupled to a pair of 3'x3' Na I (Tl) crystal. The electron capture branch was measured in a X-{gamma} coincidence system using two NaI(Tl) crystals. The gamma-ray measurements were performed in a HPGe system, previously calibrated by means of standard sources supplied by the International Atomic Energy Agency. All the uncertainties evolved were treated rigorously, by means of covariance analysis. (author)
Directory of Open Access Journals (Sweden)
Thomas Bawin
2014-11-01
Full Text Available The tomato leafminer, Tuta absoluta (Lepidoptera: Gelechiidae, is a devastating pest that develops principally on solanaceous plants throughout South and Central America and Europe. In this study, we tested the influence of three levels of T. absoluta infestations on the attraction and oviposition preference of adult T. absoluta. Three infestation levels (i.e., non-infested plants, plants infested with 10 T. absoluta larvae, and plants infested with 20 T. absoluta larvae were presented by pairs in a flying tunnel to groups of T. absoluta adults. We found no differences in terms of adult attraction for either level of infestations. However, female oviposition choice is influenced by larvae density on tomato plants. We discuss the underlying mechanisms and propose recommendations for further research.
Directory of Open Access Journals (Sweden)
Antônio Lopes da Silva
2007-09-01
Full Text Available
A tomato leafminer Scrobipalpuloides absoluta control trial with a new insect growth regulator was carried out in Goiânia, Goiás State, Brazil. The azaradictin (Azatin 3% at 36, 42, and 48 g a.i./ha was compared to abamectin at 14.4 g a.i./ha, Cartap at 480 g a.i./ha, and a witness with no insecticide control. Data showed that Azatin 3% at the levels tested did not efficiently control the tomato S. absoluta.
KEY-WORDS: Scrobipalpuloides absoluta; tomato leafminer; control.
Foi realizado, em Goiânia - GO, 1994, um ensaio de campo visando ao controle da traça do tomateiro Scrobipalpuloides absoluta (Meyrick, utilizando um novo inibidor de ecdise de origem vegetal. O azaradictin (Azatin 3% nas dosagens de 36, 42 e 48g de ingrediente ativo/ha, foi comparado com abamectin na dosagem de 14,4g de ingrediente ativo/ha, Cartap na dosagem de 480 g de ingrediente ativo/ha e uma testemunha sem inseticida. Pelos resultados obtidos concluiu-se que o Azatin 3%, nas dosagens utilizadas, não controlou eficientemente a praga S. absoluta sobre tomateiro.
PALAVRAS-CHAVE: Traça do tomateiro; Scrobipalpuloides absoluta; controle.
Occurrence of Pyemotes sp. on Tuta absoluta (Meyrick
Directory of Open Access Journals (Sweden)
Carlos Romero Ferreira de Oliveira
2007-11-01
Full Text Available The aim of this work was to study the population reduction of the tomato leafminer moth, Tuta absoluta (Meyrick, by Pyemotes sp. in the laboratory. The mite became greenish when fed on caterpillars, pupae, and adults of T. absoluta. The caterpillars and adults of T. absoluta were quickly paralyzed by the mite venom. A single T. absoluta could host many Pyemotes sp, physogastric females, which were allowed to grow on the moth. Pyemotes sp. can be a new alternative for the biological control of T. absoluta. However, this possibility must be better understood before it could be recommended, because Pyemotes sp. could also cause dermatitis in the humans.O ácaro Pyemotes sp. (Acari: Pyemotidae é um parasita de várias espécies de insetos e exibe o processo de fisogastria na reprodução. É registrada a ocorrência de Pyemotes sp. sobre a traça-do-tomateiro, Tuta absoluta (Meyrick, que sofreu redução considerável de suas populações em condições de laboratório. Este ácaro foi observado parasitando larvas, pupas e adultos de T. absoluta e suas fêmeas fisogástricas apresentaram coloração esverdeada. As larvas e adultos de T. absoluta atacados por Pyemotes sp. exibiram paralisia em poucos minutos, devido à injeção de toxinas por parte do ácaro. Observou-se que um único indivíduo de T. absoluta pode suportar muitas fêmeas fisogástricas de Pyemotes sp., permitindo que outra geração do ácaro continuasse a se reproduzir. O ácaro Pyemotes sp. surge como uma possibilidade para o controle biológico de T. absoluta, mas sua utilização deve ser melhor avaliada já que é uma espécie causadora de dermatites em humanos.
Spectroscopic study of 126I via incomplete fusion reaction
International Nuclear Information System (INIS)
Kanagalekar, B.A.; Das, Pragya; Kumar, Vinod; Kumar, R.; Singh, R.P.; Muralithar, S.; Bhowmik, R.K.
2006-01-01
The experiment at Inter University Accelerator Centre consisted of identifying the yrast high-spin states of 126 I using the incomplete fusion reaction 124 Sn ( 10 B, α4n) 126 I at beam energy of 70 MeV
Directory of Open Access Journals (Sweden)
Anaïs Chailleux
Full Text Available The South American tomato pinworm (Tuta absoluta has recently invaded Europe and is rapidly spreading in the Afro-Eurasian continent where it is becoming a major pest on tomato crops. Laboratory tests were undertaken to evaluate the potential of 29 European strains of Trichogramma parasitoids to control T. absoluta. In addition to the host itself, the host plant (tomato was used during the laboratory tests in order to increase the chance of selecting the best parasitoid strains. Trichogramma females were placed with T. absoluta eggs on a tomato leaflet in tubes. We compared the parasitism of T. absoluta by the various Trichogramma species tested to the Trichogramma species currently commercially available for the pest control in Europe, i.e. Trichogramma achaeae. Thereafter, the more promising strains were tested on a larger scale, in mesocosm (i.e. cages in greenhouses and in greenhouse compartments to evaluate efficiency of laboratory selected strains under cropping conditions. The most efficient strain from the laboratory screening trials did not perform as efficiently under the greenhouse conditions. We discuss differences in parasitism levels among species and strains and among the different scales tested in the experiments, as well as implications of these results for further screening for biocontrol agents.
International Nuclear Information System (INIS)
Cagnotti, Cynthia L.; Hernández, Carmen M.; Andormo, Andrea V.; Viscarret, Mariana; Botto, Eduardo N.; López, Silvia N.; Riquelme, María
2017-01-01
1. Tuta absoluta (Meyrick) (Lepidoptera: Gelechiidae) is one of the most devastating pests of tomato crops. We studied the acceptability and suitability of eggs laid by irradiated T. absoluta pairs to parasitism by the parasitoids Trichogramma nerudai and Trichogramma pretiosum. 2. Trichogramma absoluta pupae were irradiated with Xradiation (20834 R) and the emerged adults were separated into couples according to the crosses: ♂U × ♀U, ♂I × ♀U, ♂U × ♀I (where ‘U’ is untreated and ‘I’ is irradiated). In a no-choice experiment, 40 eggs from each cross were exposed to a female parasitoid for 24 h. 3. All T. absoluta eggs were accepted for oviposition by T. nerudai and were suitable for its development. However, eggs from irradiated females were significantly less parasitized than those from untreated females. Trichogramma pretiosum showed low parasitism on eggs from all crosses. In a choice experiment, both T. nerudai and T. pretiosum showed no differences in the parasitism of eggs from irradiated (n=40) and non-irradiated female moths (n=40). 4. These results indicate that eggs laid by irradiated parents were acceptable for oviposition and suitable for the development of these parasitoids, and also support the idea that the inherited sterility technique could be used in an integrated approach with egg parasitoids to control T. absoluta. (author)
· :':. Js~hr~! ·?a126;~;ri.~i: f~.':l~al: ~n~ vi~tp~!ho~ens;' ~' ~Ivoi~
African Journals Online (AJOL)
. Koshinikari. Bagamoyo. 56,2. 51. 2.3 np'. Mangutsumochi. Bagamoyo. 51.4. 51. 1.9 np. CT6947-7-1-4-2. CIAT. 137,6. 94. 2.9. I". lRAT 161. IRAT. 116. 91. '3~5. I. FARO 29. Nigeria. 126.4 '. 88. 10.5. IR 47686-15-5-1 (Resistailt lRRl. 133.6. 86.
Directory of Open Access Journals (Sweden)
Germano Leão Demolin Leite
2004-02-01
Full Text Available The objective of this study was to determine the effect of height of leaves in the canopy of plants, leaf organic compounds, concentrations of leaf nitrogen and potassium, leaf trichomes and cristalliferous idioblasts densities on the attack intensity of three tomato (Lycopersicon esculentum Mill. cv. Santa Clara crops by Tuta absoluta (Meyrick (Lepidoptera: Gelechiidae and Liriomyza spp. (Diptera: Agromyzidae, under field conditions. The experimental design was arranged in randomized blocks, with three replications, each being one tomato crop. Analysis of variance and the Tukey’s multiple range test (5% significance were used to test the effect of canopy height, trichome and cristalliferous idioblasts densities on the number of mines produced by T. absoluta and Liriomyza spp. and on the number of T. absoluta eggs. Pearson’s correlation (5% significance was used to evaluate the relationships between leaf organic compounds, leaf N and K concentrations, leaf trichome and cristalliferous idioblasts densities and the number of mines produced by T. absoluta and Liriomyza spp. and the number of T. absoluta eggs. Highest insect attack occurred in the final stage of the culture. A higher number of Liriomyza spp. mines/leaf was recorded in the lower (1.50 than in the upper (0.02 level of the tomato plants, the opposite was observed for the number of T. absoluta eggs/leaf (0.13 and 0.57, respectively. The number of T. absoluta mines/leaf concentrated more on the median (10.23 and apical regions (8.63 than on the basal (4.93. No significant effect of the trichomes and cristalliferous idioblasts densities of leaves was noted on T. absoluta and Liriomyza ssp. populations. Apparently, the terpenes affected oviposition of T. absoluta while leaf potassium affected Liriomyza spp. attack.Objetivou-se com este estudo determinar as influências da posição das folhas no dossel das plantas, dos compostos orgânicos foliares, das concentrações de nitrogênio e
Insecticide Effect of Zeolites on the Tomato Leafminer Tuta absoluta (Lepidoptera: Gelechiidae
Directory of Open Access Journals (Sweden)
Caroline De Smedt
2016-12-01
Full Text Available (1 Background: The tomato leafminer Tuta absoluta (Lepidoptera: Gelechiidae is a key tomato insect pest. At present, it is considered to be a serious threat in various countries in Europe, North Africa, and Middle East. The extensive use and the developed resistance of T. absoluta to spinosad causes some concern, which leads to the need for alternative products. (2 Materials and Methods: Several laboratory experiments were conducted to investigate the ovicidal properties of a zeolite particle film on T. absoluta. The toxicity of three different zeolites and six zeolite formulations to T. absoluta eggs and larvae was determined using different exposure methods. (3 Results: In general, the formulated zeolites yielded higher egg and larvae mortality values, especially when the zeolite particle film was residually applied. Notable differences in mortality rates from exposure to zeolites compared to other products, such as kaolin, its formulated product Surround, and the insecticide spinosad, were observed. Kaolin and Surround exhibited little or no effect for both application methods, while the hatch rate was reduced by 95% when spinosad was applied topically. Spinosad yielded egg and larvae mortality rates of 100% for both application methods. Additionally, increased oviposition activity was observed in adults exposed to the wettable powder (WP formulations. These WP formulations increased egg deposition, while Surround and spinosad elicited a negative oviposition response. (4 Conclusions: It can be derived that the tested products, zeolites BEA (Beta polymorph A, FAU (Faujasite, LTA (Linde type A, and their formulations, had no real insecticidal activity against the eggs of T. absoluta. Nevertheless, egg exposure to zeolites seemed to affect the development process by weakening the first instar larvae and increasing their mortality. Subsequently, based on the choice test, no significant difference was observed between the number of eggs laid on
International Nuclear Information System (INIS)
Anon.
1975-01-01
Estimated absorbed doses to human gall bladder, gastrointestinal tract, liver, ovaries, bone marrow, and testes from 123 I, 124 I, 126 I, 130 I, and 131 I after a single intravenous administration as sodium rose bengal are summarized. The greatest uncertainty in these dose estimates is due to the variability in time for the movement of radioiodine through the biliary tract, gall bladder, and gastrointestinal tract
Martins, Júlio C; Picanço, Marcelo C; Silva, Ricardo S; Gonring, Alfredo Hr; Galdino, Tarcísio Vs; Guedes, Raul Nc
2018-01-01
The spatial distribution of insects is due to the interaction between individuals and the environment. Knowledge about the within-field pattern of spatial distribution of a pest is critical to planning control tactics, developing efficient sampling plans, and predicting pest damage. The leaf miner Tuta absoluta (Meyrick) (Lepidoptera: Gelechiidae) is the main pest of tomato crops in several regions of the world. Despite the importance of this pest, the pattern of spatial distribution of T. absoluta on open-field tomato cultivation remains unknown. Therefore, this study aimed to characterize the spatial distribution of T. absoluta in 22 commercial open-field tomato cultivations with plants at the three phenological development stages by using geostatistical analysis. Geostatistical analysis revealed that there was strong evidence for spatially dependent (aggregated) T. absoluta eggs in 19 of the 22 sample tomato cultivations. The maps that were obtained demonstrated the aggregated structure of egg densities at the edges of the crops. Further, T. absoluta was found to accomplish egg dispersal along the rows more frequently than it does between rows. Our results indicate that the greatest egg densities of T. absoluta occur at the edges of tomato crops. These results are discussed in relation to the behavior of T. absoluta distribution within fields and in terms of their implications for improved sampling guidelines and precision targeting control methods that are essential for effective pest monitoring and management. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Danilo Couto
2007-09-01
Full Text Available
Foi realizado, no município de Goiânia (GO, no período de maio a outubro de 1994, um experimento visando ao controle químico da traça (S. absoluta no tomateiro, cultura rasteira. O delineamento experimental foi de blocos ao acaso com sete tratamentos em quatro repetições. Cada unidade experimental foi constituída de quatro linhas com cinco metros de comprimento, um metro entre linhas da cultivar Roma VF. Os produtos utilizados foram: Atabron 50 CE (Clorfluazuron nas doses de 0,5; 0,75; 1,0 e 1,5 litro por hectare do produto comercial; Vertimec 18 CE (Abamectin: 1,0 litro por hectare, acrescido de 0,25% de óleo mineral; Cartap 500 BR (Cartap na dose de 0,96 kg/hectare; e uma testemunha. Foram realizadas quatro aplicações consecutivas, semanalmente, a partir do aparecimento dos primeiros adultos da praga na cultura, gastando-se 1.000 litros de calda/hectare. Pelos resultados obtidos, pode-se concluir que o Atabron 50 CE controlou eficientemente a S. absoluta nas dosagens a partir de 0,75 litro (37,5 g i.a. por hectare, igualando-se ao Vertimec, até 21 dias após a última aplicação, e sendo superior ao Cartap. O Atabron apresentou um controle que variou entre 86,4 a 93,8% de eficiência.
PALAVRAS-CHAVE: Tomateiro; controle químico; traça; Scrobipalpuloides absoluta.
The tomato leafminer (Scrobipalpuloides absoluta, a common pest of tomato plant, is distributed in many regions in Brazil. In order to determine the efficiency of Chlorfluazuron to control the tomato leafminer, a field experiment was carried out in Goiânia, Goiás state, Brazil. The treatment and dosage in grams of active
Haddi, Khalid; Berger, Madeleine; Bielza, Pablo; Cifuentes, Dina; Field, Linda M; Gorman, Kevin; Rapisarda, Carmelo; Williamson, Martin S; Bass, Chris
2012-07-01
The tomato leaf miner, Tuta absoluta (Lepidoptera) is a significant pest of tomatoes that has undergone a rapid expansion in its range during the past six years and is now present across Europe, North Africa and parts of Asia. One of the main means of controlling this pest is through the use of chemical insecticides. In the current study insecticide bioassays were used to determine the susceptibility of five T. absoluta strains established from field collections from Europe and Brazil to pyrethroids. High levels of resistance to λ cyhalothrin and tau fluvalinate were observed in all five strains tested. To investigate whether pyrethroid resistance was mediated by mutation of the para-type sodium channel in T. absoluta the IIS4-IIS6 region of the para gene, which contains many of the mutation sites previously shown to confer knock down (kdr)-type resistance to pyrethroids across a range of different arthropod species, was cloned and sequenced. This revealed that three kdr/super-kdr-type mutations (M918T, T929I and L1014F), were present at high frequencies within all five resistant strains at known resistance 'hot-spots'. This is the first description of these mutations together in any insect population. High-throughput DNA-based diagnostic assays were developed and used to assess the prevalence of these mutations in 27 field strains from 12 countries. Overall mutant allele frequencies were high (L1014F 0.98, M918T 0.35, T929I 0.60) and remarkably no individual was observed that did not carry kdr in combination with either M918T or T929I. The presence of these mutations at high frequency in T. absoluta populations across much of its range suggests pyrethroids are likely to be ineffective for control and supports the idea that the rapid expansion of this species over the last six years may be in part mediated by the resistance of this pest to chemical insecticides. Crown Copyright © 2012. Published by Elsevier Ltd. All rights reserved.
Shaltiel-Harpaz, Liora; Gerling, Dan; Graph, Shaul; Kedoshim, Hendrika; Azolay, Lotem; Rozenberg, Tamir; Nachache, Yaakov; Steinberg, Shimon; Allouche, Arnon; Alon, Tamar
2016-02-01
The tomato leafminer, Tuta absoluta (Meyrick), had established in Israel by 2010, attacking both open-field tomatoes and greenhouse crops.We searched for its natural enemies in open-field tomatoes, and tried to determine their potential for controlling this pest. We surveyed the local natural enemies in open tomato fields and measured their impact on pest populations in an unsprayed field. We assessed the suppressive ability of the dominant hemipteran predator, Nesidiocoris tenuis Reuter, against T. absoluta under controlled laboratory conditions and evaluated the impact of its augmentation on T. absoluta control in open-field tomatoes. We found five natural enemy species:the predator, N. tenuis, two braconids, and two eulophids. Predation accounted for 64.5±9.2% (mean ± SE) of T. absoluta larval mortality, whereas parasitism accounted for 20.96±7.5%. Together, they eliminated the pest population at tomato harvest time. Under controlled conditions, predation by N. tenuis rose from 58 to 72% with increased density of T. absoluta, suggesting positive density dependence. The reduction of T. absoluta (83%) by N. tenuis was higher than that of Bemisia tabaci (32%), suggesting a preference of N. tenuis for T. absoluta. Augmentation of N.tenuis was as effective as conventional treatment insecticide treatment, and plant damage was low and did not seem to affect yield. Results indicate that reduced pesticide use enables indigenous natural enemies, particularly N.tenuis, to successfully control T. absoluta and prevent crop damage in open-field tomatoes.
Bioassay method for toxicity studies of insecticide formulations to Tuta absoluta (meyrick, 1917)
Galdino, Tarcísio Visintin da Silva; Picanço, Marcelo Coutinho; Morais, Elisangela Gomes Fidelis de; Silva, Nilson Rodrigues; Silva, Geverson Aelton Rezende da; Lopes, Mayara Cristina
2011-01-01
Chemical control is the main method for controlling the tomato leafminer, Tuta absoluta (Meyrick, 1917) (Lepidoptera: Gelechiidae). Reported techniques for the evaluation of insecticide toxicity to the tomato leafminer are not in agreement with field conditions and do not allow us to verify whether doses used in the field are efficient for control. Thus, the objective of this work was to develop a bioassay methodology to study the toxicity of insecticide formulations to T. absoluta that repre...
Bioassay method for toxicity studies of insecticide formulations to tuta absoluta (meyrick, 1917).
GALDINO, T. V. da S.; PICANÇO, M. C.; MORAIS, E. G. F. de; SILVA, N. R.; SILVA, G. A. R da; LOPES, M. C.
2014-01-01
Chemical control is the main method for controlling the tomato leafminer, Tuta absoluta (Meyrick, 1917) (Lepidoptera: Gelechiidae). Reported techniques for the evaluation of insecticide toxicity to the tomato leafminer are not in agreement with field conditions and do not allow us to verify whether doses used in the field are efficient for control. Thus, the objective of this work was to develop a bioassay methodology to study the toxicity of insecticide formulations to T. absoluta that repre...
Mohamadi, P; Razmjou, J; Naseri, B; Hassanpour, M
2017-01-01
The tomato leafminer, Tuta absoluta (Meyrick) is a devastating pest associated with tomato. In this study, effects of tomato plants treated with vermicompost (20, 40, and 60%), humic fertilizer (2, 4 and 6 g/kg soil) and plant growth promoting rhizobacteria (Pseudomonas fluorescens and Bacillus subtilis) were investigated on the life table parameters of T. absoluta in a growth chamber at 25 ± 2 °C, 65 ± 5% RH, and 16:8 (L:D) h. Significant differences were found for the total developmental time, fecundity, and oviposition period of T. absoluta on the treatments tested. The net reproductive rate (R0), intrinsic rate of natural increase (rm), finite rate of increase (λ), mean generation time (T), and doubling time (DT) of T. absoluta were significantly different among treatments tested. We found that in all vermicompost, humic fertilizer and plant growth promoting rhizobacteria treatments, values of R0, rm, and λ were lower than control treatment. However, the lowest values of these parameters were obtained on 2 g/kg humic fertilizer and 40% vermicompost. Furthermore, T. absoluta had longest T and DT values on 2 g/kg humic fertilizer treatment. Data obtained showed that the addition of 2 g/kg humic fertilizer and 40% vermicompost to the growing soil reduced T. absoluta populations in tomato cultures. In addition, these levels of fertilizers improved growth parameters of tomato seedlings (plant height, wet weight, and dry weight) compared with other treatments. These results could be useful in improving the sustainable management of the moth. © The Author 2017. Published by Oxford University Press on behalf of the Entomological Society of America.
Tarcísio Visintin da Silva Galdino; Marcelo Coutinho Picanço; Elisangela Gomes Fidelis de Morais; Nilson Rodrigues Silva; Geverson Aelton Rezende da Silva; Mayara Cristina Lopes
2011-01-01
Chemical control is the main method for controlling the tomato leafminer, Tuta absoluta (Meyrick, 1917) (Lepidoptera: Gelechiidae). Reported techniques for the evaluation of insecticide toxicity to the tomato leafminer are not in agreement with field conditions and do not allow us to verify whether doses used in the field are efficient for control. Thus, the objective of this work was to develop a bioassay methodology to study the toxicity of insecticide formulations to T. absoluta that repre...
Directory of Open Access Journals (Sweden)
Asma Bettaibi
2012-06-01
Full Text Available The tomato leaf miner Tuta absoluta Meyrick has invaded tomato (Solanum lycopersicum L. crop in Tunisia since 2008 and is representing today a major threat to the production of this crop. In this study, we used the Randomly Amplified Polymorphic DNA-Polymerase Chain Reaction (RAPD-PCR technology to assess the genetic variability within and among seven populations of T. absoluta, collected on tomato from different regions in Tunisia. Using five RAPD-PCR primers and 108 individuals, 140 polymorphic fragments were recorded. From 335 different RAPD phenotypes generated, 71 were redundant and 264 unique to a specific population. The genetic structure of T. absoluta was investigated using analysis of molecular variance (AMOVA, genetic distances (Fst and multidimensional scaling (MDS. We detected a high genetic diversity within and among populations in conjunction with a significant differentiation between populations, suggesting that different founder genotypes would have been responsible of the introduction of T. absoluta in Tunisia. The presence of overlapping phenotypes probably indicates migration events between populations, mainly through infested plant material carried by humans.El minador de hojas de tomate Tuta absoluta Meyrick ha invadido el cultivo del tomate (Solanum lycopersicum L. en Túnez desde 2008 y actualmente representa una importante amenaza para su producción. En este estudio usamos la tecnología de ADN polimórfico amplificado al azar-reacción de cadena polimerasa (RAPD-PCR para evaluar la variabilidad genética dentro y entre siete poblaciones de T. absoluta, colectadas desde tomate en diferentes regiones de Túnez. Usando cinco primers RAPD-PCR y 108 individuos, se registraron 140 fragmentos polimórficos. Se generaron 335 fenotipos RAPD diferentes, entre los cuales 71 fueron redundantes y 264 únicos para una población específica. La estructura genética de T. absoluta se investigó usando análisis de varianza molecular
Directory of Open Access Journals (Sweden)
Hristina Kutinkova
2016-03-01
Full Text Available The tomato leafminer, Tuta absoluta (Meyrick (Lepidoptera: Gelechiidae, is a economically important pest of processed and fresh tomatoes, both in greenhouses and open field crops. Currently, the pest threatens other cultivated solanaceous plants such as eggplant and potato. In this article we review pheromone control strategies for species-specific and environmentally safe management of the tomato leafminer, Tuta absoluta (Lepidoptera: Gelechiidae. This insect pest originates from South America and is now considered to be one of the most damaging invasive pests of tomatoes in the Mediterranean Basin countries of Europe and North Africa. In this article we describestrategies used to control T. absoluta including pest detection and population monitoring. Monitoring of Tuta absoluta was carried out in Imbabura Province in Ecuador. The parameters of using the pheromone traps Delta VI are described.
Population of Tuta absoluta and natural enemies after releasing on ...
African Journals Online (AJOL)
The study was conducted to evaluate the population of tomato leafminer, Tuta absoluta (Meyrick) (Lepidoptera: Gelechiidae) and efficiency of natural enemies on tomato grown greenhouse in Mediterranean Region of Turkey during 2010 and 2011. Trichogramma evanescens Westwood (Hymenoptera: Trichogrammatidae) ...
Population of Tuta absoluta and natural enemies after releasing on ...
African Journals Online (AJOL)
ZINO
2013-04-10
Apr 10, 2013 ... The decrease of egg and larva numbers of T. absoluta were higher in plots released T. ..... four generations in a greenhouse of tomato production in .... Arno J, Sorribas R, Prat M, Montse M, Pozo C, Rodriguez D, Garreta A,.
Directory of Open Access Journals (Sweden)
Juan Antonio Gómez
1985-04-01
Full Text Available
Los más eruditos y prestigiosos expositores nacionales han competido en destacar aspectos de la obra de López de Mesa con ocasión del centenario de su nacimiento, y las universidades y academias que él señoreó cerca de medio siglo con su erudición polifacética están revisando los variados aspectos de su personalidad. Sin embargo, nos parece que entre tantos elogios y oraciones panegíricas ha faltado dar un mayor énfasis a las líneas directrices de su posición filosófica que el profesor, y presidente que fue de la Academia Nacional de Medicina, dejó entrever en todas las ocasiones en que habló o escribió. Infortunadamente los conceptos estaban tan envueltos en su prosa barroca que muchos de sus admiradores quedáronse en la forma sin penetrar al fondo doctrinal.
En cierta forma López de Mesa erró al presentar sus pensamientos abstractos ante públicos heterogéneos que respondieron al estilo de los elocuentes discursos o conferencias en que habló al país pero no recogieron la enseñanza: al profesor le faltó una escuela de su pensamiento. En realidad este puede sumarse fundamentalmente en dos ideas generatrices que guiaron toda su vida y alrededor de las cuales elaboró disquisiciones eruditas sobre casi todos los aspectos de la cultura. Podría decirse que escudriñó tales temas para ejemplarizar su concepción general del universo y no con el propósito de contribuir a ellos por sí mismos.
Las dos ideas generatrices a que aludimos antes son: 1 la posibilidad absoluta y 2 la estética del comportamiento, que es solamente la praxis de las ideas derivadas de la primera concepción. Con el objeto de fundamentar la doctrina de la posibilidad y presentar pruebas de ella estudió historia, para citar ejemplos de la segunda hizo biografías, para unir procesos mentales con teorías neurofisiológicas estudió gramática, para aplicar en la nación sus ideas trajinó en política. Imposible abarcar en corto espacio
Beta decays of 126Cd and 126In to levels in 126In and 126Sn
International Nuclear Information System (INIS)
Gartner, M.L.
1979-01-01
A study of the beta decays of 126 Cd and 126 In using the TRISTAN on-line isotope separator facility is reported. Gamma-ray singles measurements were made for both decays usng Ge(Li) and LEPS (low energy photon spectrometer) detectors. In addition, gamma--gamma coincidence measurements and gamma multiscale measurements were made for both decays using Ge(Li) detectors. The half-life for 126 Cd was determined to be 0.506 +- 0.015 sec., and the half-lives for the low- and high-spin 126 In isomers were determined to be 1.83 +- 0.11 sec. and 1.96 +- 0.10 sec., respectively. A total of 11 gamma rays were observed in the decay of 126 Cd, and all but one were placed in a level scheme for 126 In. A total of 48 gamma rays were observed in the decay of the low- and high-spin 126 In isomers and all were placed in a level scheme for 126 Sn. Spin and parity assignments were deduced, whenever possible, on the basis of logft values and gamma decay selection rules. The 126 In decay schemes (one has been proposed for each isomer) are compared with earlier decay studies and with results from 124 Sn(t,p) 126 Sn reaction experiments. The systematics associated with the level schemes are discussed and a comparison is made with the nuclear shell model. 49 references
Energy Technology Data Exchange (ETDEWEB)
Virgala, Maria B. Riquelme, E-mail: mbriquelme@cnia.inta.gov.a [Universidade Nacional de Lujan, Buenos Aires (Argentina). Lab. de Zoologia Agricola; Botto, Eduardo N., E-mail: enbotto@cnia.inta.gov.a [Instituto de Microbiologia y Zoologia Agricola (IMYZA), Buenos Aires (Argentina)
2010-07-15
The tomato moth, Tuta absoluta Meyrick, is one of the most important tomato pests in South America. In Argentina, management strategies include only chemical control. In this work, the parasitoid wasp Trichogrammatoidea bactrae Nagaraja was evaluated as a potential natural enemy against this pest. Biological and population parameters were estimated by developing a life table under laboratory conditions at 25 {+-} 1 degree C, 14:10 photo period and 60 {+-} 10% RH. Three cohorts of 26-30 T. bactrae females each were placed with one of the three following treatments: 1 - Sitotroga cerealella (Olivier) eggs on a piece of cardboard; 2 - S. cerealella eggs on a piece of tomato leaf, and 3- T. absoluta eggs on a piece on tomato leaf. The following parameters were estimated for each cohort: survival (egg to adult), longevity, fecundity and oviposition period of females, sex proportion of the F1, net rate of reproduction (Ro), mean generation time (T) and intrinsic rate of population increase (rm). Survival of the T. bactrae immature was higher than 90% on both, S. cerealella and T. absoluta eggs. The female survival curves corresponded to type III and showed no significant differences among treatments. The three cohorts did not show significant differences between sex ratio, female longevity, oviposition period, fecundity and the population parameters studied. These results indicate that T. bactrae would be a potential biological control agent of T. absoluta. (author)
Directory of Open Access Journals (Sweden)
Juliano Tadeu Vilela de Resende
2006-02-01
Full Text Available Acylsugars present in the accession 'LA716' of Lycopersicon pennellii play an important role in the resistance to Tuta absoluta. This paper investigates the possible association between the resistance to T. absoluta and the acylsugar contents in F2 and F2BC1 tomato plants derived from the interspecific crossing between L. esculentum 'TOM-584' and L. pennellii 'LA716'. From the F2 population, four high acylsugars and one low acylsugars plants were selected and tested for Tuta absoluta resistance along with parental lines TOM-584 and LA-716, and with the checks TOM-600 (high 2-tridecanone line with resistance to T. absoluta and TOM-556 (low acylsugar line. The genotypes were tested under natural field infestation and were evaluated for overall plant damage, leaflet lesion type and percent of attacked leaflet. Four plants from F2BC1 [=(Lycopersicon esculentum 'TOM-584' ´ F2] were selected for high acylsugars and two for low acylsugars, and tested in greenhouse cages infested with T. absoluta. These genotypes were evaluated with the parental lines and the checks for oviposition ten days after infestation, and for leaflet lesion type and overall plant damage at four different dates. The F2 genotypes BPX-370Bpl#25, BPX-370Bpl#30 and BPX-370Bpl#79, the F2BC1 genotypes BPX-370B pl#30-380 and BPX-370B pl#30-271 and the wild accession LA716 had good levels of resistance to Tuta absoluta. The resistance level increased with longer exposition time to the acylsugars, both in the field and in the cage tests. Acylsugar contents seemed to be highly and negatively correlated with the traits related to the pinworm resistance.Os acilaçúcares presentes no acesso 'LA716' de Lycopersicon pennellii exercem um papel importante na resistência a Tuta absoluta. Foi avaliada a associação entre níveis de resistência à T. absoluta e o nível de acilaçúcares em plantas das gerações F2 e F2RC1 do cruzamento interespecífico L. esculentum 'TOM-584' ´ L. pennellii
Directory of Open Access Journals (Sweden)
Abd El-Ghany Nesreen M.
2016-12-01
Full Text Available Solanaceous plants have a great economic impact in Egypt. These groups of plants include potatoes, tomatoes and eggplants. The new invasive pest of tomatoes, Tuta absoluta (Meyrick causes the greatest crop losses which can range from 60 to 100%. After its detection in Egypt during the last half of 2009, it spread quickly to all provinces in the country. We aiming to propose a sustainable control program for this devastating pest. In this research we tested three groups of control agents. The first was microbial and natural, the second - plant extracts and the third - chemical insecticides. Our results showed that the impact of T. absoluta can be greatly reduced by the use of sustainable control measures represented by different insecticide groups. Bioassay experiments showed that this devastating pest can be controlled with some compounds that give high mortality rates. Of these compounds, spinosad and Beauveria bassiana, microbial control agents, followed by azadirachtin, gave the best results in controlling T. absoluta. Of the chemical insecticides, lambda-cyhalotrin was the most effective, followed by lufenuron and profenofos. In conclusion we encourage farmers to use microbial and natural control measures in combating the tomato leafminer, T. absoluta, in Integrated Pest Mangement (IPM programs.
Energy Technology Data Exchange (ETDEWEB)
Cunha, Uemerson S. da [Universidade Federal de Pelotas (UFPel), RS (Brazil). Dept. de Fitossanidade]. E-mail: uscunha@ufpel.edu.br; Vendramim, Jose D. [Escola Superior de Agricultura Luiz de Queiroz (ESALQ-USP), Piracicaba, SP (Brazil). Dept. de Entomologia, Fitopatologia e Zoologia Agricola; Rocha, Waldireny C.; Vieira, Paulo C. [Universidade de Sao Carlos (UFSCar), SP (Brazil). Dept. de Quimica
2008-11-15
Dichloromethane (DIC) leaf and fruit extracts of Trichiliapallida Swartz were obtained for the isolation and identification of molecules with insecticide activity against the tomato leafminer, Tuta absoluta (Meyrick). DIC leaf extracts of T. pallida yielded six compounds, the triterpenes 24-methylenecycloarta-3{beta}-ol (TRIT-1), 24-methylenecycloarta-3{beta}-26-diol (TRIT-2) and cycloarta-23-eno-3{beta},25-diol (TRIT-3), the sterols 24-methylene-3,22-dihydroxycholesterol (EST-1), 24-methylenecholesterol (EST-2) and 24-methylene-3{beta},4{beta},22-trihydroxycholesterol (EST-3), while the fruit extract yielded the limonoid gedunine (LIM). These molecules were dissolved in acetone and sprayed at 0.1% on tomato leaflets infested with newly-hatched larvae. Larval mortality at day 5 and 9 after infestation, larval and pupal developmental time and survival, pupal weight and adult malformation were evaluated. TRIT-1, EST-1 and LIM were the most effective against T. absoluta due to larval development arrestment and reduced larval survivorship. (author)
Directory of Open Access Journals (Sweden)
Aline Cavalcante Rodrigues de Oliveira
2008-09-01
Full Text Available
The tomato leafminer (Tuta absoluta represents a serious problem for the tomato crop, not only due to the intensity of its attack, but also to its occurrence during all the crop cycle. In Brazil, this pest has been controlled almost exclusively with insecticides, what is undesirable for economic and environmental reasons. In order to get more information on the control of this pest this research was carried out, in Ouro Verde (Goiás State, Brazil, from September through October 2002, to evaluate the use of light traps for capture of adult T. absoluta specimens. The treatments used were: 1 black lamp; 2 BLB lamp; 3 Grolux lamp; and 4 fluorescent daylight lamp. The experimental design used was randomized complete blocks with four replications. The parameter to evaluate treatment capture efficiency was the counting of the adult T. absoluta specimens trapped. The results showed that the BLB and ultraviolet lamps were the most efficient treatments. Therefore, both can help to control the tomato leafminer in integrated pest management programs.
KEY-WORDS: Tomato pinworm; integrated pest management; tomato.
A traça-do-tomateiro (Tuta absoluta representa um sério problema à tomaticultura, não somente pela intensidade de ataque, mas também por sua ocorrência durante todo o ciclo da cultura. No Brasil, esta praga tem sido controlada, quase exclusivamente, com inseticidas, o que é indesejável, tanto por motivos econômicos, quanto ambientais. Visando a obter maiores informa
1.26 Single Frequency Fiber Laser, Phase I
National Aeronautics and Space Administration — This proposal is for the development of an innovative compact, high power, and extremely reliable 1.26 micron Ho-doped single frequency fiber laser. The proposed...
Covariance methodology applied to uncertainties in I-126 disintegration rate measurements
International Nuclear Information System (INIS)
Fonseca, K.A.; Koskinas, M.F.; Dias, M.S.
1996-01-01
The covariance methodology applied to uncertainties in 126 I disintegration rate measurements is described. Two different coincidence systems were used due to the complex decay scheme of this radionuclide. The parameters involved in the determination of the disintegration rate in each experimental system present correlated components. In this case, the conventional statistical methods to determine the uncertainties (law of propagation) result in wrong values for the final uncertainty. Therefore, use of the methodology of the covariance matrix is necessary. The data from both systems were combined taking into account all possible correlations between the partial uncertainties. (orig.)
Barros, Emerson C; Bacci, Leandro; Picanco, Marcelo C; Martins, Júlio C; Rosado, Jander F; Silva, Gerson A
2015-01-01
In this study, we carried out three bioassays with nine used insecticides in tomato crops to identify their efficiency against tomato leaf miner Tuta absoluta, the physiological selectivity and the activity reduction of insecticides by three rain regimes to predatory wasps Protonectarina sylveirae and Polybia scutellaris. We assessed the mortality caused by the recommended doses of abamectin, beta-cyfluthrin, cartap, chlorfenapyr, etofenprox, methamidophos, permethrin, phenthoate and spinosad to T. absoluta and wasps at the moment of application. In addition, we evaluated the wasp mortality due to the insecticides for 30 days on plants that did not receive rain and on plants that received 4 or 125 mm of rain. Spinosad, cartap, chlorfenapyr, phenthoate, abamectin and methamidophos caused mortality higher than 90% to T. absoluta, whereas the pyrethroids beta-cyfluthrin, etofenprox and permethrin caused mortality between 8.5% and 46.25%. At the moment of application, all the insecticides were highly toxic to the wasps, causing mortality higher than 80%. In the absence of rain, all the insecticides continued to cause high mortality to the wasps for 30 days after the application. The toxicity of spinosad and methamidophos on both wasp species; beta-cyfluthrin on P. sylveirae and chlorfenapyr and abamectin on P. scutellaris, decreased when the plants received 4 mm of rain. In contrast, the other insecticides only showed reduced toxicity on the wasps when the plants received 125 mm of rain.
Metodologia para estudo do volume e densidade absoluta da placenta humana de termo
Directory of Open Access Journals (Sweden)
Del Nero Ulisses
2002-01-01
Full Text Available OBJETIVO: comparar duas metodologias para o cálculo do volume placentário em gestações normais de termo: a do princípio de Arquimedes e a do volume do cilindro, para estimar a densidade absoluta da placenta. Definir a metodologia mais adequada para o cálculo do volume e densidade placentários, que se relacione com o peso e classificação do recém-nascido. MÉTODOS: foram estudadas 50 placentas provenientes de gestações de termo sem complicações e calculados o volume e a densidade absoluta placentários: a pelo princípio de Arquimedes e b na suposição de que a placenta seria uma secção de cilindro com duas alturas diferentes do bolo placentário: com a altura média e com a altura da média aritmética do centro e extremidades. As densidades absolutas placentárias foram calculadas pelo quociente entre o peso ao ar da placenta e os diferentes volumes. RESULTADOS: a maioria das gestantes eram multíparas, idade média de 25,4 anos, volume placentário médio entre 547,8 e 610 cmsuperscript three e densidade média entre 0,94 e 1,14 g/cmsuperscript three, dependendo da metodologia empregada. CONCLUSÕES: a metodologia mais adequada para estimar o volume placentário no termo foi a do princípio de Arquimedes, pela melhor correlação com o peso dos recém-nascidos, o índice placentário e a classificação do peso dos recém-nascidos em relação à idade gestacional.
Directory of Open Access Journals (Sweden)
A. Harbi
2015-12-01
Full Text Available Insect-proof screens constitute efficient physical means of protecting horticultural crops against insect pests and their use has become widespread. However, they may have a negative impact on plant growth and fruit quality by modifying climatic parameters of greenhouses. In case of tomato crops, they are used mainly against white flies and the tomato leaf miner Tuta absoluta (Meyrick. In Tunisia, tomato plastic tunnels are often netted following two modalities: i complete netting of the greenhouse under the plastic screen (total netting; or ii netting only doors and lateral aeration windows (partial netting. Weekly monitoring of T. absoluta in two tomato greenhouses with different netting setups using pheromone traps and sampling of leaves and fruits showed no differences in the levels of infestation by the pest with a maximum average values of 6.66 eggs/leaf, 4.16 larvae/leaf and 4.16 mines/leaf. The maximum infestation rate of leaves was 86.66% and that of fruits was 10.83%. No effects of the netting setup used on plant growth parameters were detected. However, the study of fruit quality parameters revealed significant decrease in sugar contents in tomato fruits when using total netting setup (4.26°Brix versus 3.68°Brix. Recommendations regarding the combined use of pheromones traps and insect-proof nets are given and possibilities to enhance the efficiency of nets as physical barrier against T. absoluta are explored.
Directory of Open Access Journals (Sweden)
Tarcísio Visintin da Silva Galdino
2011-10-01
Full Text Available Chemical control is the main method for controlling the tomato leafminer, Tuta absoluta (Meyrick, 1917 (Lepidoptera: Gelechiidae. Reported techniques for the evaluation of insecticide toxicity to the tomato leafminer are not in agreement with field conditions and do not allow us to verify whether doses used in the field are efficient for control. Thus, the objective of this work was to develop a bioassay methodology to study the toxicity of insecticide formulations to T. absoluta that represent field conditions for fast-acting insecticides (neurotoxics and inhibitors of respiration and slow-acting insecticides (Bacillus thuringiensis and insect growth regulators. The leaf-dip method was the most efficient method for toxicity studies of insecticides formulations to T. absoluta. We verified that bioassays with fast-acting insecticides should be performed with glass Petri dishes containing one tomato foliole from the 4th leaf from the plant apex infested with 10 larvae of 3rd instar and these bioassays can last 48 hours. Conversely, bioassays with slow-acting insecticides should be performed with two-liter transparent PET bottles containing the 4th leaf from the plant apex, with their petioles immersed in a glass bottle containing 120 mL of water, and this leaf should be infested with 10 larvae of 2nd instar and this bioassays can last seven days.O principal método utilizado no controle da traça-do-tomateiro Tuta absoluta (Meyrick, 1917 (Lepidoptera: Gelechiidae é a aplicação de inseticidas. As técnicas atuais de avaliação da toxicidade de inseticidas sobre essa praga não simulam a situação de campo e não possibilitam a verificação se as doses usadas no campo são eficientes no seu controle. Assim, neste trabalho, objetivou-se desenvolver uma metodologia que represente as condições de campo para inseticidas de ação rápida (neurotóxicos e inibidores respiratórios e de ação lenta (Bacillus thuringiensis e reguladores de
Directory of Open Access Journals (Sweden)
Patricia Larraín
2014-04-01
Full Text Available The tomato moth (Tuta absoluta Meyrick, Lepidoptera: Gelechiidae has traditionally been managed in Chile with organophosphate, pyrethroid, and nereistoxin insecticides; all of these have wide action spectra and high toxicity and many of them have developed rapid resistance. It is therefore important to have new molecules which are effective in controlling this pest; how ever, these molecules must have lower toxicity and greater selectivity for beneficial fauna to produce a more sustainable tomato (Solanum lycopersicum L. production. The objective was to evaluate the effectiveness of T. absoluta control with cyantraniliprole insecticide, which has desirable characteristics for programs of integrated pest management of tomato; we thus performed three trials in the 2009-2010 and 2010-2011 seasons in the Coquimbo Region, Chile. These trials evaluated the control of T. absoluta using different doses of two formulations: cyantraniliprole 10 OD (oil dispersion with or without surfactants (Dyne-Amic, Codacide applied to leaves and cyantraniliprole 20 SC (suspension concentrate applied to soil. Trials used a randomized complete block design with four replicates. The effect of treatments was compared with standard insecticides and a control without insecticide. The degree of control was estimated by foliar and fruit damage at harvest. Results indicate a reduction in fruit damage between 75% and 85% for foliar applications and 82% for soil applications of cyantraniliprole. It is concluded that both formulations of cyantraniliprole were effective to reduce damage caused by the tomato moth larva in both the foliage and fruit of tomato.
Directory of Open Access Journals (Sweden)
José Djair Vendramim
2001-09-01
Full Text Available A traça Tuta absoluta (Meyrick é atualmente uma das principais pragas do tomateiro no Brasil. Com o objetivo de obter um método de controle eficiente e não poluente, avaliou-se a atividade dos extratos aquosos de folhas e ramos de Trichilia pallida Swartz associados a duas cultivares de tomateiro (Santa Clara e IPA-5 sobre essa praga. Acompanhou-se o desenvolvimento do inseto em folhas de cada uma das cultivares previamente submersas nos extratos a 1% de concentração, avaliando-se a duração e viabilidade das fases larval e pupal e o peso de pupas. A cultivar IPA-5 provocou alongamento da fase larval e, quando associada aos extratos de folhas e de ramos, reduziu a viabilidade pupal do inseto. Os extratos de folhas e de ramos também alongaram o período larval de T. absoluta, na cultivar Santa Clara. O extrato de folhas foi mais prejudicial ao desenvolvimento da traça do que o extrato de ramos dessa planta, reduzindo a viabilidade larval em ambas as cultivares.The tomato pinworm Tuta absoluta (Meyrick is one of the main tomato pests in Brazil. With the objective of obtaining an efficient and not pollutant method of control, the activity of aqueous extracts of Trichilia pallida Swartz leaves and twigs on this pest was studied associated to the tomato cultivars Santa Clara and IPA-5. The development of the insect was observed on leaves of each cultivar, previously treated with extracts at 1% of concentration. Length and viability of larval and pupal stages and pupal weight were evaluated. The larval period of the insect was more prolonged on 'IPA-5' and, when associated with leaf and twig extracts, reduced pupal viability. Leaf and twig extracts also prolonged the larval stage in 'Santa Clara'. The leaf extract affected more negatively the insect development than the twig extract, reducing larval viability on both cultivars.
Mohamadi, P; Razmjou, J; Naseri, B; Hassanpour, M
2017-12-01
The tomato leaf miner, Tuta absoluta (Meyrick), is a devastating pest of tomato worldwide. One of the control measures of T. absoluta is the use of biological control agents, such as Trichogramma wasps. Interactions between natural enemies and insect pests may be affected by application of fertilizers, because changes in plant quality through the fertilizer application may therefore affect herbivore characteristics and suitability of them to parasitism. Laboratory tests were carried out to evaluate the life table parameters of Trichogramma brassicae Bezdenko on T. absoluta eggs reared on tomato plants treated either with vermicompost (40%), humic fertilizer (2 g/kg soil), or control (suitable mixture of field soil and sand). Population growth parameters of T. brassicae were affected by fertilizer treatments. Significant differences were found for immature life period and total fecundity of T. brassicae on the treatments. Differences of intrinsic rate of natural increase (r m ), finite rate of increase (λ), net reproductive rate (R 0 ), mean generation time (T), and doubling time (DT) of T. brassicae among treatments were also significant. The lowest values of r m , λ, and R 0 were recorded for T. brassicae developed on T. absoluta eggs on control treatment, whereas the highest values of these parameters were observed on 2 g/kg humic fertilizer. Furthermore, T. brassicae had the shortest T and DT values on 2 g/kg humic fertilizer and 40% vermicompost treatments. Our results showed that application of humic fertilizer and vermicompost could positively affect population growth parameters of T. brassicae on eggs of T. absoluta fed on tomato plants.
Directory of Open Access Journals (Sweden)
Marília Cristina dos Santos
2012-07-01
Full Text Available The technology based on the use of silicon reduces pesticide use, keeping fruit quality and protecting the environment. This study evaluated the effects of different sources and levels of silicon applied on tomato plants, on biological and behavior characteristics of the tomato pinworm Tuta absoluta. The experimental outline was a randomized block with twenty one treatments, including control, in five replicates[(Agrosilício® soil (t ha-1 of SiO2 – 0.45, 0.90, 1.35 and 1.80; (Agrosilício® leaves (t ha-1 of SiO2 – 2.0, 4.0, 6.0 and 8.0; (Sili-K® (l ha-1 of product – 0.5, 1.0, 2.0 and 3.0; (Silicic Acid Leaves (% of SiO2 – 0.25, 0.50, 0.75 and 1.00; (Silicic acid soil (% of SiO2 – 0.25, 0.50, 0.75 and 1.00 and control]. The biological characteristics evaluated, were: duration of larval and pupal stages, survival of larvae and pupae and pupal weight of males and females individuals. The non-preference for oviposition of T. absoluta in tomato plants treated with silicon was evaluated through tests with choice and without choice trials. There were no differences observed in the length of larval and pupal stages, survival of larvae and pupae, pupal weight of males and females of T.absoluta and oviposition in individuals from the treatments with silicon applied to the soil and those in the control group. However, insects collected from treatments based on leaf application silicon showed an increase in the duration the larval and pupal stages, decreased survival of larvae and pupae, decreased pupae weight of males and females and a decrease in oviposition preference.
Considerações sobre o conceito de temperatura e de temperatura absoluta
Leal Ferreira, G.F.
2006-01-01
Discute-se o conceito de temperatura que emerge da ação de contato, e a conveniência de torná-lo menos abstrato levando em conta a quantidade de matéria envolvida. Mostra-se que o conceito de 'energia térmica molar', numericamente igual ao produto da constante dos gases pela temperatura absoluta, preenche aquele fim, expressando o conteúdo cinético da energia molar, além de permitir desonerar a entropia de inadequada dimensionalidade. The concept of temperature acquired by means of our con...
Directory of Open Access Journals (Sweden)
Leonardo Barros de Macêdo
2007-09-01
Full Text Available
O experimento foi realizado na área de horticultura da Escola de Agronomia da Universidade Federal de Goiás, visando ao controle químico da traça do tomateiro (Scrobipalpuloides absoluta Meyric, 1917, no período de setembro a dezembro de 1995, para avaliar a eficiência do inseticida Onic 300 (Alanycarb nas dosagens de 1,0, 1,5 e 2,0 litros do produto formulado por ha, comparando-o com Cartap 500 BR (Cartap na dosagem de 2,4 kg/ha, Vertimec 18 CE (Abamectin na dosagem de 1,0 l/ha misturado a um óleo mineral e uma testemunha. Pelos resultados obtidos concluiu-se que todos os inseticidas utilizados controlaram eficientemente a traça em tomateiro até 8 dias após aplicação e que todos os tratamentos promoveram aumento de produtividade.
PALAVRAS-CHAVE: Traça; Scrobipalpuloides absoluta; controle químico; tomateiro.
The tomato leafminer (Scrobipalpuloides absoluta, a common pest of tomato plants, is known in many regions in Brazil. In order to determine the efficiency of new insecticide alanycarb, to control the tomato leafminer a field experiment was carried out in Goiânia, Goiás, Brazil. The treatments and dosage of the insecticides per hectare were: alanycarb 300: 1.0, 1.5 and 2.0 l; cartap 500 BR: 2.0 kg; abamectin 18 CE: 1.0 1 plus an untreated check. The results obtained in this experiment showed that all insecticides were efficient in controlling the tomato leafminer until 8 days after treatment application and they were able to increase productivity.
KEY-WORDS: Scrobipalpuloides absoluta; tomato leafminer; chemical control.
Silva, D.B.; Bueno, V.H.P.; Lins, Juracy Caldeira; Lenteren, Van J.C.
2015-01-01
The tomato borer Tuta absoluta (Meyrick) (Lepidoptera Gelechiidae), is of growing concern worldwide as a key pest of tomato. In Brazil, the pest is controlled by frequent pesticide sprays, leading to quick development of pesticide resistance in the pest, to high pesticide residue levels on the
African Journals Online (AJOL)
More- over, injections of oxytocin or oestrogenic substances have been shown to inhibit functional corpora lutea and reduce the plasma progesterone level in cattle. (Armstrong & Hansel, 1959; Kaltenbach, Niswender,. Zimmerman & Wiltbank, 1964). The rationale for using potentiating agents was to improve the response to.
CD36 participates in PrP(106-126-induced activation of microglia.
Directory of Open Access Journals (Sweden)
Mohammed Kouadir
Full Text Available Microglial activation is a characteristic feature of the pathogenesis of prion diseases. The molecular mechanisms that underlie prion-induced microglial activation are not very well understood. In the present study, we investigated the role of the class B scavenger receptor CD36 in microglial activation induced by neurotoxic prion protein (PrP fragment 106-126 (PrP(106-126. We first examined the time course of CD36 mRNA expression upon exposure to PrP(106-126 in BV2 microglia. We then analyzed different parameters of microglial activation in PrP(106-126-treated cells in the presence or not of anti-CD36 monoclonal antibody (mAb. The cells were first incubated for 1 h with CD36 monoclonal antibody to block the CD36 receptor, and were then treated with neurotoxic prion peptides PrP(106-126. The results showed that PrP(106-126 treatment led to a rapid yet transitory increase in the mRNA expression of CD36, upregulated mRNA and protein levels of proinflammatory cytokines (IL-1β, IL-6 and TNF-α, increased iNOS expression and nitric oxide (NO production, stimulated the activation of NF-κB and caspase-1, and elevated Fyn activity. The blockade of CD36 had no effect on PrP(106-126-stimulated NF-κB activation and TNF-α protein release, abrogated the PrP(106-126-induced iNOS stimulation, downregulated IL-1β and IL-6 expression at both mRNA and protein levels as well as TNF-α mRNA expression, decreased NO production and Fyn phosphorylation, reduced caspase-1 cleavage induced by moderate PrP(106-126-treatment, but had no effect on caspase-1 activation after treatment with a high concentration of PrP(106-126. Together, these results suggest that CD36 is involved in PrP(106-126-induced microglial activation and that the participation of CD36 in the interaction between PrP(106-126 and microglia may be mediated by Src tyrosine kinases. Our findings provide new insights into the mechanisms underlying the activation of microglia by neurotoxic prion peptides
Tuta absoluta: una nueva plaga para el cultivo del tomate en Europa (Sesión Técnia: Hortalizas)
Stol, W.; Griepink, F.C.; Deventer, van P.
2009-01-01
Tuta absoluta es una polilla originaria de Chile cuyas larvas producen minas en las hojas de las plantas de tomate. En las últimas décadas de este insecto se ha extendido por gran parte del continente sudamericano. Después de su primera observación en Europa (España, Valencia) en 2007, esta polilla
Optimización de la medida de conductividad en membranas poliméricas para pilas de combustible
Espeso González, Iván
2016-01-01
El objetivo de este Trabajo de Fin de Grado se centra en la medida de conductividad iónica de membranas poliméricas de intercambio iónico en diferentes celdas de conductividad para poder optimizar este tipo de medidas y evaluar las ventajas e inconvenientes que presenta cada una de las celdas de conductividad utilizadas para poder ser utilizadas con otro tipo de membranas poliméricas utilizadas también como electrolitos sólidos en pilas de combustible. Se han utilizado co...
Directory of Open Access Journals (Sweden)
Rogério Lacerda dos Santos
2009-06-01
Full Text Available OBJETIVOS: o presente estudo comparou algumas medidas cefalométricas relacionadas às características faciais em pacientes com má oclusão Classe I, Classe II 1ª divisão e Classe II 2ª divisão. METODOLOGIA: foram selecionadas 130 telerradiografias de pacientes leucodermas em fase inicial de tratamento ortodôntico, com idades entre 10 e 16 anos (média de 12,6 anos; e divididos em 3 grupos. As medidas cefalométricas utilizadas neste estudo foram: ANB, ı-SN, IMPA, AML, Ls-ı, Li-ī e EI. A análise de variância e o teste de Tukey foram realizados nas medidas ANB, IMPA, AML, ı-SN e Li-ī. Para as demais variáveis (EI e Ls-ı foi utilizado o teste de Kruskal Wallis e Dunn. RESULTADOS: os resultados mostraram que as medidas Ls-ı e EI tiveram diferença estatisticamente significativa entre os grupos I e II-1 e entre os grupos II-1 e II-2 (p AIM: The present study compared some cephalometric measurements related to facial characteristics in patients having Class I, Class II division 1, and Class II division 2 malocclusions. METHODS: One hundred and thirty teleradiographs of Caucasian patients aged 10-16 years (mean age of 12.6 years under initial orthodontic treatment were selected for study and divided into 3 groups. The cephalometric measurements used in the present study were the following: ANB, ı-SN, IMPA, AML, Ls-ı, Li-ī, and EI. Variance analysis and Tukey's test were carried out for ANB, IMPA, AML, ı-SN, and Li-ī measurements, whereas Kruskal-Wallis and Dunn's tests were used for EI and Ls-ı. RESULTS: Statistically significant differences were found for EI and Ls-ı measurements when Group II-1 was compared to Group I and Group II-2 (p < 0.05. ANB and IMPA measurements also had statistically significant differences when Group I was compared to Group II-1 and Group II-2 (p < 0.05. The measurement ı-SN had statistically significant differences between the 3 groups (p < 0.05. CONCLUSIONS: One can conclude that the measurement
VladBot. Robot para posicionamiento de medida
Plata Rueda, Ángel
2013-01-01
VladBot es un robot autónomo diseñado para posicionar en interiores un micrófono de medida. Este prototipo puede valorar la idea de automatizar medidas acústicas en interiores mediante un robot autónomo. Posee dos ruedas motrices y una rueda loca. Ésta rueda loca aporta maniobrabilidad al robot. Un soporte extensible hecho de aluminio sostiene el micrófono de medida. VladBot ha sido diseñado con tecnologías de bajo coste y bajo una plataforma abierta, Arduino. Arduino es una plataforma el...
Ai~O~;::({{'126;~;:~1i126;~;ri126;~;jf126;~;',i~a!i126;~~~;~fJit!E~f126;~;7
African Journals Online (AJOL)
by Sabin et G atew ay u n d er licen ce gran ted by th e P u blish er (d ated ... cattle as dip wash/pour-oli or applied on screens ",,:Production of surplus male tsetse .... larva whereas those mated by sterile males show a confirm the presence or ...
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Settlement. 498.126 Section 498.126 Employees' Benefits SOCIAL SECURITY ADMINISTRATION CIVIL MONETARY PENALTIES, ASSESSMENTS AND RECOMMENDED EXCLUSIONS § 498.126 Settlement. The Inspector General has exclusive authority to settle any issues or case...
Directory of Open Access Journals (Sweden)
María B. Riquelme Virgala
2006-12-01
Full Text Available La «polilla del tomate», Tuta absoluta (Meyrick, es una plaga clave de este cultivo en Argentina. Su manejo integrado debería incluir una selección de productos fitosanitarios que sean eficaces para su control y, al mismo tiempo, selectivos respecto de sus enemigos naturales. El objetivo de este trabajo fue evaluar la capacidad de control de los insecticidas triflumurón, clorfenapir, abamectin y una cepa experimental de Bacillus thuringiensis (Bt sobre la plaga, y el poder residual de los mismos sobre Trichogrammatoidea bactrae Nagaraja. Se registró la mortalidad de la polilla cada cuatro días, desde la aplicación hasta la emergencia de los adultos. El efecto sobre el parasitoide, se evaluó a través del número de huevos parasitados por hembra expuesta durante 48 horas a folíolos tratados, y su mortalidad luego de 1, 3, 7, 14 y 30 días de la pulverización. Todos los productos ocasionaron una mortalidad de T. absoluta mayor al 65% después de 12 días de aplicados. El Bt fue el único insecticida que no afectó la supervivencia y el parasitismo de T. bactrae . Estos resultados aportan información de interés para la selección de plaguicidas, a emplearse en programas de manejo integrado.The «tomato moth», Tuta absoluta (Meyrick is one of the key pests of tomato crops in Argentina. The compatible use of chemical and biological control is the main purpose of integrated pest management. Selective pesticides that can be successfully used to control pest without adverse side effects on natural enemies are highly required. The aim of this work was to evaluate the efficacy of control of T. absoluta and the residual effect on the oophagous parasitoid, Trichogrammatoidea bactrae Nagaraja of the following insecticides: triflumuron, abamectin, chlorfenapyr, and an experimental strain of Bacillus thuringiensis (Bt. Mortality of T. absoluta was evaluated every 4 days from pesticide spraying until adult emergency. The effect of pesticides on
Directory of Open Access Journals (Sweden)
Maria Elena Echevarría-Guanilo
2017-01-01
Full Text Available Objetivo: presentar y discutir bases conceptuales y métodos de evaluaciones que fundamentan importantes propiedades de instrumentos de medidas. En esta primera parte, se presentan y discute los conceptos de confiabilidad, responsividad e interpretabilidad, citados ejemplos de las principales formas de evaluación de esas propiedades. Método: estudio teórico basado en la literatura internacional y nacional y en los instrumentos Consensus-based Standards for the selection of health Measurement Instruments y Evaluating the Measurement of Patient-Reported Outcomes que contemplan conceptos de evaluación de instrumentos para la evaluación de los resultados de los pacientes. Resultados: en este enfoque, se puede percibir que todavía hay divergencias en algunas descripciones conceptuales. Sin embargo, los autores resaltan la importancia de la confiabilidad para evaluar el instrumento de medida. Se destaca la importancia del conocimiento del Modelo Conceptual, de las propiedades de medidas y de los diferentes métodos de evaluación para garantizar, principalmente en estudio de validación de instrumentos, resultados confiables y válidos. Conclusiones : se concluye que la discusión presentada sobre la confiabilidad, responsividad e interpretabilidad contribuye a los profesionales de la salud en el conocimiento teórico y sentido crítico en la elección de instrumentos y en la conducción de análisis sobre esas propiedades de medida.
2010-10-01
... 42 Public Health 5 2010-10-01 2010-10-01 false Settlement. 1003.126 Section 1003.126 Public Health OFFICE OF INSPECTOR GENERAL-HEALTH CARE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OIG AUTHORITIES CIVIL MONEY PENALTIES, ASSESSMENTS AND EXCLUSIONS § 1003.126 Settlement. The Inspector General has exclusive...
Energy Technology Data Exchange (ETDEWEB)
Park, Mi-Hyeong; Park, Won Sun; Jo, Su-Hyun, E-mail: suhyunjo@kangwon.ac.kr
2012-07-01
Polychlorinated biphenyls (PCBs) have been known as serious persistent organic pollutants (POPs), causing developmental delays and motor dysfunction. We have investigated the effects of two PCB congeners, 3,3′,4,4′-tetrachlorobiphenyl (PCB 77) and 3,3′,4,4′,5-pentachlorobiphenyl (PCB 126) on ECG, action potential, and the rapidly activating delayed rectifier K{sup +} current (I{sub Kr}) of guinea pigs' hearts, and hERG K{sup +} current expressed in Xenopus oocytes. PCB 126 shortened the corrected QT interval (QTc) of ECG and decreased the action potential duration at 90% (APD{sub 90}), and 50% of repolarization (APD{sub 50}) (P < 0.05) without changing the action potential duration at 20% (APD{sub 20}). PCB 77 decreased APD{sub 20} (P < 0.05) without affecting QTc, APD{sub 90}, and APD{sub 50}. The PCB 126 increased the I{sub Kr} in guinea-pig ventricular myocytes held at 36 °C and hERG K{sup +} current amplitude at the end of the voltage steps in voltage-dependent mode (P < 0.05); however, PCB 77 did not change the hERG K{sup +} current amplitude. The PCB 77 increased the diastolic Ca{sup 2+} and decreased Ca{sup 2+} transient amplitude (P < 0.05), however PCB 126 did not change. The results suggest that PCB 126 shortened the QTc and decreased the APD{sub 90} possibly by increasing I{sub Kr}, while PCB 77 decreased the APD{sub 20} possibly by other modulation related with intracellular Ca{sup 2+}. The present data indicate that the environmental toxicants, PCBs, can acutely affect cardiac electrophysiology including ECG, action potential, intracellular Ca{sup 2+}, and channel activity, resulting in toxic effects on the cardiac function in view of the possible accumulation of the PCBs in human body. -- Highlights: ► PCBs are known as serious environmental pollutants and developmental disruptors. ► PCB 126 shortened QT interval of ECG and action potential duration. ► PCB 126 increased human ether-a-go-go-related K{sup +} current and I{sub Kr}.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes. 126.130 Section 126.130 Shipping COAST GUARD... § 126.130 Cranes. (a) Except as provided by paragraph (b) of this section, cranes, if installed, must... chapter. (b) The manufacturer of a crane may have tests and inspections conducted in compliance with § 107...
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Pumps. 157.126 Section 157.126... Washing (COW) System on Tank Vessels Design, Equipment, and Installation § 157.126 Pumps. (a) Crude oil must be supplied to the COW machines by COW system pumps or cargo pumps. (b) The pumps under paragraph...
High Power Narrow Linewidth 1.26 Micron Ho-Doped Fiber Amplifier, Phase I
National Aeronautics and Space Administration — This proposal is for the development of an innovative, high power, and extremely reliable 1.26-micron Ho-doped fluoride fiber amplifier. The proposed fiber amplifier...
5 CFR 1201.126 - Final decisions.
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Final decisions. 1201.126 Section 1201.126 Administrative Personnel MERIT SYSTEMS PROTECTION BOARD ORGANIZATION AND PROCEDURES PRACTICES AND PROCEDURES Procedures for Original Jurisdiction Cases Special Counsel Disciplinary Actions § 1201.126 Final...
32 CFR 643.126 - Transportation licenses.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Transportation licenses. 643.126 Section 643.126... ESTATE Additional Authority of Commanders § 643.126 Transportation licenses. Installation commanders are... free competitive proposals of all available companies or individuals. (b) DD Form 694 (Transportation...
18 CFR 284.126 - Reporting requirements.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Reporting requirements. 284.126 Section 284.126 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... AUTHORITIES Certain Transportation by Intrastate Pipelines § 284.126 Reporting requirements. (a) Notice of...
Lifescience Database Archive (English)
Full Text Available AH (Link to library) AHB126 (Link to dictyBase) - - - Contig-U16336-1 AHB126P (Link... to Original site) AHB126F 598 AHB126Z 500 AHB126P 1078 - - Show AHB126 Library AH (Link to library) Clone ID AHB126 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...RGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT...KKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT
Verdad absoluta desde el libro del Éxodo: el nombre divino
Directory of Open Access Journals (Sweden)
Andrés Ferrada Moreira
2008-01-01
Full Text Available Este artículo pretende iluminar el significado del nombre divino 'ehyé 'aser 'ehyé (Seré el que seré; Ex 3, 14, para ejemplarizar en qué sentido el libro del Éxodo (y tal vez el grueso del Antiguo Testamento afirma algunas verdades con pretensión de absoluto. Para el lector de nuestros tiempos, Seré el que seré resulta problemático, no solo por su formulación enigmática, cuyo sentido no entiende a cabalidad; sino también porque culturalmente pierden valor, cada vez con mayor fuerza, las proposiciones que se postulan como absolutas. La interpretación existencial del nombre de Dios, que se propone, resuelve el enigma: Seré el que seré designa el compromiso divino injustificado de su presencia a favor de su pueblo. El sentido absoluto de esta afirmación coincide con el de otras importantes afirmaciones teológicas del libro del Éxodo: no pretenden anular la esfera histórica de la existencia, particularmente la libertad humana y su contingencia, sino al contrario muestran su valor y le aportan su fundamento de origen, sentido y dirección.The author of thiis article intends to provide insight into the meaning of the divine ñame 'ehyé 'áser 'ehyé (I will be whom will be; Ex 3,14, in order to exemplify in what sense the book of Exodus (and, perhaps, the greater part of the Oíd Testament affirms certain truths with the intention of absoluteness. For the reader of our own times, I will be whom I will be turns out to be problematic, not only for its enigmatic formation, whose meaning is not fully captured, but also because, culturally, the propositions formulated as absolutes lose in an ever greater degree their valué. The existential interpretation of the ñame of God, which the author proposes, resolves the enigma: I will be whom will be designates the unjustified divine commitment of His presence in favor of His people. The absolute sense of this affirmation coincides with that of other important theological affirmations of
22 CFR 126.13 - Required information.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Required information. 126.13 Section 126.13... PROVISIONS § 126.13 Required information. (a) All applications for licenses (DSP-5, DSP-61, DSP-73, and DSP... are multiple consignors, consignees or freight forwarders, and all the required information cannot be...
A Medida socioeducativa de internação
Meggiato, Jaqueline da Rosa
2011-01-01
Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Sócio-Econômico, Programa de Pós-Graduação em Serviço Social, Florianópolis, 2011 O presente trabalho teve como preocupação central, investigar as diferentes correntes teóricas sobre o Direito da Criança e do Adolescente caracterizando-se, assim, como pesquisa de caráter teórico. A partir dessa investigação buscou-se entender os fundamentos que influenciam os magistrados em suas decisões pela medida socioeducativa de i...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Exceptions. 126.3 Section 126.3 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS GENERAL POLICIES AND PROVISIONS... of the United States Government, the Director, Office of Defense Trade Controls may make an exception...
Directory of Open Access Journals (Sweden)
Elsa Gilardón
2001-03-01
Full Text Available Os tricomas glandulares presentes nas folhas e ramos das plantas do gênero Lycopersicon são responsáveis pela secreção de metabólitos de diferentes naturezas. A presença de alguns desses compostos tem sido associada à resistência do tomate a diferentes insetos. A traça-do-tomateiro, Tuta absoluta (Meyrick, é uma das pragas mais nocivas da América do Sul. O adulto oviposita sobre as folhas do tomate e suas larvas abrem galerias no mesófilo das folhas, ramos, flores e frutos. As espécies silvestres do tomate conservam a capacidade de biossintetizar compostos químicos que lhes conferem resistência a esta praga. No presente trabalho, foi avaliada a preferência para oviposição desse inseto sobre folhas com e sem tricomas glandulares de L. esculentum (Mill. cv. Uco Plata, suscetível, e de L. hirsutum f. glabratum (Mull. PI 134417, espécie silvestre afim ao tomate, e resistente à traça. Os resultados sugerem que as fêmeas ovipositam indistintamente sobre as folhas de ambas espécies, independentemente da presença, ou não, dos tricomas glandulares. E a presença destes e de seus exsudatos não têm efeito inibidor na oviposição do inseto.In the genus Lycopersicon, different metabolites are secreted by the glandular trichomes of leaves and stems. These compounds have been associated to different tomato pests resistance. The South American tomato pinworm, Tuta absoluta (Meyrick, is one of the most harmful pests in South America. The females oviposit on tomato leaves and the larvae mine the leaf mesophyl, stems, flowers and fruits. Some wild accessions of Lycopersicon keep their capacity to synthesize allelochemicals that protect them from the pest. In this paper a comparison was made between the tomato pinworm oviposition on leaves with and without trichomes of L. esculentum (Mill. cv. Uco Plata, a susceptible cultivar, and L. hirsutum f. glabratum (Mull. PI 134417, a resistant wild accession. Results suggest that the female
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Administration. 12.6 Section 12.6 Agriculture Office....6 Administration. (a) General. A determination of ineligibility for benefits in accordance with the... making such determinations, as provided in this section. (b) Administration by FSA. (1) The provisions of...
Directory of Open Access Journals (Sweden)
Vanderlei Freitas Junior
2015-09-01
Full Text Available O presente trabalho se propõe analisar as publicações internacionais acerca do emprego das ontologias no contexto de medidas de desempenho. Para isso, foi realizada uma pesquisa bibliométrica em três bases de dados internacionais: Web of Science, Scopus e IEEE. Essa pesquisa foi desenvolvida em duas grandes etapas: (i busca sistemática da literatura, e (ii análise e síntese das informações bibliométricas. Foram localizados 115 trabalhos, escritos por 362 autores vinculados a 84 instituições de 101 países diferentes e estão publicados em 38 periódicos. Os autores identificaram ainda 981 palavras-chave diferentes em seus estudos. Os estudos, de maneira geral, evidenciam a possibilidade de utilização das ontologias como ferramenta semântica em diversas etapas e momentos do processo de medidas de desempenho, especialmente no que tange à representação do conhecimento e elu-cidação dos indicadores chaves, permitindo a interoperabilidade destes indicadores. A partir da identificação destes estudos o presente trabalho contribui para a compreensão das possibilidades de aplicação das ontologias para o suporte aos pro-cessos de medida de desempenho, realizando o mapeamento das publicações inter-nacionais desta temática e evidenciando a possibilidade de representação do conhecimento envolvido nesta tarefa.
International Nuclear Information System (INIS)
Li, L.-A.; Wang, P.-W.; Chang, Louis W.
2004-01-01
To understand the effects of polychlorinated biphenyls (PCBs) on adrenal aldosterone biosynthesis, we have performed a systematical study to characterize the corresponding steroidogenic response of human adrenocortical cell line H295R to PCB126 exposure. We found that PCB126 at high concentrations stimulated basal and inducible aldosterone production. The aldosterone induction occurred concomitantly with activation of the CYP11B2 gene. Despite the fact that PCB126 acted in synergy with both potassium and angiotensin II (Ang II) in activation of aldosterone synthesis, PCB126 only modestly increased CYP11B2 mRNA expression in the presence of Ang II contrary to the synergistic transcriptional induction elicited by PCB126 and potassium. This implicated that PCB126 had differential interactions with the potassium and Ang II signaling systems in the regulation of aldosterone biosynthesis. In addition, high concentrations of PCB126 elevated transcriptional expression of the type I Ang II receptor (AT 1 ) and might thus sensitize the cellular Ang II responsiveness in both basal and inducible aldosterone biosynthesis. SF-1 was not involved in the PCB126-induced transcriptional regulation despite its importance in steroidogenic gene activation
22 CFR 126.12 - Continuation in force.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Continuation in force. 126.12 Section 126.12... PROVISIONS § 126.12 Continuation in force. All determinations, authorizations, licenses, approvals of... previous provisions of this subchapter, continue in full force and effect until or unless modified, revoked...
Sistema ultra-sonico para medida volumetrica
Isaias Ferreira da Silva
1999-01-01
Resumo: Um método inovador para a medida do volume de um líquido dentro de um recipiente fechado é proposto. A motivação deste trabalho é a aplicação do método para a medida do volume de combustível dentro de um tanque de automóvel. Este método se baseia no fenômeno de reverberação sonora que relaciona o tempo de decaimento da intensidade do som dentro de um ambiente com o seu volume. Este tempo, conhecido como tempo de reverberação, está associado ao volume vazio dentro do recipiente, ao mat...
7 CFR 1710.126 - Federal debt delinquency.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Federal debt delinquency. 1710.126 Section 1710.126... and Basic Policies § 1710.126 Federal debt delinquency. (a) Prior to approval of a loan or advance of... reasons for the delinquency must be explained, and RUS will take such explanation into consideration in...
Estudio de medidas y proyectos de movilidad ambiental en el entorno europeo
Moya González, Luis
2011-01-01
Índice Introducción Tablas resumen de medidas ambientales sobre movilidad Medidas específicas para ciudades históricas Mejora del transporte públicoGestión de automóvilesVehículos compartidosInnovación en vehículos y carburantesTransporte de mercancíasBicicletasPeatonesGestión: demanda, incentivos, etcOtras medidasMedidas coordinadas y planes integrales Experiencias europeasLa situación en EspañaProgramas y proyectos subvencionados Programas de la Unión EuropeaProyectos internacionales no vin...
MEDIDA SOCIOEDUCATIVA DE INTERNAÇÃO: ESTRATÉGIA PUNITIVA OU PROTETIVA?
Directory of Open Access Journals (Sweden)
Andrea Cristina Coelho Scisleski
2015-12-01
Full Text Available ResumoEste artigo problematiza como os jovens em conflito com a lei são administrados nas medidas socioeducativas de internação e busca a discussão das diferenças entre as formas de atender aqueles que recebem medidas de proteção e aqueles que recebem medidas socioeducativas. No que concerne à gestão, encontra-se uma separação na administração das medidas de proteção e das medidas socioeducativas em meio aberto, geridas pela Assistência Social, e as medidas socioeducativas de internação, geridas pela Segurança Pública. A pesquisa se desenvolveu pelo método cartográfico, que abrangeu entrevistas realizadas com profissionais do sistema socioeducativo, visitas às unidades de internação, leitura de processos jurídicos e oitivas de audiências na Vara da Infância e da Juventude. Conclui-se que a proteção integral preconizada pelo ECA não atinge todos, como é o caso dos adolescentes em conflito com a lei que estão internados, tendo seus direitos violados em prol da manutenção da segurança da população.
Normatização de medidas acústicas da voz normal
Directory of Open Access Journals (Sweden)
Araújo Simone Adad
2002-01-01
Full Text Available Introdução: A análise acústica da voz com o avanço da tecnologia digital surge como um exame complementar promissor para aumentar a precisão diagnóstica em laringologia. Objetivo: Normatização das medidas acústicas de freqüência fundamental, perturbação e ruído na voz normal de brasileiros dos sexos masculino e feminino. Forma de estudo: Clínico prospectivo. Material e Método: Pesquisa no período de março a agosto de 1997, no Ambulatório de Otorrinolaringologia do Hospital das Clínicas da Faculdade de Medicina de Ribeirão Preto da Universidade de São Paulo, com 80 voluntários da cidade de Ribeirão Preto e região, sendo 40 do sexo masculino e 40 do feminino, selecionados por meio de triagem, foram realizadas gravações digitais dos fonemas /a/, /e/ e /i/, originando uma amostra de 240 sinais acústicos submetidos ao Programa de Análise Acústica da Voz, desenvolvido na Escola de Engenharia de São Carlos da Universidade de São Paulo com obtenção das medidas acústicas. Resultados: Foram obtidos valores médios em relação a sexo e fonemas das medidas de: Freqüência fundamental, Jitter (Directional Perturbation Factor, Perturbation Variation Index, Jitter Ratio, Jitter Factor, Period Perturbation Quotient, Shimmer (Directional Perturbation Factor, Amplitude Variation Index, Amplitude Perturbation Quotient, Spectral Noise Level, Harmonic-to-noise ratio, Harmonic-to-noise ratio cepstrum, Normalized Noise Energy e Breathiness ratio. Conclusão: A normatização das medidas acústicas é necessária para conhecer melhor a voz normal. Os valores obtidos são compatíveis em sua grande maioria com à literatura existente.
1975-05-01
memory registers A through G ( 2048 bit shift registers) for each of the basic altitude bands (1+26, 113 1+6) to store intruder responses. Since the 1...af EV 11z iIIV~ ~l126;~; NADlC-75056-60_ _ _- 2 w< -I- LI- ~jw 0IU oo2 W I aJ W %L6fI9126;~;AVdI tVOV~ aN9Ao ccH % VdI I11813iA-di V GN Ed a3IV0 %AIII1IilV11W...tei mix ;;; c le z - Is’ %126;~~~~~~~~~;;s AJIiV1 VdI ~ %AIIV~ v~iO VIR 1ý 123 Lz NADC-7056-6 w, M w o ~2IV ONY Ed CIRNIGVNOO at p 00 CLt % 118I3iAVldSIC3
29 CFR 570.126 - Parental exemption.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Parental exemption. 570.126 Section 570.126 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS CHILD LABOR REGULATIONS, ORDERS AND STATEMENTS OF INTERPRETATION General Statements of Interpretation of the Child Labor...
Análisis de las Fuerzas Absolutas y las Circunferencias de Volumen Durante el Período Preparatorio.
Directory of Open Access Journals (Sweden)
Francisco Freyre Vázquez
2003-01-01
Full Text Available Se aborda la relación de dependencia entre los resultados de las fuerzas absolutas de los planos musculares brazo, tronco y pierna, en correspondencia con las circunferencias máximas de volumen de los miembros superiores e inferiores durante la preparación de fuerza a que fueron sometidos los atletas de baloncesto de la categoría juvenil durante el periodo preparatorio. De esta forma estaríamos hablando de la estrecha relación que existe en cuanto a esta variable, repercutiendo en los resultados a alcanzar por el equipo durante el proceso de entrenamiento.
Diagnóstico de policitemia absoluta como posible causa de episodios convulsivos en un perro
Directory of Open Access Journals (Sweden)
Sandra Acevedo T.
2010-12-01
Full Text Available Se expone el caso de un perro poodle de 3 años de edad, el cual hace un año comenzó a convulsionar esporádicamente, principalmente después de hacer ejercicio y en algunas ocasiones presentó temblor generalizado. Al examen clínico realizado se observó mucosas orales y oculares hiperémicas. Al realizar los exámenes paraclínicos complementarios se encontró en hemogramas seriados un aumento marcado del hematocrito y la hemoglobina con niveles de proteínas plasmáticas en rangos normales, y una eritropoyectina 10 veces por debajo del rango normal. Se realizó ecografía abdominal y evaluación cardiaca. El diagnóstico fue de policitemia absoluta como la causa de las convulsiones.
Una medida de inflación subyacente exclusion-based para el Perú
Hauer, Erik Sebastián
2015-01-01
Hay poco consenso en la literatura sobre el diseño y evaluación de medidas de inflación subyacente. Estudios previos han mostrado que las medidas más técnicas de influencia limitada tienen mejor rendimiento empírico. Sin embargo, es deseado que las medidas de inflación subyacente sean lo más transparentes y replicables posibles, lo cual usualmente resulta en medidas más simples “exclusion-based”. A este respecto, se utiliza una nueva metodología de extracción de señal a la inflación para enco...
Directory of Open Access Journals (Sweden)
Yang Liu
2014-06-01
Full Text Available Recent studies suggested an association of endothelial microRNA-126 (miR-126 with type 2 diabetes mellitus (T2DM. In the current study, we examined whether circulating miR-126 is associated with T2DM and pre-diabetic syndrome. The study included 82 subjects with impaired glucose tolerance (IGT, 75 subjects with impaired fasting glucose (IFG, 160 patients with newly diagnosed T2DM, and 138 healthy individuals. Quantitative polymerase chain reaction (qPCR was used to examine serum miR-126. Serum miR-126 was significantly lower in IGT/IFG subjects and T2DM patients than in healthy controls (p < 0.05. After six months of treatment (diet control and exercise in IGT/IFG subjects, insulin plus diet control and exercise in T2DM patients, serum miR-126 increased significantly (p < 0.05. An analysis based on serum miR-126 in the sample revealed a significantly higher odds ratio (OR for the subjects with the lowest 1/3 of serum miR-126 for T2DM (OR: 3.500, 95% confidence interval: 1.901–6.445, p < 0.05 than subjects within the highest 1/3 of serum miR-126. Such an association was still apparent after adjusting for other major risk factors. The area under the curve (AUC for the receiver-operating characteristic (ROC analysis was 0.792 (95% confidence interval: 0.707–0.877, p < 0.001. These results encourage the use of serum miR-126 as a biomarker for pre-diabetes and diabetes mellitus, as well as therapeutic response.
Liu, Yang; Gao, Guangqiang; Yang, Chun; Zhou, Kun; Shen, Baozhong; Liang, Hongyan; Jiang, Xiaofeng
2014-06-12
Recent studies suggested an association of endothelial microRNA-126 (miR-126) with type 2 diabetes mellitus (T2DM). In the current study, we examined whether circulating miR-126 is associated with T2DM and pre-diabetic syndrome. The study included 82 subjects with impaired glucose tolerance (IGT), 75 subjects with impaired fasting glucose (IFG), 160 patients with newly diagnosed T2DM, and 138 healthy individuals. Quantitative polymerase chain reaction (qPCR) was used to examine serum miR-126. Serum miR-126 was significantly lower in IGT/IFG subjects and T2DM patients than in healthy controls (pdiet control and exercise in IGT/IFG subjects, insulin plus diet control and exercise in T2DM patients), serum miR-126 increased significantly (pdiabetes and diabetes mellitus, as well as therapeutic response.
desarrollo y validación de un instrumento de medida
Directory of Open Access Journals (Sweden)
Arménio Rego
2005-01-01
Full Text Available El artículo describe cómo un instrumento de medida de la Inteligencia Emocional fue construido y validado. Cuatro etapas fueron seguidas: 1 Fueron escritos 96 ítems con base en la literatura y en trabajo propio de los autores; 2 Fue elaborado un cuestionario y aplicado a una muestra de 339 individuos; 3 Se procedió a un análisis factorial de las componentes principales; 4 Se relacionaron los factores emergentes con una medida de satisfacción con la vida. Los resultados sugirieron una solución factorial de seis componentes. Las consistencias internas de las escalas son invariablemente superiores a 0.70. Las seis dimensiones explican el 29% de la varianza de la medida de satisfacción con la vida
Energy Technology Data Exchange (ETDEWEB)
Podolyak, Zs.; Steer, S.J.; Pietri, S.; Regan, P.H.; Brandau, C.; Catford, W.N.; Cullen, I.J.; Gelletly, W.; Jones, G.A.; Liu, Z.; Walker, P.M. [University of Surrey, Department of Physics, Guildford (United Kingdom); Gorska, M.; Gerl, J.; Wollersheim, H.J.; Grawe, H.; Becker, F.; Geissel, H.; Kelic, A.; Kojouharov, I.; Kurz, N.; Montes, F.; Prokopowicz, W.; Saito, T.; Schaffner, H.; Tashenov, S.; Werner-Malento, E. [GSI, Darmstadt (Germany); Rudolph, D.; Hoischen, R. [Lund University, Department of Physics, Lund (Sweden); Garnsworthy, A.B. [University of Surrey, Department of Physics, Guildford (United Kingdom); Yale University, WNSL, New Haven, CT (United States); Maier, K.H. [Institute of Nuclear Physics, Krakow (Poland); University of the West of Scotland, Dept. of Physics, Paisley (United Kingdom); Bednarczyk, P.; Grebosz, J. [GSI, Darmstadt (Germany); Institute of Nuclear Physics, Krakow (Poland); Caceres, L. [GSI, Darmstadt (Germany); Universidad Autonoma de Madrid, Dept. de Fisica Teorica, Madrid (Spain); Doornenbal, P. [GSI, Darmstadt (Germany); Universitaet zu Koeln, IKP, Koeln (Germany); Heinz, A. [Yale University, WNSL, New Haven, CT (United States); Kurtukian-Nieto, T. [Universidad de Santiago de Compostela, Santiago de Campostela (Spain); Benzoni, G.; Wieland, O. [Universita degli Studi di Milano (Italy); INFN, Milano (Italy); Pfuetzner, M. [Warsaw University, IEP, Warsaw (Poland); Jungclaus, A. [Universidad Autonoma de Madrid, Dept. de Fisica Teorica, Madrid (Spain); Balabanski, D.L. [Bulgarian Academy of Sciences, INRNE, Sofia (Bulgaria); Brown, B.A. [Univ. of Surrey, Dept. of Physics, Guildford (United Kingdom); Michigan State Univ., NSCL, East Lansing, MI (United States); Bruce, A.M.; Lalkovski, S. [Univ. of Brighton, School of Environment and Technology, Brighton (United Kingdom); Dombradi, Zs. [Institute for Nuclear Research, Debrecen (Hungary); Estevez, M.E. [Instituto de Fisica Corpuscular, Valencia (Spain)] [and others
2009-12-15
Heavy neutron-rich nuclei have been populated through the relativistic fragmentation of a {sup 208}{sub 82} Pb beam at E/A = 1 GeV on a 2.5 g/cm{sup 2} thick Be target. The synthesised nuclei were selected and identified in-flight using the fragment separator at GSI. Approximately 300 ns after production, the selected nuclei were implanted in an {proportional_to}8 mm thick perspex stopper, positioned at the centre of the RISING {gamma} -ray detector spectrometer array. A previously unreported isomer with a half-life T{sub 1/2} = 163(5) ns has been observed in the N=126 closed-shell nucleus {sup 205}{sub 79} Au. Through {gamma}-ray singles and {gamma}-{gamma} coincidence analysis a level scheme was established. The comparison with a shell model calculation tentatively identifies the spin-parity of the excited states, including the isomer itself, which is found to be I{sup {pi}} = (19/2{sup +}). (orig.)
22 CFR 126.9 - Advisory opinions and related authorizations.
2010-04-01
.... 126.9 Section 126.9 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS GENERAL POLICIES AND PROVISIONS § 126.9 Advisory opinions and related authorizations. (a) Advisory opinion. Any person desiring information as to whether the Directorate of Defense Trade Controls would be...
7 CFR 959.126 - Handling of culls.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Handling of culls. 959.126 Section 959.126 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements...) Handled for canning or freezing. (b) As a safeguard against culls entering fresh market channels each...
9 CFR 354.126 - Carcasses held for further examination.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Carcasses held for further examination. 354.126 Section 354.126 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF... Inspection § 354.126 Carcasses held for further examination. Each carcass, including all parts thereof, in...
Pensamiento constructivo como medida de inteligencia emocional en patología dual
Albalat Alcaraz, Caridad; Fernández Ros, Encarnación; López García, Juan José
2014-01-01
Introducción: El objetivo de este estudio es comparar el pensamiento constructivo, una medida de inteligencia emocional, entre una muestra clínica de pacientes adultos diagnosticados de patología dual y una muestra no clínica. Método: Mediante un diseño de investigación comparativo, una muestra no clínica de 835 sujetos se comparó con una muestra de 180 sujetos diagnosticados de patología dual: 78 con trastornos clínicos o del Eje I y102 con trastornos de la personalidad o del ...
Ahmed, R G; El-Gareib, A W; Shaker, H M
2018-01-01
Exposure to polychlorinated biphenyls (PCBs) is related to several endocrine disorders. This study examined the effect of maternal exposure of 3,3',4,4',5-pentachlorobiphenyl (PCB 126) on the fetoplacental unit and fetal thyroid-cytokine axis during the pregnancy. Pregnant albino rats received PCB 126 (20 or 40μg/kgb.wt.) by oral gavage from gestation day (GD) 1 to 20. Potential effects of PCB 126 were evaluated by following the histopathological changes in the placenta by Haematoxylin and Eosin (H&E) stain and measuring the maternofetal thyroid axis (ELIZA), maternofetal body weight, and fetal growth markers (ELIZA), and cytokines (ELIZA) at embryonic day (ED) 20. Placental tissues of both treated groups showed hyperemia, hemorrhage, degeneration and apoptosis in labyrinth layer and spiral artery at GD 20. Both administrations of PCB 126 elevated serum thyrotropin (TSH) concentration, and decreased free thyroxine (FT4) and free triiodothyronine (FT3) concentrations, resulting in a maternofetal hypothyroidism. The presence of hypothyroidism increased fetal serum concentration of transforming growth factor-β (TGF-β), leptin (LEP), tumor necrosis factor-α (TNF-α), interleukin-1β (IL-1β), and decreased the fetal serum insulin growth factor-I (IGF-I), IGF-II, insulin, adiponectin (ADP), and growth hormone (GH) in both treated groups at ED 20. However, the increase in resistin (RETN) and interferon-γ (IFN-γ) was non-significant in low-dose group and highly significant in high-dose group. Simultaneously, the reduction in body weight of the dams and fetuses was observed in both PCB 126 groups of examined day with respect to the control group. The maternal PCB 126 distorted the fetoplacental unit might disrupt the fetal thyroid-cytokines axis and prenatal development. Copyright © 2017 Elsevier Inc. All rights reserved.
29 CFR 794.126 - Computations for a new business.
2010-07-01
... million test of the exemption. In other cases, where doubt exists, the gross receipts of the new business... 29 Labor 3 2010-07-01 2010-07-01 false Computations for a new business. 794.126 Section 794.126... of Sales § 794.126 Computations for a new business. When a new business is commenced the employer...
Medidas antidumping: instrumento del neoproteccionismo
Fernando Gutiérrez Solsona
1994-01-01
El objetivo fundamental de este trabajo se puede expresar fácilmente: demostrar que las medidas antidumping, que hoy en día son tan utilizadas por la Unión Europea (U.E.) y por los Estados Unidos (EE. UU.), tienen exclusivamente un fin proteccionista. Proteccionismo entendido en el sentido económico, esto es proteger a los sectores nacionales frente a la competencia extranjera, porque los primeros son menos eficientes que los segundos.
13 CFR 126.701 - Can these subcontracting percentages requirements change?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Can these subcontracting percentages requirements change? 126.701 Section 126.701 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION HUBZONE PROGRAM Contract Performance Requirements § 126.701 Can these subcontracting percentages...
7 CFR 1.26 - Representation before the Department of Agriculture.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Representation before the Department of Agriculture. 1.26 Section 1.26 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Departmental Proceedings § 1.26 Representation before the Department of Agriculture. (a) Applicability. This...
40 CFR 89.126 - Denial, revocation of certificate of conformity.
2010-07-01
... conformity. 89.126 Section 89.126 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Standards and Certification Provisions § 89.126 Denial, revocation of certificate of conformity. (a) If... issued certificate of conformity if the Administrator finds any one of the following infractions to be...
38 CFR 4.126 - Evaluation of disability from mental disorders.
2010-07-01
... from mental disorders. 4.126 Section 4.126 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS SCHEDULE FOR RATING DISABILITIES Disability Ratings Mental Disorders § 4.126 Evaluation of disability from mental disorders. (a) When evaluating a mental disorder, the rating agency shall consider the...
Ionic mechanisms of action of prion protein fragment PrP(106-126) in rat basal forebrain neurons.
Alier, Kwai; Li, Zongming; Mactavish, David; Westaway, David; Jhamandas, Jack H
2010-08-01
Prion diseases are neurodegenerative disorders that are characterized by the presence of the misfolded prion protein (PrP). Neurotoxicity in these diseases may result from prion-induced modulation of ion channel function, changes in neuronal excitability, and consequent disruption of cellular homeostasis. We therefore examined PrP effects on a suite of potassium (K(+)) conductances that govern excitability of basal forebrain neurons. Our study examined the effects of a PrP fragment [PrP(106-126), 50 nM] on rat neurons using the patch clamp technique. In this paradigm, PrP(106-126) peptide, but not the "scrambled" sequence of PrP(106-126), evoked a reduction of whole-cell outward currents in a voltage range between -30 and +30 mV. Reduction of whole-cell outward currents was significantly attenuated in Ca(2+)-free external media and also in the presence of iberiotoxin, a blocker of calcium-activated potassium conductance. PrP(106-126) application also evoked a depression of the delayed rectifier (I(K)) and transient outward (I(A)) potassium currents. By using single cell RT-PCR, we identified the presence of two neuronal chemical phenotypes, GABAergic and cholinergic, in cells from which we recorded. Furthermore, cholinergic and GABAergic neurons were shown to express K(v)4.2 channels. Our data establish that the central region of PrP, defined by the PrP(106-126) peptide used at nanomolar concentrations, induces a reduction of specific K(+) channel conductances in basal forebrain neurons. These findings suggest novel links between PrP signalling partners inferred from genetic experiments, K(+) channels, and PrP-mediated neurotoxicity.
12 CFR 225.126 - Activities not closely related to banking.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Activities not closely related to banking. 225.126 Section 225.126 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE... Financial Holding Companies Interpretations § 225.126 Activities not closely related to banking. Pursuant to...
Medidas automatizadas de psicrômetro de termopar aspirado versus não aspirado
Directory of Open Access Journals (Sweden)
Antonio Ribeiro da Cunha
2014-06-01
Full Text Available O termopar ou par termoelétrico é utilizado na obtenção da temperatura do ar com ótima precisão, sensibilidade e com grande vantagem sobre o termômetro de mercúrio ou álcool, pois geram sinais elétricos que podem ser armazenados em sistemas automatizados. No entanto, quando se trata da obtenção da umidade relativa a partir de termopar, o processo se torna mais cauteloso devido a outros fatores envolvidos. Neste estudo, avaliaram-se dois conjuntos psicrômetros de termopar, aspirado e não aspirado, em relação a um conjunto Vaisala, no período de 17 a 31/01/2008 (15 dias. A partir de medidas de temperaturas de bulbos seco e úmido foram obtidas medidas da umidade relativa, e com isso, foi possível compará-las com as medidas obtidas pelo conjunto Vaisala. Os dois tipos de psicrômetros apresentaram precisão e exatidão nas medidas de temperatura do ar, e apenas precisão nas medidas de umidade relativa do ar, sendo que o psicrômetro aspirado foi o mais preciso. Apesar do psicrômetro não aspirado ter apresentado menor precisão nas medidas, ele é mais robusto porque independe do micro-ventilador de 12 VDC, o que faz dele um sensor com menos riscos de medidas inadequadas. Ambos os psicrômetros, aspirado e não aspirado, não medem com exatidão a umidade relativa do ar no período noturno.
Transmutation of 126Sn in spallation targets of accelerator-driven systems
International Nuclear Information System (INIS)
Han, Chi Young; Saito, Masaki; Sagara, Hiroshi
2009-01-01
The practical feasibility of 126 Sn transmutation in spallation targets of accelerator-driven systems was evaluated from the viewpoints of accumulation of radioactive spallation products and neutron production as well as transmutation amount of 126 Sn. A cylindrical liquid 126 Sn target whose length depends on proton beam energy was described, based on a Pb-Bi target design of accelerator-driven system being developed in JAEA. A proton beam of 1.5 GeV-20 mA was estimated to give the transmutation rate of 126 Sn 6.4 kg/yr, which corresponds to the amount of 126 Sn annually discharged in 27 LWRs of 1 GWt and 33 GWd/THM. The equilibrium radioactivity of spallation products would reach 9% of that of 126 Sn transmuted in the spallation target, and the equilibrium toxicity would be just 3%. Some parametric analyses showed that the effective half-life of 126 Sn could be reduced through a proper reduction of the target size. The 126 Sn target was calculated to produce 40 neutrons per proton of 1.5 GeV and give a neutron spectrum very similar to that of the reference Pb-Bi target. As a result, the transmutation of 126 Sn in the spallation target has a high feasibility in terms of better transmutation performance and comparable target performance. (author)
Resonancia magnética cardiaca: medidas lineales y volumétricas en adultos sanos
Heredia Sánchez, Fabian Mauricio; Cabezas, Andrés Mauricio
2015-01-01
Introducción: La gran mayoría de las medidas de normalidad utilizadas para la interpretación de resonancia cardiaca son extrapoladas de las medidas de ecocardiografía. Los limitados registros de medidas de normalidad se encuentran ajustados en poblaciones extranjeras, no hay registros en latinoamericanos. Objetivo: Determinar las dimensiones cardiacas utilizando resonancia magnética en una población de personas sin antecedente médicos con repercusión cardiaca para lograr una muestra de val...
Medidas de la felicidad nacional bruta
R. Veenhoven (Ruut)
2009-01-01
textabstractResumen. La felicidad está abriéndose hueco en la agenda política, lo cual reclama medir el éxito alcanzado por los distintos países en crear felicidad para un gran número de personas, de un modo análogo a las medidas del éxito en la creación de riqueza, como el PNB. La felicidad se
A Universal Aptamer Chimera for the Delivery of Functional microRNA-126.
Rohde, Jan-H; Weigand, Julia E; Suess, Beatrix; Dimmeler, Stefanie
2015-06-01
microRNAs (miRs) regulate vascular diseases such as atherosclerosis and cancer. miR-126 is important for endothelial cell signaling and promotes angiogenesis, protects against atherosclerosis, and reduces breast cancer cell growth and metastasis. The overexpression of miR-126, therefore, may be an attractive therapeutic strategy for the treatment of cardiovascular disease or cancer. Here we report a novel strategy to deliver miR-126 to endothelial and breast cancer cells. We tested three different strategies to deliver miR-126 by linking the miR to an aptamer for the ubiquitously expressed transferrin receptor (transferrin receptor aptamer, TRA). Linking the precursor of miR-126 (pre-miR-126) to the TRA by annealing of a complementary stick led to efficient uptake and processing of miR-126, resulting in the delivery of 1.6×10(6)±0.3×10(6) copies miR-126-3p per ng RNA in human endothelial cells and 7.4×10(5)±2×10(5) copies miR-126-3p per ng in MCF7 breast cancer cells. The functionality of the active TRA-miR-126 chimera was further demonstrated by showing that the chimera represses the known miR-126 target VCAM-1 and improved endothelial cell sprouting in a spheroid assay. Moreover, the TRA-miR-126 chimera reduced proliferation and paracrine endothelial cell recruitment of breast cancer cells to a similar extent as miR-126-3p mimics introduced by conventional liposome-based transfection. Together, this data demonstrates that pre-miR-126 can be delivered by a non-specific aptamer to exert biological functions in two different cell models. The use of the TRA-miR-126 chimera or the combination of the delivery strategy with other endothelial or tumor specific aptamers may provide an interesting therapeutic option to treat vascular disease or cancers.
Acetylcholinesterase triggers the aggregation of PrP 106-126
International Nuclear Information System (INIS)
Pera, M.; Roman, S.; Ratia, M.; Camps, P.; Munoz-Torrero, D.; Colombo, L.; Manzoni, C.; Salmona, M.; Badia, A.; Clos, M.V.
2006-01-01
Acetylcholinesterase (AChE), a senile plaque component, promotes amyloid-β-protein (Aβ) fibril formation in vitro. The presence of prion protein (PrP) in Alzheimer's disease (AD) senile plaques prompted us to assess if AChE could trigger the PrP peptides aggregation as well. Consequently, the efficacy of AChE on the PrP peptide spanning-residues 106-126 aggregation containing a coumarin fluorescence probe (coumarin-PrP 106-126) was studied. Kinetics of coumarin-PrP 106-126 aggregation showed a significant increase of maximum size of aggregates (MSA), which was dependent on AChE concentration. AChE-PrP 106-126 aggregates showed the tinctorial and optical amyloid properties as determined by polarized light and electronic microscopy analysis. A remarkable inhibition of MSA was obtained with propidium iodide, suggesting that AChE triggers PrP 106-126 and Aβ aggregation through a similar mechanism. Huprines (AChE inhibitors) also significantly decreased MSA induced by AChE as well, unveiling the potential interest for some AChE inhibitors as a novel class of potential anti-prion drugs
Directory of Open Access Journals (Sweden)
Daniela de Abreu Barra
2008-03-01
Full Text Available OBJETIVO: comparar a reprodutibilidade intra- e interobservador da medida da espessura total do segmento uterino inferior (SUI, por via abdominal, e da medida da camada muscular, por via vaginal, usando ultra-sonografia bi- e tridimensional. MÉTODOS: foi estudada a medida da espessura do SUI de 30 gestantes com cesárea anterior, entre a 36ª e a 39ª semanas, por dois observadores. Foi efetuada abordagem ultra-sonográfica abdominal com a paciente em posição supina e vaginal em posição de litotomia. No corte sagital, foi identificado SUI e foram coletadas quatro imagens bidimensionais e dois blocos tridimensionais da espessura total por via abdominal e o mesmo da camada muscular por via vaginal. As aquisições tridimensionais foram manipuladas no modo multiplanar. O tempo foi cronometrado. A reprodutibilidade foi avaliada pelo cálculo da diferença absoluta entre todas as medidas, proporção de diferenças menores que 1 mm, coeficiente de correlação intraclasse (ICC e limites de concordância de Bland e Altman. RESULTADOS: a medida da espessura média do SUI por via abdominal bidimensional foi de 7,4 mm e, por via vaginal, de 2,7 mm; a tridimensional foi 6,9 mm abdominal e 5,1 mm vaginal. Reprodutibilidade intra- e interobservador da via vaginal versus abdominal: menor diferença absoluta (0,2-0,4 versus 0,8-1,5 mm, maior proporção de diferenças (85,8-97,8 versus 48,7-72,8% com p0,05 e menores limites de concordância (-3,8 a 3,4 versus -3,6 a 4 mm para ultra-sonografia tridimensional e ICC semelhantes (0,6-0,9 versus 0,7-0,9. CONCLUSÕES: do exposto, concluímos que a medida da espessura da camada muscular do SUI por via vaginal utilizando a ultra-sonogafia tridimensional é mais reprodutível. Nossos resultados, porém, não indicam que essa medida tenha implicação clínica para predição de rotura uterina, que não foi objeto deste estudo. O único trabalho que correlacionou a espessura do SUI com risco de rotura uterina, sem
Reprodutibilidade do teste de caminhada e do degrau de 6 minutos em adultos jovens saudáveis
Directory of Open Access Journals (Sweden)
Simone Fernandes Davi
2014-06-01
Full Text Available INTRODUÇÃO: Os testes caminhada de seis minutos (TC6 e degrau de seis minutos (TD6 são meios de avaliação da capacidade funcional. No entanto, pouco se sabe sobre sua reprodutibilidade em adultos jovens. OBJETIVO: Avaliar a reprodutibilidade relativa e absoluta tanto intra quanto inter-avaliadores do TC6 e TD6 em indivíduos adultos jovens. MÉTODOS: Foram avaliados 33 indivíduos adultos jovens aparentemente saudáveis por meio da espirometria; e realizados os testes TC6 e TD6. Três (T1, T2 e T3 TC6 e TD6 foram feitos em cada indivíduo, sendo o último de cada teste realizado por um avaliador diferente. Para a análise intra-avaliadores foram comparados os desempenhos do T1 e T2 enquanto que a análise inter-avaliadores foi feita pela comparação dos desempenhos do T3 com: T1; T2; e escolha do melhor dos primeiros dois testes. Foi calculado o coeficiente de correlação intra-classe (CCI como medida da reprodutibilidade relativa; o erro padrão de medida; a diferença mínima detectável; traçados gráficos de Bland-Altman e teste ANOVA para analisar a reprodutibilidade absoluta. RESULTADOS: Observaram-se, nos dois testes funcionais, intra e inter-avaliadores, valores excelentes de reprodutibilidade relativa (CCI>0,75 e a reprodutibilidade absoluta mostrou alto erro. CONCLUSÃO: O TD6 e o TC6 apresentaram reprodutibilidade intra e inter-avaliadores excelente para a população adulto jovem, mas altos valores de erro.
Medida de espessura de filmes finos com interferometro de haidinger
Elisabeth Andreoli de Oliveira
1987-01-01
Resumo: Apresentamos um método não destrutivo para medida de espessura de filmes finos transparentes depositados em substratos transparentes, usando um interferômetro de Haidinger. A partir das frações de interferência, medidas para vários comprimentos de onda, e do índice de refração para um único comprimento de onda, determinamos a espessura do filme e sua dispersão cromática, através de um procedimento analítico-numérico Abstract: We introduce a non-destructive method for the thickness ...
Directory of Open Access Journals (Sweden)
Elsa Gilardón
2001-07-01
Full Text Available O metabólito secundário 2-tridecanona, secretado pelos tricomas glandulares tipo VI das folhas de tomateiro silvestre, Lycopersicon hirsutum L., confere-lhe resistência a uma grande variedade de insetos, inclusive a traça-do-tomateiro, Tuta absoluta (Meyrick. O objetivo do trabalho foi avaliar a concentração de 2- tridecanona, a densidade de tricomas glandulares tipo VI e o grau de infestação da traça-do-tomateiro na cultivar suscetível 'Uco Plata' (Lycopersicon esculentum Mill., na linhagem resistente PI 134417 (L. hirsutum f. glabratum e em suas progênies F1 e F2. Foram avaliadas ainda as possíveis associações entre a concentração de 2-tridecanona, a densidade de tricomas glandulares tipo VI e o grau de infestação da traça-do-tomateiro. O grau médio de infestação da traça-do-tomateiro em 'Uco Plata' foi significativamente superior ao obtido em PI 134417. Ainda que a concentração de 2-tridecanona tenha sido significativamente superior no parental resistente, a presença deste metabólito somente explicaria parcialmente a resistência (R² = 8,17%. Não se detectaram diferenças significativas na densidade de tricomas tipo VI entre o parental suscetível e o resistente. Este comportamento ocorreu independentemente do conteúdo de 2-tridecanona e do grau de infestação da traça-do-tomateiro.The secondary metabolite 2-tridecanone, secreted by the type VI glandular trichomes present in the leaves of Lycopersicon hirsutum L., make it resistant to a great variety of insects, including the tomato pinworm, Tuta absoluta (Meyrick. The 2-tridecanone concentration, the type VI glandular trichome densities and the pinworm infestation degree were evaluated on the Lycopersicon esculentum Mill. susceptible cultivar 'Uco Plata', on the Lycopersicon hirsutum f. glabratum resistant accession PI 134417 and on their F1 and F2. The mean infestation degree with pinworm larvae was significantly higher in 'Uco Plata' than in PI 134417. The 2
Medidas tipográficas: un recuento
Directory of Open Access Journals (Sweden)
Oriol Moret Viñals
2015-07-01
Full Text Available Breve repaso al desarrollo de la concepción métrica en la tipografía en plomo, alternativa y complemento de la visión habitual en lo que conocemos como “tipometría”. Se parte de una noción amplia de medida: el factor cuantitativo se dilata con la articulación de relaciones proporcionales e integra la dimensión cualitativa de los sistemas métricos tradicionales. La tipografía se considera bajo presupuestos similares: como sistema articulado de piezas materiales cuyas magnitudes contienen usos y valores específicos, más allá de su simple expresión numérica. Con tales premisas, se revisan fuentes documentales significativas del “período de la imprenta manual”. Su examen, vinculado a los usos y costumbres de oficio, desvela la distinta aproximación métrica, que puede resumirse en tres fases evolutivas: hermética, intensiva, expansiva –como recogen las referencias de los cuerpos tipográficos: adjetivas, sustantivas, numéricas. Se proporciona así un marco para apreciar el cambio de sentido en las medidas tipográficas hasta nuestros días.
17 CFR 1.26 - Deposit of instruments purchased with customer funds.
2010-04-01
... purchased with customer funds. 1.26 Section 1.26 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION GENERAL REGULATIONS UNDER THE COMMODITY EXCHANGE ACT Customers' Money, Securities, and Property § 1.26 Deposit of instruments purchased with customer funds. (a) Each futures commission merchant...
22 CFR 126.2 - Temporary suspension or modification of this subchapter.
2010-04-01
... subchapter. 126.2 Section 126.2 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS GENERAL POLICIES AND PROVISIONS § 126.2 Temporary suspension or modification of this subchapter. The Deputy Assistant Secretary for Defense Trade Controls or the Managing Director, Directorate of...
13 CFR 126.204 - May a qualified HUBZone SBC have affiliates?
2010-01-01
... affiliates? 126.204 Section 126.204 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION HUBZONE PROGRAM Requirements to be a Qualified HUBZone SBC § 126.204 May a qualified HUBZone SBC have affiliates? A concern may have affiliates provided that the aggregate size of the concern and all of its...
Adolescente em conflito com a lei e medidas socioeducativas: limites e (impossibilidades
Directory of Open Access Journals (Sweden)
Francischini, Rosângela
2005-01-01
Full Text Available Reinserção social, readaptação, ajustamento social, integração à família e sociedade. Várias são as expressões empregadas para referir-se ao efeito desejado do trabalho com o jovem em conflito com a lei, em cumprimento de medidas socioeducativas, particularmente em privação de liberdade. Parte do aparato legal do Estado, a partir da promulgação do Estatuto da Criança e do Adolescente, significaram, essas medidas, uma chamada à responsabilização do jovens, em face da transgressão cometida. No entanto, avalia-se, o que dá a essas medidas o caráter socioeducativo, fazendo com que o trabalho desenvolvido nas instituições diferencie-se do cumprimento de pena? Estrutura física, formação de recursos humanos, ações educativas e trabalho transdiciplinar são alguns dos aspectos implicados nesta questão. Neste contexto de discussão insere-se o presente artigo, que tem por objetivo discutir o caráter socioeducativo das medidas de privação de liberdade e as possibilidades de reinserção social do jovem em conflito com a lei
Hacia una definición de la medida
Parot, Jean Jacques
2012-01-01
Hacia una definición de la medida A. Primera situación Un granjero va al mercado para vender a) Una gallina (20 pesos) b) Un bulto de naranjas (45 pesos) c) Un pate (38 pesos) d) Una docena de huevos (12 pesos)
El trabajo en Smith: valor o medida del valor?
Directory of Open Access Journals (Sweden)
Adolfo Rodríguez Herrera
2016-12-01
Este artículo revisa los conceptos desarrollados por Smith para formular su teoría del valor (valor, precio real y valor de cambio. Nuestra interpretación de sus textos sobre el valor no coincide con la que tradicionalmente se ha hecho. De acuerdo con nuestra interpretación, no sería correcta la crítica de Ricardo y Marx a la posición de Smith sobre el papel del trabajo como medida de valor. Para estos autores, Smith no es consistente al proponer que el valor de una mercancía es definido o medido como la cantidad de trabajo necesaria para producirla y simultáneamente como la cantidad de trabajo que puede ser comprada por esta mercancía. Tratamos de demostrar que para Smith el trabajo tiene un doble papel –como fuente y como medida del valor–, y que a ello se debe la confusión generada por su uso de algunos términos: Smith propone el trabajo como una medida de valor porque lo concibe como una fuente de valor. Con esta interpretación queda claro, paradójicamente, que la teoría del valor trabajo de Smith corresponde sustancialmente con la que más tarde desarrollarán Ricardo y Marx.
On the absolute measure of Beta activities; Sobre la medida absoluta de actividades Beta
Energy Technology Data Exchange (ETDEWEB)
Sanchez del Rio, C; Jimenez Reynaldo, O; Rodriguez Mayquez, E
1956-07-01
A new method for absolute beta counting of solid samples is given. The measurements is made with an inside Geiger-Muller tube of new construction. The backscattering correction when using an infinite thick mounting is discussed and results for different materials given. (Author)
LAS MEDIDAS PREVENTIVAS AMBIENTALES, UNA APROXIMACIÓN DESDE EL DERECHO ADMINISTRATIVO.
Directory of Open Access Journals (Sweden)
Iván Andrés Páez Páez
2013-05-01
Full Text Available Las medidas preventivas previstas en el régimen sancionatorio ambiental sonuna especie de las medidas cautelares consagradas en el ordenamiento jurídicocolombiano, aunque con algunas particularidades propias de su ámbito deaplicación, que es el derecho ambiental. El artículo realiza una aproximaciónrespecto al contenido, alcance, antecedentes y justificación de las medidaspreventivas ambientales desde la óptica del derecho administrativo y comomanifestación de una de las funciones del ejecutivo, cual es el mantenimientodel orden público.
Directory of Open Access Journals (Sweden)
Gabriel M Maciel
2011-06-01
Full Text Available O trabalho foi realizado com o objetivo de avaliar o potencial agronômico de híbridos de tomateiro a partir da linhagem TOM-687, rica em acilaçúcares e de resistência comprovada a pragas. O experimento foi instalado na HortiAgro, município de Ijaci, MG. Foi constituído de 30 genótipos (5 híbridos comerciais, 1 linhagem pré-comercial (TOM-687, e 24 híbridos nos quais TOM-687 foi utilizada como um dos pais, os quais foram conduzidos em tutoramento com haste dupla, no espaçamento de 1,30 x 0,50 m, totalizando 15.385 plantas por hectare. Foram realizadas nove colheitas, entre as datas de 01/11/08 a 28/11/08. Foram avaliadas as características de massa média por fruto (g fruto-1 e produção por hectare (t ha-1. Os 24 híbridos que tiveram TOM-687 como um dos pais apresentaram potencial produtivo similar ao das testemunhas comerciais Débora Max, Bravo, Bônus, Kombat e Atyna. Dos 24 híbridos experimentais, quatro (TEX-298, TEX-310, TEX-315 e TEX-316 foram avaliados quanto à resistência à traça-do-tomateiro (Tuta absoluta e mostraram-se mais resistentes do que as testemunhas comerciais.This experiment was designed to assess the agronomic potential of tomato hybrids obtained from the tomato line TOM-687, an acylsugar-rich line with confirmed resistance to an array of tomato pests. The experiment was carried out at the HortiAgro Sementes research station, in Ijaci, Minas Gerais State, Brazil. The treatments comprised 30 genotypes (5 commercial hybrid checks, 1 high acylsugar line (TOM-687, and 24 hybrids in which TOM-687 was one of the parents. Plants were trained to two stems, in a spacing of 1.30 m between rows x 0.50 m between plants within a row, totaling 15,385 plants per hectare. Nine harvests were performed between November 1st, 2008 and November 28th,2008. Traits assessed were mean fruit weight (g fruit-1 and total yield (t ha-1. All 24 hybrids with TOM-687 as a parent showed yields similar to those of the commercial check
29 CFR 780.126 - Contract arrangements for raising poultry.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Contract arrangements for raising poultry. 780.126 Section... General Scope of Agriculture Raising of Livestock, Bees, Fur-Bearing Animals, Or Poultry § 780.126 Contract arrangements for raising poultry. Feed dealers and processors sometimes enter into contractual...
The development of 126Sn separation procedure by means of TBP resin
International Nuclear Information System (INIS)
Andris, Boris; Bena, Jozef
2016-01-01
Separation possibilities of 126 Sn with a new extraction-chromatographic material TBP Resin were studied. Suitable conditions for tin separation were determined in hydrochloric acid medium. 126 Sn was concentrated on TBP resin from 6 mol L -1 HCl and was eluted with 0.1 mol L -1 HCl. A purification step to remove 137 Cs with AMP-PAN column was necessary to obtain sufficiently purified samples which were directly measured with gamma spectrometry for 126 Sn activity. Separation of 126 Sn from a raw sludge sample was done according to proposed procedure, 126 Sn was detected and its activity was determined. (author)
Directory of Open Access Journals (Sweden)
Masoud Khanaghaei
2016-04-01
Full Text Available BackgroundThe aim of this study was to assess plasma levels of endothelium- and heart-associated microRNAs (miRNAs miR-126 and miR-499, respectively, using quantitative reverse transcriptase polymerase chain reaction.MethodsA two-step analysis was conducted on 75 patients undergoing off-pomp coronary artery bypass graft (CABG surgery. Five biomarkers of inflammation and cardiac injury were assessed in addition to the above-mentioned miRNAs.ResultsPlasma concentrations of miRNAs were found to be significantly correlated with plasma levels of cardiac troponin I (cTnI (miR-499, r 0.49, p~0.002; miR-126, r = 0.30, p~0.001, indicating cardiac damage. Data analysis revealed that miR-499 had higher sensitivity and specificity for cardiac injury than miR-126, which reflects more endothelial activation. Interestingly, a strong correlation was observed between both miRNAs and uric acid (UA levels with ventricular contractility measured as ejection fraction (EF (miR-499/EF%, r = 0.58, p~0.004; UA/EF%, r = -0.6, p~0.006; UA/miR-499, r = -0.34; UA/miR-126, r = 0.5, p~0.01.ConclusionsIn patients undergoing CABG, circulating miR-126/499 is associated with presentation of traditional risk factors and reflects post-operative response to injury. Plasma pool of miRNAs likely reflects extracellular miRNAs which are proportional to intracellular miRNA levels. Therefore, circulating levels of these miRNAs have prognostic implications in detection of higher risk of future cardiovascular events.
Violência Juvenil e Medidas Socioeducativas: Revisão de Literatura
Directory of Open Access Journals (Sweden)
Jacqueline de Oliveira Moreira
2017-10-01
Full Text Available RESUMO Neste artigo, partindo do objetivo de compreender a relação entre violência juvenil e a resposta do Estado através das medidas socioeducativas, buscamos explicitar o pano de fundo das pesquisas científicas atuais. Realizamos uma meta-análise dos artigos publicados sobre adolescência e medidas socioeducativas, no campo da psicologia, entre os anos de 2000 e 2012. Concluímos que essa produção nacional pode ser reunida em três grandes categorias: (a prático-experiencial, que apresenta relatos analíticos da prática na aplicação das medidas socioeducativas, privilegiando a experiência concreta; (b político-institucional, que discute criticamente a dimensão política da lógica socioeducativa, detendo-se na análise estrutural de sua legislação e de suas instituições; (c sociocultural, que analisa os determinantes sociais e psíquicos do fenômeno da violência juvenil.
Medidas cautelares innominadas en la protección de los derechos de autor y conexos en Colombia
Directory of Open Access Journals (Sweden)
Nixon Jefrey Gil Aguirre
2016-12-01
Full Text Available Actualmente, el ejercicio de funciones jurisdiccionales atribuidas a las autoridades administrativas ha generado interpretaciones judiciales confusas, en la aplicación de medidas cautelares innominadas para la protección de derechos de autor y conexos en Colombia; así lo evidencia el análisis realizado a las medidas cautelares descritas en la Ley 1493 del año 2011, que otorgó competencias de inspección, vigilancia y control sobre las sociedades de gestión colectiva de derechos de autor y conexos; en este sentido se requiere describir las funciones jurisdiccionales de la Dirección Nacional de Derecho de Autor respecto a las medidas cautelares y su importancia en la protección de los derechos de autor y conexos, al igual que analizar las medidas cautelares innominadas desde su origen, las características y lo propuesto por la Corte Constitucional en materia de funciones jurisdiccionales de la Dirección Nacional de Derecho de Autor y respecto de la procedencia de las medidas cautelares innominadas como competencia de esta entidad. Se concluye que las medidas cautelares nominadas no son suficientes, y que se hace necesario acudir a las medidas cautelares innominadas, como herramienta jurídica del funcionario administrativo, sin que ello implique arbitrariedad y prejuzgamiento en el proceso.
Les coalicions polítiques a Catalunya. El cas del govern catalanista i d’esquerres
Ridao, Joan,
2007-01-01
El fenomen coalicional ha anat guanyant centralitat arreu a mesura que s’ha assumit que els governs d’aquest signe no tenen per què ser febles i inestables. A Catalunya, que en aquest capítol se situa dins la més absoluta normalitat europea, aquest tipus d’aliances han esdevingut moneda corrent. Manejant l’utillatge propi de les teories multidimensionals, el present treball identifica els factors que han influït en la formació del denominat govern catalanista i d’esquerres (2003-2006), examin...
27 CFR 24.126 - Change in proprietorship involving a bonded wine warehouse.
2010-04-01
... involving a bonded wine warehouse. 24.126 Section 24.126 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Establishment and Operations Changes Subsequent to Original Establishment § 24.126 Change in proprietorship involving a bonded wine warehouse...
Directory of Open Access Journals (Sweden)
Gregorio Martínez-Sánchez
2009-04-01
Full Text Available Se reporta un caso del sexo masculino, de 72 años de edad con antecedentes de hipertensión arterial (con un período de evolución de 5 años que fue remitido en el 2001 a la Consulta de Hematología por presentar cifras elevadas de hemoglobina (Hb y hematócrito (Hto. Las cifras elevadas de Hb y Hto se detectaron durante un chequeo médico como resultado de que el paciente presentara pérdida de conocimiento y fuera hospitalizado. El paciente se remitió al Instituto de Hematología e Inmunología (Ciudad de La Habana para realizarle un estudio de volemia y ferrocinética, el cual mostró que presentaba policitemia absoluta moderada. Se descartó policitemia vera y se buscaron causas de policitemia absoluta secundaria sin que hayan encontrado ninguna hasta el presente. Desde este momento el paciente se ha seguido en la Consulta de Hematología del Hospital General Docente Ernesto Che Guevara (Las Tunas y cada 6 meses es chequeado en el Instituto de Hematología e Inmunología, Ciudad de La Habana. A partir del mes de abril de 2004 el paciente recibió 600 mg de Vimang® (extracto de Mangifera indica L. y se incrementó 2 meses después a 900 mg en 3 dosis separadas de 300 mg (tabletas diariamente. El presente estudio analizó la historia clínica del paciente y los resultados de todos los estudios que se le practicaron en los años precedentes al tratamiento con Vimang® y los observados durante el año que estaba bajo tratamiento. Como resultado se observó una reducción en un 50 % del número de flebotomías necesarias para mantener el paciente bajo control con respecto a los valores de Hto y Hb. Se encontraron además diferencias significativas (p < 0,05 con respecto a las desviaciones estándar de los indicadores Hto y Hb, que fueron menores en el periodo en que el paciente fue tratado con el extracto natural.
Medidas morfofuncionais do coração obtidas por ressonância magnética em brasileiros
Directory of Open Access Journals (Sweden)
Robson Macedo
2013-07-01
Full Text Available FUNDAMENTO: Medidas ainda hoje utilizadas como referência na ressonância magnética cardíaca foram obtidas principalmente de estudos realizados em populações norte-americanas e europeias. OBJETIVO: Obter medidas do diâmetro diastólico, diâmetro sistólico, volume diastólico final, volume sistólico final, fração de ejeção e massa miocárdica dos ventrículos esquerdo e direito em brasileiros. MÉTODOS: Foram submetidos à ressonância magnética cardíaca, utilizando técnica de precessão livre em estado de equilíbrio, 54 homens e 53 mulheres, com idade média de 43,4 ± 13,1 anos, assintomáticos, sem cardiopatias. RESULTADOS: As médias e os desvios padrão dos parâmetros do ventrículo esquerdo foram: diâmetro diastólico = 4,8 ± 0,5 cm; diâmetro sistólico = 3,0 ± 0,6 cm; volume diastólico final = 128,4 ± 29,6 mL; volume sistólico final = 45,2 ± 16,6 mL; fração de ejeção = 65,5 ± 6,3%; massa = 95,2 ± 30,8 g. Para o ventrículo direito, foram: diâmetro diastólico = 3,9 ± 1,3 cm; diâmetro sistólico = 2,5 ± 0,5 cm; volume diastólico final = 126,5 ± 30,7 mL; volume sistólico final = 53,6 ± 18,4 mL; fração de ejeção = 58,3 ± 8,0% e massa = 26,1 ± 6,1 g. As massas e os volumes foram significativamente maiores nos homens, exceto para o volume sistólico final do ventrículo esquerdo. A fração de ejeção do ventrículo direito foi significativamente maior nas mulheres. Houve correlação significativa e inversa do volume sistólico do volume direito com o aumento da idade. CONCLUSÃO: Este estudo descreveu, pela primeira vez, medidas cardíacas obtidas pela ressonância magnética cardíaca em brasileiros assintomáticos, sem cardiopatias, mostrando diferenças de acordo com o gênero e a idade.
Una medida de eficiencia de mercado. Un enfoque de teoría de la información
Directory of Open Access Journals (Sweden)
Reyna Susana García Ruiz
2014-01-01
Full Text Available En este trabajo, con base en el concepto de entropía de Shan-non, se propone una medida de eficiencia de mercado que uti-liza la función de densidad empírica de los rendimientos comoalfabeto para calcular la entropía del sistema y proveer con ellouna medida de eficiencia de mercado. Se demuestra que bajociertas condiciones de ergodicidad y de estacionariedad la en-tropía muestral converge a la entropía del estado dominante,lo que valida el uso de la entropía muestral como medida deeficiencia del sistema. Asimismo, se demuestra que la medidapropuesta es consistente con algunos de los axiomas de Artz-neret al.(1999 acerca de una medida coherente de riesgo. Porúltimo, con fines ilustrativos, se llevan a cabo varias aplicacio-nes de la medida de eficiencia propuesta a distintos mercadosde capitales: DJIA, S&P500, FTSE100 e IPC.
Ato infracional e medida socioeducativa: representações de adolescentes em L.A.
Directory of Open Access Journals (Sweden)
Bianca Izoton Coelho
2013-01-01
Full Text Available A pesquisa analisou as representações sociais de ato infracional e medida socioeducativa em adolescentes em conflito com a lei. Utilizou-se, como aporte teórico e metodológico, a Teoria das Representações Sociais. Participaram da pesquisa quarenta e seis adolescentes que cumpriam, há mais de três meses, a medida de Liberdade Assistida. Os dados foram coletados, por meio de entrevistas, com um roteiro semiestruturado e consistiram na técnica das evocações livres por meio dos termos ato infracional e medida socioeducativa. Utilizou-se o software EVOC para análise das evocações emitidas. Os resultados apontaram como caracterização socioeconômica dos adolescentes: renda familiar baixa, baixo nível de escolaridade, local de residência precário, etnias afro-descendentes predominantes e distanciamento da religião. As representações sociais de ato infracional relacionaram-se aos tipos de atos infracionais e às suas causas e consequências. As representações sociais de medida socioeducativa relacionaram-se a ações positivas em que, além da aprendizagem, houve a possibilidade de mudança.
40 CFR Appendix C to Part 97 - Final Section 126 Rule: Trading Budget
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Final Section 126 Rule: Trading Budget... PROGRAMS (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS Pt. 97, App. C Appendix C to Part 97—Final Section 126 Rule: Trading Budget ST F126-EGU F126-NEGU Total DC 207 26...
Data Presentation Report, Army Spill Sites, South Plants Manufacturing Complex. Version 3.2. Phase I
1988-09-01
h .00I SO .4 60 Oa - Opo UP~g . 75 - A A a 4j 22 U- 4 21. . + A3 82a 4h1 cC 4 ja.340 A a.3 4a a2 a In w al .i.2 +. .2 + aa acca .ar.ac A .3 .4 .2 -0...it .61 0a -: t Cý L LX L - 4" f7 -- C: ~ 126;~; ~ ~ ~ < , , : EI t. 0 : D c =l o~c Q0 oc c z c z ;c C c c c Z -0 -0 411 LIL Z z L4 t L I 4... F7 % tq.-- -- ...- .. 2-86 14~1 126;~;(26’. - - ~-1 2- [I5]2[5 (4)1a2.] . (40) 220.4D.126;~; 2 I29 1551 .... ...... I4 PI A I65. 115 5 13 [ I 7 464 9r 0551T35
Rojas, Lizbeth; Flores, Marlene; Berríos, Marlyn; Briceño, Indira
2013-01-01
La presente investigación consistió en un estudio no experimental de campo, con diseño descriptivo y de corte transversal correlacional. El objetivo fue relacionar el nivel de conocimiento sobre medidas de bioseguridad y su aplicación por el personal médico y de enfermería del Ambulatorio Urbano Tipo I del Estado Mérida. La población estuvo conformada por el personal médico (26) y de enfermería (22). Se diseñó un instrumento Ad Hoc que recogió información sobre datos generales, ri...
Nodo sensor para la medida ambiental de CO2, temperatura y humedad
Jara Burgos, Marcos
2007-01-01
En este documento se describe el diseño y la implementación de un nodo sen-sor para la medida ambiental del nivel de CO2, la temperatura y la humedad relativa. El sistema se basa en un interfaz directo sensor a microcontrolador para las medidas de temperatura y humedad relativa, mientras que para el sensor de CO2 se basa en una conversión analógica digital. El sistema utiliza un sensor resistivo para medir la temperatura, un sensor capacitivo para medir la humedad relativa y un sensor...
Medidas preventivas, correctoras y compensatorias del impacto ecológico de carreteras
Aizpurúa Giráldez, Nerea
2011-01-01
Las medidas preventivas, correctoras y compensatorias empleadas en los proyectos de carretera son uno de los elementos clave para conseguir la integración ambiental de estas infraestructuras. De ellas dependerá que los posibles impactos ambientales generados durante su construcción y explotación no supongan un detrimento inadmisible de la calidad ambiental. La tipología de medidas que se vienen aplicando desde hace más de veinte años en durante el proceso de Evaluación de Impacto Ambiental (E...
2010-07-01
... ACCIDENT PREVENTION PROVISIONS Regulated Substances for Accidental Release Prevention § 68.126 Exclusion. Flammable Substances Used as Fuel or Held for Sale as Fuel at Retail Facilities. A flammable substance... substance is used as a fuel or held for sale as a fuel at a retail facility. [65 FR 13250, Mar. 13, 2000] ...
13 CFR 126.801 - How does one file a HUBZone status protest?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false How does one file a HUBZone status protest? 126.801 Section 126.801 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION HUBZONE PROGRAM Protests § 126.801 How does one file a HUBZone status protest? (a) General. The protest procedures...
Medidas de administración pesquera.
2014-01-01
En el Titulo II de la Ley General de Pesca y Acuicultura "De la Administración de las Pesquerías", específicamente en facultades de conservación de los recursos hidrobiológicos, se establece lo siguiente: En cada área de pesca, independiente del régimen de acceso a que se encuentre sometida, el Ministerio, mediante decreto supremo fundado, podrá establecer una o más prohibiciones o medidas de administración de recursos hidrobiológicos. Esta presentación que proporciona información refere...
Medidas de pobreza: un enfoque alternativo
Lazzari, Luisa L; Fernández, María José
2006-01-01
Una medida creíble de pobreza e indigencia puede ser un poderoso instrumento para concentrar la atención del policymaker en las condiciones de vida de los pobres. Las opciones elegidas para fijarlas tienen gran importancia para las decisiones políticas a tomar. El método indirecto o enfoque del ingreso parte de la valorización de una Canasta Básica Alimentaria (CBA) que determina la cantidad de calorías mínimas necesarias para satisfacer las necesidades biológicas básicas de...
Belmonte Serrato, Francisco; Romero Díaz, María Asunción
2006-01-01
En este trabajo se presenta un método de medida directa de la Evapotranspiración Real (ETR) bajo distintas coberturas vegetales, basado en las diferencias de humedad en el suelo medidas mediante el procedimiento TDR, en un intervalo temporal de 15 días y su comparación con los valores calculados mediante el método de Thornthwaite, que usa la temperatura media como parámetro fundamental. Los resultados demuestran la validez del método utilizado, habiendo obtenido valores de E...
Medidas directas e indirectas de las funciones ejecutivas en niños con trastorno de espectro autista
Directory of Open Access Journals (Sweden)
María Fernanda Pérez Pichardo
2018-01-01
Full Text Available INTRODUCCIÓN: los niños con trastorno del espectro autista (TEA tienen dificultades en las funciones ejecutivas (FE pero se han sugerido discrepancias entre las medidas directas e indirectas. OBJETIVO: conocer si existen diferencias en las funciones ejecutivas mediante medidas directas e indirectas entre niños con y sin TEA. MÉTODO: se incluyeron 14 varones entre primero y tercero de primaria, 50% con diagnóstico de TEA y 50% con desarrollo neurotípico, seleccionados por emparejamiento en edad y grado escolar. El promedio de edad de la muestra fue de 7.43 (DE 0.98 años. Se aplicaron las pruebas de Evaluación neuropsicológica de funciones ejecutivas en niños (ENFEN y el Inventario de clasificación comportamental de las funciones ejecutivas (BRIEF. RESULTADOS: se encontraron diferencias significativas en las medidas de las FE indirectas, pero no en las directas, entre los grupos (p < 0.05. Así mismo, las correlaciones entre las medidas directas e indirectas fueron mayores en el grupo con TEA. CONCLUSIONES: los niños con TEA son evaluados con más dificultades en las medidas indirectas de las funciones ejecutivas, pero obtienen puntuaciones similares a los niños con desarrollo neurotípico cuando son evaluados en condiciones estructuradas empleando medidas directas.
Methylation of the miR-126 gene associated with glioma progression.
Cui, Hongwei; Mu, Yongping; Yu, Lei; Xi, Ya-guang; Matthiesen, Rune; Su, Xiulan; Sun, Wenjie
2016-04-01
Gliomas are the most common and the most malignant brain tumors, accouting for 45-55% of all intracranial tumors. The incidence of glioma worldwide is about 6-12 per 100,000. Recently, several studies showed that the activation of the oncogenes and the inactivation and/or loss of the tumor suppressor genes, especially for miRNA-21, let-7 and so on, are the most primary molecule event in gliomas. MicroRNAs (miRNAs) are a class of endogenously expressed small noncoding RNAs which are usually 21-23 nucleotides long. miRNAs regulate gene expression and play important roles in a variety of physiological and pathological processes, such as cell proliferation, differentiation and apoptosis. To date, Growing evidence has shown that mi RNAs are frequently dysregulated in human cancers and can act as both tumor suppressors and oncogenes. Along with the discovery of micro RNA, more and more research focusing on its relationship with glioma was carried out to investigate the biological features of glioma and to provide experimental evidence for glioma mechanism. In the present study, we aimed to verify the miRNA-126 down-regulation which showed in the results of glioma tissue miRNAs chip and discuss the miRNA-126 methylation in patients with glioma. A total of 50 samples from patients with glioma and 20 control samples from patients with cerebral trauma were included in this study. The expression levels of the miR-126 gene were detected using quantitative polymerase chain reaction (PCR), and the methylation status of miR-126 was examined using methylation-specific PCR-denaturing high-performance liquid chromatography (MSP-DHPLC). The expression level of miRNA-126 was found to be significantly higher in the control group (0.6134 ± 0.1214) than in the glioma group (0.2771 ± 0.1529; P < 0.05). The expression was also significantly elevated in low-grade gliomas (0.3117 ± 0.1474) compared with high-grade gliomas (0.1582 ± 0.1345; P < 0.05). In addition, increased methylation of
Dose-Response of High-Intensity Training (HIT on Atheroprotective miRNA-126 Levels
Directory of Open Access Journals (Sweden)
Boris Schmitz
2017-05-01
Full Text Available Aim: MicroRNA-126 (miR-126 exerts beneficial effects on vascular integrity, angiogenesis, and atherosclerotic plaque stability. The purpose of this investigation was to analyze the dose-response relationship of high-intensity interval training (HIIT on miR-126-3p and -5p levels.Methods: Sixty-one moderately trained individuals (females = 31 [50.8%]; 22.0 ± 1.84 years were consecutively recruited and allocated into three matched groups using exercise capacity. During a 4-week intervention a HIIT group performed three exercise sessions/week of 4 × 30 s at maximum speed (all-out, a progressive HIIT (proHIIT group performed three exercise sessions/week of 4 × 30 s at maximum speed (all-out with one extra session every week (up to 7 × 30 s and a low-intensity training (LIT control group performed three exercise sessions/week for 25 min <75% of maximum heart rate. Exercise miR-126-3p/-5p plasma levels were determined using capillary blood from earlobes.Results: No exercise-induced increase in miR-126 levels was detected at baseline, neither in the LIT (after 25 min low-intensity running nor the HIIT groups (after 4 min of high-intensity running. After the intervention, the LIT group presented an increase in miR-126-3p, while in the HIIT group, miR-126-3p levels were still reduced (all p < 0.05. An increase for both, miR-126-3p and -5p levels (all p < 0.05, pre- vs. during and post-exercise was detected in the proHIIT group. Between group analysis revealed that miR-126-3p levels after LIT and proHIIT increased by 2.12 ± 2.55 and 1.24 ± 2.46 units (all p < 0.01, respectively, compared to HIIT (−1.05 ± 2.6 units.Conclusions: LIT and proHIIT may be performed to increase individual miR-126 levels. HIIT without progression was less effective in increasing miR-126.
Medidas de experiencia e cienciometria para avaliar impacto da producao cientifica
Directory of Open Access Journals (Sweden)
Marco Akerman
2013-08-01
Full Text Available Propõe-se a “experienciometria” como medida da experiência acadêmica de pesquisadores de modo a complementar a medida consagrada da cienciometria nas avaliações de competências em pesquisa. O artigo baseia-se em parte na produção cientifica do autor, utilizada sob uma perspectiva qualitativa para explorar possibilidades de análise de impactos. Ensaia-se uma síntese com possíveis implicações dessa análise, indicando algumas possibilidades para se avaliar impacto de pesquisas e artigos que não se restrinjam exclusivamente à contagem de números de citações dos autores para o cálculo do fator de impacto.
As medidas aplicadas aos acordos SPS e TBT sobre as exportações brasileiras de fumo
Directory of Open Access Journals (Sweden)
Carlos Otávio de Freitas
2015-11-01
Full Text Available O presente estudo tem como objetivo analisar os efeitos das medidas não tarifárias, especificamente as medidas sanitárias e fitossanitárias - SPS e medidas técnicas - TBT, sobre as exportações brasileiras de fumo e se tais efeitos permaneceram nos períodos subsequentes à emissão das notificações. Para tal, foi estimado um modelo gravitacional utilizando uma amostra de 89 países importadores do fumo do Brasil entre o período de 1997 a 2011. O método utilizado na estimação das equações foi o modelo Poisson-Pseudo Maximum Likehood-PPML. Os resultados obtidos mostram que as medidas ou SPS afetaram negativamente o fluxo internacional do comércio de fumo. Além disso, verificou-se que esses efeitos perduraram nos períodos posteriores à emissão da notificação, sendo que as empresas exportadores podem demorar até dois anos para se ajustarem às exigências requeridas. Dentre os objetivos das notificações SPS, a maior parte está relacionada a medidas para proteção da saúde humana e proteção da planta, o que pode explicar a maior dificuldade de adequação, pois são exigências que demandam grandes investimentos. Já as medidas TBT não foram estatisticamente significativas, confirmando o caráter não restritivo dessas notificações sobre o comércio internacional de fumo. Apesar da maior parte das notificações ao fumo estarem associadas a medidas técnicas, os resultados indicaram que elas não configuraram como barreiras ao comércio de fumo. Isso pode sugerir que as exigências a elas referidas, que, em sua grande maioria, foi referente à rotulagem e/ou embalagem, foram atendidas pelo Brasil sem maiores dificuldades. Dessa forma, torna-se importante a inclusão de questões referentes à regulamentação dessas medidas nas discussões e processos de tomada de decisão das empresas exportadoras de fumo. Em termos de ações governamentais, seria interessante a criação ou aperfeiçoamento de políticas no sentido
miR-126 Functions as a Tumor Suppressor in Osteosarcoma by Targeting Sox2
Directory of Open Access Journals (Sweden)
Chenglin Yang
2013-12-01
Full Text Available Osteosarcoma (OS is the most common malignant bone tumor in children and young adults, the early symptoms and signs of which are non-specific. The discovery of microRNAs (miRNAs provides a new avenue for the early diagnosis and treatment of OS. miR-126 has been reported to be highly expressed in vascularized tissues, and is recently widely studied in cancers. Herein, we explored the expression and significance of miR-126 in OS. Using TaqMan RT-PCR analysis, we analyzed the expression of miR-126 in 32 paired OS tumor tissues and 4 OS cell lines and found that miR-126 was consistently under-expressed in OS tissues and cell lines compared with normal bone tissues and normal osteoblast cells (NHOst, respectively. As miR-126 is significantly decreased in OS tissues and cell lines, we sought to compensate for its loss through exogenous transfection into MG-63 cells with a miR-126 mimic. Ectopic expression of miR-126 inhibited cell proliferation, migration and invasion, and induced apoptosis of MG-63 cells. Moreover, bioinformatic prediction suggested that the sex-determining region Y-box 2 (Sox2 is a target gene of miR-126. Using mRNA and protein expression analysis, luciferase assays and rescue assays, we demonstrate that restored expression of Sox2 dampened miR-126-mediated suppression of tumor progression, which suggests the important role of miR-126/Sox2 interaction in tumor progression. Taken together, our data indicate that miR-126 functions as a tumor suppressor in OS, which exerts its activity by suppressing the expression of Sox2.
Ilustração de incertezas em medidas utilizando experimentos de queda livre
Coluci,Vitor R.; Paulino,Guilherme; Souza,Diego C. de; Vasconcelos,Elba P.R.
2013-01-01
O conhecimento da incerteza de uma medida é crucial para obter conclusões a partir de resultados experimentais. Erros aleatórios, comuns em experimentos, produzem uma distribuição dos valores medidos que segue o formato gaussiano. Neste trabalho desenvolvemos uma montagem baseada no fenômeno de queda livre para auxiliar na ilustração do conceito de incerteza em medidas. Os tempos de queda de um objeto foram obtidos automaticamente pela placa Arduino e exibidos na forma de um histograma na tel...
33 CFR 126.30 - What are the conditions for conducting welding and hotwork?
2010-07-01
... conducting welding and hotwork? 126.30 Section 126.30 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... FACILITIES § 126.30 What are the conditions for conducting welding and hotwork? (a) The facility operator must ensure that all welding or hotwork conducted at the facility meets the requirements of this...
African Journals Online (AJOL)
tems, better insight into its structure at molecu- lar level is important and fbis can be accom- plished by determining the, three dimensional structure of soybean glyciniD.. This is important. I since it would provide a solid framework both for understanding its functlon- structure rela- tionships and in formulatin~ strategies for de-.
Fusão INS/GNSS com auxílio de medidas de baseline e ângulo GNSS
Priscylla Angélica da Silva Oliveira
2014-01-01
Este trabalho investiga sistemas de navegação INS/GNSS auxiliado por medidas de baseline e ângulo GNSS. Os dados gerados para as simulações foram os dados IMU, dados GNSS e informações de baseline e ângulo GNSS. Estas informações, determinadas a partir de um sistema multiantenas para o posicionamento simples e relativo e no método direto, respectivamente, foram utilizadas como medidas auxiliares para a fusão INS/GNSS. Foi estudada a influência dessas medidas auxiliares nas estimativas de atit...
La medida de la inteligencia emocional en el ámbito psicoeducativo
Directory of Open Access Journals (Sweden)
Iratxe Antonio-Agirre
2017-01-01
Full Text Available La diversidad individual que alberga la escuela representa un reto ineludible. Para promover el desarrollo integral del alumnado resulta necesario favorecer competencias para la vida, como la inteligencia emocional, que les ayuden a lograr un mejor ajuste sociopersonal y escolar. Sin embargo, la diversidad conceptual en torno a la inteligencia emocional ha contribuido a la proliferación de medidas y ha dificultado la integración de la investigación. En todo caso, atendiendo a las propiedades psicométricas y a las dimensiones que miden, este trabajo recoge los principales instrumentos de medida de la inteligencia emocional que posibilitan una evaluación más rigurosa y exhaustiva del constructo en niños, niñas y adolescentes.
24 CFR 1000.126 - May a recipient charge flat or income-adjusted rents?
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false May a recipient charge flat or income-adjusted rents? 1000.126 Section 1000.126 Housing and Urban Development Regulations Relating to... § 1000.126 May a recipient charge flat or income-adjusted rents? Yes, providing the rental or homebuyer...
Consecuencias de las medidas no arancelarias impuestas a Colombia por Ecuador y Argentina
Perez Giraldo, Johanna Sembelly; Vargas, William
2016-01-01
Con la apertura económica y comercial ha aumentado la negociación de acuerdos comerciales por medio de los cuales los países han logrado tener acceso preferencial libre de aranceles aduaneros. Esta dinámica ha incrementado el uso de medidas no arancelaria como instrumentos para controlar y restringir el acceso a los mercados de los países. Por lo expuesto, esta investigación presenta y analiza las medidas no arancelarias que fueron aplicadas a Colombia por Ecuador y Argentina desde el año 201...
ÇETİN, Gürsel; GÖKSEL, Pınar; DURA, Onur; HANTAŞ, Cemil
2014-01-01
This study was conducted in order to determine spreading, infestation and fruit damage rates and adult population monitoring of Tomato leaf miner, (Tuta absoluta, Meyrick) on open field tomato grown in the South Marmara Region (Bilecik, Bursa, Kocaeli, Sakarya and Yalova provinces) of Turkey in 2011-2012. As result of spreading studies carried out according to systematic sampling method, it was determined that all tomato locations in every province were infested by this pest. Infestation rate...
Número de ínstares larvais de Tuta absoluta (Meyrick em genótipos de tomateiro
Directory of Open Access Journals (Sweden)
Giustolin Teresinha Augusta
2002-01-01
Full Text Available A traça Tuta absoluta (Meyrick é uma das principais pragas do tomateiro no Brasil e tem sido controlada quase que exclusivamente com inseticidas, o que é indesejável tanto por motivos econômicos quanto ambientais. Esses problemas podem ser minimizados com métodos alternativos de controle, tal como a resistência varietal que é uma alternativa interessante, mas que ainda precisa ser mais estudada. Visando obter mais informações sobre a relação inseto-planta, estudou-se o número de instares da traça em dois genótipos de tomateiro Lycopersicon hirsutum f. glabratum (PI 134417 -- resistente e L. esculentum (`Santa Clara' - suscetível. O experimento foi desenvolvido em câmara climatizada em duas temperaturas (26 ± 0,5 e 30 ± 0,5ºC. As lagartas recém-eclodidas foram alimentadas com folhas dos dois genótipos. Diariamente foram retiradas 15 lagartas de cada tratamento para medições da largura da cápsula cefálica. O desenvolvimento do inseto seguiu a regra de Dyar e, em qualquer das situações testadas, apresentou quatro ínstares larvais.
Cocco, Arturo; Serra, Giuseppe; Lentini, Andrea; Deliperi, Salvatore; Delrio, Gavino
2015-09-01
The within- and between-plant distribution of the tomato leafminer, Tuta absoluta (Meyrick), was investigated in order to define action thresholds based on leaf infestation and to propose enumerative and binomial sequential sampling plans for pest management applications in protected crops. The pest spatial distribution was aggregated between plants, and median leaves were the most suitable sample to evaluate the pest density. Action thresholds of 36 and 48%, 43 and 56% and 60 and 73% infested leaves, corresponding to economic thresholds of 1 and 3% damaged fruits, were defined for tomato cultivars with big, medium and small fruits respectively. Green's method was a more suitable enumerative sampling plan as it required a lower sampling effort. Binomial sampling plans needed lower average sample sizes than enumerative plans to make a treatment decision, with probabilities of error of sampling plan required 87 or 343 leaves to estimate the population density in extensive or intensive ecological studies respectively. Binomial plans would be more practical and efficient for control purposes, needing average sample sizes of 17, 20 and 14 leaves to take a pest management decision in order to avoid fruit damage higher than 1% in cultivars with big, medium and small fruits respectively. © 2014 Society of Chemical Industry.
Stol, W.; Griepink, F.C.; Deventer, van P.
2009-01-01
Tuta absoluta es una polilla originaria de Chile cuyas larvas producen minas en las hojas de las plantas de tomate. En las últimas décadas de este insecto se ha extendido por gran parte del continente sudamericano. Después de su primera observación en Europa (España, Valencia) en 2007, esta polilla
27 CFR 28.126 - Proprietor's report.
2010-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Withdrawal of Wine Without Payment of Tax for..., or Transportation to a Manufacturing Bonded Warehouse § 28.126 Proprietor's report. The records of the proprietor of the bonded wine cellar shall reflect the quantity of wine removed without payment of...
miR-126 Regulation of Angiogenesis in Age-Related Macular Degeneration in CNV Mouse Model
Directory of Open Access Journals (Sweden)
Lei Wang
2016-06-01
Full Text Available miR-126 has recently been implicated in modulating angiogenic factors in vascular development. Understandings its biological significance might enable development of therapeutic interventions for diseases like age-related macular degeneration (AMD. We aimed to determine the role of miR-126 in AMD using a laser-induced choroidal neovascularization (CNV mouse model. CNV was induced by laser photocoagulation in C57BL/6 mice. The CNV mice were transfected with scrambled miR or miR-126 mimic. The expression of miR-126, vascular endothelial growth factor-A (VEGF-A, Kinase insert domain receptor (KDR and Sprouty-related EVH1 domain-containing protein 1 (SPRED-1 in ocular tissues were analyzed by qPCR and Western blot. The overexpression effects of miR-126 were also proven on human microvascular endothelial cells (HMECs. miR-126 showed a significant decrease in CNV mice (p < 0.05. Both mRNA and protein levels of VEGF-A, KDR and SPRED-1 were upregulated with CNV; these changes were ameliorated by restoration of miR-126 (p < 0.05. CNV was reduced after miR-126 transfection. Transfection of miR-126 reduced the HMECs 2D-capillary-like tube formation (p < 0.01 and migration (p < 0.01. miR-126 has been shown to be a negative modulator of angiogenesis in the eye. All together these results high lights the therapeutic potential of miR-126 suggests that it may contribute as a putative therapeutic target for AMD in humans.
50 CFR 648.126 - Protection of threatened and endangered sea turtles.
2010-10-01
... sea turtles. 648.126 Section 648.126 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT... sea turtles. This section supplements existing regulations issued to regulate incidental take of sea turtles under authority of the Endangered Species Act under 50 CFR parts 222 and 223. In addition to the...
Dose-Response of High-Intensity Training (HIT) on Atheroprotective miRNA-126 Levels
Schmitz, Boris; Schelleckes, Katrin; Nedele, Johanna; Thorwesten, Lothar; Klose, Andreas; Lenders, Malte; Krüger, Michael; Brand, Eva; Brand, Stefan-Martin
2017-01-01
Aim: MicroRNA-126 (miR-126) exerts beneficial effects on vascular integrity, angiogenesis, and atherosclerotic plaque stability. The purpose of this investigation was to analyze the dose-response relationship of high-intensity interval training (HIIT) on miR-126-3p and -5p levels. Methods: Sixty-one moderately trained individuals (females = 31 [50.8%]; 22.0 ± 1.84 years) were consecutively recruited and allocated into three matched groups using exercise capacity. During a 4-week intervention a HIIT group performed three exercise sessions/week of 4 × 30 s at maximum speed (all-out), a progressive HIIT (proHIIT) group performed three exercise sessions/week of 4 × 30 s at maximum speed (all-out) with one extra session every week (up to 7 × 30 s) and a low-intensity training (LIT) control group performed three exercise sessions/week for 25 min HIIT groups (after 4 min of high-intensity running). After the intervention, the LIT group presented an increase in miR-126-3p, while in the HIIT group, miR-126-3p levels were still reduced (all p HIIT (−1.05 ± 2.6 units). Conclusions: LIT and proHIIT may be performed to increase individual miR-126 levels. HIIT without progression was less effective in increasing miR-126. PMID:28611681
Monitoreo neurointensivo en pediatría (III: Tratamiento. Medidas generales
Directory of Open Access Journals (Sweden)
Eduardo M. Pleguezuelo Rodríguez
2001-06-01
Full Text Available Se informa que con el neuromonitoreo y el manejo intensivo del traumatismo craneoencefálico grave, se han identificado un grupo de fenómenos fisiopatológicos diferentes, los cuales requieren de medidas disímiles y específicas para cada paciente, lo que hace más racional el tratamiento de ellos. De la misma manera esto ha propiciado que cambien radicalmente las concepciones acerca de antiguos patrones terapéuticos establecidos durante muchos años; ejemplo de esto es el cambio en la reposición hídrica de ellos, los cuales antes se mantenían sobre una vertiente seca y hoy se preconiza la euvolemia estricta, la sustitución de la hiperventilación de rutina por la ventilación optimizada, cambios en la política del uso de agentes osmóticos, la terapia barbitúrica y la craneotomía descompresiva en casos de hipertensión intracraneal refractaria a medidas terapéuticas convencionales. En este trabajo se hace una revisión actualizada de las principales medidas terapéuticas utilizadas en estos pacientes, acorde con lo que plantean los lineamientos para el tratamiento del traumatismo craneal grave de la Asociación Americana de Cirujanos Neurológicos y los del consorcio europeo para la lesión cerebral. Las medidas terapéuticas utilizadas en estos pacientes se dividen en 2 fases. En este tercer trabajo de actualización se aborda el manejo de la primera fase que corresponde a la estabilización urgente inicial antes de establecer la medición de la presión intracraneal (PIC, así como las medidas generales de la segunda fase una vez iniciado el monitoreo de la PIC. Principios terapéuticos que desde hace algunos años se vienen utilizando en el Hospital provincial General y el Hospital Pediátrico Provincial Docente de Camagüey para el manejo del trauma craneal grave, los cuales se basan en medidas iniciales en la recepción, acorde con lo que plantean los principios del soporte vital avanzado en trauma para la reanimaci
Abuso de las medidas y medidas abusivas. Crítica al pensamiento bibliométrico hegemónico
GÒMEZ-MORALES, YURI JACK
2018-01-01
RESUMEN En este ensayo reflexivo se hace una crítica a la economía política de la medición de la ciencia, la cual se ejemplifica mediante el análisis del factor de impacto como medida de la calidad científica; se explican los mecanismos sociales y culturales que operan en la construcción de estas formas de pensar y actuar hegemónicas; y se advierte sobre las graves consecuencias de este proyecto global para la desinstitucionalización de la ciencia local, y el surgimiento de una ciencia nacion...
MicroRNA-126:a promising novel biomarker in peripheral blood for diabetic retinopathy
Institute of Scientific and Technical Information of China (English)
Li-Li; Qin; Mei-Xia; An; Yan-Li; Liu; Han-Chun; Xu; Zhi-Qing; Lu
2017-01-01
AIM:To investigate the content of serum micro RNA-126(mi R-126) and its role in screening retinal endothelial injury and early diagnosis of proliferative diabetic retinopathy.METHODS:The study included 184 serum samples,59 samples from healthy individuals,44 samples from diabetes mellitus(DM) patients without diabetic retinopathy(NDR),42 from non-proliferative diabetic retinopathy(NPDR) patients and 39 samples from proliferative diabetic retinopathy(PDR) patients.The expression of mi R-126 was evaluated using a real-time quantitative polymerase chain reaction.RESULTS:The serum content of mi R-126 declined as the damage degree in the retina.There was significant difference between the two retinopathy groups(P0.05).Receiver operating characteristic curve(ROC) analyses indicated that serum mi R-126 had significant diagnostic value for PDR.It yielded an area under the curve(AUC) of ROC of 0.976 with 81.21% sensitivity and 90.34% specificity in discriminating PDR from healthy controls,and an AUC of ROC of 0.919 with 84.75% sensitivity and 94.41% specificity in discriminating NDR and NPDR from healthy controls.When the diagnostic threshold was greater than or equal to 8.43,there was an increase in the possibility of NPDR.When the content of mi R-126 was less than or equal to 5.02,the possibility of the occurrence of PDR increased.CONCLUSION:Serum mi R-126 can serve as a non-invasive biomarker for screening retinal endothelial injury and early diagnosis PDR.
Preliminary report on SG126 Task 3: 129I interlaboratory comparison
International Nuclear Information System (INIS)
Roberts, M.L.; Caffee, M.W.; Proctor, I.D.
1996-01-01
An interlaboratory comparison exercise for 129 I has been organized and conducted. A total of seven laboratories participated in the exercise to either a full or limited extent. In the comparison, a suite of 11 samples was used. This suite of standards contained both synthetic 'standard type' materials (i.e., AgI) and environmental materials. The isotopic 129 I/ 127 I ratio of the samples varied from 10 -8 to 10 -14 . Results of the comparison are presented
Directory of Open Access Journals (Sweden)
María B. RIQUELME VIRGALA
2006-01-01
Full Text Available La «polilla del tomate», Tuta absoluta (Meyrick, es una plaga clave de este cultivo en Argentina. Su manejo integrado debería incluir una selección de productos fitosanitarios que sean eficaces para su control y, al mismo tiempo, selectivos respecto de sus enemigos naturales. El objetivo de este trabajo fue evaluar la capacidad de control de los insecticidas triflumurón, clorfenapir, abamectin y una cepa experimental de Bacillus thuringiensis (Bt sobre la plaga, y el poder residual de los mismos sobre Trichogrammatoidea bactrae Nagaraja. Se registró la mortalidad de la polilla cada cuatro días, desde la aplicación hasta la emergencia de los adultos. El efecto sobre el parasitoide, se evaluó a través del número de huevos parasitados por hembra expuesta durante 48 horas a folíolos tratados, y su mortalidad luego de 1, 3, 7, 14 y 30 días de la pulverización. Todos los productos ocasionaron una mortalidad de T. absoluta mayor al 65% después de 12 días de aplicados. El Bt fue el único insecticida que no afectó la supervivencia y el parasitismo de T. bactrae . Estos resultados aportan información de interés para la selección de plaguicidas, a emplearse en programas de manejo integrado.
Expression of miR-126 and its potential function in coronary artery ...
African Journals Online (AJOL)
Objective: This study aimed to explore the role of miR-126 in coronary artery disease ... pectoris and acute myocardial infarction (AMI) compared with controls (both P<0.01) the miR-126 expression in AMI was ..... in acute coronary syndromes.
Directory of Open Access Journals (Sweden)
Fuensanta Cerezo Ramírez
2017-01-01
Full Text Available Sendos informes del Defensor del Pueblo Español alertaron de la necesidad de adoptar medidas para controlar el acoso entre escolares y mejorar la convivencia en las aulas. Sus recomendaciones fueron recogidas por las Comunidades Autónomas (CC.AA. y plasma das en normativas propias. El presente artículo reflexiona sobre las medidas adoptadas, como normas de convivencia, por las administraciones públicas, para los centros educativos sostenidos con fondos públicos. Se plantea un estudio comparativo sobre la no rmativa relacionada con los fenómenos de acoso escolar o bullying y ciberacoso o cyberbullying en ocho CC.AA. seleccionadas al azar. El objetivo principal es conocer cómo se ha abordado esta problemática, así como comparar los protocolos de actuación propu estos y el carácter de las medidas recogidas para su intervención en cada CC.AA. Los resultados indican que la mayoría de las políticas hacen referencia expresa al bullying y una de cada cuatro menciona el cyberbullying, también se detectó que la mitad de los protocolos proponen medidas de actuación ante violencia escolar. En cuanto al carácter de las medidas adoptadas, el análisis demuestra que éstas se dirigen, casi exclusivamente, al alumnado agresor y que, en la mayoría de los casos, son de índole corre ctiva/disciplinaria. Se destaca que en las normativas apenas se hace referencia a medidas de carácter educativo, dejando sin respuesta la propuesta del Defensor del Pueblo que hacía hincapié en las medidas educativas.
Directory of Open Access Journals (Sweden)
Vallejo Cabrera Franco Alirio
1994-12-01
Full Text Available
En condiciones de campo, se evaluaron 32 introducciones silvestres de Lycopersicon sp. y una de la especie cultivada, L. esculentum Mill, con el fin de determinar la resistencia a Scrobipalpula absoluta (Meyrick. Se utilizó el diseño experimental bloques completos al azar con 4 repeticiones. Como bordes se colocaron tres variedades comerciales susceptibles al insecto (Chonto "Mata Verde", Napoli Y Chonto "Santa Cruz Kada" con el fin de tener una fuente de infestación natural y permanente del cogollero dentro del experimento. Se evaluaron los caracteres número de cogollos afectados, número de hojas dañadas, número de ampollas e intensidad de daño. Todas las introducciones de L. hirsutum y L. peruvianum fueron altamente resistentes. Las introducciones 1406 y 1407 de L. pimpinellifolium también fueron altamente resistentes. La introducción 1759 de L. esculentum y L. esculentum var. ceraciforme fueron muy susceptibles. Las introducciones de L. pimpinellifolium y L. hirsutum no tuvieron dificultad para hibridarse con L. esculentum var. Tropic. El cruzamiento L. esculentum x L. peruvianum no presentó semilla híbrida y se requirió efectuar cultivo de embriones inmaduros, in vitro, utilizando el medio Murashige & Skoog pero sin lograrse resultados positivos.
Thirty two (32 wild accessions of Lycopersicon sp. and one (1 cultivated accession of Lycopersicon esculentum Mill were evaluated to determinate the resistance to Scrobipalpula absoluta (Meyrick. The experiment was conducted with a complete random design and four repetitions. Three (3 susceptibles cultivated accessions of L. esculentum (Chonto "Mata Verde", Napoli and Chonto "Santa Cruz Kada" were sowed to have natural infestation of S. absoluta. Damage intensity, number of buds damaged, number of leaves demaged and number of "blister" in the leaves were evaluated, All evaluated accessions of L. peruvianum showed heigh resistence. 1406 and 1407 accessions of L. pimpinellifolium
R-ES-ONANCE--I-Ju-ne--2-0-06------------126;~~~;----------------------------3
Indian Academy of Sciences (India)
study physics, his first choice, and instead he read metallurgy at the University of ... also led his wife to write a renowned historical book about the atomic scientists' movement, A Peril and ... Institute at the famous Harvard University. From 1962 ...
Directory of Open Access Journals (Sweden)
Acácia Aparecida Angeli dos Santos
2012-08-01
Full Text Available O objetivo estabelecido nesta pesquisa descritivo-correlacional foi a averiguação da consciência metatextual por meio de um questionário especialmente elaborado para este fim, analisando sua validade pela relação com medidas de compreensão de leitura e o critério de diferenciação do nível escolar. Participaram 315 alunos do 3º ao 5º ano do ensino fundamental, de escolas públicas, cujas idades variaram de 8 a 13 anos, sendo 169 meninos. Os escores obtidos com a medida de avaliação da consciência metatextual (QACM foram convergentes com a pontuação em compreensão de leitura e o instrumento mostrou-se sensível para captar o progresso das crianças em identificar os gêneros textuais com o avanço da escolaridade. Dessa forma, o estudo forneceu evidências de validade tanto no que se refere à convergência de construtos, identificada com base nas medidas relacionadas, como de critério, distinguindo os alunos pelo seu nível de escolaridade.El objetivo establecido en esta investigación descriptivo-correlacional fue averiguar la consciencia metatextual a través de un cuestionario especialmente diseñado para este fin, analizando su validez por la relación con medidas de comprensión de lectura y el criterio de diferenciación por nivel escolar. Participaron 315 alumnos del 3º al 5º año de la enseñanza básica, de escuelas públicas, cuyas edades variaron de 8 a 13 años, siendo 169 niños. Los puntajes obtenidos con la medida de evaluación de la consciencia metatextual (QACM fueron convergentes con los de la comprensión de lectura y el instrumento se mostró sensible para captar el desarrollo de los niños en identificar los géneros textuales con el avance de la escolaridad. De esa forma, el estudio forneció evidencias de validez por la convergencia de constructos, identificada con base en las medidas relacionadas, como de criterio, distinguiendo los alumnos por su nivel de escolaridad.The stated goal of this
Camiones y dumpers: medidas de seguridad. (Tercera parte
Directory of Open Access Journals (Sweden)
Chinchilla, M.
1963-04-01
Full Text Available Safety measures to be adopted in connection with any type of work should be those that are specifically adequate for the kind of risks involved, for it is just as wrong to adopt measures that are too ellaborate as not to take any at all. Two kinds of safety measures can be considered: those applying to the personnel, and those that protect the equipment. The efficiency and trouble free completion of the work will depend on the nature of the safety measures that are taken. Accidents are easy to avoid in general if the right safety precautions are taken. Such accidents involve both moral and financial damage, and a consequent loss of efficiency.Las medidas de seguridad que deberán adoptarse en cualquier trabajo serán las precisas, puesto que puede ser tan perjudicial señalar demasiadas como no señalar ninguna. Pueden considerarse dos tipos de medidas de seguridad: las concernientes a la seguridad del personal y las referentes a la maquinaria empleada. De la determinación de unas y otras, así como de su exacta observancia, dependerá que el trabajo se realice de forma eficaz y sin contratiempos, fácilmente evitables, por otra parte, que acarrearían consecuencias de tipo moral y económico, con el consiguiente descenso del rendimiento obtenido.
The orphan adhesion-GPCR GPR126 is required for embryonic development in the mouse.
Directory of Open Access Journals (Sweden)
Helen Waller-Evans
2010-11-01
Full Text Available Adhesion-GPCRs provide essential cell-cell and cell-matrix interactions in development, and have been implicated in inherited human diseases like Usher Syndrome and bilateral frontoparietal polymicrogyria. They are the second largest subfamily of seven-transmembrane spanning proteins in vertebrates, but the function of most of these receptors is still not understood. The orphan Adhesion-GPCR GPR126 has recently been shown to play an essential role in the myelination of peripheral nerves in zebrafish. In parallel, whole-genome association studies have implicated variation at the GPR126 locus as a determinant of body height in the human population. The physiological function of GPR126 in mammals is still unknown. We describe a targeted mutation of GPR126 in the mouse, and show that GPR126 is required for embryonic viability and cardiovascular development.
Medidas Explícitas e Implícitas de las Actitudes Hacia las Mujeres
Directory of Open Access Journals (Sweden)
Manuel Cárdenas
2009-01-01
Full Text Available El presente estudio tiene como objeto utilizar el IAT (Implicit Association Test para medir actitudes hacia las mujeres, de modo de comparar dichas evaluaciones de carácter automático con las obtenidas por medio de una medida explícita. Además, los participantes respondieron a un inventario de roles sexuales de modo de ver si los sujetos manejaban el estereotipo dominante asociado a lo femenino y sus efectos sobre el prejuicio. La muestra quedó conformada por 80 estudiantes universitarios. No se detectaron diferencias significativas entre hombres y mujeres en los estereotipos asociados a la mujer, ni en la evaluación que se hace de estas (medida explícita. En la medida de IAT las diferencias entre sexos aparecen, indicando que los hombres muestran una actitud implícita más negativa hacia las mujeres. De este modo se confirma que la aparente disminución del prejuicio que puede constatarse en los cuestionarios podría encubrir el hecho de que las actitudes negativas se mantienen a nivel implícito.
Trabajos en espacios confinados. Riesgos y medidas preventivas
Fernández, Sergio
2012-01-01
La ejecución de trabajos en espacios confinados resulta una necesidad en diversos sectores como por ejemplo en la industria química, redes de alcantarillado, construcción de barcos, en pozos,… con el fin desarrollar diversas tareas como limpiezas, inspecciones interiores, trabajos de pintura, reparaciones varias,… lo que implica la implantación de medidas especiales y rigurosas a planificar y llevar a cabo. Los riesgos que presentan la ejecución de estos trabajos en espacios confinados ...
Abdominoplastia y pexia de pubis: estandarización de medidas
Directory of Open Access Journals (Sweden)
O. Ballestas-Campo
2014-06-01
Full Text Available La abdominoplastia es el procedimiento de elección para corregir la flacidez abdominal, la lipodistrofia supra e infraumbilical y la diástasis de los rectos abdominales. Los nuevos métodos añaden liposucción para definir el contorno corporal. Presentamos una estandarización de medidas para lograr una cicatriz abdominal baja y pexia pubiana en casos de lipodistrofias tipo III y IV de Matarasso. Realizamos un estudio observacional, descriptivo y retrospectivo, evaluando las historias clínicas y las fotografías sobre 420 mujeres, con edades entre 18 y 63 años, intervenidas entre 2004 y 2011. Basamos la técnica quirúrgica en los siguientes principios: referencias anatómicas; medidas estandarizadas con la paciente de pie sobre zapatos de tacón alto para el trazado de una incisión suprapúbica baja, siguiendo diseño de los autores; pexia de pubis y región inguinal; cicatriz suprapúbica baja cubierta por un biquini estándar. El 70,95 % de los casos (298 pacientes correspondieron a abdomen grado IV de lipodistrofia, el 28,57 % (120 pacientes al grado III y el 0,47 % (2 pacientes al grado II según Matarasso. Las complicaciones más frecuentes fueron: seroma, (4,04 % , alteraciones cicatríciales (7,37 % , necrosis parcial y epidermolisis (2,38 % y estenosis umbilical (1,19 % . Como conclusión creemos que la estandarización de medidas para el diseño de la cicatriz en la abdominoplastia permite obtener resultados estéticos predecibles y funcionales buenos: cicatriz baja cubierta por un biquini o ropa interior estándar, cicatriz umbilical ovalada, pexia de pubis y excelente definición del contorno abdominal y corporal, con baja tasa de complicaciones.
1.26 Single Frequency Fiber Laser, Phase II
National Aeronautics and Space Administration — This proposal is for the development of an innovative compact, high power, and extremely reliable 1.26 micron Ho-doped single frequency fiber laser. The proposed...
La Deshumanización de la Medicina.
Gilberto Rueda Pérez
1997-01-01
El arte y la ciencia de conocer la enfermedad y de procurar su prevención o su curación y de aminorar el sufrimiento y el dolor o retardar la muerte del ser humano, ha pasado desde el principio de la existencia del hombre por diferentes etapas, que el análisis retrospectivo nos facilita reconocer y que se imbrican y entrelazan a través de los tiempos y del cambiante desarrollo de las ciencias, a medida que el hombre evoluciona, desde su ignorancia absoluta de los fenómenos de la natu...
Determination of {sup 126}Sn half-life from ICP-MS and gamma spectrometry measurements
Energy Technology Data Exchange (ETDEWEB)
Bienvenu, P.; Arnal, N.; Comte, J. [CEA Cadarache DEN/DEC/SA3C/LARC, Paul Lez Durance (France); Ferreux, L.; Lepy, M.C.; Be, M.M. [CEA Saclay LIST LNE/LNHB, Gif sur Yvette (France); Andreoletti, G. [AREVA Cogema SL/UP2-800, Beaumont Hague (France)
2009-07-01
A new value of {sup 126}Sn half-life was determined by combination of inductively coupled plasma-mass spectrometry (ICP-MS) and gamma spectrometry measurements on purified sample solutions collected from nuclear fuel reprocessing. {sup 126}Sn was isolated through dissolution of fission product precipitates and liquid-liquid extraction with N-benzoyl-N-phenyl-hydroxylamine (BPHA). The abundance of {sup 126}Sn atoms together with the absence of interfering species in the analysed solutions made it possible to measure both mass concentration and nuclide activity with high precision and accuracy. This led to a {sup 126}Sn half-life value of 1.980 (57) x 10{sup 5} a. (orig.)
Medidas dinámicas de predictibilidad en el índice s&p 500 y sus determinantes
Directory of Open Access Journals (Sweden)
Javier Humberto Ospina Holguín
2015-04-01
Full Text Available El objeto de este estudio es medir la predictibilidad del índice accionario estadounidense S&P 500 y establecer posibles determinantes de esta predictibilidad. La predictibilidad se ha estudiado ampliamente, pero en pocos casos mediante medidas dinámicas y per se, como se hace aquí. Para establecer la predictibilidad se utilizan la medida eta del campo de las redes neuronales, el valor p del test de la razón de varianzas del campo de la econometría financiera y el análisis de fluctuación sin tendencia del campo de la econofísica. Se construye un algoritmo de inversión basado en las medidas dinámicas de predictibilidad que es mejor que la estrategia de comprar y mantenerse en el periodo estudiado. Para la medida más promisoria, se establece una relación empírica entre la predictibilidad y varios factores económicos y financieros. El panorama que arroja este estudio es el de un mercado que no es estáticamente predecible, sino cuya predictibilidad evoluciona dinámicamente en el tiempo, lo cual es compatible con la hipótesis del mercado adaptativo.
International Nuclear Information System (INIS)
Sagajdak, R.N.
2008-01-01
The production of heavy nuclei from Rn to Th around the N = 126 neutron shell in complete fusion reactions of nuclei has been considered in a systematic way in the framework of the conventional barrier-passing fusion model coupled with the Standard Statistical Model (SSM). Available data on the excitation functions for fusion and production of evaporation residues obtained in very asymmetric combinations are described with these models rather well. In the interaction of massive projectiles with heavy target nuclei quasi-fission effects appear in the entrance reaction channel. The quantity of the fusion probability introduced empirically has been used to reproduce excitation functions with the same SSM parameters (fission barriers) as those obtained in the analysis of very asymmetric combinations. A lack of stabilization against fission around N = 126 for Th nuclei was earlier explained with a reduced collective contribution to the level density in spherical nuclei. However, the present analysis shows severe inhibition for fusion, i.e., the drop in production cross sections of Th nuclei in the vicinity of N = 126 is mainly caused by entrance channel effects. The macroscopic component of fission barriers for nuclei involved in a deexcitation cascade has been derived and compared with the theoretical model predictions and available data
Mediano, Arturo; Natividad, Eva; Palacio, Fernando; Castro, Miguel
2007-01-01
Equipo adiabático para medida del coeficiente de absorción específico de un material sometido a un campo magnético alterno y método para realizar dicha medida. En esta patente se describe un equipo que permite medir de forma adiabática el incremento de temperatura experimentado por aquellos materiales que presentan mecanismos activos de disipación de calor al someterlos a un campo magnético alterno. Conocida esta magnitud y el tiempo de aplicación del campo y, conocien...
Directory of Open Access Journals (Sweden)
Edna Regina de Oliveira
2007-12-01
Full Text Available O objetivo do estudo foi avaliar a variabilidade intra e inter-avaliadores de medidas antropométricas realizadas por três antropometristas considerados experientes mediante o cálculo dos erros técnicos de medida (ETM. Para esse fim, foi selecionada uma amostra de 21 voluntários (25,7 ± 7,5 anos, sendo 12 homens e 9 mulheres. Foram consideradas as medidas de peso corporal (kg, estatura (cm, circunferências (cm do braço direito relaxado, abdômen, quadril e coxa, e da espessura das dobras cutâneas (mm tricipital, subescapular, suprailíaca, abdômen, coxa e panturrilha medial. As medidas foram realizadas em 2 dias consecutivos, sempre no período da tarde, envolvendo os mesmos equipamentos e os mesmos voluntários. Os resultados apontaram a ocorrência de ETMs acima dos recomendados para aceitabilidade, tanto a variabilidade intra-avaliador como inter-avaliadores, sugerindo, portanto, a importância e a necessidade de treinamento específico dos antropometristas.The aim of this study was to evaluate the intra and inter-observer reliability in the anthropometric measures of three expert observers through the technical error of measure (TEM. For this end, 21 healthy volunteers (25.7 ± 7.5 years took part in the study, being 12 males and 9 females. The following aspects were analyzed: body weigh (kg, stature (cm, circumferences (cm of relaxed right arm, abdomen, hip and thigh, and skinfold thickness (mm of triceps, subescapular, supra-iliac, abdomen, thigh and calf medial. The measures were made in 2 different days, always in the afternoon, with the same equipments and in the same volunteers. The results pointed the occurrence of TEMs out of the recommended patterns, in both intra-observer and inter-observers variability. This fact showed the importance and need of specific training of the observers.
Work hardening characteristics in Al base alloys with 12.6 and 45 wt.% Zn
International Nuclear Information System (INIS)
Abd El-Salam, F.; Mostafa, M.M.; Wahab, L.A.; Mostafa, M.T.; Abd El-Aziz, Sh.M.
2008-01-01
The stress-strain curves were obtained for Al-Zn alloys of 12.6 wt.% Zn (alloy I) and 45 wt.% Zn (alloy II) with elements of purity (99.99). The monotonic shift of these curves towards lower flow stress and higher ductility was interrupted at the transformation temperatures 483 K (alloy I) and both 543, 603 K (alloy II). By increasing deformation temperature, Young's modulus, Y, yield and fracture stresses, σ y and σ f , respectively, fracture time, t f , the coefficient of parabolic work hardening, χ, decreased while fracture strain, ε f , and dislocation slip distance, L, increased. From the obtained X-rays diffraction patterns the lattice strain, ε, crystallite size, η, and dislocation density, ρ, were obtained at different deformation temperatures around transformation
Manzini, L; Halwachs, S; Girolami, F; Badino, P; Honscha, W; Nebbia, C
2017-12-01
The ATP-binding cassette efflux transporter ABCG2 plays a key role in the mammary excretion of drugs and toxins in humans and animals. Aflatoxins (AF) are worldwide contaminants of food and feed commodities, while PCB 126 is a dioxin-like PCB which may contaminate milk and dairy products. Both compounds are known human carcinogens. The interactions between AF and bovine ABCG2 (bABCG2) as well as the effects of PCB 126 on its efflux activity have been investigated by means of the Hoechst H33342 transport assay in MDCKII cells stably expressing mammary bABCG2. Both AFB1 and its main milk metabolite AFM1 showed interaction with bABCG2 even at concentrations approaching the legal limits in feed and food commodities. Moreover, PCB 126 significantly enhanced bABCG2 functional activity. Specific inhibitors of either AhR (CH233191) or ABCG2 (Ko143) were able to reverse the PCB 126-induced increase in bABCG2 transport activity, showing the specific upregulation of the efflux protein by the AhR pathway. The incubation of PCB 126-pretreated cells with AFM1 was able to substantially reverse such effect, with still unknown mechanism(s). Overall, results from this study point to AFB1 and AFM1 as likely bABCG2 substrates. The PCB 126-dependent increased activity of the transporter could enhance the ABCG2-mediated excretion into dairy milk of chemicals (i.e., drugs and toxins) potentially harmful to neonates and consumers. © 2017 John Wiley & Sons Ltd.
Aplicaciones de los modelos multinivel al análisis de medidas repetidas en estudios longitudinales
María Victoria Zunzunegui; María Jesús García de Yébenes; Mathieu Forster; María Dolores Aguilar Conesa; Angel Rodríguez Laso; Ángel Otero
2004-01-01
Este trabajo es una introducción al análisis de medidas repetidas en estudios longitudinales. Se utiliza un marco analítico con dos etapas, ajustando modelos jerárquicos lineales con dos niveles. El primer nivel corresponde a la ocasión (tiempo) de medida y el segundo al individuo. Estos modelos estadísticos proceden de las ciencias sociales, en las que se han utilizado durante más de 25 años para analizar datos en organizaciones con múltiples niveles. Su aplicación permi...
Medida del coeficiente d33 de piezocomposites por interferometría láser
Directory of Open Access Journals (Sweden)
Montero de Espinosa, F.
2002-02-01
Full Text Available The measurement of piezoelectric coefficient d33 is made using devices like the Berlincourt Meter ®, based on a force generator internally calibrated by a reference piezoelectric element which measures the charge ratio Culomb/Newton. For estructures such as piezoelectric composites, formed by materials of very different elastic properties, the measurements made by the described system present a great dispersión which depends on both the size of the pressing head and the aplied arm pressure. This work presents a set of systematic measurements of d33 for several piezocomposite geometries by means of optical interferometry. These measurements are compared with those obtained with the Berlincourt. It is observed that both techniques render closer results as the net step is reduced.La medida del coeficiente piezoeléctrico d33 se realiza utilizando equipos como el Berlincourt Meter ®, basados en un generador de fuerza calibrado internamente por un elemento piezoeléctrico de referencia que mide la relación de carga, Culombio/ Newton. Estos sistemas están absolutamente contrastados, tomando los grupos de investigación sus medidas como estándar. En el caso de estructuras tales como los composites piezoeléctricos, en los que la estructura está formada por materiales de muy distinta elasticidad, bien por este hecho, bien por la misma estructura, las medidas con el sistema descrito presentan una gran dispersión dependiendo del tamaño de la cabeza presionante y la presión del brazo. Dado que en el modelado de resonadores piezocomposite para su uso en aplicaciones con acoplamiento en aire es necesario conocer dicho parámetro sin incertidumbre, se presentan en el trabajo una serie de medidas sistemáticas de dicho coeficiente para varias geometrías de piezocomposites utilizando interferometría óptica. Se relaciona así mismo estas medidas con el resultado obtenido con el equipo estándar antes referido observando como cuanto más pequeño es
7 CFR 989.126 - Representation of the Committee.
2010-01-01
... selected from and representing the four handler(s) other than major cooperative marketing association....126 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE RAISINS...
Expression of miR-126 and its potential function in coronary artery ...
African Journals Online (AJOL)
Objective: This study aimed to explore the role of miR-126 in coronary artery disease (CAD) patients and the potential gene targets of miR-126 in atherosclerosis. Methodology: A total of 60 CAD patients and 25 healthy control subjects were recruited in this study. Among the 60 CAD patients, 18 cases were diagnosed of ...
22 CFR 126.14 - Special comprehensive export authorizations for NATO, Australia, and Japan.
2010-04-01
... NATO, Australia, and Japan. 126.14 Section 126.14 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL... authorizations for NATO, Australia, and Japan. (a) Comprehensive authorizations. With respect to NATO members, Australia, Japan, and Sweden, the Directorate of Defense Trade Controls may provide the comprehensive...
48 CFR 18.126 - Extraordinary contractual actions.
2010-10-01
... authority granted by Public Law 85-804 (50 U.S.C. 1431-1434). This includes— (a) Amending contracts without consideration (see 50.103-2(a)); (b) Correcting or mitigating mistakes in a contract (see 50.103-2(b)); and (c... CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Available Acquisition Flexibilities 18.126...
Idalina Maria Nunes Salgado Reis dos Santos
2005-01-01
Hidrolipodistrofia ginóide (H.L.D.G.), a celulite, é comumente tratada com cosméticos contendo extratos vegetais. O estudo realizado foi: ultra-sonografia na avaliação da espessura da hipoderme e a microcirculação cutânea; uso de termômetro infravermelho na medida da temperatura e análise das medidas antropométricas da uma formulação cosmética anticelulítica contendo extrato hidroglicólico de Trichilia catigua e Ptychopetalum olacoides Bentham (catuaba e marapuama). Foram realizadas medidas i...
Directory of Open Access Journals (Sweden)
Airton Leite Kronbauer
2011-04-01
Full Text Available OBJETIVO: Desenvolver um método e um dispositivo para quantificar a visão em candela (cd. Os estudos de medida da visão são importantes para todas as ciências visuais. MÉTODOS: É um estudo teórico e experimental. Foram descritos os detalhes do método psicofísico e da calibração do dispositivo. Foram realizados testes preliminares em voluntários. RESULTADOS: É um teste psicofísico simples e com resultado expresso em unidades do sistema internacional de medidas. Com a descrição técnica será possível reproduzir o experimento em outros centros de pesquisa. CONCLUSÃO: Os resultados aferidos em intensidade luminosa (cd são uma opção para estudo visual. Esses resultados possibilitarão extrapolar medidas para modelos matemáticos e para simular efeitos individuais com dados aberrométricos.
In developmg countri.e~: 126;~;~ :6~s~d. S~:~J~_s126;~;e '126;~;9'·i'~t'126;~;a~fng ...
African Journals Online (AJOL)
treatment time above 6 h at ambient temperature (26-2t, C) produced milk .... u 26 hours. depending on the storage tem.perature ..... It was the objective ofthisl work ... days (d» were obtained with the milk under LP3 teurized milk over several .... Programme. Ne}fsletter No1&''2. FAOJ ...ipsala. '" Sweden. ppJ-7.':.\\ : : . . . . , ' ; ,.
Neutron activation analysis of 127I and 129I environmental samples
International Nuclear Information System (INIS)
Takeishi, Minoru; Namiki, Atsushi; Ishida, Junichiro; Iwai, Makoto
1987-01-01
The analytical method of 127 I and 129 I in environmental samples has been studied and the background levels of these nuclides in soils, seaweeds and milk were measured. The analytical method consists of the combustion technique and neutron activation analysis (N.A.A.). The iodine was separated from samples by ignition at about 1,000 deg C in a quartz combustion apparatus with an oxygen and a nitrogen stream, and was absorbed by small amounts of active charcoal. The iodine was then purified through the carbontetrachloride extraction method and the PdI 2 decomposition method. Irradiation was conducted by JRR-4 (n th : 8 x 10 13 n/cm 2 · sec) for 40 min. After irradiation, the iodine was purified by the solvent extraction method same as pre-irradiation extraction. Each activity of 126 I and 130 I, which was produced by 127 I(n,2n) 126 I and 129 I(n,γ) 130 I reaction respectively, was measured by γ-spectrometry using a Ge-detector. The lower detection limits of 129 I by this method were 4 x 10 -7 Bq/g for dry soil, 7 x 10 -8 Bq/g for fresh seaweeds and 7 x 10 -6 Bq/l for fresh milk, respectively. The relative standard deviation of 129 I measurements in soil and milk were less than 10 %. (author)
Directory of Open Access Journals (Sweden)
JULIÁN MARINO
2011-01-01
Full Text Available Para evaluar la evocación de palabras asociadas bajo una consigna de prueba de fluidez verbal (PFV se tienen en cuenta la cantidad de palabras producidas, las asociaciones categoriales y fonológicas entre ellas y el tiempo en que son evocadas. A continuación se presenta un estudio que se realizó aplicando PFV semánticas y fonológicas en una población infantil (8 - 12 años de la ciu dad de Granada (España, que tuvo por objetivos: (1 revisar las tradicionales medidas en PFV, (2 actualizar los índices temporales de medición y (3 presentar combinaciones de éstas con el fin de establecer con mayor precisión la participación del control ejecutivo en PFV. Se encontraron resultados significativos entre los que se destaca que la combinación entre la medida temporal de evocación de palabras conjuntas y la cualitativa de palabras en relación cluster podría aislar con mayor fiabilidad el compromiso de funciones ejecutivas como el control inhibitorio y la flexibilidad cognitiva. Esto se determinó empleando medidas de regresión, ingre sando como variables independientes funciones ejecutivas y como variables dependientes cada una de las medidas de Fluidez Verbal. Para la mencionada combinación de palabras conjuntas - palabras en relación cluster (PFV fonológica letra P se halló un R2 de .41 (p = .000 ingresando como variables predictoras el Trail Making B y la parte Color - Palabra de la versión Trenerry del paradigma Stroop (Lezak, 1995. Se describen también otras posibilidades de medición temporales - cualitativas y su posible utilidad clínica y de investigación.
Directory of Open Access Journals (Sweden)
Paulo Sergio Chagas Gomes
2010-02-01
Full Text Available OBJETIVO: Determinar a confiabilidade das medidas de espessuras dos músculos flexores e extensores do cotovelo e joelho pela ultrassonografia (US, quantificando o erro típico associado a essas medidas (ETM. MÉTODOS: A confiabilidade (duas medidas interdias foi determinada em 15 voluntários aparentemente saudáveis (oito mulheres, 33,9 ± 11,4 anos, 76 ± 21kg, 170 ± 10cm. As imagens da musculatura flexora (FC e extensora do cotovelo (EC e flexora (FJ e extensora do joelho (EJ foram obtidas pela US bidimensional no modo B, utilizando transdutor de 7,5MHz. As espessuras do tecido muscular compreendidas entre as interfaces com o osso e com o tecido adiposo foram medidas em sítios anatômicos identificados e registrados para ser repetidos na segunda medida. RESULTADOS: A ANOVA não identificou diferenças significativas entre as medidas repetidas. Os coeficientes de correlação intraclasse foram FC = 0,970, EC = 0,971, FJ = 0,555 e EJ = 0,929 (P PURPOSE: To determine the reliability of muscle thickness measurements of elbow and knee flexors and extensors using ultrasound, and to quantify the typical error associated to the measurements (TEM. METHODS: The test-retest reliability was determined in 15 apparently healthy volunteers (8 women, 34 ± 11 years, 76 ± 21 kg, 170 ± 10 cm. The images of elbow flexors (EF and extensors (EE and knee flexors (KF and extensors (KE were obtained using a two dimensional mode B ultrasound instrument with a 7.5 MHz transducer. Muscle thickness between the adipose tissue and bone interfaces were measured at anatomical landmarks previously identified and recorded to assure the exact site for the retest. RESULTS: ANOVA did not identify any significant differences between the repeated measurements. Intraclass correlation coefficients (ICC of each pair of measure were EF = 0.970, EE = 0.971, KF = 0.555 e KE = 0.929 (P < 0.05 for all. The coefficients of variation were 3.9 %, 6.1 %, 6.6 % e 4.6 %, and TEM 1.3 mm, 1
7 CFR 457.126 - Popcorn cop isurance povisions.
2010-01-01
... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.126 Popcorn cop isurance... permit mechanical cultivation, unless otherwise provided by the Special Provisions, actuarial documents... policy unless the Special Provisions provide different price elections by type, in which case you may...
43 CFR 30.126 - What happens if property was omitted from the inventory of the estate?
2010-10-01
... the inventory of the estate? 30.126 Section 30.126 Public Lands: Interior Office of the Secretary of the Interior INDIAN PROBATE HEARINGS PROCEDURES Judicial Authority and Duties § 30.126 What happens if property was omitted from the inventory of the estate? This section applies when, after issuance of a...
USO DE MEDIDAS AUTO-REFERIDAS PARA AVALIAÇÃO DO ESTADO NUTRICIONAL DE ADOLESCENTES
Directory of Open Access Journals (Sweden)
ROZANE APARECIDA TOSO BLEIL
2009-12-01
Full Text Available
Comparar os valores referidos e aferidos de peso e estatura em estudantes adolescentes de um municÃpio da região oeste paranaense. Participaram do estudo 125 adolescentes com idade entre 10 e 18 anos. Os estudantes relataram aos pesquisadores dados referentes ao peso e estatura e, após o registro das informações, os jovens foram pesados e medidos. Foram coletadas informações sobre a percepção corporal para verifi car como o adolescente percebe seu peso em relação a sua estatura e as respostas foram agrupadas em três categorias. O teste t-student pareado foi utilizado para identifi car possÃveis diferenças nas medidas referidas e aferidas de peso, estatura e do Ãndice de Massa Corporal - IMC. Para avaliar a concordância entre as medidas aferidas e referidas, calculou-se o coefi ciente de correlação intraclasse de Pearson (CCI, de acordo com a faixa etária e o gênero de cada indivÃduo. O teste t-student foi adotado para verifi car possÃveis diferenças entre os resultados obtidos, de acordo com o gênero dos alunos. Adotouse o nÃvel de signifi cância de 5%. Os resultados obtidos mostraram que as meninas mais jovens apresentaram melhor percepção corporal quando comparadas à s alunas com maior idade. Não foram identifi cadas diferenças signifi cativas entre as medidas referidas e aferidas do grupo estudado, em relação ao gênero e à faixa etária. Porém, nota-se que osadolescentes tendem a subestimar suas medidas corporais, sendo a estatura, a que apresentou menor concordância entreos valores informados e aferidos. As medidas referidas devem ser utilizadas com cuidado na avaliação nutriciona lde adolescentes. Sugere-se a implementação de outros estu dospara confi rmar a validade do uso de tais medidas e ainda avaliar outros fatores que possam interferir nos resulta dos.
Huang, Chih-Yang; Lee, Fa-Lun; Peng, Shu-Fen; Lin, Kuan-Ho; Chen, Ray-Jade; Ho, Tsung-Jung; Tsai, Fu-Jen; Padma, Vijaya V; Kuo, Wei-Wen; Huang, Chih-Yang
2018-02-01
Hypertension-induced cardiac hypertrophy and apoptosis are major characteristics of early-stage heart failure (HF). Inhibition of extracellular signal-regulated kinases (ERK) efficaciously suppressed angiotensin II (ANG II)-induced cardiomyocyte hypertrophy and apoptosis by blocking insulin-like growth factor II receptor (IGF-IIR) signaling. However, the detailed mechanism by which ANG II induces ERK-mediated IGF-IIR signaling remains elusive. Here, we found that ANG II activated ERK to upregulate IGF-IIR expression via the angiotensin II type I receptor (AT 1 R). ERK activation subsequently phosphorylates HSF1 at serine 307, leading to a secondary phosphorylation by glycogen synthase kinase III (GSK3) at serine 303. Moreover, we found that ANG II mediated ERK/GSK3-induced IGF-IIR protein stability by downregulating the E3 ubiquitin ligase of IGF-IIR RING finger protein CXXVI (RNF126). The expression of RNF126 decreased following ANG II-induced HSF1 S303 phosphorylation, resulting in IGF-IIR protein stability and increased cardiomyocyte injury. Inhibition of GSK3 significantly alleviated ANG II-induced cardiac hypertrophy in vivo and in vitro. Taken together, these results suggest that HSF1 phosphorylation stabilizes IGF-IIR protein stability by downregulating RNF126 during cardiac hypertrophy. ANG II activates ERK/GSK3 to phosphorylate HSF1, resulting in RNF126 degradation, which stabilizes IGF-IIR protein expression and eventually results in cardiac hypertrophy. HSF1 could be a valuable therapeutic target for cardiac diseases among hypertensive patients. © 2017 Wiley Periodicals, Inc.
Observation of curative effect of 131I in treatment of hyperthyroidism
International Nuclear Information System (INIS)
Huang Kebin; Xu Fan; Zhang Yaping; Wang Jingchang; Zhao Mingli; Ye Ming
2012-01-01
Objective: To explore the curative effect of 131 I in the treatment of hyperthyroidism. Method: 126 patients with hyperthyroidism were treated with 131 I and the curative effect was analyzed. Result: The results showed that among 126 cases of hyperthyroidism treated with 131 I, 117 cases had recovered and the cure rate was 92.9%. 9 cases were found hypothyroidism in one-year follow-up and the occurrence rate was 7.1%. Conclusion: The treatment of hyperthyroidism with 131 I is safe and effective method. (authors)
Wan, J; Harmark, K; Davidson, B E; Hillier, A J; Gordon, J B; Wilcock, A; Hickey, M W; Coventry, M J
1997-03-01
The effect of bacteriocin, piscicolin 126, on the growth of Listeria monocytogenes and cheese starter bacteria was investigated in milk and in Camembert cheese manufactured from milk challenged with 10(2) cfu ml(-1) L. monocytogenes. In milk incubated at 30 degrees C, piscicolin 126 added in the range of 512-2,048 AU ml(-1) effectively inhibited growth of L. monocytogenes for more than 20 d when challenged with approximately 10(2) cfu ml(-1) L. monocytogenes. At higher challenge levels (10(4) and 10(6) cfu ml(-1)), piscicolin 126 reduced the viable count of L. monocytogenes by 4-5 log units immediately after addition of the bacteriocin; however, growth of Listeria occurred within 24 h. The minimum inhibitory concentration (MIC) of piscicolin 126 against lactic acid cheese starter bacteria was generally greater than 204,800 AU ml(-1) , and the viable count and acid production of these starter cultures in milk were not affected by the addition of 2,048 AU ml(-1) piscicolin 126. Camembert cheeses made from milk challenged with L. monocytogenes and with added piscicolin 126 showed a viable count of L. monocytogenes 3-4 log units lower than those without piscicolin 126. Inactivation of piscicolin 126 by proteolytic enzymes from cheese starter bacteria and mould together with the emergence of piscicolin 126-resistant isolates was responsible for the recovery of L. monocytogenes in the cheeses during ripening.
Refração atmosferica nas medidas Doppler
Oliveira, Leonardo Castro de
1990-01-01
Orientador: Jose Bittencourt de Andrade Dissertação (mestrado) - Universidade Federal do Parana. Setor de Tecnologia Resumo: Esta dissertação tem por objetivo realizar investigações referentes à refração atmosférica nas medidas Doppler. São considerados quatro modelos para correção troposférica, e o modelo de duas frequências para a correção da refração ionosférica . São também testados de diferentes fontes de dados meteorológicos. Todos os testes são feitos utilizando-se o programa GEO...
Altura do joelho como medida alternativa confiável na avaliação nutricional de idosos
Directory of Open Access Journals (Sweden)
Vera Elizabeth CLOSS
2015-10-01
Full Text Available Objetivo:Avaliar o uso da altura do joelho como medida alternativa confiável na avaliação nutricional de idosos atendidos em um ambulatório de geriatria.Métodos:Estudo transversal com idosos atendidos em ambulatório de geriatria de um hospital universitário, entre novembro de 2009 e novembro de 2010. Variáveis investigadas: gênero, idade, peso, estatura, altura do joelho, estatura estimada através das equações de Chumlea, índice de massa corporal para as medidas de estatura aferida e estimada e classificado segundo Lipschitz, e dados sociodemográficos. Na análise descritiva dos dados foram usadas medidas de tendência central, dispersão e proporção; a homogeneidade entre as medidas foi verificada através do coeficiente de correlação intraclasse e do gráfico de Bland e Altman e a concordância entre a avaliação nutricional baseada no índice de massa corporal calculado a partir da estatura aferida e a avaliação nutricional baseada no índice de massa corporal calculado a partir da estatura estimada foi avaliada através do coeficiente Kappa ponderado com pesos quadráticos.Resultados:Foram avaliados 186 idosos com média de idade de 74,3±7,1 anos. A média do índice de massa corporal aferido e estimado foi 28,96±5,86 kg/m2e 27,95±5,47 kg/m2, respectivamente, e a prevalência de sobrepeso foi de 59,7% para o índice de massa corporal aferido e 53,2% para o estimado. Foi observada uma boa concordância (Kappa=0,79; p<0,001 entre as duas avaliações.Conclusão:Os resultados mostraram ser possível utilizar a altura do joelho na estimativa da estatura para cálculo do índice de massa corporal em idosos atendidos em ambulatório, alternativa útil para aqueles que apresentam limitações na aferição das medidas, sendo esta uma medida alternativa importante na avaliação nutricional de idosos.
Effects of Mn addition on microstructure and hardness of Al-12.6Si alloy
Biswas, Prosanta; Patra, Surajit; Mondal, Manas Kumar
2018-03-01
In this work, eutectic Al-12.6Si alloy with and without manganese (Mn) have been developed through gravity casting route. The effect of Mn concentration (0.0 wt.%, 1 wt%, 2 wt% and 3 wt%) on microstructural morphology and hardness property of the alloy has been investigated. The eutectic Al-12.6 Si alloy exhibits the presence of combine plate, needle and rod-like eutectic silicon phase with very sharp corners and coarser primary silicon particles within the α-Al phase. In addition of 1wt.% of Mn in the eutectic Al-12.6Si alloy, sharp corners of the primary Si and needle-like eutectic Si are became blunt and particles size is reduced. Further, increase in Mn concentration (2.0 wt.%) in the Al-12.6Si alloy, irregular plate shape Al6(Mn,Fe) intermetallics are formed inside the α-Al phase, but the primary and eutectic phase morphology is similar to the eutectic Al-12.6Si alloy. The volume fraction of Al6(Mn,Fe) increases and Al6(Mn,Fe) particles appear as like chain structure in the alloy with 3 wt.% Mn. An increase in Mn concentration in the Al-12.6Si alloys result in the increase in bulk hardness of the alloy as an effects of microstructure modification as well as the presence of harder Al6(Mn,Fe) phase in the developed alloy.
Medidas de bioseguridad adoptadas en el manejo con materiales biológicos en Laboratorios Liorad
Directory of Open Access Journals (Sweden)
Nancy Burguet Lago
2013-03-01
Full Text Available Introducción: el trabajo con microorganismos puede conllevar a riesgos tanto para el personal que trabaja con los mismos como para el medio ambiente. La existencia de laboratorios de seguridad biológica y la implementación de medidas en la manipulación de los agentes biológicos minimizan el riesgo. Objetivo: evaluar las medidas de bioseguridad adoptadas en el manejo con materiales biológicos en Laboratorios Liorad. Métodos: empleo de una lista de chequeo y análisis de los resultados a través de una Matriz DAFO para valorar si el diseño de la instalación cumple con la bioseguridad. Además establecer un sistema documental para la manipulación de microorganismos y la confección de un plan de capacitación para el personal que trabaja en el laboratorio de control microbiológico. Resultados: la lista de chequeo permitió identificar como principal debilidad el no disponer de un doble pasillo para el traslado del material limpio y sucio. Como fortalezas, cumplir con las prácticas y procesamientos adecuados y el contar con equipos de seguridad biológica. El sistema documental incorporó a los procedimientos establecidos para la manipulación, un acápite referido a la «Peligrosidad y Medidas de Seguridad». El programa de capacitación desarrollado permitió proveer conocimientos específicos referidos a esta temática. Conclusión: las medidas adoptadas en el laboratorio permiten plantear que de manera general se cumplen los requisitos establecidos en materia de Bioseguridad para el trabajo con microorganismos.
Directory of Open Access Journals (Sweden)
Mirlene Maria Matias Siqueira
1999-08-01
Full Text Available O estudo teve como objetivo construir e validar uma medida que aferisse cinco habilidades da inteligência emocional. Dentre os 126 itens elaborados para representar as cinco habilidades, 97 deles que apresentaram consistência após análise teórica foram aplicados a uma amostra de 972 sujeitos dos sexos masculino e feminino, com idade média de 22,41 anos. Os dados foram submetidos à analise dos componentes principais e extraídos sete fatores com eigenvalues superiores a 2,0. A rotação dos fatores, através do método ortogonal (varimax, revelou que apenas os cinco primeiros apresentaram agrupamentos de itens teoricamente consistentes com as definições das cinco habilidades da inteligência emocional. O fator 1 cobre o conceito de empatia (14 itens, a = 0,87, o fator 2 o de sociabilidade (13 itens, a = 0,82, o fator 3 representa automotivação (12 itens, a = 0,82, o fator 4 o conceito de autocontrole (10 itens, a = 0,84 e o fator 5 a autoconsciência (10 itens, a= 0,78. A versão da medida da inteligência emocional, resultante deste estudo, abre perspectivas para futuras pesquisas nacionais sobre o assunto, visto que a MIE possui validade fatorial e fatores com índices de precisão que a indicam para aplicações no âmbito científico.This study was set up to construct and validate a measurement of five skills of emotional intelligence. Among the 126 items elaborated to represent the five skills 97, which demonstrated consistency after theoretical analysis, were applied to a sample of 972 individuals, both male and female, with an average age of 22,41 years. The data were submitted to analysis of the principal components and seven factors were taken with eigenvalues over 2,0. The rotation of these factors, using the orthogonal method (varimax, showed that only the first five factors presented grouping of consistent items with the definitions of the five emotional intelligence skills. Factor 1 covers empathy (14 items, alpha = 0
Aplicação de medidas cefalométricas em 3D-TC: Application of cephalometric measurements in 3D-TC
Directory of Open Access Journals (Sweden)
Patrícia de Medeiros Loureiro Lopes
2007-01-01
Full Text Available OBJETIVO: o objetivo desta pesquisa foi avaliar a precisão e acurácia (validade de medidas cefalométricas lineares em imagens reconstruídas em terceira dimensão (3D, pela técnica de volume, a partir da tomografia computadorizada (TC multislice. METODOLOGIA: o material da pesquisa consistiu de 10 (dez crânios secos, previamente selecionados, sem distinção de etnia ou gênero, os quais foram submetidos à TC multislice 16 cortes com 0,5mm de espessura por 0,3mm de intervalo de reconstrução. Posteriormente, os dados obtidos foram enviados para uma estação de trabalho independente, contendo o programa Vitrea®. Os pontos cefalométricos (n=13 foram localizados e as respectivas medidas ósseas lineares (n=15 foram realizadas por 2 examinadores, previamente treinados, medindo cada um duas vezes, independentemente, em 3D. As medidas físicas foram obtidas por um terceiro examinador, utilizando um paquímetro digital. A análise dos dados foi realizada mediante um estudo comparativo entre as medidas inter e intra-examinadores, em 3D-TC, e entre estas e as medidas físicas obtidas diretamente nos crânios, utilizando ANOVA (análise de variância. RESULTADOS: não foram encontradas diferenças estatisticamente significantes entre os valores das medidas inter e intra-examinadores, nem entre as medidas físicas e em 3D, com p>0,6 para todas as medidas. O erro percentual foi de 2,05% para as medidas interexaminadores e de 2,11% para as medidas intra-examinadores. A média do erro percentual entre as medidas físicas e em 3D variou de 0,96% a 1,47%. CONCLUSÃO: todas as medidas cefalométricas lineares foram consideradas precisas e acuradas utilizando a técnica de volume em 3D por meio da TC multislice.AIM: To test the precision and accuracy of conventional linear cephalometric measurements in 3D reconstructed images using a multislice CT. METHODS: The study population consisted of 10 dry skulls, previously selected, without distinction of
Directory of Open Access Journals (Sweden)
F. de la Torre Silva
2008-01-01
Full Text Available Este trabajo muestra el estudio realizado en turbinas de vapor de pequeña capacidad de generación de las centrales termoeléctricas cubanas, relacionadas con la influencia estadística entre parámetros de proceso de la turbina, respecto al parámetro vibración absoluta, medidos en las chumaceras de la turbina. Se utilizan las bases de datos de los sistemas de monitoreado on-line de la turbina. Se exponen las relaciones existentes entre los principales parámetros seleccionados para este estudio.This work show the study in small steam turbine capacity of generation in cubans thermoelectric power station to relative with statistical influence between steam process parameters regarding absolute vibration parameter, in the steam housing measurements. Themselves use database as steam on-line monitoring systems. Expose the existing relation between the principal selection parameters for this study.
47 CFR 36.126 - Circuit equipment-Category 4.
2010-10-01
... separating property associated with special services, circuit equipment included in Categories 4.12 (other... Equipment Excluding Wideband—Category 4.13—The cost of Circuit Equipment associated with exchange line plant... 47 Telecommunication 2 2010-10-01 2010-10-01 false Circuit equipment-Category 4. 36.126 Section 36...
2010-10-01
... during riveting, welding, burning, or other hot work. 126.160 Section 126.160 Shipping COAST GUARD... § 126.160 Tests and inspections during repairs or alterations, or during riveting, welding, burning, or... riveting, welding, burning, or other hot work may commence. (c) Each examination must be conducted as...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Foreign-owned military aircraft and naval vessels, and the Foreign Military Sales program. 126.6 Section 126.6 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS GENERAL POLICIES AND PROVISIONS § 126.6 Foreign-owned military...
Directory of Open Access Journals (Sweden)
Lidiany C. de O. Godoi
2009-01-01
Full Text Available http://dx.doi.org/10.5007/2175-7941.2008v25n3p523 Sugerimos neste artigo um plano de ensino que, envolvendo um trabalho interdisciplinar, discuta a natureza do Sistema de Unidades de Medida. Por meio de dinâmicas de grupos, leitura e interpretação de textos históricos, poemas e ilustrações e também através de outras fontes, acreditamos ser possível mostrar que o sistema de unidades de medida adotado atualmente (SI não é um dado natural, mas o resultado de um processo histórico de negociação de significados e, portanto, contingente das relações sociais. A partir da perspectiva dos Estudos Sociais da Ciência (ou Nova História e Sociologia do Conhecimento, apresentamos algumas discussões que envolveram a adoção do Sistema Decimal na França, bem como as dificuldades de sua posterior implementação no Brasil, expressa pela Revolta do Quebra-Quilos. Esperamos que as dinâmicas sugeridas neste trabalho possibilitem aos estudantes reconhecerem a si mesmos como participantes do processo de construção do conhecimento científico através da observação diária das mudanças que conferem novas feições a ele e também da tentativa de tornar mais significativo um tópico do currículo que, muitas vezes, é considerado desinteressante, enfadonho ou simples memorização de grandezas e de suas conversões.
Directory of Open Access Journals (Sweden)
Alonso Alonso Alonso
2004-12-01
Full Text Available Este trabajo trata sobre los procedimientos de medida de las radiaciones no ionizantes y sus niveles registrados en medidas reales. Las fuentes de radiación analizadas cubren los medios de radiodifusión más corrientes, tales como las transmisiones AM y FM y también las estaciones base de telefonía móvil GSM. Estas fuentes habitualmente radian sobre áreas con alta densidad de población. Se describe brevemente el marco legal que regula los niveles de radiación en España y se señalan algunas posibles mejoras. Se valorarán los resultados encontrados en las medidas.
27 CFR 26.126 - Taxpayment in Puerto Rico.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Taxpayment in Puerto Rico..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Liquors and Articles Purchased by Tourists in Puerto Rico § 26.126 Taxpayment in Puerto Rico. Liquors upon which all...
Medidas Sanitarias y Fitosanitarias, ¿Barreras al Comercio?: el Caso Peruano en el Asia-Pacífico
Directory of Open Access Journals (Sweden)
Marcelo Alonso Valverde Arevalo
2016-01-01
Full Text Available Los aranceles han dejado de representar la principal barrera al comercio exterior, debido a la reducción constante de éstos en el ámbito multilateral o bilateral. Contrariamente, las medidas no arancelarias han ido en aumento, siendo la principal preocupación para las exportaciones mundiales. En este escenario, se presentan las medidas sanitarias y fitosanitarias, las cuales sirven para proteger la salud de las personas, animales y plantas en contra de riesgos asociados con enfermedades, pestes u otros; sin embargo, por la naturaleza de las mismas pueden distorsionar el comercio hasta ser utilizadas con fines proteccionistas en favor de las industrias nacionales de los países importadores. El presente artículo cuestiona si es que a pesar de contar con una serie de acuerdos comerciales internacionales, los cuales han disminuido progresivamente los aranceles, el Perú ha logrado un acceso real al mercado del Asia-Pacífico con productos agropecuarios y pesqueros. En ese sentido, se presentan casos históricos y pendientes en materia de acceso a mercados por medidas de carácter sanitario o fitosanitario, tal como el acceso de paltas a Japón. Asimismo, se analizan las disposiciones de los acuerdos comerciales en materia de medidas sanitarias y fitosanitarias y se presentan las potenciales oportunidades que se establecen en estos acuerdos, a fin de agilizar el acceso a mercados internacionales, y que no se han aprovechado.
Potus, François; Ruffenach, Grégoire; Dahou, Abdellaziz; Thebault, Christophe; Breuils-Bonnet, Sandra; Tremblay, Ève; Nadeau, Valérie; Paradis, Renée; Graydon, Colin; Wong, Ryan; Johnson, Ian; Paulin, Roxane; Lajoie, Annie C; Perron, Jean; Charbonneau, Eric; Joubert, Philippe; Pibarot, Philippe; Michelakis, Evangelos D; Provencher, Steeve; Bonnet, Sébastien
2015-09-08
Right ventricular (RV) failure is the most important factor of both morbidity and mortality in pulmonary arterial hypertension (PAH). However, the underlying mechanisms resulting in the failed RV in PAH remain unknown. There is growing evidence that angiogenesis and microRNAs are involved in PAH-associated RV failure. We hypothesized that microRNA-126 (miR-126) downregulation decreases microvessel density and promotes the transition from a compensated to a decompensated RV in PAH. We studied RV free wall tissues from humans with normal RV (n=17), those with compensated RV hypertrophy (n=8), and patients with PAH with decompensated RV failure (n=14). Compared with RV tissues from patients with compensated RV hypertrophy, patients with decompensated RV failure had decreased miR-126 expression (quantitative reverse transcription-polymerase chain reaction; P<0.01) and capillary density (CD31(+) immunofluorescence; P<0.001), whereas left ventricular tissues were not affected. miR-126 downregulation was associated with increased Sprouty-related EVH1 domain-containing protein 1 (SPRED-1), leading to decreased activation of RAF (phosphorylated RAF/RAF) and mitogen-activated protein kinase (MAPK); (phosphorylated MAPK/MAPK), thus inhibiting the vascular endothelial growth factor pathway. In vitro, Matrigel assay showed that miR-126 upregulation increased angiogenesis of primary cultured endothelial cells from patients with decompensated RV failure. Furthermore, in vivo miR-126 upregulation (mimic intravenous injection) improved cardiac vascular density and function of monocrotaline-induced PAH animals. RV failure in PAH is associated with a specific molecular signature within the RV, contributing to a decrease in RV vascular density and promoting the progression to RV failure. More importantly, miR-126 upregulation in the RV improves microvessel density and RV function in experimental PAH. © 2015 American Heart Association, Inc.
7 CFR 28.126 - Loaning of forms and exhibits.
2010-01-01
... Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE COMMODITY STANDARDS AND STANDARD CONTAINER... Fees and Costs § 28.126 Loaning of forms and exhibits. In the discretion of the Director, limited...
Carrero Peñaranda, Rocio
2013-01-01
Se realizaron diferentes medidas centradas y descentradas del espesor y volumen retiniano con OCT para determinar si un ligero descentramiento en la medida puede ocasionar una medida errónea del espesor macular y, en consecuencia, una mala decisión por parte del oftalmólogo a la hora de decidir un tratamiento en pacientes con edema macular. Máster en Física de los sistemas de diagnóstico, tratamiento y protección en Ciencias de la Salud
Analysis ofGen~tic Divei"SiiY8alid ~¢I~#p126;~;ips~o(ra9126;~;ijriJ~I
African Journals Online (AJOL)
2,. 2nd edition, Cold Spring Harbour, Laboratory. Press, USA. Takezaki N. and Nei M. 1996. Genetic distances and reconstruction of phylogenetic trees from microsatellite DNA. Genetics 144: 389 - 399. Weir B.S. 1990. Genetic data analysis: Methods for discrete population genetic data. Sinauer Asso- ciates. Inc. Publishers.
Evaluación de medidas técnicas introducidas en las redes del litoral de Ciudad de La Habana. Parte I
Directory of Open Access Journals (Sweden)
Olga Susana Suárez
2011-10-01
Full Text Available En el trabajo se reportan los primeros resultados alcanzados en la evaluación de las medidas técnicas introducidas en las redes del litoral de Ciudad de la Habana en el proceso de rehabilitación de las redes de distribución que tiene lugar dentro de la Revolución Energética. Estas medidas fueron, principalmente, la sustitución de aisladores deporcelana por poliméricos y el cambio de las crucetas de maderas por crucetas de hierro. En esta primera parte, los resultados de un exhaustivo ciclo de ensayos de laboratorio de los parámetros eléctricos del aislador polimérico ISOELECTRIC, ciclos de ensayos de contaminación natural y contaminación artificial así como los resultados de la inspección de campo después de entre 3 y 6 meses de instalación permiten recomendar la suspensión de la instalación de este tipo de aisladores en el litoral habanero y realizar un estricto control de los ya instalados paraevitar situaciones complejas de operación. In this paper are reported the first achieved results in relation to the technical procedures applied in the littoral distribution network of Havana City in the process of distribution network rehabilitation that takes place inside the Energetic Revolution. These procedures were mainly the substitution of the porcelain for polymeric insulator. In thisfirst part, the results of the an exhaustive laboratorial test cycles of the electric parameters of ISOELECTRIC polymeric insulator, natural and artificial contamination test cycles, as well as visual inspection results after three and six moths of installation, have allowed to suggest the suspension of the installation of this type of insulators in thiszone and to carry out a strict control of those previously installed in order to avoid complex situations of operation.
Medida de la dureza de sólidos mediante nanoindentación
Directory of Open Access Journals (Sweden)
Alkorta, J.
2005-10-01
Full Text Available Hardness is not readily measurable by means of instrumented indentation since the value of the contact area depends on the pile-up or sink-in occurring near the contact surface of the sample. The most widespread method to estimate it by means of the loading/unloading curve of indentation, Oliver and Pharr’s method, deviates, in the extreme cases, up to a 25% from the real values since it only takes into account the elastic deflection. In this work, a new correction based on Oliver and Pharr’s method is proposed that agrees with the numerical calculations. Plastic hardening behaviour of the sample must be known to accurately estimate the contact area.
La medida de la dureza mediante indentación con registro de carga y desplazamiento no es evidente, dada la incertidumbre sobre el tamaño de huella debido al levantamiento (pile-up o hundimiento (sink-in plásticos de la superficie de la muestra alrededor del indentador. El método más utilizado para la medida de la dureza mediante la curva de carga/descarga de indentación, el de Oliver y Pharr, sólo tiene en cuenta hundimiento elástico, por lo que el error en la medida de la dureza y el módulo de Young puede llegar hasta un 25% en los casos más extremos. En el presente trabajo se discute una posible corrección al método de Oliver y Pharr para una obtención más ajustada del área de contacto de la huella. Esta corrección requiere de un conocimiento a priori o a posteriori del comportamiento plástico del material.
VIOLENCIA DE GÉNERO EN LAS UNIVERSIDADES: INVESTIGACIONES Y MEDIDAS PARA PREVENIRLA
Directory of Open Access Journals (Sweden)
Rosa Larena
2010-12-01
Full Text Available Normal 0 21 false false false ES ZH-TW X-NONE MicrosoftInternetExplorer4 En este artículo recogemos los resultados de la investigación “Violencia de género en las universidades españolas”, la primera investigación que analiza la violencia de género en el contexto universitario en España. Las investigaciones sobre esta clase de violencia en el ámbito internacional muestran, por un lado, que es una realidad existente en la universidad, de la misma forma que lo es en otros ámbitos sociales. Por otro lado, el análisis de las actuaciones implementadas por universidades de prestigio muestra la existencia de diferentes medidas para prevenirla y superarla. Estas evidencias, contrastadas con las percepciones de diferentes colectivos de la comunidad universitaria sobre la aplicabilidad de estas medidas en las universidades españolas, son el punto de partida para iniciar el desarrollo de medidas que erradiquen la violencia de género en nuestras universidades. In this article we present the findings from the research “Gender violence in Spanish universities”, the first study that analyses gender violence in the university context in Spain. Studies on gender violence at the international level show, on the one hand, that gender violence is a reality that exists in universities, in the same way that it exists in other social contexts. On the other hand, the analysis of the actions implemented in prestigious universities shows the existence of measures to prevent and overcome it. Contrasting these evidences with the perceptions of different university collectives about the applicability of these measures in Spanish universities is the starting point to develop measures to eradicate gender violence in our universities.
Medidas de protección del menor en los casos de violencia de género
Directory of Open Access Journals (Sweden)
Francisca Ramón Fernández
2013-04-01
Full Text Available En el presente trabajo nos proponemos realizar un análisis de los distintos preceptos que contemplan las medidas de protección del menor en los casos de violencia de género, tanto en la legislación internacional, estatal y autonómica. El menor como sujeto, directo o indirecto, de la violencia sobre la mujer es protegido a través de una serie de medidas y reconocimiento de derechos, que es más amplio en una legislación que en otra de las estudiadas. Sería conveniente una uniformidad sobre esa protección al menor, ya que en la mayoría de las veces sufre esa violencia en el entorno familiar. La reflexión del análisis de los preceptos nos indica que es el interés superior del menor el que tiene que prevalecer en todas las situaciones, y que, en muchas ocasiones, la legislación no dota de suficientes medidas de protección al menor que se encuentra en una situación de violencia doméstica.
Pan, Jianjun; Sahoo, Prasana K; Dalzini, Annalisa; Hayati, Zahra; Aryal, Chinta M; Teng, Peng; Cai, Jianfeng; Rodriguez Gutierrez, Humberto; Song, Likai
2017-05-18
A fragment of the human prion protein spanning residues 106-126 (PrP106-126) recapitulates many essential properties of the disease-causing protein such as amyloidogenicity and cytotoxicity. PrP106-126 has an amphipathic characteristic that resembles many antimicrobial peptides (AMPs). Therefore, the toxic effect of PrP106-126 could arise from a direct association of monomeric peptides with the membrane matrix. Several experimental approaches are employed to scrutinize the impacts of monomeric PrP106-126 on model lipid membranes. Porous defects in planar bilayers are observed by using solution atomic force microscopy. Adding cholesterol does not impede defect formation. A force spectroscopy experiment shows that PrP106-126 reduces Young's modulus of planar lipid bilayers. We use Raman microspectroscopy to study the effect of PrP106-126 on lipid atomic vibrational dynamics. For phosphatidylcholine lipids, PrP106-126 disorders the intrachain conformation, while the interchain interaction is not altered; for phosphatidylethanolamine lipids, PrP106-126 increases the interchain interaction, while the intrachain conformational order remains similar. We explain the observed differences by considering different modes of peptide insertion. Finally, electron paramagnetic resonance spectroscopy shows that PrP106-126 progressively decreases the orientational order of lipid acyl chains in magnetically aligned bicelles. Together, our experimental data support the proposition that monomeric PrP106-126 can disrupt lipid membranes by using similar mechanisms found in AMPs.
1981-06-30
omomrnuurI CONTENTS Location Plan Watershed Map Plate la : Field Sketch of Woodward Dam Plate Ib: Field Sketch of Greenleaf Dam Plate 2: Plan of Dam...goOFftkoww P L "mm alom+0a,0164m asm a Gooch126;~;A’~e mftLrrL - ol-ob o prat -n 4A ~ /e4 SojA S~tT IIV&-~ ~ i pqPiE5M 1%b, k&vs APPENDIX F...in ry flScrvice orflSi).. L I) Ip. lv.ay ConcrCLC Sp’%way Las j’ r. Joints Surfncc of S p 5.3i). y ’Mclarical Ar .Dra .o 126;~;~ LI:C azard Class E
[Fistulography. Results of 126 examinations (author's transl)].
Metges, P J; Silici, R; Kleitz, C; Delahaye, R P; Mine, J; Pailler, J L
1980-01-01
The authors describe the results obtained in a series of 126 patients examined by fistulography. This investigation should be conducted systematically after operative treatment of any type of fistula. The procedure involves perfusion of a water-soluble iodized contrast medium at low pressure, using a balloon sound to ensure that there are no leaks. The results supply the general or orthopedic surgeon with the information necessary for deciding the operative procedure to be used.
Lønvik, Kenneth; Sørbye, Sveinung W; Nilsen, Marit N; Paulssen, Ruth H
2014-01-01
Dicer and Drosha are important enzymes for processing microRNAs. Recent studies have exhibited possible links between expression of different miRNAs, levels of miRNA processing enzymes, and cancer prognosis. We have investigated the prognostic impact of Dicer and Drosha and their correlation with miR-126 expression in a large cohort of non-small cell lung cancer (NSCLC) patients. We aimed to find patient groups within the cohort that might have an advantage of receiving adjunctive therapies. Dicer expression in the cytoplasm and Drosha expression in the nucleus were evaluated by manual immunohistochemistry of tissue microarrays (TMAs), including tumor tissue samples from 335 patients with resected stages I to IIIA NSCLC. In addition, in situ hybridizations of TMAs for visualization of miR-126 were performed. Kaplan-Meier analysis was performed, and the log-rank test via SPSS v.22 was used for estimating significance levels. In patients with normal performance status (ECOG = 0, n = 197), high Dicer expression entailed a significantly better prognosis than low Dicer expression (P = 0.024). Dicer had no significant prognostic value in patients with reduced performance status (ECOG = 1-2, n = 138). High Drosha expression was significantly correlated with high levels of the microRNA 126 (miR-126) (P = 0.004). Drosha/miR-126 co-expression had a significant negative impact on the disease-specific survival (DSS) rate (P < 0.001). Multivariate analyses revealed that the interaction Dicer*Histology (P = 0.049) and Drosha/miR-126 co-expression (P = 0.033) were independent prognostic factors. In NSCLC patients with normal performance status, Dicer is a positive prognostic factor. The importance of Drosha as a prognostic factor in our material seems to be related to miR-126 and possibly other microRNAs.
Medidas procesales especiales y proteccíon de los derechos humanos Informe general
Vervaele, J.A.E.
2009-01-01
El objetivo del informe general es realizar un análisis comparativo de los informes nacionales para evidenciar los procesos de transformación de los sistemas nacionales de justicia penal, en particular del proceso penal, en el que se han introducido medidas procesales especiales para hacer frente al
Medida de la temperatura con conexión directa sensor-microcontrolador para estación marítima
SISCAR ESCRIVÀ, XAVIER RAMÓN
2013-01-01
En el presente trabajo se ha diseñado e implementado un sistema de medida de la temperatura para una estación marina, usando una interfaz de conexión directa sensor-microcontrolador. El sistema se basa en un sensor resistivo para medir la temperatura, un microcontrolador para procesar los datos y una memoria donde se almacenan. La interfaz de conexión directa sensormicrocontrolador permite realizar medidas de manera más rápida y con menor consumo respecto al uso de convertidore...
Kim, Hyemee; Banerjee, Nivedita; Barnes, Ryan C.; Pfent, Catherine M.; Talcott, Stephen T.; Dashwood, Roderick H.; Mertens-Talcott, Susanne U.
2016-01-01
This study sought to elucidate the mechanisms underlying the anti-inflammatory effect of mango (Mangifera Indica L.) polyphenolics containing gallic acid and gallotanins, and the role of the miR-126/PI3K/AKT/mTOR signaling axis in vitro and in vivo. Polyphenolics extracted from mango (var. Keitt) were investigated in lipopolysaccharide (LPS)-treated CCD-18Co cells. Rats received either a beverage with mango polyphenolics or a control beverage, and were exposed to three cycles of 3% dextran sodium sulfate (DSS) followed by a 2-wk recovery period. The mango extract (10 mg GAE/L) suppressed the protein expression of NF-κB, p-NF-κB, PI3K (p85β), HIF-1α, p70S6K1, and RPS6 in LPS-treated CCD-18Co cells. LPS reduced miR-126 expression, whereas, the mango extract induced miR-126 expression in a dose-dependent manner. The relationship between miR-126 and its target, PI3K (p85β), was confirmed by treating cells with miR-126 antagomiR where mango polyphenols reversed the effects of the antagomiR. In vivo, mango beverage protected against DSS-induced colonic inflammation (47%, P = 0.05) and decreased the Ki-67 labeling index in the central and basal regions compared to the control. Mango beverage significantly attenuated the expression of pro-inflammatory cytokines such as TNF-α, IL-1β, and iNOS at the mRNA and protein level. Moreover, the expression of PI3K, AKT, and mTOR was reduced, whereas, miR-126 was upregulated by the mango treatment. These results suggest that mango polyphenols attenuated inflammatory response by modulating the PI3K/AKT/mTOR pathway at least in part through upregulation of miRNA-126 expression both in vitro and in vivo; thus, mango polyphenolics might be relevant as preventive agents in ulcerative colitis. PMID:27061150
Directory of Open Access Journals (Sweden)
Mª Dolores Calero
2014-05-01
Full Text Available Tradicionalmente la determinación de la sobredotación se ha realizado con tests tradicionales de inteligencia. El principal argumento para hacerlo ha sido la estabilidad temporal de esta medida. En los últimos años algunos autores defienden una determinación temprana de la sobredotación en niños, aunque otros señalan que la determinación del C.I. en niños pequeños arroja un número importante de falsos positivos debido a la variabilidad de la medida de la inteligencia por influencia de diferentes factores tales como la plasticidad cerebral, la estimulación, etc., por lo que proponen el uso de índices complementarios para el diagnóstico de sobredotación. En este trabajo se realiza un estudio longitudinal de dos años a 49 niños de entre 5 y 9 años, -inicialmente identificados como superdotados-, para comprobar la estabilidad de su C.I. y de otras medidas tales como el potencial de aprendizaje y la memoria de trabajo. Los resultados muestran como las medidas de potencial de aprendizaje y memoria de trabajo permanecen estables en el tiempo mientras que el C.I. de un grupo de niños de menor edad no se mantiene en dicho periodo. Estos resultados señalan la utilidad de las medidas de P.A. como un índice complementario en la determinación de la sobredotación en niños pequeños.
Crystal structure and conformational flexibility of the unligated FK506-binding protein FKBP12.6
Energy Technology Data Exchange (ETDEWEB)
Chen, Hui; Mustafi, Sourajit M. [New York State Department of Health, Empire State Plaza, Albany, NY 12201 (United States); LeMaster, David M. [New York State Department of Health, Empire State Plaza, Albany, NY 12201 (United States); University at Albany – SUNY, Empire State Plaza, Albany, NY 12201 (United States); Li, Zhong [New York State Department of Health, Empire State Plaza, Albany, NY 12201 (United States); Héroux, Annie [Brookhaven National Laboratory, Upton, NY 11973 (United States); Li, Hongmin; Hernández, Griselda, E-mail: griselda@wadsworth.org [New York State Department of Health, Empire State Plaza, Albany, NY 12201 (United States); University at Albany – SUNY, Empire State Plaza, Albany, NY 12201 (United States)
2014-03-01
Two crystal forms of unligated FKBP12.6 exhibit multiple conformations in the active site and in the 80s loop, the primary site for known protein-recognition interactions. The previously unreported NMR backbone assignment of FKBP12.6 revealed extensive doubling of amide resonances, which reflects a slow conformational transition centered in the 80s loop. The primary known physiological function of FKBP12.6 involves its role in regulating the RyR2 isoform of ryanodine receptor Ca{sup 2+} channels in cardiac muscle, pancreatic β islets and the central nervous system. With only a single previously reported X-ray structure of FKBP12.6, bound to the immunosuppressant rapamycin, structural inferences for this protein have been drawn from the more extensive studies of the homologous FKBP12. X-ray structures at 1.70 and 1.90 Å resolution from P2{sub 1} and P3{sub 1}21 crystal forms are reported for an unligated cysteine-free variant of FKBP12.6 which exhibit a notable diversity of conformations. In one monomer from the P3{sub 1}21 crystal form, the aromatic ring of Phe59 at the base of the active site is rotated perpendicular to its typical orientation, generating a steric conflict for the immunosuppressant-binding mode. The peptide unit linking Gly89 and Val90 at the tip of the protein-recognition ‘80s loop’ is flipped in the P2{sub 1} crystal form. Unlike the >30 reported FKBP12 structures, the backbone conformation of this loop closely follows that of the first FKBP domain of FKBP51. The NMR resonances for 21 backbone amides of FKBP12.6 are doubled, corresponding to a slow conformational transition centered near the tip of the 80s loop, as recently reported for 31 amides of FKBP12. The comparative absence of doubling for residues along the opposite face of the active-site pocket in FKBP12.6 may in part reflect attenuated structural coupling owing to increased conformational plasticity around the Phe59 ring.
Plan de negocios de la empresa Random; pantalones a medida
Marsal Josa, Armando
2017-01-01
Este trabajo trata de la realización del Plan de Negocio de Random, idea de negocio que consiste en una startup que diseña y vende pantalones tipo vaquero y chino a medida, pudiendo el comprador elegir, de entre una serie de detalles de motivos navajos ofrecidos por la marca, la forma de personalizarlos. Tendrán un precio asequible, intermedio entre las grandes marcas (Zara...) y las marcas tradicionales (Levi’s...). Se pretende dar salida a un producto artesanal y de calidad, aprovechando un...
Abdominoplastia y pexia de pubis: estandarización de medidas
O. Ballestas-Campo; A. Pomerane
2014-01-01
La abdominoplastia es el procedimiento de elección para corregir la flacidez abdominal, la lipodistrofia supra e infraumbilical y la diástasis de los rectos abdominales. Los nuevos métodos añaden liposucción para definir el contorno corporal. Presentamos una estandarización de medidas para lograr una cicatriz abdominal baja y pexia pubiana en casos de lipodistrofias tipo III y IV de Matarasso. Realizamos un estudio observacional, descriptivo y retrospectivo, evaluando las historias clínicas y...
International Nuclear Information System (INIS)
Johnson, G.R.; Arik, L.; Foster, C.J.
1989-01-01
The addition of 200 pM monoiodinated human atrial natriuretic factor-(99-126) (125I-hANF) to cultured bovine aortic smooth muscle cells at 37 degree C resulted in a rapid clearance from the medium (t1/2 approximately 7.5 min). Within 5 min, [125I]iodotyrosine126 (125I-Y), Arg125-[125I]iodotyrosine126 (125I-RY) and Phe124-Arg-[125]iodotyrosine126 (125I-FRY) appeared in the medium. The identities of these degradation products were confirmed by (1) retention time on high performance liquid chromatography (HPLC) relative to standards, (2) products generated by digestion with aminopeptidase M, and (3) the absence of the Met110. Preincubation of the cells with ammonium chloride or chloroquine resulted in a significant increase in the intracellular accumulation of radiolabel, indicative of endocytosis and rapid delivery of 125I-hANF to an acidic intracellular compartment (endosome and/or lysosome). Neither ammonium chloride, chloroquine, nor excess unlabeled hANF blocked the rapid appearance in the medium of 125I-RY or 125I-FRY. Bestatin inhibited the generation of 125I-RY, with a concomitant increase in 125I-FRY, suggesting that the 125I-RY is produced by aminopeptidase action on 125I-FRY. The endopeptidase 24.11 (enkephalinase) inhibitor, SCH 39370, did not inhibit the formation of 125I-FRY. These results provide evidence of a peptidase capable of specifically removing the COOH-terminal tripeptide from 125I-hANF. The COOH-terminal tripeptide, Phe124-Arg-Tyr126, was also isolated from cell digests of hANF by HPLC and its identity confirmed by amino acid analysis. Since it is generally believed that the COOH-terminal tripeptide is critical to many of atrial natriuretic factor-(99-126)'s bioactivities, this enzyme may be involved in the inactivation of atrial natriuretic factor-(99-126) in target tissues
Chu, F; Hu, Y; Zhou, Y; Guo, M; Lu, J; Zheng, W; Xu, H; Zhao, J; Xu, L
2018-02-01
Recent evidence has shown that microRNA-126 (miR-126) has been involved in the development and function of immune cells, which contributed to the pathogenesis of related clinical diseases. However, the potential role of miR-126 in the development and function of CD4 + T cells remains largely unknown. Here we first found that the activation and proliferation, as well as the expression of interferon (IFN)-γ, of CD4 + T cells from miR-126 knock-down (KD) mice using the miRNA-sponge technique were enhanced significantly in vitro, compared with those in CD4 + T cells from wild-type (WT) mice. To monitor further the possible effect of miR-126 deficiency on the function of CD4 + T cells in vivo, we used dextran sulphate sodium (DSS)-induced murine model of acute autoimmune colitis and found that miR-126 deficiency could elevate the pathology of colitis. Importantly, the proportion of CD4 + T cells in splenocytes increased significantly in miR-126KD mice. Moreover, the expression levels of CD69 and CD44 on CD4 + T cells increased significantly and the expression level of CD62L decreased significantly. Of note, adoptive cell transfer assay showed that the pathology of colitis was more serious in carboxyfluorescein succinimidyl ester (CFSE)-labelled miR-126KD CD4 + T cell-transferred group, compared with that in the CFSE-labelled WT CD4 + T cells transferred group. Consistently, the expression levels of CD69 and CD44 on CFSE + cells increased significantly. Furthermore, both the proliferation and IFN-γ secretion of CFSE + cells also increased significantly in the CFSE-labelled miR-126KD CD4 + T cell-transferred group. Mechanistic evidence showed that the expression of insulin receptor substrate 1 (IRS-1), as a functional target of miR-126, was elevated in CD4 + T cells from miR-126KD mice, accompanied by altered transduction of the extracellular regulated kinase, protein B (AKT) and nuclear factor kappa B (NF-κB) pathway. Our data revealed a novel role in which miR-126
MEDIDAS DE NÚCLEO INFLACIONARIO PARA COSTA RICA
Directory of Open Access Journals (Sweden)
Gabriela Saborío Muñoz
2003-07-01
Full Text Available En este documento se elaboran y evalúan medidas alternativas de núcleo inflacionario para Costa Rica. La idea fundamental contempla al núcleo inflacionario como un indicador de la tendencia subyacente de la inflación capaz de capturar el componente del cambio total de precios común a todos los bienes y servicios, cuya persistencia se mantendría en el mediano y largo plazo y que excluye los cambios en los precios relativos de estos. La medida de núcleo inflacionario seleccionada se contrasta con el Índice de Núcleo Inflacionario (INI, indicador de inflación subyacente actualmente utilizado por el Banco Central de Costa Rica (BCCR.El Índice Subyacente de Inflación (ISI, definido como una medida de núcleo inflacionario que excluye un 30,7% del peso total del Índice de Precios al Consumidor (IPC, refleja más fielmente la tendencia subyacente de la inflación y logra capturar el movimiento más permanente del nivel general de precios, aislando las variaciones en precios relativos. Además, el ISI es fácil de calcular e interpretar lo cual ayuda a incrementar la transparencia y credibilidad de la política monetaria. También es un indicador oportuno, aumentando su valor para los que formulan la política monetaria. Por último, el ISI supera algunas de las limitaciones del INI, como son la falta de un criterio estadístico para definir el punto de corte de los bienes y servicios a excluir y el alto porcentaje del peso total del IPC eliminado. AbstractThis paper builds and evaluates several alternative measures of core inflation for Costa Rica. The chosen measure of core inflation is contrasted with the core inflation index (INI, which is the indicator of underlying inflation used today by the Central Bank of Costa Rica (BCCR. The main idea is that core inflation is a good indicator of the underlying inflation and catches the part of overall price change common to all the goods and services that is expected to persist in the
Small stress molecules inhibit aggregation and neurotoxicity of prion peptide 106-126
International Nuclear Information System (INIS)
Kanapathipillai, Mathumai; Ku, Sook Hee; Girigoswami, Koyeli; Park, Chan Beum
2008-01-01
In prion diseases, the posttranslational modification of host-encoded prion protein PrP c yields a high β-sheet content modified protein PrP sc , which further polymerizes into amyloid fibrils. PrP106-126 initiates the conformational changes leading to the conversion of PrP c to PrP sc . Molecules that can defunctionalize such peptides can serve as a potential tool in combating prion diseases. In microorganisms during stressed conditions, small stress molecules (SSMs) are formed to prevent protein denaturation and maintain protein stability and function. The effect of such SSMs on PrP106-126 amyloid formation is explored in the present study using turbidity, atomic force microscopy (AFM), and cellular toxicity assay. Turbidity and AFM studies clearly depict that the SSMs-ectoine and mannosylglyceramide (MGA) inhibit the PrP106-126 aggregation. Our study also connotes that ectoine and MGA offer strong resistance to prion peptide-induced toxicity in human neuroblastoma cells, concluding that such molecules can be potential inhibitors of prion aggregation and toxicity
Fundamentos e métodos de medidas de energia dinâmica no SPT
Directory of Open Access Journals (Sweden)
Antonio Belincanta
2000-05-01
Full Text Available Discutem-se neste trabalho os métodos disponíveis no Brasil e no exterior para a medida da energia transferida às hastes no SPT, apresentando-se inclusive registros típicos dos eventos dinâmicos correspondentes
miR-126 is downregulated in cystic fibrosis airway epithelial cells and regulates TOM1 expression.
LENUS (Irish Health Repository)
Oglesby, Irene K
2010-02-15
Cystic fibrosis (CF) is one of the most common lethal genetic diseases in which the role of microRNAs has yet to be explored. Predicted to be regulated by miR-126, TOM1 (target of Myb1) has been shown to interact with Toll-interacting protein, forming a complex to regulate endosomal trafficking of ubiquitinated proteins. TOM1 has also been proposed as a negative regulator of IL-1beta and TNF-alpha-induced signaling pathways. MiR-126 is highly expressed in the lung, and we now show for the first time differential expression of miR-126 in CF versus non-CF airway epithelial cells both in vitro and in vivo. MiR-126 downregulation in CF bronchial epithelial cells correlated with a significant upregulation of TOM1 mRNA, both in vitro and in vivo when compared with their non-CF counterparts. Introduction of synthetic pre-miR-126 inhibited luciferase activity in a reporter system containing the full length 3\\'-untranslated region of TOM1 and resulted in decreased TOM1 protein production in CF bronchial epithelial cells. Following stimulation with LPS or IL-1beta, overexpression of TOM1 was found to downregulate NF-kappaB luciferase activity. Conversely, TOM1 knockdown resulted in a significant increase in NF-kappaB regulated IL-8 secretion. These data show that miR-126 is differentially regulated in CF versus non-CF airway epithelial cells and that TOM1 is a miR-126 target that may have an important role in regulating innate immune responses in the CF lung. To our knowledge, this study is the first to report of a role for TOM1 in the TLR2\\/4 signaling pathways and the first to describe microRNA involvement in CF.
Medida de la eficiencia ambiental en la industria cerámica española
Directory of Open Access Journals (Sweden)
Sala Garrido, Ramon
2008-01-01
Full Text Available En el trabajo de Färe, Grosskopf y Hernández-Sancho (2004 se propone un índice de eficiencia medioambiental, para medir el grado en el que las empresas generan outputs deseables al mismo tiempo que reducen su outputs no deseables. Este indicador consiste en una ratio entre una medida para outputs deseables y otra para no deseables. Cada uno de ellos está basado en el uso de las funciones distancia. El índice de los outputs deseables mide el éxito de una empresa k en aumentar estos outputs utilizando el mismo número de inputs y generando el mismo nivel de outputs no deseables. Esta medida de eficiencia medioambiental se ha aplicado a la industria de los pavimentos cerámicos sobre una muestra de empresas a las que se ha aplicado un test de Kruskal-Wallis para determinar la utilidad de este indicador.
Pandemia influenza A/H1N1 2009 em Portugal : estratégias de intervenção e saúde pública
Pinto, Carla Cristina Clemente Rodrigues
2011-01-01
RESUMO - Introdução: A necessidade de gestão da ameaça de uma pandemia obriga à gestão da incerteza absoluta. O desconhecimento científico quanto a uma série de factores tais como, as características dos vírus causadores de infecções, a efectividade das medidas de prevenção e de tratamento, contribuiu para a dificuldade de actuação a vários níveis. Face à evolução da situação epidemiológica mundial no campo da gripe, Portugal reviu e adaptou o seu plano de contingência para a g...
Directory of Open Access Journals (Sweden)
Weimar Kunz Sebba Barroso de Souza
2011-08-01
Full Text Available FUNDAMENTO: A medida casual da pressão arterial (PA pelos profissionais de saúde está sujeita a uma grande variabilidade, sendo necessário buscar novos métodos que possam superar essa limitação. OBJETIVO: Comparar e avaliar a correlação entre os níveis de PA obtidos por meio da automedida da pressão arterial (AMPA com a medida casual e com a monitorização ambulatorial da pressão arterial (MAPA. MÉTODOS: Avaliamos hipertensos que realizaram as três metodologias de medida da PA com intervalo menor que 30 dias; as médias das pressões foram utilizadas para comparação e correlação. Foram empregados os aparelhos: OMRON 705 CP (medida casual, OMRON HEM 714 (AMPA e SPACELABS 9002 (MAPA. RESULTADOS: Foram avaliados 32 pacientes, 50,09% mulheres, idade média 59,7 (± 11,2 anos, média do IMC 26,04 (± 3,3 kg/m². Valores médios de pressão sistólica (PAS e pressão diastólica (PAD para a AMPA foram de 134 (± 15,71mmHg e 79,32 (± 12,38 mmHg. Na medida casual as médias da PAS e PAD foram, respectivamente, 140,84 (± 16,15mmHg e 85 (± 9,68 mmHg. Os valores médios da MAPA na vigília foram 130,47 (± 13,26 mmHg e 79,84 (± 9,82 mmHg para PAS e PAD, respectivamente. Na análise comparativa, a AMPA apresentou valores semelhantes aos da MAPA (p > 0,05 e diferentes da medida casual (p < 0,05. Na análise de correlação a AMPA foi superior à medida casual, considerando a MAPA como o padrão de referência nas medidas tensionais. CONCLUSÃO: A AMPA apresentou melhor comparação com a MAPA do que a medida casual e também se correlacionou melhor com a aquela, especialmente para a pressão diastólica, devendo ser considerada uma alternativa com baixo custo para o acompanhamento do paciente hipertenso.
Directory of Open Access Journals (Sweden)
Fahd Boundi Chraki
2017-07-01
Full Text Available El presente trabajo tiene como objeto analizar los determinantes de las relaciones reales de intercambio de España con Alemania, tomando como período 1970-2010. Para tal propósito, se lleva a cabo un análisis de series temporales aplicando pruebas de raíces unitarias y un test de cointegración, siendo el marco teórico de referencia el enfoque de Anwar Shaikh de la ventaja absoluta de costo intrasectorial. Finalmente, el análisis econométrico constata que el tipo de cambio real efectivo entre España y Alemania se encuentra sujeto en el largo plazo a los costos laborales unitarios reales relativos de la industria manufacturera de ambos países.
The leukodystrophy protein FAM126A (hyccin) regulates PtdIns(4)P synthesis at the plasma membrane.
Baskin, Jeremy M; Wu, Xudong; Christiano, Romain; Oh, Michael S; Schauder, Curtis M; Gazzerro, Elisabetta; Messa, Mirko; Baldassari, Simona; Assereto, Stefania; Biancheri, Roberta; Zara, Federico; Minetti, Carlo; Raimondi, Andrea; Simons, Mikael; Walther, Tobias C; Reinisch, Karin M; De Camilli, Pietro
2016-01-01
Genetic defects in myelin formation and maintenance cause leukodystrophies, a group of white matter diseases whose mechanistic underpinnings are poorly understood. Hypomyelination and congenital cataract (HCC), one of these disorders, is caused by mutations in FAM126A, a gene of unknown function. We show that FAM126A, also known as hyccin, regulates the synthesis of phosphatidylinositol 4-phosphate (PtdIns(4)P), a determinant of plasma membrane identity. HCC patient fibroblasts exhibit reduced PtdIns(4)P levels. FAM126A is an intrinsic component of the plasma membrane phosphatidylinositol 4-kinase complex that comprises PI4KIIIα and its adaptors TTC7 and EFR3 (refs 5,7). A FAM126A-TTC7 co-crystal structure reveals an all-α-helical heterodimer with a large protein-protein interface and a conserved surface that may mediate binding to PI4KIIIα. Absence of FAM126A, the predominant FAM126 isoform in oligodendrocytes, destabilizes the PI4KIIIα complex in mouse brain and patient fibroblasts. We propose that HCC pathogenesis involves defects in PtdIns(4)P production in oligodendrocytes, whose specialized function requires massive plasma membrane expansion and thus generation of PtdIns(4)P and downstream phosphoinositides. Our results point to a role for FAM126A in supporting myelination, an important process in development and also following acute exacerbations in multiple sclerosis.
Nuevo criterio de complejidad utilizando una medida de eficiencia
Munduate del Río, Arantza; Pérez Prados, Antonio; Cano Sevilla, Francisco J.
1995-01-01
Centrado en el campo de los árboles de decisión, este trabajo estudia la forma de selección de un árbol óptimo entre los posibles árbo1es obtenidos a partir del análisis de un conjunto de datos, utilizando para ello una cantidad criterio que combina linealmente dos medidas de la calidad de un árbol: el error de resustitución y la eficiencia. Analizando el efecto de un proceso de poda en la cantidad criterio se obtiene una sucesión finita de subárboles rnínimos óptimamente podados del árbol má...
Katarzyńska, Dorota; Hrabia, Anna; Kowalik, Kinga; Sechman, Andrzej
2015-03-01
The aim of this study was to compare the in vitro effects of 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD), 3,3',4,4',5-pentachlorobiphenyl (PCB 126; a coplanar PCB congener) and 2,2'4,4',5,5'-hexachlorobiphenyl (PCB153; non-coplanar PCB) on mRNA expression of thyroid-restricted genes, i.e. sodium iodide symporter (NIS), thyroid peroxidase (TPO) and thyroglobulin (TG), and thyroid hormone secretion from the thyroid gland of the laying chicken. Relative expression levels of NIS, TG and TPO genes and thyroxine (T4) and triiodothyronine (T3) secretion from the thyroidal explants were quantified by the real-time qPCR and RIA methods, respectively. In comparison with the control group, TCDD and PCB 126 significantly increased mRNA expression of TPO and TG genes. TCDD did not affect NIS mRNA levels, but PCB 126 decreased its expression. No effect of PCB 153 on the expression of these genes was observed. TCDD and PCB 126 significantly decreased T4 and T3 secretion. There was no significant effect of PCB 153 on these hormone secretions. In conclusion, the results obtained show that in comparison with non-coplanar PCB 153, TCDD and coplanar PCB 126 can directly affect thyroid hormone synthesis and secretion, and in consequence, they may disrupt the endocrine function of the thyroid gland of the laying chicken. Copyright © 2015 Elsevier B.V. All rights reserved.
Medidas de aislamiento en enfermedades transmisibles dentro del ámbito hospitalario
Villanueva Rábano, Raúl
2016-01-01
En el ámbito hospitalario, son un problema frecuente las infecciones nosocomiales, causadas por las enfermedades transmisibles que pasan de unos pacientes a otros. Estas infecciones son potencialmente prevenibles, a través de medidas de aislamiento llevadas a cabo por el personal sanitario y no sanitario encargado de atender al paciente. En este aspecto, el papel del personal de enfermería es de fundamental importancia dado que mantienen un estrecho contacto con el paciente como cuidadores pr...
17 CFR 248.126 - Delivery of opt out notices.
2010-04-01
... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.126 Delivery... Internet Web site at which the consumer obtained a product or service electronically and requires the... by e-mail from the affiliate providing the notice; or (3) Posts the notice on an Internet Web site...
Directory of Open Access Journals (Sweden)
Qunwen Pan
2018-01-01
Full Text Available Endothelial progenitor cells (EPCs have shown the potential for treating ischemic stroke (IS, while microRNA-126 (miR-126 is reported to have beneficial effects on endothelial function and angiogenesis. In this study, we investigated the effects of miR-126 overexpression on EPCs and explore the efficacy of miR-126-primed EPCs (EPCmiR-126 in treating IS. The effects of miR-126 overexpression on EPC proliferation, migratory, tube formation capacity, reactive oxygen species (ROS production, and nitric oxide (NO generation were determined. In in vivo study, the effects of EPCmiR-126 on the cerebral blood flow (CBF, neurological deficit score (NDS, infarct volume, cerebral microvascular density (cMVD, and angiogenesis were determined. Moreover, the levels of circulating EPCs (cEPCs and their contained miR-126 were measured. We found (1 miR-126 overexpression promoted the proliferation, migration, and tube formation abilities of EPCs; decreased ROS; and increased NO production of EPCs via activation of PI3K/Akt/eNOS pathway; (2 EPCmiR-126 was more effective than EPCs in attenuating infarct volume and NDS and enhancing cMVD, CBF, and angiogenesis; and (3 infusion of EPCmiR-126 increased the number and the level of miR-126 in cEPCs. Our data indicate that miR-126 overexpression enhanced the function of EPCs in vitro and in vivo.
G 126.1-0.8-14: A molecular shell related to Sh2-187
Cichowolski, S.; Pineault, S.; Gamen, R.; Ortega, M. E.; Arnal, E. M.; Suad, L. A.
2014-10-01
We present a multi-wavelength study of a region where a well defined molecular shell, named G 126.1-0.8-14, is observed. The distance of G 126.1-0.8-14 is about 1 kpc. Based on HI and CO data we analyze the atomic and molecular gas related to the structure and estimate its main physical properties. From the radio continuum and infrared data we analyze whether the emission associated with G 126.1-0.8-14 has a thermal origin. To disentangle the possible origin of the shell, and given the lack of catalogued O-type stars in the area, we observed with GEMINI the spectra of four OB stars located in projection inside the shell, to get their accurate spectral types and distances. The young HII region Sh2-187 is located onto the densest part of this molecular shell. A search for young stellar object candidates (cYSOs) was made using infrared point source catalogs. Several cYSOs are found spread out onto the shell. Based on all the available data, we discuss the possible origin of G 126.1-0.8-14 as well as its role in the formation of a new generation of stars.
Directory of Open Access Journals (Sweden)
Maria Helena Baena de Moraes Lopes
1999-10-01
Full Text Available Durante 1993 e 1994 foi realizada reciclagem em Precauções-Padrão para os profissionais de enfermagem do Centro de Atenção Integral à Saúde da Mulher (CAISM. Em 1995 foi avaliada, por observação direta nos setores, a adesão a estas medidas, o uso adequado, a acessibilidade e disponibilidade de luvas e caixas para descarte de materiais pérfuro-cortantes. Registraram-se 60 observações e 232 procedimentos. Em 164 (71% destes houve adoção das medidas, não ocorrendo o mesmo em outros 68 (29%. Evidenciou-se a necessidade de enfatizar a lavagem de mãos e o não-reencape de agulhas.Durante el periodo de 1993 y 1994 se realizó la actualización en medidas de precaución patrón para los profisionales de enfermeria del Centro de Atención Integral a la Salud de la Mujer (CAISM. En 1995, se realizó una evaluación a través de la observación directa en los sectores; la adhesión a estas medidas, el uso adecuado y la disposición de guantes y cajas para descarte de materiales corto-punzantes. Se registraron 60 observaciones e 232 procedimientos, 164 de ellos (71% adoptaron el uso de las medidas y en 68 (29% esto no ocurrió. Es evidente la necesidad de dar énfasis al lavado de las manos y colocar de nuevo la camisa (tapa a las agujas.During 1993 and 1994, a recycling program on Standard Precautions was conducted for the nursing personnel at the Women's Health Centre (CAISM. In 1995, an evaluation was obtained through direct observation of these sectors regarding the adoption of these measures, the adequate use, access and availability of gloves and boxes for the disposal of perforating, sharp material. Sixty observations and 232 procedures were reported. One hundred sixty four procedures (71% adopted these measures and 68 procedures (29% did not. It was evident that the need to wash hands and not to use needles twice should be emphasized.
Kania-Korwel, Izabela; Wu, Xianai; Wang, Kai; Lehmler, Hans-Joachim
2017-09-01
Exposure to PCB 126, an environmentally relevant aryl hydrocarbon receptor agonist, is an environmental factor causing hepatic steatosis in rodent models; however, the lipidome of PCB 126-exposed rats has not been investigated in-depth. The objective of the present study was therefore to characterize dose-dependent changes in the lipid profile in the liver of male Sprague-Dawley rats exposed to PCB 126. Rats were exposed for three month to intraperitoneal injections of 0.01, 0.05 and 0.2μmol/kg bw PCB 126 in corn oil. Control animals were exposed in parallel and received corn oil alone. Lipids were extracted from whole liver homogenate and levels of polar lipids and fatty acids incorporated into triglycerides (FA TAGs ) were determined with tandem mass spectrometry using electrospray ionization. PCB 126 exposure increased the hepatic content of polar lipids and FA TAGs . Protein adjusted levels of several polar lipid classes, in particular phosphatidylserine levels, decreased, whereas FA TAGs levels typically increased with increasing PCB 126 dose. Sensitive, dose-dependent endpoints of PCB 126 exposure included an increase in levels of adrenic acid incorporated into triglycerides and changes in levels of certain ether-linked phospholipid and 1-alkyl/1-alkenyldiacylglycerol species, as determined using partial least square discriminant analysis (PLS-DA) and ANOVA. These changes in the composition of polar lipids and fatty acid in the liver of PCB 126 exposed rats identified several novel markers of PCB 126-mediated fatty liver disease that need to be validated in further studies. Copyright © 2017 Elsevier B.V. All rights reserved.
Rouigari, Maedeh; Dehbashi, Moein; Ghaedi, Kamran; Pourhossein, Meraj
2018-07-01
For the first time, we used molecular signaling pathway enrichment analysis to determine possible involvement of miR-126 and IRS-1 in neurotrophin pathway. In this prospective study, Validated and predicted targets (targetome) of miR-126 were collected following searching miRtarbase (http://mirtarbase.mbc.nctu.edu.tw/) and miRWalk 2.0 databases, respectively. Then, approximate expression of miR-126 targeting in Glioma tissue was examined using UniGene database (http://www.ncbi. nlm.nih.gov/unigene). In silico molecular pathway enrichment analysis was carried out by DAVID 6.7 database (http://david. abcc.ncifcrf.gov/) to explore which signaling pathway is related to miR-126 targeting and how miR-126 attributes to glioma development. MiR-126 exerts a variety of functions in cancer pathogenesis via suppression of expression of target gene including PI3K, KRAS, EGFL7, IRS-1 and VEGF. Our bioinformatic studies implementing DAVID database, showed the involvement of miR-126 target genes in several signaling pathways including cancer pathogenesis, neurotrophin functions, Glioma formation, insulin function, focal adhesion production, chemokine synthesis and secretion and regulation of the actin cytoskeleton. Taken together, we concluded that miR-126 enhances the formation of glioma cancer stem cell probably via down regulation of IRS-1 in neurotrophin signaling pathway. Copyright© by Royan Institute. All rights reserved.
Dietary Selenium as a Modulator of PCB 126–Induced Hepatotoxicity in Male Sprague-Dawley Rats
Lai, Ian K.; Chai, Yingtao; Simmons, Donald; Watson, Walter H.; Tan, Rommel; Haschek, Wanda M.; Wang, Kai; Wang, Bingxuan; Ludewig, Gabriele; Robertson, Larry W.
2011-01-01
Homeostasis of selenium (Se), a critical antioxidant incorporated into amino acids and enzymes, is disrupted by exposure to aryl hydrocarbon receptor (AhR) agonists. Here we examined the importance of dietary Se in preventing the toxicity of the most toxic polychlorinated biphenyl congener, 3,3′,4,4′,5-pentachlorobiphenyl (PCB 126), a potent AhR agonist. Male Sprague-Dawley rats were fed a modified AIN-93 diet with differing dietary Se levels (0.02, 0.2, and 2 ppm). Following 3 weeks of acclimatization, rats from each dietary group were given a single ip injection of corn oil (vehicle), 0.2, 1, or 5 μmol/kg body weight PCB 126, followed 2 weeks later by euthanasia. PCB exposure caused dose-dependent increases in liver weight and at the highest PCB 126 dose decreases in whole body weight gains. Hepatic cytochrome P-450 (CYP1A1) activity was significantly increased even at the lowest dose of PCB 126, indicating potent AhR activation. PCB exposure diminished hepatic Se levels in a dose-dependent manner, and this was accompanied by diminished Se-dependent glutathione peroxidase activity. Both these effects were partially mitigated by Se supplementation. Conversely, thioredoxin (Trx) reductase activity and Trx oxidation state, although significantly diminished in the lowest dietary Se groups, were not affected by PCB exposure. In addition, PCB 126–induced changes in hepatic copper, iron, manganese, and zinc were observed. These results demonstrate that supplemental dietary Se was not able to completely prevent the toxicity caused by PCB 126 but was able to increase moderately the levels of several key antioxidants, thereby maintaining them roughly at normal levels. PMID:21865291
SIMULASI PREDIKSI PROBABILITAS AWAL MUSIM HUJAN DAN PANJANG MUSIM HUJAN DI ZOM 126 DENPASAR
Directory of Open Access Journals (Sweden)
Yunus Subagyo Swarinoto
2014-05-01
Full Text Available Simulasi prediksi probabilitas Awal Musim Hujan (AMH dan Panjang Musim Hujan (PMH terkait kondisi Indonesia SSTA, Nino34 SSTA, dan IODM SSTA sebagai prediktor telah dilakukan di Zona Musim (ZOM 126 Denpasar. Lokasi ini dipilih karena memiliki pola curah hujan dasarian maupun bulanan pola monsunal, sehingga terdapat perbedaan yang jelas antara kondisi Musim Hujan (MH dengan kondisi Musim Kemarau (MK. Kejadian puncak dan lembah curah hujan pada lokasi ini berlangsung sekali dalam satu tahun. Puncak hujan berlangsung bersamaan dengan MH dan sebaliknya lembah hujan berlangsung bersamaan dengan MK. Untuk ZOM 126 Denpasar, simulasi prediksi probabilitas ini dihitung berdasaran pada kondisi seluruh prediktor sebagaimana tersebut di atas. Time lag 3, 2, dan 1 bulan digunakan pada data dasarian awal yang diolah. Data yang memiliki nilai koefisien determinasi R2 terbesar dari persamaan regresi multi linear yang dibentuk berdasarkan pada kondisi prediktor di atas selanjutnya digunakan dalam menentukan simulasi prediksi probabilitas AMH dan PMH. Hasil menunjukkan bahwa kondisi Indonesia SSTA sangat berperan dalam menentukan nilai probabilitas maju-mundur AMH dan panjang-pendek PMH di ZOM 126 Denpasar, khususnya pada saat Nino34 dan IODM SSTA lemah. Sementara itu kondisi Nino34 SSTA dan IODM Anomaly memiliki peran sebagai penguat/pelemah terhadap probabilitas kejadian AMH dan PMH di ZOM 126 Denpasar. The probability forecast simulation of Rainy Season Onset and the Lenght of Season based on Indonesia SST, Nino34 SST, and IODM SST Anomalies as predictors, have been done over Seasonal Forecast Area (SFA 126 Denpasar. This SFA was chosen as a case in relation to it’s monsoonal rainfall pattern. In this SFA there were clearly different condition between Rainy and Dry Seasons. Basically the peak of Rainy and Dry Seasons only happen once a year. The peak of Rainy Season commonly takes place during early year but Dry Season occurs in the middle year. The
Directory of Open Access Journals (Sweden)
Ilse Maria Beuren
2016-04-01
Full Text Available O estudo objetiva verificar se as medidas de desempenho são variáveis mediadoras entre a importância dos recursos estratégicos e a avaliação de desempenho em empresas brasileiras. De modo específico o estudo busca investigar a percepção dos gestores quanto à importância atribuída às medidas de desempenho tradicionais e não tradicionais e aos recursos estratégicos de capital humano, estrutural e físico em empresas brasileiras. O estudo pauta-se na pesquisa realizada por Widener (2006 em empresas norte americanas. Assim, um levantamento foi realizado junto aos gestores das empresas listadas na BM&FBovespa nos níveis 1 e 2 de Governança Corporativa. Na análise dos dados foi aplicada estatística descritiva e análise fatorial. Os resultados mostram que os gestores atribuem importância a várias medidas de desempenho, mas a estatística descritiva evidencia que a maior importância é atribuída às medidas de retorno e financeiras tradicionais. Dentre os recursos estratégicos, o capital humano desponta como o recurso mais importante para as empresas analisadas, seguido do capital estrutural e do capital físico. A partir das relações estabelecidas na pesquisa de base e aplicadas neste estudo, conclui-se que as medidas de desempenho são variáveis mediadoras entre a importância dos recursos estratégicos e o desempenho na percepção dos gestores.
Directory of Open Access Journals (Sweden)
Thiago Galvão Tiradentes Decina
2016-03-01
Full Text Available RESUMO Este trabalho teve como objetivo analisar, por meio de simulações hidrológicas e hidráulicas, o desempenho de algumas medidas de controle de inundação, estruturais e não estruturais. Para tanto, os mapas e demais informações espaciais da bacia hidrográfica do Córrego do Gregório, em São Carlos (SP, foram digitalizadas com auxílio do software de geoprocessamento ArcGIS(r e imagens de satélite de alta resolução. Com base nessas informações, foram propostos cenários alternativos que incorporaram as medidas de controle. Através da utilização dos softwares HEC-HMS e HEC-RAS realizaram-se as modelações hidráulicas e hidrológicas, utilizando tempos de retorno de 25, 50 e 100 anos para a chuva de projeto. Com os resultados obtidos (hidrogramas de cheia e manchas de inundação referentes a cada tempo de retorno, foi possível analisar as medidas, comparando-se os diferentes cenários. Concluiu-se, para este caso, que os melhores resultados correspondem à associação das medidas estruturais e não estruturais. Contudo, também foi verificado que, mesmo com a concretização do cenário mais favorável, o problema das inundações não seria satisfatoriamente equacionado, o que revela a necessidade de se considerar outras medidas para minimizar os prejuízos decorrentes das inundações, tais como medidas de controle na fonte, seguros contra inundações e sistemas de alerta antecipados.
The prognostic value of microRNA-126 and microvessel density in patients with stage II colon cancer
DEFF Research Database (Denmark)
Hansen, Torben Frøstrup; Kjær-Frifeldt, Sanne; Morgenthaler, Søren
2014-01-01
BACKGROUND: Angiogenesis plays a pivotal role in malignant tumour growth and the metastatic process. We analysed the prognostic value of two angiogenesis parameters, microRNA-126 (miRNA-126) and microvessel density (MVD), in a population based cohort of patients operated for stage II colon cancer...... estimate was not associated with either RF-CSS, p = 0.49, or OS, p = 0.94.CONCLUSION: The current population based study of patients operated for stage II colon cancer demonstrated correlations between several prognostic unfavourable characteristics and miRNA-126 and argues for a possible prognostic impact...
Nivel de conocimiento y aplicación de las medidas de bioseguridad del personal de enfermería
Directory of Open Access Journals (Sweden)
Luz Marina Bautista-Rodríguez
2013-12-01
Full Text Available Objetivo. Identificar el nivel de conocimiento y aplicación de las medidas de bioseguridad que tiene el personal de Enfermería. Materiales y Métodos. Se realizó investigación cuantitativa, de tipo descriptivo transversal, con una muestra de 96 personas pertenecientes. La información se recolectó a través de una encuesta y una lista de chequeo, la cual se analizó por medio de tabulaciones y representaciones gráficas. Resultados. El personal de Enfermería de la Clínica San José tiene un conocimiento regular en un 66% frente a las medidas de bioseguridad y un 70% de aplicación deficiente frente a estas. Conclusión. Se identificó que las principales medidas de bioseguridad, como métodos de barrera, eliminación adecuada del material contaminado, manejo adecuado de los elementos cortopunzante, lavado de manos no están siendo aplicadas correctamente por el personal de Enfermería de la institución, convirtiéndose estas situaciones en un factor de riesgo para el presentar un accidente laboral esta población.
Revisión de ideación, comportamiento suicida y medidas de evaluación psicológicas
Directory of Open Access Journals (Sweden)
Giselle Pianowski
2015-01-01
Full Text Available El presente estudio tuvo como objetivo una revisión en la base ScienceDirect de la literatura sobre ideación, comportamiento y medidas de evaluación del suicidio en los últimos años. Utilizamos las palabras suicide, ideation y scale, y para procesamiento, suicidal ideation, suicide ideation y rating scale, excluyendo estudios que no presentaban el suicidio como enfoque y no utilizaban medidas de evaluación, restringiéndose a 176 artículos. Los resultados revelaron una muestra preferentemente femenina, con edad económicamente activa y varios niveles de escolaridad. Sobre los objetivos, hubo prevalencia del enfoque del constructo y su relación con otras variables, resaltándose depresión, dolor crónico, desesperanza, pensamiento rumiante e histórico traumático, además del uso de substancias, apoyo familiar y social, condiciones socioeconómicas, sexualidad y otros. Se identificaron la Suicide Probability Scale, la Beck Scale for Suicide Ideation, y la Beck Depression Inventory Item, como medidas prioritarias en la evaluación de la ideación y/o comportamiento suicida.
(2008) SWJ:121-126 Evolutionary Trend of The Jarawa Younger ...
African Journals Online (AJOL)
Dr. Ahmed
2008) SWJ:121-126. Evolutionary Trend of The Jarawa Younger Granite. TABLE 1. CHEMICAL COMPOSITION OF HORNBLENDE PORPHYRY GRANITES. Sample. No. Oxide (%). K2O CaO MgO FeO Fe2O3. AL2O3 Na2O PbO. JA-HP.
27 CFR 46.126 - Change in name or address.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Change in name or address... (occupational) Tax Stamps § 46.126 Change in name or address. (a) Change in name. If there is a change in the corporate or firm name, or in the trade name, as shown on TTB Form 5630.5t, the taxpayer must file an...
Large-scale shell model calculations for the N=126 isotones Po-Pu
International Nuclear Information System (INIS)
Caurier, E.; Rejmund, M.; Grawe, H.
2003-04-01
Large-scale shell model calculations were performed in the full Z=82-126 proton model space π(Oh 9/2 , 1f 7/2 , Oi 13/2 , 2p 3/2 , 1f 5/2 , 2p 1/2 ) employing the code NATHAN. The modified Kuo-Herling interaction was used, no truncation was applied up to protactinium (Z=91) and seniority truncation beyond. The results are compared to experimental data including binding energies, level schemes and electromagnetic transition rates. An overall excellent agreement is obtained for states that can be described in this model space. Limitations of the approach with respect to excitations across the Z=82 and N=126 shells and deficiencies of the interaction are discussed. (orig.)
Test de campo para valorar la resistencia de los músculos del tronco
Directory of Open Access Journals (Sweden)
Casto Juan-Recio
2014-09-01
Full Text Available El Biering-Sorensen test (BST, el Side Bridge test (SBT y el Ito test (IT son tres de los test de campo más utilizados para medir la resistencia de los músculos del tronco. El objetivo de este estudio fue analizar la fiabilidad absoluta y relativa de los test referidos, así como valorar el efecto de la antropometría de los participantes en el rendimiento en las pruebas. En el estudio participaron 27 jóvenes varones (23,5 ± 4,0 años y físicamente activos. Los participantes realizaron dos sesiones de registro en las que ejecutaron los tres test (recuperación de 8 min entre pruebas y donde se midieron diversas variables antropométricas. La fiabilidad relativa fue buena, con ICC mayores de 0.80 en todos los test, pero no así la fiabilidad absoluta, con SEM que oscilaron entre el 13,36 % en el BST y el 19,89 % en el IT. El IT mostró una correlación negativa con la masa (r= – ,475; p= ,014 y el diámetro bileocrestal (r = – ,404; p = ,040 y el SBT una correlación negativa con la masa (r = –,610; p = ,001, el diámetro bileocrestal (r = –,546; p = ,004, el diámetro biacromial (r= - ,456; p = ,019 y el índice acromioiliaco (r= –,413; p = ,036. Los datos de fiabilidad ab-soluta cuestionan la utilidad de estas pruebas en programas de entrenamiento donde los participantes tienen poco margen de mejora. Además, si se realizan comparaciones entre sujetos es importante tener en cuenta sus diferencias antropométricas, ya que durante la ejecución de los test el cuerpo se utiliza como instrumento de medida.
Medidas de selectividad y sensibilidad en un receptor de AM simplificado
Przylecki Siwek, Maciej
2011-01-01
Se describen las medidas de selectividad y sensibilidad de un receptor de AM simplificado que sólo dispone de una etapa detectora formada por antena de ferrita y un transistor BJT npn polarizado en zona no líneal actuando como un amplificador de clase B. La señal detectada se preamplifica y finalmente se lleva a un amplificador de audio de circuito integrado y al altavoz. Debido a la sencillez la selectividad es variable con la frecuencia de sintonía proporcionando a 392 KHz un...
A revelação de abuso sexual: as medidas adotadas pela rede de apoio
Directory of Open Access Journals (Sweden)
Luísa Fernanda Habigzang
Full Text Available O presente estudo identificou e analisou as medidas adotadas pela rede de apoio de crianças e adolescentes após a revelação de abuso sexual. Participaram 40 meninas, entre oito e 16 anos, vítimas de abuso sexual. As medidas de proteção adotadas pela rede foram mapeadas através de entrevista semi-estruturada. A revelação foi feita aos pais em 42,5% da amostra e 92,5% das pessoas acreditaram. O abrigamento ocorreu em 35% dos casos e o restante permaneceu com a família que afastou o agressor. A atitude de confiança da família na revelação e a denúncia da violência constituíram-se em um fator de proteção. Contudo, o alto índice de abrigamento e o não acompanhamento efetivo do afastamento do agressor representaram fatores de risco.
Comparación de las medidas del ángulo kappa realizadas mediante pupilometría y topografía corneal
Marcos Pérez, Mario
2016-01-01
El ojo no es un sistema óptico centrado, por ello surge la necesidad de definir ejes visuales. El ángulo kappa está formado entre el eje pupilar y la línea de mirada, es un parámetro mensurable y relevante a la hora de afrontar cirugía refractiva. El objetivo del trabajo es demostrar la intercambiabilidad de las medidas de kappa con los dispositivos Galilei G4 y Allegro Topolyzer. En la literatura no se encuentra un estudio similar, con lo que resulta conveniente. Para ello se realizan medida...
Ammonium perchlorate and 3,3,4,4,5-pentachlorobiphenyl (PCB126) are environmental contaminants that are known to disturb thyroid hormone (TH) homeostasis by well defined modes of action that lead to hypothyroidism in the rat. PCB126 increases phase II conjugation of T4 by induc...
International Nuclear Information System (INIS)
Dupiereux, Ingrid; Zorzi, Willy; Lins, Laurence; Brasseur, Robert; Colson, Pierre; Heinen, Ernst; Elmoualij, Benaissa
2005-01-01
Prion diseases are fatal neurodegenerative disorders characterized by the accumulation in the brain of an abnormally misfolded, protease-resistant, and β-sheet rich pathogenic isoform (PrP sc ) of the cellular prion protein (PrP c ). In the present work, we were interested to study the mode of prion protein interaction with the membrane using the 106-126 peptide and small unilamellar lipid vesicles as model. As previously demonstrated, we showed by MTS assay that PrP 106-126 induces alterations in the human neuroblastoma SH-SY5Y cell line. We demonstrated for the first time by lipid-mixing assay and by the liposome vesicle leakage test that PrP 106-126, a non-tilted peptide, induces liposome fusion thus a potential cell membrane destabilization, as supported by membrane integrity assay (LDH). By circular dichroism (CD) analysis we showed that the fusogenic property of PrP 106-126 in the presence of liposome is associated with a predominantly β-sheet structure. These data suggest that the fusogenic property associated with a predominant β-sheet structure exhibited by the prion peptides contributes to the neurotoxicity of these peptides by destabilizing cellular membranes. The latter might be attached at the membrane surface in a parallel orientation as shown by molecular modeling
Luba, Daniel G; DiSario, James A; Rock, Colleen; Saraiya, Devki; Moyes, Kelsey; Brown, Krystal; Rushton, Kristen; Ogara, Maydeen M; Raphael, Mona; Zimmerman, Dayna; Garrido, Kimmie; Silguero, Evelyn; Nelson, Jonathan; Yurgelun, Matthew B; Kastrinos, Fay; Wenstrup, Richard J; Syngal, Sapna
2018-01-01
Lynch syndrome is a genetic disorder that greatly increases risk for colorectal and other cancers, although it is underdiagnosed. Prediction of MLH1, MSH2, and MSH6 (PREMM 1,2,6 ) is a web-based tool that analyzes individuals' personal/family histories of cancer to quantify their likelihood of carrying a germline mutation associated with Lynch syndrome. We investigated the feasibility of systematic risk assessment for Lynch syndrome in a community gastroenterology practice using a patient-completed version of PREMM 1,2,6 . PREMM 1,2,6 was adapted into a computer tablet version designed for self-administration by patients. Individuals presenting to a community gastroenterology office and endoscopy facility in California completed the PREMM 1,2,6 assessment before their visit (n = 3134). The total study duration (8 months) comprised a 2-month initiation period (May 1-June 30, 2013) and a 6-month study period (July 1-December 31, 2013). Genetic counseling and germline analysis for mutations in genes associated with Lynch syndrome (MLH1, MSH2, MSH6, PMS2, and EPCAM) were offered to individuals with PREMM 1,2,6 scores of 5% or higher. Patients and providers completed surveys to evaluate the feasibility and satisfaction with the process. Of the 3134 individuals assessed by PREMM 1,2,6 during the 6-month study period, 177 individuals (5.6%) had scores of 5% or higher. Of these, 146 individuals underwent genetic testing, along with 28 additional participants recruited nonconsecutively during the initiation period. Mutations associated with Lynch syndrome were detected in 3 of the 146 individuals (2.1%) with PREMM 1,2,6 scores of 5% or higher who underwent germline testing, and 3 of the 28 patients (10.7%) recruited during study initiation with PREMM 1,2,6 scores of 5% or higher. Of the participants who underwent genetic analysis, 98.6% stated that they understood the information provided to them. All of the surveyed providers stated that they were satisfied with the
Ciberactivismo: conceptualización, hipótesis y medida
Directory of Open Access Journals (Sweden)
Fernández Prados, Juan Sebastián
2012-08-01
Full Text Available Cyberactivism has emerged as a transposition of unconventional political action to the context of information and communication technologies. This phenomenon raises at least three questions. The first is the definition, delineation and classification of the concept. The second is that of the theoretical perspectives from which to answer questions such as: does the emergence of ICTs in the public sphere enhance civic culture or not? This question led to Pippa Norris to distinguish between mobilization theories and theories of reinforcement. Finally, there is a need to design tools and studies with which to attempt to evaluate and measure the phenomenon, as proposed by the biannual study entitled The Internet in Britain and in the work of the University of Southern California through the Center for the Digital Future. Following this review, we develop a new definition of cyberactivism and propose some instrument to measure the phenomenon.
La emergencia del ciberactivismo como una traslación de la acción política no convencional en el contexto de las tecnologías de la información y la comunicación plantea al menos tres cuestiones. La definición, delimitación y clasificación del mismo concepto. El segundo aspecto que suscita el ciberactivismo es de carácter teórico al plantear las siguientes perspectivas antitéticas: ¿Provoca o no la aparición de las TIC en la esfera política un aumento de la cultura cívica? Pregunta que lleva a Pippa Norris a distinguir entre las teorías de la movilización y las teorías del refuerzo. Finalmente, surge la necesidad de diseñar instrumentos y estudios que procuran en parte una evaluación y medida del fenómeno del ciberactivismo tal y como lo lleva a cabo el estudio bianual <i>The Internet in Britaini> o los trabajos de la Universidad del Sur de California a través del Center for the Digital Future. Tras esta revisión, desarrollaremos propuestas conceptuales y metodológicas para medir
Zhang, Wenshuo; Sargis, Robert M.; Volden, Paul A.; Carmean, Christopher M.; Sun, Xiao J.; Brady, Matthew J.
2012-01-01
Dioxins and dioxin-like compounds encompass a group of structurally related heterocyclic compounds that bind to and activate the aryl hydrocarbon receptor (AhR). The prototypical dioxin is 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD), a highly toxic industrial byproduct that incites numerous adverse physiological effects. Global commercial production of the structurally similar polychlorinated biphenyls (PCBs), however, commenced early in the 20th century and continued for decades; dioxin-like PCBs therefore contribute significantly to total dioxin-associated toxicity. In this study, PCB 126, the most potent dioxin-like PCB, was evaluated with respect to its direct effects on hepatic glucose metabolism using primary mouse hepatocytes. Overnight treatment with PCB 126 reduced hepatic glycogen stores in a dose-dependent manner. Additionally, PCB 126 suppressed forskolin-stimulated gluconeogenesis from lactate. These effects were independent of acute toxicity, as PCB 126 did not increase lactate dehydrogenase release nor affect lipid metabolism or total intracellular ATP. Interestingly, provision of cells with glycerol instead of lactate as the carbon source completely restored hepatic glucose production, indicating specific impairment in the distal arm of gluconeogenesis. In concordance with this finding, PCB 126 blunted the forskolin-stimulated increase in phosphoenolpyruvate carboxykinase (PEPCK) mRNA levels without affecting glucose-6-phosphatase expression. Myricetin, a putative competitive AhR antagonist, reversed the suppression of PEPCK induction by PCB 126. Furthermore, other dioxin-like PCBs demonstrated similar effects on PEPCK expression in parallel with their ability to activate AhR. It therefore appears that AhR activation mediates the suppression of PEPCK expression by dioxin-like PCBs, suggesting a role for these pollutants as disruptors of energy metabolism. PMID:22615911
Directory of Open Access Journals (Sweden)
Wenshuo Zhang
Full Text Available Dioxins and dioxin-like compounds encompass a group of structurally related heterocyclic compounds that bind to and activate the aryl hydrocarbon receptor (AhR. The prototypical dioxin is 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD, a highly toxic industrial byproduct that incites numerous adverse physiological effects. Global commercial production of the structurally similar polychlorinated biphenyls (PCBs, however, commenced early in the 20(th century and continued for decades; dioxin-like PCBs therefore contribute significantly to total dioxin-associated toxicity. In this study, PCB 126, the most potent dioxin-like PCB, was evaluated with respect to its direct effects on hepatic glucose metabolism using primary mouse hepatocytes. Overnight treatment with PCB 126 reduced hepatic glycogen stores in a dose-dependent manner. Additionally, PCB 126 suppressed forskolin-stimulated gluconeogenesis from lactate. These effects were independent of acute toxicity, as PCB 126 did not increase lactate dehydrogenase release nor affect lipid metabolism or total intracellular ATP. Interestingly, provision of cells with glycerol instead of lactate as the carbon source completely restored hepatic glucose production, indicating specific impairment in the distal arm of gluconeogenesis. In concordance with this finding, PCB 126 blunted the forskolin-stimulated increase in phosphoenolpyruvate carboxykinase (PEPCK mRNA levels without affecting glucose-6-phosphatase expression. Myricetin, a putative competitive AhR antagonist, reversed the suppression of PEPCK induction by PCB 126. Furthermore, other dioxin-like PCBs demonstrated similar effects on PEPCK expression in parallel with their ability to activate AhR. It therefore appears that AhR activation mediates the suppression of PEPCK expression by dioxin-like PCBs, suggesting a role for these pollutants as disruptors of energy metabolism.
Directory of Open Access Journals (Sweden)
Tarcísio Visintin da Silva Galdino
Full Text Available The performance of herbivorous insects is related to the locations of defenses and nutrients found in the different plant organs on which they feed. In this context, the females of herbivorous insect species select certain parts of the plant where their offspring can develop well. In addition, their offspring can adapt to plant defenses. A system where these ecological relationships can be studied occurs in the specialist herbivore, Tuta absoluta, on tomato plants. In our experiments we evaluated: (i the performance of the herbivore T. absoluta in relation to the tomato plant parts on which their offspring had fed, (ii the spatial distribution of the insect stages on the plant canopy and (iii the larval resistance to starvation and their walking speed at different instar stages. We found that the T. absoluta females preferred to lay their eggs in the tomato plant parts where their offspring had greater chances of success. We verified that the T. absoluta females laid their eggs on both sides of the leaves to better exploit resources. We also observed that the older larvae (3rd and 4th instars moved to the most nutritious parts of the plant, thus increasing their performance. The T. absoluta females and offspring (larvae were capable of identifying plant sites where their chances of better performance were higher. Additionally, their offspring (larvae spread across the plant to better exploit the available plant nutrients. These behavioral strategies of T. absoluta facilitate improvement in their performance after acquiring better resources, which help reduce their mortality by preventing the stimulation of plant defense compounds and the action of natural enemies.
1978-06-01
NATIONAL BIJRIAU Of SIANDAR)S ] tbi A PHOTOGRAPH THIS SHEET J4 LEVEL 1"ve 00. ) N9v126;~;v- .M INY TORY R.I . V . ! iK- DOCUMENT IDENTIFICATION ~ c~A~I.Ay...the effects of the terrain and potential obstacles on the ability of the tank to move to the objective and to maintain its position with re- spect to
Precision hfs of 126Cs(T1/2=1.63 m) by ABMR
International Nuclear Information System (INIS)
Pinard, J.; Duong, H.T.; Marescaux, D.; Stroke, H.H.; Redi, O.; Gustafsson, M.; Nilsson, T.; Matsuki, S.; Kishimoto, Y.; Kominato, K.; Ogawa, I.; Shibata, M.; Tada, M.; Persson, J.R.; Nojiri, Y.; Momota, S.; Inamura, T.T.; Wakasugi, M.; Juncar, P.; Murayama, T.; Nomura, T.; Koizumi, M.
2005-01-01
The hfs separation Δν of 126 Cs(T1/2=1.63 m) in the 6s S1/22 ground state was obtained in a precision measurement near zero magnetic field by means of atomic beam magnetic resonance with laser optical pumping on-line with the CERN-PSB-ISOLDE mass separator. The result, Δν=3629.514 (0.001) MHz, corrects significantly a previous published value from a high-field experiment. With our result, the precision of the nuclear magnetic moment, μ(Cs126)∼0.776μN, is now limited by the influence of extended nuclear structure on the hfs (the Bohr-Weisskopf effect)
Infe~lity 0; 126;~;~I)' co~s iS;~ se~ousyro~l~m in
African Journals Online (AJOL)
bypass the runlen. Molasses urea blocks or licks third parity and were selected from eight small- ..... underfeeding for most of the time, Depending on trous cycle (Roberts, 1986). .... Monitoring reproductive function and disorders in cattle by ...
Directory of Open Access Journals (Sweden)
Pedrola, J.
1986-10-01
Full Text Available A critical revision of some useful taxonomic criteria in paleontology of Charophytes is carried Out. The results are based in four modern populations ((<i>Chara aculeolata, Charai> aff.<i>baltica, Chara delicatulai> and <i>Chara globularisi> and they permit to make some serious objections to these critera. The results are related with three principal aspects: the meaning of the absolute magnitudes of me girogonite, the behaviour of his joint variation and the morphological variability during the calcification process. In general, and for each one of the four populations, an absence of influence of the position of the girogonite over their measurements is observed. This doesn't happens when the verticil is considered as source of variation. These biometrical differences which are equivalent to some of those that has been used to distinguish fossil species, are not due to a process of progressive or heteregenous calcification in the secuence of verticils of me plant. Several arguments against the indiscriminate use of cocients between absolute magnitudes (e.g. the polarity index as detectors of systematic interest are showed. In the same way, some remarks to the use of the morphology of the spiral calcificated cells, the prominence of the basal pore and some aspects of the apex shape, as taxonomic criteria are made. All this are variable within the same plant when there are differents in the calcification degree of the girogonites.
Se hace una revisión crítica de-algunos criterios taxonómicos de uso habitual en paleontología de carofitas. Sus resultados, basados en cuatro poblaciones actuales (<i>Chara aculeolata, Charai> aff.<i>baltica, Chara delicatulai> y <i>Chara globularisi>, permiten hacer algunas serias objeciones a estos criterios. Dichos resultados se relacionan con tres aspectos principales: el significado de las magnitudes absolutas del girogonito, el comportamiento de su variación conjunta y la variabilidad
13 CFR 126.308 - What happens if SBA inadvertently omits a qualified HUBZone SBC from the List?
2010-01-01
... writing at U.S. Small Business Administration, 409 Third Street, SW., Washington, DC 20416 or via e-mail... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What happens if SBA inadvertently omits a qualified HUBZone SBC from the List? 126.308 Section 126.308 Business Credit and Assistance...
Directory of Open Access Journals (Sweden)
Yang Liu
2014-01-01
Full Text Available Background. The purpose of the present study was to assess the feasibility of using miR-126 in the urine as a biomarker for diabetic nephropathy. Methods. miRNAs were extracted from the urine samples of T2DM patients with diabetic nephropathy (DN; n=92, T2DM without DN (n=86, and 85 healthy volunteers using quantitative reverse transcriptase polymerase chain reaction (real-time polymerase chain reaction analysis. Stability of urinary miR-126 and factors that affected the stability were assessed. A subgroup analysis was also carried out to compare the urinary miR-126 level in T2DM patients well controlled by the treatment versus those who were not well controlled. Results. Urinary miR-126 was stable when the urine samples were kept at room temperature for extended period of time, 4°C, −20°C, and −80°C for up to 12 hours or subjected to 10 freeze-and-thaw cycle. Urinary miR-126 was significantly higher in T2DM patients with DN (5.76±0.33 versus 3.25±0.45 in T2DM patients without DN. Successful treatment significantly reduced urinary miR-126 in T2DM patients with DN to 3.89±0.52 (P<0.05. Conclusion. miR-126 in the urine is stable and it could be used as a biomarker of DN and to monitor the treatment response.
Medidas de actuación para la prevención de la toxiinfección alimentaria
Directory of Open Access Journals (Sweden)
María Ascensión Maestre Naranjo
2008-09-01
Full Text Available La toxiinfección alimentaria manifestada en forma de brotes tiene gran importancia desde el punto de vista epidemiológico. Tras analizar su etiología se instauran las medidas preventivas y de seguridad en todos los procesos de manipulación de alimentos, así como las medidas de prevención para los trabajadores manipuladores de alimentos. Se insiste de forma especial en la información y formación que deben recibir estos trabajadores, para concienciar y fomentar su responsabilidad y educación en las medidas higiénico sanitarias que favorecen su desarrollo. En caso de producirse el brote se marcan las pautas a seguir para su notificación, por la gran importancia legal y epidemiológica que comporta.The alimentary toxiinfección manifested in form of buds has great importance from the epidemic point of view. After analyzing their etiología the preventive measures they are established and of security in all the processes of manipulation of foods, as well as the measures of prevention for the hard-working manipulators of foods. It is insisted in a special way in the information and formation that these workers should receive, to make aware and to foment their responsibility and education in the hygienic sanitary measures that favor their development. In the event of taking place the bud the rules they are marked to continue for their notification, for the legal and epidemic great importance that behaves.
As Inundações e Memória Social: Algumas Medidas De Prevenção ...
African Journals Online (AJOL)
As Inundações e Memória Social: Algumas Medidas De Prevenção e Controlo da Biodegradação Dos Documentos e Arquivos (Floods and Social Memory: Some Measures for the Protection and Control of Biodegradation in Records and Archives)
RLE (Research Laboratory of Electronics) Progress Report Number 126.
1984-01-01
Loudness 184 26.3 Binaural Hearing 186 S.26.4 Hearing Aid Research 188 26.5 Discrimination of Spectral Shape 191 26.6 Tactile Perception of Speech... beating in the pulse. It is these high intensities which are responsible for large A.C. Stark shifts and ionization RLE P.R. No. 126 12 * . . . Atomic...Department of Aeronautics and Astronautics, Massachusetts Institute of Technology, 1984. 26.3 Binaural Hearing National Institutes of Health (Grant
Directory of Open Access Journals (Sweden)
Juan Sebastián Sereno Restrepo
2009-11-01
Full Text Available En algunas normas europeas y en precedentes judiciales estadounidenses se encuentran los primeros antecedentes de tutela jurídica a medidas tecnológicas de protección. Sin embargo, sólo a partir de 1996, con del Tratado ompi de Derecho de Autor, se encuentra una consagración expresa de las medidas tecnológicas de protección. La amplia formulación adoptada en el tratado ha sido desarrollada por las legislaciones de los países signatarios de él. En cuanto a la definición, se encuentran los siguientes elementos: producto, dispositivo, componente; aplicación de la medida sobre un bien inmaterial sujeto al régimen de copyright (derecho de autor; la especial finalidad de prevenir o inhibir la infracción al copyright o controlar el acceso; la efectividad; la aplicación de la medida por un sujeto cualificado. La legitimación para el ejercicio del derecho, las modalidades de infracción, las consecuencias civiles y penales y las eximentes de responsabilidad han sido también objeto de tratamiento normativo. Este artículo desarrolla el significado de los complejos elementos enunciados, con ayuda de la jurisprudencia y la doctrina, en tres secciones: estudio de la función práctica de las medias tecnológicas y su historia legislativa; definición de medida y condiciones para su protección; modalidades de infracción y eximentes de responsabilidad
Directory of Open Access Journals (Sweden)
Juan Sebastián Sereno Restrepo
2009-11-01
Full Text Available En algunas normas europeas y en precedentes judiciales estadounidenses se encuentran los primeros antecedentes de tutela jurídica a medidas tecnológicas de protección. Sin embargo, sólo a partir de 1996, con del Tratado ompi de Derecho de Autor, se encuentra una consagración expresa de las medidas tecnológicas de protección. La amplia formulación adoptada en el tratado ha sido desarrollada por las legislaciones de los países signatarios de él. En cuanto a la definición, se encuentran los siguientes elementos: producto, dispositivo, componente; aplicación de la medida sobre un bien inmaterial sujeto al régimen de copyright (derecho de autor; la especial finalidad de prevenir o inhibir la infracción al copyright o controlar el acceso; la efectividad; la aplicación de la medida por un sujeto cualificado. La legitimación para el ejercicio del derecho, las modalidades de infracción, las consecuencias civiles y penales y las eximentes de responsabilidad han sido también objeto de tratamiento normativo. Este artículo desarrolla el significado de los complejos elementos enunciados, con ayuda de la jurisprudencia y la doctrina, en tres secciones: estudio de la función práctica de las medias tecnológicas y su historia legislativa; definición de medida y condiciones para su protección; modalidades de infracción y eximentes de responsabilidad.
Ocular phenotypes associated with two mutations (R121W, C126X) in the Norrie disease gene.
Kellner, U; Fuchs, S; Bornfeld, N; Foerster, M H; Gal, A
1996-06-01
To describe the ocular phenotypes associated with 2 mutations in the Norrie disease gene including a manifesting carrier. Ophthalmological examinations were performed in 2 affected males and one manifesting carrier. Genomic DNA was analyzed by direct sequencing of the Norrie disease gene. Family I: A 29-year-old male had the right eye enucleated at the age of 3 years. His left eye showed severe temporal dragging of the retina and central scars. Visual acuity was 20/300. DNA analysis revealed a C-to-T transition of the first nucleotide in codon 121 predicting the replacement of arginine-121 by tryptophan (R121W). Both the mother and maternal grandmother carry the same mutation in heterozygous form. Family 2: A 3-month-old boy presented with severe temporal dragging of the retina on both eyes and subsequently developed retinal detachment. Visual acuity was limited to light perception. His mother's left eye was amaurotic and phthitic. Her right eye showed severe retinal dragging, visual acuity was reduced to 20/60. DNA analysis revealed a T-to-A transversion of the third nucleotide in codon 126 creating a stop codon (C126X). The mother and maternal grandmother were carriers. Mutations in the Norrie disease gene can lead to retinal malformations of variable severity both in hemizygous males and manifesting carriers.
Directory of Open Access Journals (Sweden)
Yepes-Nuñez, Juan José
2011-12-01
Full Text Available La medición de los valores del estado de salud, preferencias y utilidad calcula el valor o la conveniencia de un estado de salud contra un instrumento externo; son medidas genéricas de la calidad de vida relacionada con la salud (CVRS y resumen el valor de esta en un solo número entre 0 (cero y 1 (uno. Las medidas de preferencias de estados de salud y de utilidad difieren de las medidas generales y específicas obtenidas mediante cuestionarios de CVRS en áreas importantes. Primero, calculan las predilecciones de los individuos por alternativas. Segundo, proveen un resultado completo de la CVRS. Tercero, ofrecen una unidad común de análisis. Existen dos métodos para la medición de las utilidades, uno directo y otro indirecto, que se conocen también como utilidades multiatributo o sistemas de clasificación de estados de salud. El proceso directo de medición consiste en un agregado de descripciones que un entrevistador presenta a los encuestados. Para las mediciones indirectas se aplican solamente cuestionarios. El objetivo principal de este artículo es describir los principales métodos de valoración de utilidades, con el fin de dar a conocer los desenlaces que actualmente se utilizan tanto en estudios de CVRS como en evaluaciones económicas.
Energy Technology Data Exchange (ETDEWEB)
Wojtowicz, A.; Augustowska, K.; Gregoraszczuk, E. [Lab. of Physiology and Toxicology of Reproduction, Dept. of Animal Physiology, Inst. of Zoology, Jagiellonian Univ., Krakow (Poland)
2004-09-15
Polychlorinated biphenyles (PCBs) like other endocrine disrupters could interfere with natural hormones by binding to their receptors and thus mimicking the cellular response to them. They are known to possess either estrogenic or antiestrogenic properties. In our previous papers we demonstrated that PCBs are able to disrupt ovarian steroidogenesis. We found that the coplanar PCB 126 caused the decrease in estradiol secretion in whole cultured pig ovarian follicles. PCB 126 congener is structurally related to 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD). Since TCDD effects are known to be mediated by aryl hydrocarbone receptors (AhRs), we decided to determine if PCB 126 affects signal transduction pathway activated by these receptors. It has been reported that the functional AhR is present in ovary including oocytes, granulosa and theca cells of rat, mouse, rhesus monkey and human ovary. Moreover, the expression of AhR in the rat ovary appeared to be estrous cycle-dependent, thus suggesting that AhR expression may be regulated by fluctuating hormone levels. This study was designed to investigate the effects of the non-ortho-substituted 3,3',4,4',5-pentachlorobiphenyl (PCB126) on the AhR activation, localization and protein level in pig ovarian follicle cells.
1+ collective states of 124Cs and 126Cs nuclei
International Nuclear Information System (INIS)
Ivanova, S.P.; Kuliev, A.A.; Salamov, D.I.
1977-01-01
Within the framework of the random phase approximation β-decay properties of the 1 + states of 124 Cs and 126 Cs have been investigated. Greatly collectivized 1 + states in odd-odd nuclei are produced by the spin-dependent charge-exchange nucleon interaction. For numerical calculations the scheme of single-particle levels in the deformed Saxon-Woods potential has been used
22 CFR 126.1 - Prohibited exports and sales to certain countries.
2010-04-01
... policy applies to Belarus, Cuba, Eritrea, Iran, North Korea, Syria, and Venezuela. This policy also... REGULATIONS GENERAL POLICIES AND PROVISIONS § 126.1 Prohibited exports and sales to certain countries. (a) General. It is the policy of the United States to deny licenses and other approvals for exports and...
Energy Technology Data Exchange (ETDEWEB)
Groppo, Gerson Antonio
1996-10-01
The effects of different gamma radiation (Cobalt-60) doses on different phases of the evolutive cycle of Tuta absoluta (Meyrich, 1917) (Lepidoptera, Gelechiidae) have been studied under laboratory conditions in the laboratory of Entomology of Center for Nuclear Energy in Agriculture (CENA), University of Sao Paulo, Piracicaba, Sao Paulo State, Brazil. For all the treatments with gamma radiation a Cobalt-60 source type Gamma beam-650 was used. The doses utilized ranged from of 0,0 (Control) to 3250 Gy with a dose rate of 1110 Gy/h. The experiment was conducted under controlled conditions at 25{+-} 2 deg C, 70 {+-} 5% of relative humidity and photo period of (12:12). It was verified that the lethal doses were: for eggs - 70 Gy; for larvae - 200 Gy e for pupae - 300 Gy. The sterilizing dose for adults from irradiated larvae was 45 Gy. The sterilizing dose for the crossing of irradiated female with normal males (FI X MN) was 100 Gy and for normal female with irradiated male (FN x MI) was 150 Gy, in the both crosses, doses refer to irradiation of pupae. The sterilizing dose for adults, of both sexes, irradiated and crossed with normal adults, (FI x MN) and (FN x MI, were 150 and 200 Gy, respectively. The average longevity of adults, of both sexes, irradiated and crossed with normal adults was 8,3 days. The immediate lethal dose for adults was 3250 Gy. (author)
Directory of Open Access Journals (Sweden)
Felipe Núñez Izquierdo
2012-04-01
Full Text Available Después de más de 10 años de entrada en vigor de la Ley Orgánica 5/2000, de 12 de enero, de Responsabilidad Penal del Menor, se hace imprescindible realizar un estudio sobre la reincidencia juvenil en Extremadura, para conocer el impacto de dicho precepto. No cabe duda que uno de los problemas que más alarma social genera en la población es la delincuencia cometida por los menores con responsabilidad penal. Inicialmente se hace un repaso a la literatura criminológica actual sobre la reincidencia, programas de prevención, tratamiento a menores delincuentes y la evaluación de la eficacia de dichos programas. En el presente trabajo, siguiendo la metodología de otros estudios nacionales como el de Catalunya, analizamos la reincidencia de la delincuencia juvenil en Extremadura, concretamente de las medidas privativas de libertad. Se analizan los expedientes judiciales cerrados de aquellos jóvenes que hubieran finalizado una medida de este tipo en el año 2007 y se realiza el seguimiento de los mismos hasta el año 2010. En el año 2007, 115 jóvenes cumplieron o estaban cumpliendo una medida privativa de libertad en un Centro de Menores o Permanencia Fin de Semana, de los cuales 63 (57 varones y 7 mujeres resultaron pertenecer a la muestra final objeto de análisis. Los resultados obtenidos revelan que la tasa de reincidencia es del 52,4%, similar a la de otras Comunidades Autónomas, como País Vasco o Catalunya, e inferior a la de Asturias. Otro dato relevante es que un 41,9% de los menores objeto de estudio presentaban antecedentes, por lo que se refleja un comienzo en carreras delictivas acorde con los estudios existentes. La presente investigación ayuda a conocer la eficacia de los diferentes programas que se aplican a los menores delincuentes que cumplen medidas de internamiento, así como también hace una crítica de ésta al situarla con una elevada tasa de reincidencia.After more than 10 years of the entry into force of the
Directory of Open Access Journals (Sweden)
Laura Cházaro García
2009-12-01
Full Text Available This text juxtaposes medical practices involving the measurement of bodies and the topographic and geodesic surveys carried out by engineers in late 19th-century Mexico. In an era known for generating measurements, these two histories converged: body and territory became objects of knowledge and control, two surfaces whose respective geometries spoke of the national space. To measure them, physicians and engineers used instruments whose characteristics assured their circulation between America and Europe and within Mexico, where they produced objective, interchangeable, standardized measures; but they were the result of an interrelation: that of the people who measured, the instrument and that which was measured, so although their uses were normative and standardized they generated values both situated and local in nature that responded to contemporary political demands: measuring bodies meant dimensioning races and gender; while surveying territories meant delimiting communal properties in order to create private ones. I argue that both types of measurement embodied epistemic practices that presupposed evaluation and perspective.//El texto interrelaciona las prácticas médicas de medición de cuerpos y las mediciones topográficas y geodésicas de ingenieros en México, en el siglo XIX. En una época productora de medidas, sus historias convergen: cuerpo y territorio se convierten en objetos de conocimiento y de control, ambos superficies cuya geometría habla del espacio nacional. Para medirlos, médicos e ingenieros usaban instrumentos que, por sus características, se desplazaban (de América a Europa o dentro del país para producir mediciones objetivas, intercambiables y estandarizadas. Pero, las medidas resultan de la interrelación entre el que mide, el instrumento y lo medido, de modo que aún cuando sus usos estaban normados y estandarizados, generaban valores situados y locales, respondiendo a las exigencias políticas de su tiempo
Directory of Open Access Journals (Sweden)
Núñez Velázquez, José Javier
2006-12-01
Full Text Available En el presente trabajo se analiza la influencia de las curvas de Lorenz, el Principio de Transferencias y las relaciones de mayoración entre vectores de renta sobre las medidas de desigualdad. De esta forma, se pasa revista al desarrollo histórico que ha permitido diseñar el conjunto actual de axiomas o propiedades deseables para que una medida de desigualdad se comporte razonablemente. Además, se analiza la problemática de la ordenación en desigualdad de los vectores de renta. Ante la imposibilidad de selección de una única medida de desigualdad, se presenta la construcción de un indicador sintético dinámico construido a partir de una batería de índicessimples de desigualdad, compatibles con el criterio de dominación de Lorenz. Finalmente, se incluye como ilustración el estudio de la evolución de la desigualdad y el nivel de vida en los países de la Unión Europea, durante el período 1993-1999.
Medidas de calidad aplicadas a los levantamientos topográficos en Colombia
Sabogal Lemus, Carlos Augusto
2016-01-01
Este trabajo documenta la investigación “Medidas de calidad aplicadas a los levantamientos topográficos en Colombia”; la propuesta metodológica de este documento, tiene como objetivo principal la realización de la evaluación de calidad de un conjunto de datos levantados en campo, para lo cual es necesario revisar los antecedentes de la topografía en Colombia, así como los diferentes sistemas de referencia que gobiernan la cartografía del país -- Previo a realizar una evaluación de calidad, se...
Medidas de indices de refração de cristais liquidos esmecticos
Kroin, Teodosio
1980-01-01
Dissertação (mestrado) - Universidade Federal de Santa Catarina. Centro de Ciencias Fisicas e Matematicas Mostramos que os cristais líquidos biaxiais podem ter seus índices de refração principais medidos pelo método de Abbe, desde que convenientemente alinhados. Apresentam-se as medidas dos índices de refração das diferentes mesofases e da fase isotrópica do cristal líquido uni-axial 4-butoxibenzilideno-4'- aminoacetofenona em função da temperatura e para três comprimentos de onda. As medi...
Evaluación del desarrollo testicular y medidas morfométricas en ovinos de pelo colombiano
Directory of Open Access Journals (Sweden)
Amado Espitia-Pacheco
2018-01-01
Full Text Available Las medidas corporales en ovinos son útiles como indicador de tipo y función, permiten mejorar la selección. Se conocen estudios biométricos en ovinos que, relacionan la importancia de estas medidas con algunas variables productivas. El objetivo del presente estudio fue evaluar el desarrollo testicular y su relación con los parámetros morfométricos en ovinos de pelo colombiano, en el municipio de Sampués, Sucre, Colombia. Se utilizaron doce ovinos machos (destetados nacidos entre febrero y abril del 2014, sobre los cuales se tomaron las siguientes medidas: circunferencia escrotal (CE, peso corporal (PC, altura a la grupa (AG, alzada a la cruz (AC y longitud testicular derecha e izquierda (LTD y LTI, cada veintiocho días hasta los doce meses de edad. Para CE se efectuó análisis de regresión múltiple (RM del PC; AG; AC; LT. Para describir la variación del LT, el modelo incluyó solo las variables PC; AG; AC. El grado de asociación entre las variables estudiadas, se realizó por medio de correlación Pearson. La circunferencia escrotal mostró una correlación alta con los parámetros morfométricos evaluados. Dentro del análisis de RM, el PC influyó en la variable CE (p<0,05, mientras que las demás variables no influyeron significativamente. Según el coeficiente de regresión asociado a la medición, por cada kg de incremento en PC, hubo un correspondiente aumento de 0,09 cm en la CE.
Pascoal M.I.N.; Rapoport A.; Chagas J.F.S.; Pascoal M.B.N.; Costa C.C.; Magna L.A.
2001-01-01
Introduction: A presence of otologic symptoms associated to the temporomandibular disorders (TMD) is discussed since six decades ago, however its etiology still stays obscure. Study design: Prospective clinical randomized. Aim: In that study it was appraised the prevalence of otologic symptoms in TMD, the correlation with the muscular pain and the absence of posterior teeth. Material and Methods: 126 patients, presented TMD, were appraised through questionnaire about their symptoms, palpation...
Campos, Mateus R; Rodrigues, Agna Rita S; Silva, Wellington M; Silva, Tadeu Barbosa M; Silva, Vitória Regina F; Guedes, Raul Narciso C; Siqueira, Herbert Alvaro A
2014-01-01
The introduction of an agricultural pest species into a new environment is a potential threat to agroecosystems of the invaded area. The phytosanitary concern is even greater if the introduced pest's phenotype expresses traits that will impair the management of that species. The invasive tomato borer, Tuta absoluta (Meyrick) (Lepidoptera: Gelechiidae), is one such species and the characterization of the insecticide resistance prevailing in the area of origin is important to guide management efforts in new areas of introduction. The spinosad is one the main insecticides currently used in Brazil for control of the tomato borer; Brazil is the likely source of the introduction of the tomato borer into Europe. For this reason, spinosad resistance in Brazilian populations of this species was characterized. Spinosad resistance has been reported in Brazilian field populations of this pest species, and one resistant population that was used in this study was subjected to an additional seven generations of selection for spinosad resistance reaching levels over 180,000-fold. Inheritance studies indicated that spinosad resistance is monogenic, incompletely recessive and autosomal with high heritability (h(2) = 0.71). Spinosad resistance was unstable without selection pressure with a negative rate of change in the resistance level ( = -0.51) indicating an associated adaptive cost. Esterases and cytochrome P450-dependent monooxygenases titration decreased with spinosad selection, indicating that these detoxification enzymes are not the underlying resistance mechanism. Furthermore, the cross-resistance spectrum was restricted to the insecticide spinetoram, another spinosyn, suggesting that altered target site may be the mechanism involved. Therefore, the suspension of spinosyn use against the tomato borer would be a useful component in spinosad resistance management for this species. Spinosad use against this species in introduced areas should be carefully monitored to
7 -8----------------------------~-126;~;-----------R-ES-ONAN--CE--IDecemb-er ...
Indian Academy of Sciences (India)
Einstein, Heisenberg, Piaget and Jung. They were also honoring Hardy. Hardy gave a series of lectures that later came out as a book entitled Ramanujan: Twelve lectures on subjects suggested by his life and work. Hardy said at the beginning of his lectures, and I quote from. Kanigel's book: "I have to form myself, as I have ...
La variable latente calidad medida a través del modelo de Rasch.
Directory of Open Access Journals (Sweden)
Guerrero, Mª M.
1997-01-01
Full Text Available La obtención de aceites de oliva de calidad requiere unos cuidados especiales en todas y cada una de las sucesivas fases de elaboración de los mismos, es una cadena que comienza en el olivo y termina en el consumo. Condición indispensable para ello es conocer las características organolépticas del aceite (a fin de potenciar sus atributos y eliminar, en la medida de los posible, sus defectos, y la influencia del proceso de elaboración en las mismas. El control y medida de estos caracteres se hará mediante las catas, realizadas por expertos catadores utilizando para ello las fichas de cata del Consejo Oleícola Internacional. El modelo de Rasch, que emplearemos para obtener la evaluación sensorial de los aceites de oliva virgen, nos permitirá no sólo dar una calificación organoléptica global al aceite (que ya podemos realizar sin necesidad de aplicar ningún método, siguiendo la metodología de valoración del Consejo Oleícola Internacional, sino también clasificar y medir los factores sensoriales que intervienen en la calidad, lo que nos permitirá realizar las acciones oportunas encaminadas a obtener aceites de oliva de cualidades óptimas.
Directory of Open Access Journals (Sweden)
Larentis, Naiara Leites
2014-01-01
Full Text Available Objetivo: Esse estudo teve por objetivo comparar medidas obtidas de imagens de secções dentárias adquiridas em estereomiscrópio e escâner de mesa, assim como determinar se existem diferenças entre os dois métodos. Métodos: Cinquenta dentes humanos extraídos foram seccionados no sentido mésio-distal. Cada secção foi fotografada em estereomicroscópio e digitalizada em escâner de mesa com resolução de 230 dpi. O programa Photoshop foi utilizado para obter medidas verticais e horizontais das imagens de cada secção dentárias, adquiridas por ambos os métodos. Foram repetidas as medidas em 20% das amostras, selecionadas randomicamente. Resultados: As medidas iniciais e as repetidas apresentaram correlação positiva e o teste t para amostras pareadas não revelou diferença significativa (a=5% entre elas. A média das medidas e os devios-padrão foram: horizontal, estereomicroscópio 8,89 mm±4,30 mm e escâner 8,89 mm±4,52 mm; vertical, estereomicroscópio 4,42 mm±2,19 mm e escâner 4,43 mm±2,19 mm. Os resultados do teste t para amostras pareadas (a=5% não mostrou nenhuma diferença significativa entre os dois métodos para as medidas horizontais (p=0,685 e verticais (p=0,299. Conclusão: O escâner de mesa pode ser usado substituindo o estereomicroscópio na aquisição de imagens de secções dentárias para a obtenção de medidas verticais e horizontais
DEFF Research Database (Denmark)
Hansen, Torben Frøstrup; Andersen, Claus Lindbjerg; Nielsen, Boye Schnack
2011-01-01
was to analyse the possible relationship between miRNA-126, VEGFR-2 and angiogenesis in tumour tissue from patients with colorectal cancer (CRC). Tumour tissue was obtained from 81 patients. The miRNA-126 and VEGFR-2 gene expression levels were analysed by PCR and the protein concentrations of VEGFR-2 were...... the median as the cut-off. The median gene expression levels of VEGFR-2 were significantly lower in the tumours expressing low levels of miRNA-126, 0.30 (95% CI, 0.24‑0.36), compared to those expressing high levels of miRNA-126, 0.48 (95% CI, 0.28-0.60), p=0.02. A positive association was observed with VEGFR...... analysed by ELISA. Angiogenesis, visualised by the endothelial cell marker CD105 combined with caldesmon, was assessed by immunohistochemistry and the microvessel density (MVD) technique. In situ hybridisation was performed for miRNA-126. Tumours were classified as low or high miRNA‑126-expressing using...
High Power Narrow Linewidth 1.26 Micron Ho-Doped Fiber Amplifier, Phase II
National Aeronautics and Space Administration — This proposal is for the development of an innovative, high power, and extremely reliable 1.26-micron Ho-doped fluoride fiber amplifier. The proposed fiber amplifier...
Directory of Open Access Journals (Sweden)
Cervero M
2012-09-01
Full Text Available INTRODUCCIÓN Conocer valores de presión arterial en la población juvenil va a permitir identificar individuos predispuestos a presentar enfermedades cardiovasculares y a diseñar estrategias de prevención. OBJETIVOS Obtener valores de medida de presión arterial con aparatos oscilométricos en una muestra de jóvenes escolares de ambos sexos, entre 12 y 17 años de edad y realizar Educación Sanitaria a los participantes en el estudio. MATERIAL Y MÉTODOS Estudio epidemiológico, observacional, transversal y multicéntrico realizado en Centros Escolares de la Comunidad Autónoma de Madrid, sobre una muestra estimada de 2.500 jóvenes elegidos mediante un muestreo por conglomerados. Se les realizará una encuesta sobre hábitos de vida, un examen antropométrico: peso, talla, índice de masa corporal, medida de la presión arterial y se les proporcionará educación sanitaria mediante una charla formativa. UTILIDAD DEL ESTUDIO Conocer los valores de referencia de presión arterial y los factores de riesgo cardiovascular de nuestros adolescentes no tiene por si mismo ninguna utilidad práctica si no va acompañado de una intervención efectiva para prevenir el desarrollo de ECV. Los cambios en el estilo de vida tienen un nivel de recomendación A. El farmacéutico, como se espera poner de manifiesto en el estudio, puede ejercer de educador sanitario para promover estilos de vida saludable.
Loiola, Rodrigo Azevedo; Dos Anjos, Fabyana Maria; Shimada, Ana Lúcia; Cruz, Wesley Soares; Drewes, Carine Cristiane; Rodrigues, Stephen Fernandes; Cardozo, Karina Helena Morais; Carvalho, Valdemir Melechco; Pinto, Ernani; Farsky, Sandra Helena
2016-06-01
It has been recently proposed that exposure to polychlorinated biphenyls (PCBs) is a risk factor to type 2 diabetes mellitus (DM2). We investigated this hypothesis using long-term in vivo PCB126 exposure to rats addressing metabolic, cellular and proteomic parameters. Male Wistar rats were exposed to PCB126 (0.1, 1 or 10 μg/kg of body weight/day; for 15 days) or vehicle by intranasal instillation. Systemic alterations were quantified by body weight, insulin and glucose tolerance, and blood biochemical profile. Pancreatic toxicity was measured by inflammatory parameters, cell viability and cycle, free radical generation, and proteomic profile on islets of Langerhans. In vivo PCB126 exposure enhanced the body weight gain, impaired insulin sensitivity, reduced adipose tissue deposit, and elevated serum triglycerides, cholesterol, and insulin levels. Inflammatory parameters in the pancreas and cell morphology, viability and cycle were not altered in islets of Langerhans. Nevertheless, in vivo PCB126 exposure increased free radical generation and modified the expression of proteins related to oxidative stress on islets of Langerhans, which are indicative of early β-cell failure. Data herein obtained show that long-term in vivo PCB126 exposure through intranasal route induced alterations on islets of Langerhans related to early end points of DM2.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What must the contracting officer do if a contracting opportunity does not exist for competition among qualified HUBZone SBCs? 126.609 Section 126.609 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION HUBZONE PROGRAM Contractual...
Directory of Open Access Journals (Sweden)
Yomara Lima Mota
2011-10-01
Full Text Available O erro na medida de um sistema de avaliação da postura está relacionado com a digitalização, a resolução da câmera, a distância da câmera em relação ao voluntário estudado, entre outros. Estes erros somam-se no procedimento metodológico e muitos deles não são possíveis evitar, porém devem ser conhecidos e quantificados. OBJETIVO: Quantificar o erro na medida realizada pelo SAPO (Software para avaliação postural em diferentes situações experimentais. MÉTODOS: Foram realizadas 16 fotos de um manequim de 1,40m articulado nos planos anterior, posterior, lateral direita e lateral esquerda com câmeras de 3,2 e 12,0 megapixels, posicionadas a 3,0m e a 5,0m de distância do manequim. Para a quantificação do erro, foram calculadas as diferenças das medidas obtidas por meio do SAPO com as medidas feitas diretamente no manequim. Apenas um avaliador realizou o registro das imagens, porém a digitalização no software dos pontos demarcados no manequim foi realizada por três digitalizadores, sendo dois inexperientes e um experiente. RESULTADOS: Os valores médios das medidas horizontais, verticais, angulares e de distância são próximos de zero, embora algumas variáveis angulares apresentem valores maiores, como nas medidas de ângulo Q direito e esquerdo. A câmera com resolução de 3,2 megapixels posicionada a 3m apresentou o menor erro. CONCLUSÃO: O SAPO é um método acurado para uso clínico; são necessários estudos para verificar a influência do plano de posicionamento do voluntário em relação à câmera, o efeito do reposicionamento e da palpação nas medidas oferecidas pelo software.
Método para obtenção de medidas antropométricas utilizando um digitalizador 3D de baixo custo
Clariana Fischer Bendler; Fábio Gonçalves Teixeira
2016-01-01
O objetivo é desenvolver um método para obtenção de medidas antropométricas através de um digitalizador 3D de baixo custo. A metodologia da pesquisa consiste em seis etapas: pesquisa bibliográfica, coleta e análise dos dados antropométricos pelo método direto e o desenvolvimento do método indireto de obtenção de medidas antropométricas, comparação e análise dos dados obtidos, discussão dos resultados e a finalização. O processo de digitalização utilizado está baseado em um dispositivo de baix...
Directory of Open Access Journals (Sweden)
Vinícius de Azevedo Couto Firme
2012-11-01
Full Text Available Analisar o impacto de medidas antidumping aplicadas pelos Estados Unidos sobre exportações do setor siderúrgico de Minas Gerais, para o período entre 1999 e 2002, foi o objetivo deste trabalho. Os resultados mostraram que tal medida teve efeitos estatisticamente significativos sobre a redução no fluxo de comércio. Na análise da integração dos resultados econométricos com a abordagem de matrizes inter-regionais de insumo-produto, foi possível concluir que o setor mais afetado, no que se refere à produção, seria a siderurgia mineira, em que o impacto representou mais de 75% do total, no período em análise. Com relação ao emprego, o impacto sobre a siderurgia de Minas Gerais corresponde, em média, a mais de 50% do total de vagas que seriam criadas, caso nenhuma medida antidumping tivesse sido adotada; e a siderurgia do restante do país seria responsável por mais de 16% dos postos de trabalho criados no período.
Construcción de un equipo de medida de fotosíntesis neta y transpiración para plantas individuales
Directory of Open Access Journals (Sweden)
Anundo Polanía
2010-01-01
Full Text Available Se construyó un equipo de medida de fotosíntesis neta y transpiración para plantas individuales jóvenes de sistema abierto. La parte aérea de la planta se introdujo en una cámara transparente con un sistema de entrada y salida de aire. Esta tenía un control de temperatura y ventilación y estaba iluminada por varias bombillas cuya distancia a la cámara era graduable.Un analizador de gases infrarrojo midió la diferencia de concentración de CO2 entre la entrada y la salida de la cámara. La humedad del aire era registrada por unhigrómetro de punto de rocío. La concentración de CO2 y H2O en el aire que entraba a la cámara era controlada usando trampas selectivas y saturadores de vapor de agua. Con el equipo se hicieron medidas de ratas de fotosíntesis neta y transpiración en plantas de maíz. La precisión y la reproducibilidad de las medidas obtenidas con el equipo permiten su utilización para estudios del mismo tipo en otrasespecies.
Directory of Open Access Journals (Sweden)
Pascual Artiaga, Mercedes
2002-06-01
Full Text Available Since 1800 the yellow fever started producing epidemic incidents in the Iberian Peninsula. In this article the measures that were established by the different sanitary assemblies implied in the control of the epìdemic outbreak that affected the city of Alicante in 1804 are shown and analysed. The study of this case in Alicante has allowed to put in context this analysis in the framework of what happened in other places during this and other epidemies. It is proved the coexistence of traditional measures of prevention and of new ones. The political and sanitary speech focused on assuring the isolation of the population affected in order to avoid the spreading of this disease and to extend it as long as possible, as a quarantee for the surrounding cities.
el artículo se presentan y analizan las medidas que instauraron las diversas Juntas de Sanidad implicadas en el control del brote epidémico que afectó a la ciudad de Alicante en 1804. El estudio del caso alicantino ha permitido contextualizar dicho análisis en el marco de lo sucedido en otras localidades durante ésta y otras epidemias. Se constata la coexistencia de medidas tradicionales de prevención y de nuevas medidas. Las medidas administrativas y sanitarias se centraron en asegurar el aislamiento de la población afectada para evitar la extensión de la enfermedad y prolongarlo el mayor tiempo posible, como una garantía para las localidades vecinas.
SERVIÇO SOCIAL, MEDIDAS SOCIOEDUCATIVAS E O ADOLESCENTE INFRATOR NO LIBERDADE ASSISTIDA
Directory of Open Access Journals (Sweden)
Cristiano Costa Carvalho
2013-10-01
Full Text Available RESUMO: A temática dos adolescentes em conflito com a Lei é uma questão que merece uma atenção especial, pois é significativa ao longo da trajetória pela conquista da mudança de paradigma na legislação em relação ao enfrentamento desta expressão da questão social, e porque mesmo diante desta mudança, as medidas em meio aberto são as que têm sido menos aplicadas. Deste modo, esta pesquisa permitiu conhecer e problematizar a atuação do profissional de Serviço Social dentro da política de atendimento aos adolescentes em conflito com a Lei e em destaque a medida socioeducativa no programa de Liberdade Assistida, devido a sua característica educativa que preserva o convívio social, familiar e comunitária. O processo de preparação desta pesquisa consistiu em entrevistas semi-estruturadas, estudos bibliográficos, documentais, e acervos digitais. Foi analisado o potencial da atuação profissional em consonância com as diretrizes previstas pelo Estatuto da Criança e do Adolescente, Lei que garante aos mesmos um atendimento especial, e reconhece que são sujeitos em processo de formação. PALAVRAS-CHAVE: adolescentes, ato infracional, medidas socioeducativas ABSTRACT: The topic of minors in conflict with the Law is an issue that deserves special attention due to its representativeness in the course of attaining a paradigm shift in the legislation related to this social matter, and because even before this change takes place, it is the open regime measures that have been less applied. This research has therefore helped identify and discuss the role of the Social Worker in the assistance policy for juveniles in conflict with the Law, highlighting the socio-educational measure of the probation program “Liberdade Assistida”, which, due to its educational nature, preserves the social, family and community life. The process of preparing this research consisted of semi-structured interviews, bibliographical and documentary
Systems Integration: RNAV and the Upgraded Third Generation System.
1976-12-01
III126;~;f I I iI~ 126;~~~~~~~~~~~~~; -126;~;;tit I l i j I l i l 126;~~~~~~~~~~~~~~~; 126;~~~; I 126;~~~~~;~ _ PRE FACE The Systems Researc h and Deve lopment Service of the... researc Ii a rid o the rw i so ) I)u1’~I is hed by t he Off i n n ’ 01’ th e Ad ii i iii I s I i a to r [4 1] on On.’ lobe r 1 ‘1 .1 )/S . The resul t i n...body aircra ft will be manufactured primarily for the domestic market , thus the total non- domestic 3ESB count was presumed to be constan t . • The
1991-08-01
crowned Kinglet 12 11 1 3 5 0 0 9 3 4 i Reciulus calendula _Gnatcatcher 0 1 0 0 0 0 00 0Blue-grayGattce Polioptila caerulea Eastern Bluebird 0 0 0 0 1 0 6 0...and species determinations was done at 1250X magnification on a Zeiss microscope equipped with phase contrast illumination and an oil immersion 10OX...xx MMN M M N NŘ N NMN NM M N II~ ~ 0 a MM NM 333 30661 6961 x x x 39961 x x xK x x S996 x K K U I *c E I I. i126;~; 0* oil ] o o I4 33 0) x LL 5 I. CoI
Medidas de conservación y ordenación pesquera del jurel Trachurus murphyien el Perú
Directory of Open Access Journals (Sweden)
Jorge Zuzunaga
2013-10-01
Full Text Available Las pesquerías peruanas como actividades realizadas sobre recursos naturales renovables son reguladas por un marco jurídico, cuyo objetivo es asegurar su conservación y uso sostenible. La Ley General de Pesca (DL N°. 25977 señala que para cada tipo de pesquería y según la situación del recurso explotado debe establecerse un sistema de ordenamiento que concilie el principio de sostenibilidad de los recursos pesqueros o conservación en el largo plazo, con la obtención de los mayores beneficios económicos y sociales. En el ordenamiento pesquero del jurel Trachurus murphyi, las medidas incluyen entre otras, el régimen de acceso constituido por las autorizaciones de incremento de flota y permisos de pesca, que se otorgan solo a los buques cuyas capturas son destinadas únicamente para el consumo humano directo, de acuerdo a lo dispuesto en el Reglamento de Ordenamiento Pesquero (DS N.° 011-2007-PRODUCE. La obligación de destinar los recursos sardina Sardinops sagax, jurel T. murphyiy caballa Scomber japonicus al consumo humano directo rige desde septiembre 2002 (DS N°. 001-2002-PRODUCE. Otras medidas vigentes restringen el tamaño mínimo de malla de las redes, prohíben la captura de ejemplares menores de 31 cm de longitud total, determinan el inicio y cierre de las temporadas de pesca, los límites de captura o cuotas anuales. Estas disposiciones son complementadas por medidas de seguimiento, control y vigilancia para la efectiva conservación y uso sostenido del recurso.
Martínez Fernández, José Luis
2016-01-01
En el laboratorio del departamento de Ingeniería Térmica y de Fluidos se dispone de una instalación experimental de golpe de ariete en la que es conveniente revisar y mejorar el sistema de medida. Paralelamente se desarrollará un modelo numérico mediante el método de las características que reproduzca en mayor medida los fenómenos transitorios producidos. Ambos aspectos del trabajo deben converger y permitir enriquecer el contenido de las prácticas realizables en la instalación y la com...
Adesão às medidas preventivas de pneumonia associada à ventilação mecânica.
Directory of Open Access Journals (Sweden)
Luany Caroline Adamovicz Bork
2015-01-01
Full Text Available Justificativa e Objetivos: Ressaltando a relevância da adoção de medidas preventivas de infecção para a realização de uma assistência livre de danos emergiu a necessidade de observar como a equipe de saúde aplica o bundle. Objetivou-se verificar a adesão de medidas preventivas de pneumonia pelos profissionais de saúde, da Unidade de Terapia Intensiva geral adulta de um hospital público, Ponta Grossa-PR. Métodos: Pesquisa transversal, de abordagem quantitativa, prospectiva e observacional, realizada no período de abril a julho de 2013. A amostra constituiu-se de 33 pacientes que estavam em ventilação mecânica, totalizando o registro de 1522 momentos de aplicações das medidas preventivas de pneumonia associada à ventilação mecânica (PAVM. Resultados: Dos 33 pacientes, 13 desenvolveram pneumonia, a média de idade foi de 59,72 anos e a prevalência foi do gênero feminino (44,44%. Verificou-se que os profissionais de saúde atenderam a cabeceira elevada dos leitos em média 69,80%, assim como aderiram à interrupção da sedação em média 66,66%, realizaram a higiene oral com clorexidina 94,61%, mantiveram o cuff do tubo orotraqueal (entre 20 e 25 mmH20 64,44%, adequaram o filtro de nebulizador para ficar dentro da validade 89,50% e em 93,4% das observações deixaram os circuitos livre de condensados. Analisou-se que o valor médio de dias passados em ventilação mecânica dos pacientes que adquiriram infecção foi de 15,85 (DP = 8,65 dias. Conclusão: Revela-se que quando a equipe aplica todas as medidas preventivas ao paciente sob ventilação mecânica há redução do risco de adquirir infecção no trato respiratório. DESCRITORES: Terapia intensiva; Pneumonia associada à ventilação mecânica; Infecção hospitalar; Equipe de assistência ao paciente.
The economic emergency: an insufficient solution La emergencia económica: una medida inconclusa
Directory of Open Access Journals (Sweden)
Lorente Luis
1997-06-01
Full Text Available There are many reasons for the Colombian recession that began in 1995, but the disagreement between fiscal and monetary authorities is an outstanding one. Monetary measures against inflation promoted high interest rates, made real investment more risky, rocketed the exchange rate, attracted foreign capital and elevated public debt costs.
Emergency measures announced early in the year were insufficient because the problem comes from old and needs long range measures. Balanced budget is a valid target, but along the economic cycle and not in each fiscal year. Reduction of public expenses or public debt must be applied in periods of growth and not when taxes go down because a recession has begun. Monetary policy must allow for anti-cyclical measures and can do it effectively by controlling the volume. of credit accessible to the Government, or to finance private construction of public works, or to those that will buy the facilities and services that get privatized.La fase recesiva de la economía colombiana que comenzó en 1995 tiene varias causas, en especial, el desacuerdo entre políticas fiscales y monetarias. Las medidas antiinflacionarias elevaron las tasas de interés y dificultaron la inversión, y provocaron la revaluación de la moneda, la promoción de la entrada masiva de capital externo y del encarecimiento del servicio de la deuda pública. Las medidas de emergencia anunciadas a comienzos de 1995 no fueron suficientes: se necesita una política con objetivos de largo plazo. Hay que buscar un balance fiscal a lo largo del ciclo económico y no en cada año fiscal; la contracción del gasto público debe aplicarse en las fases de auge económico y no cuando caen los recaudos porque ya comenzó una recesión. La política monetaria debe permitir medidas anticíclicas y puede contribuir a ellas si regula el volumen de crédito accesible al Estado, a sus contratistas y a quienes adquieren prvatizaciones.
1980-07-01
tlsq &W CPA VWTv * 0~ wfe 4 o-f’ffv 1401,1 etc, flm# 4bd u J>’ i te.’. fRt. -126;~;ab t~rviof of ~naGt ##d a dfDW. >*74otoo -o 42 -’J-’A le VI C...Inw+ A *c*I.PLA I. N ~ ,4E O. 8 ’DETAIL5 OF SPECIAL DE51GIJ 5PILLWsAY ATTACHED) TD INLET ENjD OF 5TANDARD DOUBJrLE 10g12* bOX C11LVERT ot- Ad#,. Z
Directory of Open Access Journals (Sweden)
Marcelo Carlos Bortoluzzi
Full Text Available Resumo O estudo objetivou criar um instrumento de medida que pudesse quantificar os desconfortos associados ao procedimento cirúrgico de pacientes submetidos a cirurgias dento-alveolares (QCirDental. O instrumento QCirDental foi desenvolvido em duas etapas iniciais: (1 geração e seleção das perguntas ou itens e, (2 teste do instrumento com avaliação das propriedades de medida (consistência interna e responsividade. A amostra foi composta por 123 pacientes. Nenhum deles apresentou qualquer dificuldade em entender o QCirDental. O instrumento mostrou excelente consistência interna com coeficiente alfa de Cronbach de 0,83. A análise de componentes principais (Kaiser-Meyer-Olkin Measure of Sampling Adequacy 0,72 e Bartlett's Test of Sphericity com p < 0,001 mostrou seis (6 dimensões do instrumento que explicam 67,5% da variância. O QCirDental possui excelente consistência interna, sendo um instrumento de fácil leitura e interpretação compatível com uma adequada validade semântica e de conteúdo. Mais de 80% dos pacientes submetidos a extrações dentárias de rotina odontológica apresentam algum desconforto ou incomodo no período transoperatório o que ressalta a necessidade de utilização de um instrumento para avaliação de cuidados.
Medidas de control de tuberculosis en una institución de salud de Bogotá D.C
Directory of Open Access Journals (Sweden)
Alba I. Muñoz-Sánchez
2016-02-01
Full Text Available Resumen Objetivo: evaluar la implementación de medidas de control, de tipo administrativo, ambiental y de protección respiratoria, de la infección de tuberculosis en un hospital de III nivel de atención en la ciudad de Bogotá D.C. Metodología: estudio de tipo descriptivo, transversal. Para la recolección de datos se aplicó una herramienta de autorreporte a 158 trabajadores de la salud del hospital, se realizó una entrevista estructurada al responsable del programa institucional de control de tuberculosis y una visita de observación de un experto en salud y seguridad laboral a las diferentes áreas de trabajo, para indagar por la implementación de medidas de control de infección de tuberculosis en la institución. Resultados: el responsable del programa institucional de control de tuberculosis y 158 trabajadores de la salud del hospital objeto de estudio reportaron una deficiente implementación de medidas de control de tuberculosis, de tipo administrativo, ambiental y de protección respiratoria en la institución, lo cual fue corroborado por el experto. Conclusiones: la deficiente implementación de medidas de control de infección de tuberculosis en instituciones de la salud, y algunas condiciones de trabajo presentes pueden favorecer la exposición ocupacional de los trabajadores de la salud al Mycobacterium Tuberculosis. Abstract Objective: to evaluate the implementation of tuberculosis infection control measures in administrative, environmental and respiratory protection equipment in a third level hospital in Bogota D.C. Methodology: a descriptive, cross-sectional study. Data were collected through a self-reporting instrument applied on 158 health care workers. The chief officer of the institutional program for tuberculosis control participated in a structured interview. In addition, an expert in occupational health and safety conducted an observational visit to the different workplaces in order to inquire on the implementation
International Nuclear Information System (INIS)
Lundberg, Rebecca; Lyche, Jan L.; Ropstad, Erik; Aleksandersen, Mona; Roenn, Monika; Skaare, Janneche U.; Larsson, Sune; Orberg, Jan; Lind, P. Monica
2006-01-01
The aim of this study was to investigate if environmentally relevant doses of the putative estrogenic non dioxin-like PCB 153 and the dioxin-like PCB 126 caused changes in bone tissue in female goat offspring following perinatal exposure. Goat dams were orally dosed with PCB 153 in corn oil (98 μg/kg body wt/day) or PCB 126 (49 ng/kg body wt/day) from day 60 of gestation until delivery. The offspring were exposed to PCB in utero and through mother's milk. The suckling period lasted for 6 weeks. Offspring metacarpal bones were analysed using peripheral quantitative computed tomography (pQCT) after euthanisation at 9 months of age. The diaphyseal bone was analysed at a distance of 18% and 50% of the total bone length, and the metaphyseal bone at a distance of 9%. Also, biomechanical three-point bending of the bones was conducted, with the load being applied to the mid-diaphyseal pQCT measure point (50%). PCB 153 exposure significantly decreased the total cross-sectional area (125 mm 2 ± 4) versus non-exposed (142 mm 2 ± 5), decreased the marrow cavity (38 mm 2 ± 4) versus non-exposed (50 mm 2 ± 3) and decreased the moment of resistance (318 mm 3 ± 10) versus non-exposed (371 mm 3 ± 20) at the diaphyseal 18% measure point. At the metaphyseal measure point, the trabecular bone mineral density (121 mg/cm 3 ± 5) was increased versus non-exposed (111 mg/cm 3 ± 3). PCB 126 exposure did not produce any observable changes in bone tissue. The biomechanical testing of the bones did not show any significant changes in bone strength after PCB 153 or PCB 126 exposure. In conclusion, perinatal exposure to PCB 153, but not PCB 126, resulted in altered bone composition in female goat offspring
Medidas socioeducativas em meio aberto em Guaíba: entre pressupostos e significados
Jacques, Luciana Gomes de Lima
2015-01-01
No presente estudo, do tipo descritivo e exploratório, de natureza qualitativa, fundamentado no método dialético-crítico, discorre-se sobre os aspectos de proximidade e de distanciamento entre os pressupostos da socioeducação no Sistema Único de Assistência Social (SUAS) e no Sistema Nacional Socioeducativo (SINASE), e analisam-se os significados atribuídos às Medidas Socioeducativas em Meio Aberto (MSE-MA) pelos sujeitos que a protagonizam e/ou que participaram de seu processo de municipaliz...
Bouayad Alam, Samira; Dib, Mohammed El Amine; Djabou, Nassim; Tabti, Boufeldja; Gaouar Benyelles, Nassira; Costa, Jean; Muselli, Alain
2017-07-01
Thymus capitatus and Tetraclinis articulata essential oils as well their major components (carvacrol and α-pinene) were evaluated for their antifungal and insecticidal activities. Both oils showed good in vitro antifungal activity against Fusarium oxysporum, Aspergillus niger, Penicillium sp., Alternaria alternata, and Botrytis cinerea, the fungi causing tomato rot. In vivo results indicate the efficacies of both essential oils and carvacrol of reduce postharvest fungal pathogens, such as B. cinerea and Al. alternata that are responsible of black and gray rot of tomato fruit. Disease incidence of Al. alternata and B. cinerea decreased on average from 55% to 80% with essential oil of Th. capitatus and pure carcvacrol, while Te. articulata essential oil exhibited inhibition of fungal growth of 55% and 25% against Al. alternata and B. cinerea, respectively, with concentration of 0.4 μl/l air. The insecticidal activity of Th. capitatus and Te. articulata essential oils exhibited also a good insecticidal activity. At the concentration of 0.2 μl/ml air, the oils caused mortality over 80% for all larval stages of Tuta absoluta and 100% mortality for the first-instar after 1.5 h only of exposure. α-Pinene presented lower insecticidal and antifungal activities compared to essential oils of Th. capitatus, Te. articulata and pure carvacrol. Thus, these essential oils can be used as a potential source to develop control agents to manage some of the main pests and fungal diseases of tomato crops. © 2017 Wiley-VHCA AG, Zurich, Switzerland.
Maimon, Roy; Ionescu, Ariel; Bonnie, Avichai; Sweetat, Sahar; Wald-Altman, Shane; Inbar, Shani; Gradus, Tal; Trotti, Davide; Weil, Miguel; Behar, Oded; Perlson, Eran
2018-05-17
Axon degeneration and disruption of neuromuscular junctions (NMJs) are key events in Amyotrophic Lateral Sclerosis (ALS) pathology. Although the disease's etiology is not fully understood, it is thought to involve a non-cell-autonomous mechanism and alterations in RNA metabolism. Here, we identified reduced levels of miR-126-5p in pre-symptomatic ALS male mice models, and an increase in its targets: axon destabilizing type-3 Semaphorins and their co-receptor Neuropilins. Utilizing compartmentalized in vitro co-cultures, we demonstrated that myocytes expressing diverse ALS-causing mutations promote axon degeneration and NMJ dysfunction, which were inhibited by applying Neuropilin1 (NRP1) blocking antibody. Finally, overexpressing miR126-5p is sufficient to transiently rescue axon degeneration and NMJ disruption both in vitro and in vivo Thus, we demonstrate a novel mechanism underlying ALS pathology, in which alterations in miR126-5p facilitate a non-cell-autonomous mechanism of motor neuron degeneration in ALS. SIGNIFICANCE STATEMENT In spite of some progress, currently no effective treatment is available for ALS. We suggest a novel regulatory role for miR126-5p in ALS and demonstrate for the first time a mechanism by which alterations in miR126-5p contribute to axon degeneration and NMJ disruption observed in ALS. We show that miR126-5p is altered in ALS models and that it can modulate Sema3 and NRP protein expression. Furthermore, NRP1 elevations in motor neurons and muscle secretion of Sema3A contribute to axon degeneration and NMJ disruption in ALS. Finally, overexpressing miR126-5p is sufficient to transiently rescue NMJ disruption and axon degeneration both in vitro and in vivo. Copyright © 2018 Maimon et al.
Liao, Feng-Ling; Tan, Lin; Liu, Hua; Wang, Jin-Ju; Ma, Xiao-Tang; Zhao, Bin; Chen, Yanfang; Bihl, Ji; Yang, Yi; Chen, Ri-Ling
2018-04-01
Cell-derived exosomes (EXs) can modulate target cell differentiation via microRNAs (miRs) that they carried. Previous studies have shown that miR126 is highly expressed in hematopoietic stem cells (HSCs) and plays a role in hematopoiesis via modulating the Notch pathway that participates in progenitors' cell fate decisions. In this study we investigated whether HSC-derived EXs (HSC-EXs) could affect the differentiation of mouse embryonic stem cells (ESCs) into HSCs. We prepared HSC-EXs con , HSC-EXs sc and HSC-EXs miR126 from control HSCs and the HSCs transfected with scramble control or miR126 mimics, respectively. HSC-EXs were isolated by ultracentrifugation and analyzed using nanoparticle tracking analysis. We incubated the collected EXs with mouse ESCs over a 10-d differentiation induction period, during which HSC-EXs and a Notch pathway activator (Jagged1, 100 ng/mL) were added to the cultures every 3 d. After the 10-d differentiation period, the expression levels of miR126, SSEA1, CD117, Sca1, Notch1 and Hes1 in ESCs were assessed. The generated HSCs were validated by flow cytometry using antibodies against HSC markers (CD117, CD34 and Sca1). Our results revealed that: (1) transfection with miR126 mimics significantly increased miR126 levels in HSC-EXs miR126 . (2) HSC-EX co-culture promoted mouse ESCs differentiation into HSCs with the most prominent effect found in the HSC-EXs miR126 co-culture. (3) HSC differentiation was verified by reduced SSEA1 expression and increased CD117 and Sca1 expression. (4) All the effects caused by HSC-EXs were accompanied by significant reduction of Notch1 and Hes1 expression, thus inhibition of the Notch1/Hes1 pathway, whereas activation of Notch by Jagged1 abolished the effects of HSC-EXs miR126 . In conclusion, HSC-EXs promote hematopoietic differentiation of mouse ESCs in vitro by inhibiting the miR126/Notch1 pathway.
Directory of Open Access Journals (Sweden)
Alfredo Ribeiro de Freitas
2005-12-01
Full Text Available Objetivou-se estudar duas alternativas de análises de variâncias e covariâncias para dados de pesagens de bovinos. Foram utilizados dados de animais Nelore, Guzerá, Gir e Indubrasil, machos e fêmeas, pertencentes à Associação Brasileira de Criadores de Zebu - ABCZ. De cada indivíduo, foram obtidas, em intervalos trimestrais, nove medidas repetidas de pesos, do nascimento aos dois anos de idade. Na primeira análise, a variável resposta y i foi transformada por meio da família de transformação de Box-Cox y ilambda = (ylambda-lambda/lambda, (l ¹ 0 ou y i = log y i, (lambda = 0. Essa transformação foi efetiva na redução dos coeficientes de assimetria e da heterogeneidade de variância para todas as pesagens e raças. Na segunda análise, foi selecionada a estrutura de covariâncias mais adequada para representar a variabilidade dentro de indivíduo, considerando-se um modelo misto usual para medidas repetidas. Utilizando-se os critérios fornecidos pelo procedimento MIXED do SAS: distribuição de chi2, AIC ("Akaike's Information Criterion" e SBC ("Schwarz's Bayesian Criterion", a estrutura de covariância mais adequada para todas as raças foi a Não-Estruturada, seguida da estrutura Fator-Analítico para Nelore, Gir e Indubrasil e Simetria Composta Heterogênea para Guzerá.Data consisting of individual records of male and female animals of purebred Bos Indicus beef cattle (Nellore, Guzerá, Gir and Indubrasil weighted every three months from birth to 24 months of age available from National Archive of Brazilian Zebu Breeders Association (ABCZ were used to evaluate two alternatives (covariance analyses for body weight. In the first analysis the Box-Cox family transformation y ilambda = (ylambda-lambda/lambda (l ¹ 0 or y i = log y i, for lambda=0 was effective in reducing the asymmetry of the coefficients and variance heterogeneity for all weights and breeds. In the second analysis a usual standard mixed model for repeated
Habilidades auditivas e medidas da imitância acústica em crianças de 4 a 6 anos de idade
Toscano,Rafaela Della Giacoma Prado; Anastasio,Adriana Ribeiro Tavares
2012-01-01
OBJETIVO: avaliar o desempenho em habilidades auditivas e as condições de orelha média de crianças de 4 a 6 anos de idade. MÉTODO: foram aplicados os testes de detecção sonora (audiômetro pediátrico em 20dBNA), a Avaliação Simplificada do Processamento Auditivo (ASPA) e as medidas de imitância acústica (handtymp com tom de 226Hz) em 61 crianças com média de idade de 5,65 anos. Para comparar os resultados das provas de habilidades auditivas e das medidas da imitância acústica foi aplicado o te...
Medida de Segurança: a violação do direito à saúde a partir do conceito de periculosidade
Valéria Rondon Rossi
2015-01-01
A relação dos fenômenos da loucura e criminalidade foi um ponto estratégico para a constituição da medicina mental – psiquiatria e para a constituição de instituições de controle, punição e regeneração. No Brasil, a resposta penal aos crimes dos loucos infratores é a medida de segurança, instituto que se anuncia como despenalizante e voltado ao tratamento em saúde. No entanto, vigora o sistema da periculosidade como parâmetro para imposição e suspensão da medida de segurança, o que faz com qu...
Los riesgos de la tecnología. Medidas tecnológicas de protección: el caso de los DVD
Directory of Open Access Journals (Sweden)
Jhonny Antonio Pabón Cadavid
2008-11-01
Full Text Available Conceptos como el de sociedad red y sociedad del riesgo revelan una serie de transformaciones que están sucediendo a nivel social, político, económico, cultural y jurídico. Las medidas tecnológicas de protección de los contenidos protegidos por el derecho de autor y la tutela legal que se les ha otorgado son un icono de las problemáticas del derecho en este nuevo escenario de la sociedad red y sociedad del riesgo. Se estudia en el presente artículo siete procesos relacionados con las mtp y los dvd-Video; jurisprudencias de Estados Unidos, Francia, Noruega y Finlandia, que nos permiten observar las múltiples implicaciones relacionadas de este tema con derecho del consumo, derecho de la competencia, libertad de expresión, acceso a la cultura, secretos comerciales, relaciones contractuales y propiedad intelectual. La jurisprudencia y el desarrollo del mercado de las medidas tecnológicas de protección demuestran que existe un desequilibrio entre los riesgos que intentan contener, los cuales son de interés exclusivo de la industria tecnológica y de contenidos, y los riesgos que la implementación de estas medidas producen en intereses colectivos, como la eficiencia del mercado y la innovación.
29 CFR 1910.126 - Additional requirements for special dipping and coating operations.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Additional requirements for special dipping and coating... Dipping and Coating Operations § 1910.126 Additional requirements for special dipping and coating... requirements apply to flow coating? (1) You must use a direct low-pressure pumping system or a 10-gallon (38 L...
Directory of Open Access Journals (Sweden)
José Lopes Silva
2011-07-01
Full Text Available Este artigo resulta da pesquisa sobre adolescentes em conflito com a lei e o cumprimento da medida sócio educativa de Prestação de Serviços a Comunidade no município de Maringá – PR. Trata-se de uma pesquisa documental qualitativa, cujo objetivo foi o de construir uma breve reflexão sobre a a infância e juventude para compreensão do envolvimento do adolescente em atos infracionais. A pesquisa foi realizada no Centro de Referência Sócio Educativo - CRSE, órgão executor das medidas sócio educativas de Prestação de Serviços a Comunidade e Liberdade Assistida, no município de Maringá- PR. A pesquisa ocorreu em duas etapas: a revisão de literatura sobre os temas criança e adolescente e adolescente em conflito com a lei. A segunda ocorreu por meio da consulta ao banco de dados do CRSE; do registro dos prontuários dos adolescentes que cumprem a referida medida, bem como os instrumentos utilizados pelos profissionais do CRSE nos atendimentos realizados. A pesquisa foi desenvolvida no período de julho a novembro de 2010. Foi possível identificar o perfil do adolescente em cumprimento de medida sócio educativa de PSC no CRSE. Esta identificação nos deu a dimensão da situação econômica e social do adolescente e família atendidos pela equipe do programa.
Directory of Open Access Journals (Sweden)
Tânia Pereira Nunes
2005-12-01
Full Text Available OBJETIVO: Comparar a medida manual do comprimento vertical da fenda palpebral e sua medida obtida por meio de processamento computadorizado de imagens de indivíduos sem alterações palpebrais. MÉTODOS: Foram analisadas 102 fendas palpebrais de 51 indivíduos normais. A faixa etária variou entre 17 e 84 anos, sendo 25 (49% do sexo masculino e 26 (51% do sexo feminino. RESULTADOS: Não houve diferença estatisticamente significativa entre as medidas manuais da fenda palpebral e as obtidas por meio de processamento computadorizado de imagens. Também não se observou diferença entre ambos os sexos e a faixa etária. CONCLUSÕES: Os resultados obtidos com estes dois métodos podem ser comparados entre si devida à equivalência estatística das medidas.PURPOSE: To compare the measurement of the palpebral fissure done either manually and by computer analysis of image of individuals without lid alterations. METHODS: One hundred two palpebral fissures from 51 normal subjects have been analyzed. The patients' age ranged from 17 to 84 years, with 25 (49% males and 26 (51% females. RESULTS: There was no statistically significant difference between the measurements done either manually or by computer analysis of images, neither, when we grouped the patients by sex or age. Also we did not observe difference between males and females, and regarding age. CONCLUSIONS: The results obtained by both methods are comparable and reliable due to the statistical equivalence of the obtained measurements.
Medidas que puede tomar para prevenir el cáncer (Steps You Can Take to Prevent Cancer)
Centers for Disease Control (CDC) Podcasts
2012-02-02
Este podcast habla de las principales medidas que las personas pueden tomar para reducir su riesgo de contraer cáncer. Created: 2/2/2012 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP). Date Released: 3/13/2012.
GRITO DE SOCORRO: TENHO MEDO DE MORRER - A VIOLÊNCIA DOMÉSTICA E O USO DA MEDIDA PROTETIVA
Directory of Open Access Journals (Sweden)
Elizangêla Silva Paiva
2018-03-01
Full Text Available O presente artigo trata-se da Lei 11.340/06, mais conhecida como Lei Maria da Penha. Tem-se o objetivo de demonstrar a importância da lei citada. Para a realização de tal estudo, foram analisadas obras bibliográficas. Apresentando conceitos trazidos por Dias (2007, Mirabetti (2000, Souza (2009, entre outros; busca-se desenvolver o entendimento sobre as formas de violência dos casos onde a referida lei poderá ser aplicada. Seguindo esta linha de raciocínio, apresentam-se as soluções sustentadas pela lei Maria da Penha, analisando-se o contexto do caso concreto para aplicar-se uma medida eficaz. Ao estudarem-se estas medidas, nota-se a existência de vários casos aos quais não se verifica a eficácia da sansão imposta; neste diapasão, tem-se um breve estudo apresentando as principais causas que podem justificar a origem desta questão.
13 CFR 126.103 - What definitions are important in the HUBZone program?
2010-01-01
... work week. The totality of the circumstances, including factors relevant for tax purposes, will..., pursuant to the provisions of the Agricultural Marketing Act, 12 U.S.C. 1141j, whose size does not exceed... May 3, 2010. For the convenience of the user, the revised text is set forth as follows: § 126.103 What...
Campos, Mateus R.; Rodrigues, Agna Rita S.; Silva, Wellington M.; Silva, Tadeu Barbosa M.; Silva, Vitória Regina F.; Guedes, Raul Narciso C.; Siqueira, Herbert Alvaro A.
2014-01-01
The introduction of an agricultural pest species into a new environment is a potential threat to agroecosystems of the invaded area. The phytosanitary concern is even greater if the introduced pest’s phenotype expresses traits that will impair the management of that species. The invasive tomato borer, Tuta absoluta (Meyrick) (Lepidoptera: Gelechiidae), is one such species and the characterization of the insecticide resistance prevailing in the area of origin is important to guide management efforts in new areas of introduction. The spinosad is one the main insecticides currently used in Brazil for control of the tomato borer; Brazil is the likely source of the introduction of the tomato borer into Europe. For this reason, spinosad resistance in Brazilian populations of this species was characterized. Spinosad resistance has been reported in Brazilian field populations of this pest species, and one resistant population that was used in this study was subjected to an additional seven generations of selection for spinosad resistance reaching levels over 180,000-fold. Inheritance studies indicated that spinosad resistance is monogenic, incompletely recessive and autosomal with high heritability (h 2 = 0.71). Spinosad resistance was unstable without selection pressure with a negative rate of change in the resistance level ( = −0.51) indicating an associated adaptive cost. Esterases and cytochrome P450-dependent monooxygenases titration decreased with spinosad selection, indicating that these detoxification enzymes are not the underlying resistance mechanism. Furthermore, the cross-resistance spectrum was restricted to the insecticide spinetoram, another spinosyn, suggesting that altered target site may be the mechanism involved. Therefore, the suspension of spinosyn use against the tomato borer would be a useful component in spinosad resistance management for this species. Spinosad use against this species in introduced areas should be carefully monitored to
DEFF Research Database (Denmark)
Hansen, T F; Carlsen, A L; Heegaard, N H H
2015-01-01
BACKGROUND: This study investigated the predictive value of circulating microRNA-126 (cir-miRNA-126) in patients with metastatic colorectal cancer (mCRC) treated with first-line chemotherapy combined with bevacizumab.METHODS: The study included 68 patients. Blood samples (plasma) were collected b...
Satellite Atmospheric Radiance Measurements in the Vacuum Ultraviolet.
1979-07-05
APERTURE I I 1_ _126;~;J ;~- WHEEL MOTOR IDRIVE r126;~; II I :_-~I 126;~~~~~~~~~~~~~~~~~; 126;~;~_I 126;~;APERT URE WHEEL\\ ELLIPSOIDAL PRIMARY MIRROR VV ~ V SUNSHADE V I...Table 1. Vacuum Ultraviolet Backg rounds Sensors (Cont ) P~ iot ometer Interf erence Filters (A) 1216 1340 1550 1750 no f
Jansen, Felix; Yang, Xiaoyan; Hoelscher, Marion; Cattelan, Arianna; Schmitz, Theresa; Proebsting, Sebastian; Wenzel, Daniela; Vosen, Sarah; Franklin, Bernardo S; Fleischmann, Bernd K; Nickenig, Georg; Werner, Nikos
2013-10-29
Repair of the endothelium after vascular injury is crucial for preserving endothelial integrity and preventing the development of vascular disease. The underlying mechanisms of endothelial cell repair are largely unknown. We sought to investigate whether endothelial microparticles (EMPs), released from apoptotic endothelial cells (ECs), influence EC repair. Systemic treatment of mice with EMPs after electric denudation of the endothelium accelerated reendothelialization in vivo. In vitro experiments revealed that EMP uptake in ECs promotes EC migration and proliferation, both critical steps in endothelial repair. To dissect the underlying mechanisms, Taqman microRNA array was performed, and microRNA (miR)-126 was identified as the predominantly expressed miR in EMPs. The following experiments demonstrated that miR-126 was transported into recipient human coronary artery endothelial cells by EMPs and functionally regulated the target protein sprouty-related, EVH1 domain-containing protein 1 (SPRED1). Knockdown of miR-126 in EMPs abrogated EMP-mediated effects on human coronary artery endothelial cell migration and proliferation in vitro and reendothelialization in vivo. Interestingly, after simulating diabetic conditions, EMPs derived from glucose-treated ECs contained significantly lower amounts of miR-126 and showed reduced endothelial repair capacity in vitro and in vivo. Finally, expression analysis of miR-126 in circulating microparticles from 176 patients with stable coronary artery disease with and without diabetes mellitus revealed a significantly reduced miR-126 expression in circulating microparticles from diabetic patients. Endothelial microparticles promote vascular endothelial repair by delivering functional miR-126 into recipient cells. In pathological hyperglycemic conditions, EMP-mediated miR-126-induced EC repair is altered.
Fasti consulares, fasti locales y horologia en la epigrafía de Hispania
Directory of Open Access Journals (Sweden)
Abascal, Juan Manuel
2002-12-01
Full Text Available The number of texts with consular or local dating in Roman inscriptions of Hispania is low, but the Fasti consulares and Fasti locales are mentioned in all texts series. They are some epigraphic evidences for the public horologia at the towns; however, the time mensuration is only a city task, but not a private matter.El número de inscripciones con dataciones absolutas en Hispania, corno en el resto del Imperio, es muy reducido; las referencias a los Fasti consulares y Fasti locales están presentes en todo tipo de inscripciones, pero la costumbre de datar las inscripciones fue una práctica poco extendida; los escasos testimonios epigráficos de horologia públicos parecen indicar que la medida del tiempo fue más una preocupación administrativa que una costumbre de la población.
Zhang, Junfeng; Zhang, Zongqi; Zhang, David Y; Zhu, Jianbing; Zhang, Tiantian; Wang, Changqian
2013-01-01
Endothelial progenitor cells (EPCs) are capable of proliferating and differentiating into mature endothelial cells, and they have been considered as potential candidates for coronary heart disease therapy. However, the transition of EPCs to mesenchymal cells is not fully understood. This study aimed to explore the role of microRNA 126 (miR-126) in the endothelial-to-mesenchymal transition (EndMT) induced by transforming growth factor beta 1 (TGFβ1). EndMT of rat bone marrow-derived EPCs was induced by TGFβ1 (5 ng/mL) for 7 days. miR-126 expression was depressed in the process of EPC EndMT. The luciferase reporter assay showed that the PI3K regulatory subunit p85 beta (PIK3R2) was a direct target of miR-126 in EPCs. Overexpression of miR-126 by a lentiviral vector (lenti-miR-126) was found to downregulate the mRNA expression of mesenchymal cell markers (α-SMA, sm22-a, and myocardin) and to maintain the mRNA expression of progenitor cell markers (CD34, CD133). In the cellular process of EndMT, there was an increase in the protein expression of PIK3R2 and the nuclear transcription factors FoxO3 and Smad4; PI3K and phosphor-Akt expression decreased, a change that was reversed markedly by overexpression of miR-126. Furthermore, knockdown of PIK3R2 gene expression level showed reversed morphological changes of the EPCs treated with TGFβ1, thereby giving the evidence that PIK3R2 is the target gene of miR-126 during EndMT process. These results show that miR-126 targets PIK3R2 to inhibit EPC EndMT and that this process involves regulation of the PI3K/Akt signalling pathway. miR-126 has the potential to be used as a biomarker for the early diagnosis of intimal hyperplasia in cardiovascular disease and can even be a therapeutic tool for treating cardiovascular diseases mediated by the EndMT process.
El tecnoestrés: un estudio del desarrollo de diferentes instrumentos de medida
Ventura, Mercedes; Llorens Gumbau, Susana; Salanova Soria, Marisa
2005-01-01
Onzenes Jornades de Foment de la Investigació de la FCHS (Any 2005-2006) El uso de las Tecnologías de la Información y la Comunicación (TICs) como herramienta de trabajo está teniendo un gran impacto en el mundo laboral. A pesar de que en si misma la tecnología es ‘neutra’ también puede generar consecuencias negativas en los usuarios de TIC quienes pueden sufrir el llamado ‘tecnoestrés’. El concepto y por tanto, la medida de este fenómeno han sufrido diferentes variaciones a lo la...
Energy Technology Data Exchange (ETDEWEB)
Morales-Arteaga, Maria [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2017-11-07
This GUM WorkbenchTM propagation of uncertainty is for the coulometric measurement of the plutonium concentration in a Pu standard material (C126) supplied as individual aliquots that were prepared by mass. The C126 solution had been prepared and as aliquoted as standard material. Samples are aliquoted into glass vials and heated to dryness for distribution as dried nitrate. The individual plutonium aliquots were not separated chemically or otherwise purified prior to measurement by coulometry in the F/H Laboratory. Hydrogen peroxide was used for valence adjustment.
Directory of Open Access Journals (Sweden)
Guilherme Victor Nippes Pereira
2008-06-01
Full Text Available Uma das estratégias do melhoramento do tomateiro, no Brasil, visando à resistência a pragas, tem sido a utilização de aleloquímicos presentes nos folíolos. Objetivou-se no presente trabalho, estudar os níveis de resistência a dois artrópodos-pragas [traça do tomateiro (Tuta absoluta e ácaros (Tetranychus evansi], em genótipos previamente selecionados com base apenas no seu teor foliar de acilaçúcares. Foram selecionadas 11 plantas contrastantes quanto aos níveis de acilaçúcares nos folíolos, de uma população F3RC2, derivada do cruzamento interespecífico Lycopersicon esculentum Mill 'TOM-584' x Lycopersicon pennellii (Correll D'Arcy 'LA-716'. Esses genótipos, juntamente com os genitores TOM-584 e LA-716, foram submetidos a ensaios de repelência/resistência a artrópodos-pragas. No teste de repelência ao ácaro T. evansi, as plantas com altos teores de acilaçúcares se comportaram de forma semelhante ao genitor resistente LA-716. As magnitudes das correlações foram negativas e significativas, confirmando assim a associação entre altos teores do aleloquímico e a resistência (repelência ao ácaro, avaliada pela distância percorrida. No ensaio realizado com a traça do tomateiro, os genótipos foram avaliados para danos nas plantas e lesões nos folíolos. Os genótipos contendo alto teor de acilaçúcares, demonstraram bons níveis de resistência a Tuta absoluta, não diferindo significativamente do acesso selvagem LA-716. Em todas as épocas de avaliação, os teores de acilaçúcares mostraram-se alta e negativamente correlacionados com os níveis de dano causados pela traça. Os resultados obtidos comprovaram a eficiência da seleção de genótipos de tomateiro com elevados teores de acilaçúcares nos folíolos, visando à resistência a artrópodos-praga.Selection for high foliar levels of allelochemicals has been proposed as a suitable strategy for breeding tomatoes for arthropod pest resistance. In the
International Nuclear Information System (INIS)
Groppo, Gerson Antonio
1996-10-01
The effects of different gamma radiation (Cobalt-60) doses on different phases of the evolutive cycle of Tuta absoluta (Meyrich, 1917) (Lepidoptera, Gelechiidae) have been studied under laboratory conditions in the laboratory of Entomology of Center for Nuclear Energy in Agriculture (CENA), University of Sao Paulo, Piracicaba, Sao Paulo State, Brazil. For all the treatments with gamma radiation a Cobalt-60 source type Gamma beam-650 was used. The doses utilized ranged from of 0,0 (Control) to 3250 Gy with a dose rate of 1110 Gy/h. The experiment was conducted under controlled conditions at 25± 2 deg C, 70 ± 5% of relative humidity and photo period of (12:12). It was verified that the lethal doses were: for eggs - 70 Gy; for larvae - 200 Gy e for pupae - 300 Gy. The sterilizing dose for adults from irradiated larvae was 45 Gy. The sterilizing dose for the crossing of irradiated female with normal males (FI X MN) was 100 Gy and for normal female with irradiated male (FN x MI) was 150 Gy, in the both crosses, doses refer to irradiation of pupae. The sterilizing dose for adults, of both sexes, irradiated and crossed with normal adults, (FI x MN) and (FN x MI, were 150 and 200 Gy, respectively. The average longevity of adults, of both sexes, irradiated and crossed with normal adults was 8,3 days. The immediate lethal dose for adults was 3250 Gy. (author)
Dai, Bingyan; Pan, Qunwen; Li, Zhanghua; Zhao, Mingyan; Liao, Xiaorong; Wu, Keng; Ma, Xiaotang
2016-01-01
Multilayer composite membrane of biomaterials can increase the function of adipose stem cells or osteoprogenitor cells. Recent evidence indicates endothelial progenitor cells (EPCs) and EPCs released microvesicles (MVs) play important roles in angiogenesis and vascular repair. Here, we investigated the effects of biomaterial multilayer membranes of hyaluronic acid (HA) or chondroitin sulfate (CS) and Collagen I (Col I) on the functions and MVs release of EPCs. Layer-by-layer (LBL) technology was applied to construct the multilayer composite membranes. Four types of the membranes constructed by adsorbing either HA or CS and Col I alternatively with different top layers were studied. The results showed that all four types of multilayer composite membranes could promote EPCs proliferation and migration and inhibit cell senility, apoptosis, and the expression of activated caspase-3. Interestingly, these biomaterials increased the release and the miR-126 level of EPCs-MVs. Moreover, the CS-Col I membrane with CS on the top layer showed the most effects on promoting EPCs proliferation, EPCs-MV release, and miR-126 level in EPCs-MVs. In conclusion, HA/CS and Collagen I composed multilayer composite membranes can promote EPCs functions and release of miR-126 riched EPCs-MVs, which provides a novel strategy for tissue repair treatment.
International Nuclear Information System (INIS)
Dang, Juan; Shi, Xiangli; Zhang, Qingzhu; Wang, Wenxing
2015-01-01
Polychlorinated biphenyls (PCBs) primarily exist in the gas phase in air and may undergo atmospheric oxidation degradations, particularly the oxidation reaction initiated by OH radicals. In this work, the mechanism of the OH radical-initiated atmospheric oxidation of the most toxic PCB congener 3,3′,4,4′,5-pentachlorobiphenyl (PCB126) was investigated by using quantum chemistry methods. The rate constants of the crucial elementary reactions were estimated by the Rice–Ramsperger–Kassel–Marcus (RRKM) theory. The oxidation products of the reaction of PCB126 with OH radicals include 3,3′,4,4′,5-pentachlorobiphenyl-ols, chlorophenols, 2,3,4,7,8-pentachlorodibenzofuran, 2,3,4,6,7-pentachlorodibenzofuran, dialdehydes, 3,3′,4,4′,5-pentachloro-5′-nitro-biphenyl, and 4,5-dichloro-2-nitrophenol. Particularly, the formation of polychlorinated dibenzofurans (PCDFs) from the atmospheric oxidation of PCBs is revealed for the first time. The overall rate constant of the OH addition reaction is 2.52 × 10 −13 cm 3 molecule −1 s −1 at 298 K and 1 atm. The atmospheric lifetime of PCB126 determined by OH radicals is about 47.08 days which indicates that PCB126 can be transported long distances from local to global scales. - Highlights: • A comprehensive mechanism of OH-initiated oxidation of PCB126 was investigated. • The formation of PCDFs from the oxidation of PCBs is determined for the first time. • The rate constants for key elementary reactions were estimated by the RRKM theory. • The atmospheric lifetime of PCB126 determined by OH radicals is about 47.08 days
Qin, Haiyan; Zhang, Guang; Zhang, Lianbo
2018-01-01
Polycomb group genes (PcG) encode chromatin modification proteins that are involved in the epigenetic regulation of cell differentiation, proliferation and the aging processes. The key subunit of the PcG complex, enhancer of zeste 2 polycomb repressive complex 2 subunit (EZH2), has a central role in a variety of mechanisms, such as the formation of chromatin structure, gene expression regulation and DNA damage. In the present study, ultraviolet A (UVA) was used to radiate human dermal fibroblasts in order to construct a photo-aged cell model. Subsequently, the cell viability assay, Hoechst staining, apoptosis detection using flow cytometry, senescence-associated β-galactosidase (SA-β-gal) staining and erythrocyte exclusion experiments were performed. GSK126, a histone methylation enzyme inhibitor of EZH2, was used as an experimental factor. Results suggested that GSK126 downregulated the mRNA expression levels of EZH2 and upregulated the mRNA expression levels of BMI-1. Notably, GSK126 affected the transcription of various photoaging-related genes and thus protected against photoaging induced by UVA radiation. PMID:29545866
Medidas compensatórias aplicáveis à questão da poluição hídrica de origem agrícola
Martini, Luiz Carlos Pittol
2000-01-01
Tese (doutorado) - Universidade Federal do Rio Grande do Sul, Instituto de Pesquisas Hidráulicas. Em uma estrutura de gestão que privilegia aspectos econômicos, avalia-se o uso de medidas compensatórias como alternativa para proteção das águas no meio rural. Essas medidas visam compensar os agricultores pelas perdas econômicas decorrentes de mudanças no sistema de produção quando se busca proteção dos mananciais hídricos. Como exemplo de caso, simula-se a aplicação das compensações na baci...
La educación tributaria como medida para incrementar la recaudación fiscal
Tapia, Monica; Gaona, Wilmer; Tumbaco, Pedro
2009-01-01
La presente tesis está basada en el análisis de la La Educación Tributaria como Medida para Incrementar la Recaudación Fiscal en Ecuador; la importancia de este tema es incrementar la base de contribuyentes, aumentando la Recaudación Fiscal que ayudará a desarrollar planes de inversión y una estabilidad tributaria. Dentro de este estudio es necesario un análisis completo de naturaleza teórica, donde se examinaría la actividad financiera del Estado, la importancia en lo económico, ...
Development of an Optical Disc Recorder
1977-02-01
Kenney , F / Zernike D /Lou ,~ R,’Harp:r 1 ( Li, ‘126;~~~~~~~~~~~~~~~~~~~~~; _ _ 126;~; _ 126;~~~~~~~~~~~~~; I R. McFarlane - - ____________________________ 9. PER...7 371 4 0 “7 4 :4 7-7 / 99 c crc 7i 3d ) -75, 375 331 4 7 Cl 4 :53 2177 70 Ci 0 0 2 ) 2 2-37 3172 FIGURE 4 . 1 S I M I I I A T 1 ON RESUl TS FOR
Directory of Open Access Journals (Sweden)
Ana Maria Lacerda Teixeira Pires
2010-04-01
Full Text Available El estudio trataba de medir las manifestaciones del prejuicio racial en una muestra de la población brasileña, utilizando las escalas de racismo moderno de McConahay, Hardee y Batts (1981 y la escala de racismo cordial de Turra y Venturi (1995 y Venturi (2003. Se aplicó los cuestionarios a un total de 101 estudiantes de diversas universidades en la región sur de Brasil. Los resultados muestran que las dos escalas difieren entre si respecto a captar las expresiones del prejuicio. Las personas declararon mayor racismo moderno que racismo cordial. También hemos estudiado las variables que influyen en el prejuicio racial declarado por los participantes. La variable género y orientación a la dominancia social son variables que predicen el racismo moderno en la muestra estudiada. Los participantes indicaron, en mayor medida, la manifestación del prejuicio racial de forma encubierta y lo hacen más abiertamente cuando hay la posibilidad del contacto personal y estrecho.O estudo avaliou as manifestações de preconceito racial em uma amostra da população brasileira, usando escalas de racismo moderno de McConahay, Hardee e Batts (1981, escala racismo cordial do Datafolha (1995 e Venturi, G. (2003. Os questionários foram aplicados a um total de 101 estudantes de várias universidades da região sul do Brasil. Os resultados mostram que as duas escalas diferem entre si sobre como capturar as expressões de preconceito. As pessoas relataram mais racismo moderno que racismo cordial. Estudamos também as variáveis que influenciam o preconceito racial declarado pelos participantes. As variáveis gênero e orientação à dominância social são preditores do racismo moderno na amostra estudada. Os participantes indicaram, em maior medida, a manifestação do preconceito racial dissimulado e o fazem mais abertamente quando existe a possibilidade do contato pessoal e estreito.This study measured the manifestations of racial prejudice in a sample of
Prevalence of otologic symptoms in temperomandibular disorders: 126 case studies
Pascoal, Maria I. N.; Rapoport, Abrão; Chagas, José F. S.; Pascoal, Maria B.N.; Costa, Claudiney C.; Magna, Luis Antonio
2001-01-01
Introdução: A presença de sintomas otológicos associados à desordem temporomandibular (DTM) é discutida há seis décadas; entretanto, sua etiologia ainda permanece obscura. Forma de estudo: Prospectivo clínico randomizado. Objetivo: Neste estudo foram avaliadas a prevalência de sintomas otológicos na DTM, sua correlação com a dor muscular e a ausência de dentes posteriores. Material e Método: Foram avaliados 126 pacientes portadores de DTM, através de questionário subjetivo dos sintomas, palpa...
Directory of Open Access Journals (Sweden)
Junfeng Zhang
Full Text Available AIMS: Endothelial progenitor cells (EPCs are capable of proliferating and differentiating into mature endothelial cells, and they have been considered as potential candidates for coronary heart disease therapy. However, the transition of EPCs to mesenchymal cells is not fully understood. This study aimed to explore the role of microRNA 126 (miR-126 in the endothelial-to-mesenchymal transition (EndMT induced by transforming growth factor beta 1 (TGFβ1. METHODS AND RESULTS: EndMT of rat bone marrow-derived EPCs was induced by TGFβ1 (5 ng/mL for 7 days. miR-126 expression was depressed in the process of EPC EndMT. The luciferase reporter assay showed that the PI3K regulatory subunit p85 beta (PIK3R2 was a direct target of miR-126 in EPCs. Overexpression of miR-126 by a lentiviral vector (lenti-miR-126 was found to downregulate the mRNA expression of mesenchymal cell markers (α-SMA, sm22-a, and myocardin and to maintain the mRNA expression of progenitor cell markers (CD34, CD133. In the cellular process of EndMT, there was an increase in the protein expression of PIK3R2 and the nuclear transcription factors FoxO3 and Smad4; PI3K and phosphor-Akt expression decreased, a change that was reversed markedly by overexpression of miR-126. Furthermore, knockdown of PIK3R2 gene expression level showed reversed morphological changes of the EPCs treated with TGFβ1, thereby giving the evidence that PIK3R2 is the target gene of miR-126 during EndMT process. CONCLUSIONS: These results show that miR-126 targets PIK3R2 to inhibit EPC EndMT and that this process involves regulation of the PI3K/Akt signalling pathway. miR-126 has the potential to be used as a biomarker for the early diagnosis of intimal hyperplasia in cardiovascular disease and can even be a therapeutic tool for treating cardiovascular diseases mediated by the EndMT process.
Violencia de género en el ámbito universitario. Medidas para su superación.
Directory of Open Access Journals (Sweden)
Consol Aguilar Ródenas
2009-01-01
Full Text Available Este artículo expone parte de los resultados de la primera investigación sobre violencia de género en las universidades españolas. A partir de la revisión de investigaciones internacionales, mostramos que la violencia de género tiene una presencia importante en las universidades. Posteriormente, identificamos medidas para la prevención y superación de la violencia de género que ya se están desarrollando en algunas de las universidades de más prestigio internacional. Ambos aspectos son el punto de partida para el estudio de la violencia de género en las universidades españolas y para el diseño de medidas que contribuyan a su superación.---------------------------------------------------------------------This article contains some of the results from the first research on gender violence in Spanish universities. Based on a review of international research, we demonstrate that gender violence is prevalent in universities. Subsequently, we identify measures to prevent and overcome gender violence which are already being developed in some of the most prestigious international universities. Both of these aspects are the starting off point to study gender violence in Spanish universities and to design measures which contribute towards overcoming it.
Directory of Open Access Journals (Sweden)
Inmaculada García Sánchez
2011-06-01
Full Text Available En la actualidad, investigadores y entrenadores utilizan la repetición máxima (1RM en el ejercicio de sentadilla como la medida más identificativa y representativa de la máxima fuerza muscular en el movimiento de extensión de cadera y rodilla. El presente trabajo de revisión tiene el propósito de describir los procedimientos utilizados en investigación para evaluar la 1RM en el ejercicio de sentadilla y analizar los factores determinantes de su rendimiento. Con muestras de sujetos entrenados, en la mayoría de estudios revisados se utilizan protocolos de medida muy similares. Además, la heterogeneidad de los resultados publicados en relación al rendimiento obtenido en la 1RM se debe fundamentalmente a diferencias relacionadas con la edad y sexo de los ejecutantes, la técnica de ejecución del ejercicio de sentadilla y/o el historial de entrenamiento de fuerza de la muestra seleccionada según práctica deportiva.
Futebol libertário: compromisso social na medida
Directory of Open Access Journals (Sweden)
Fábio Silvestre Silva
Full Text Available Baseados na Constituição de 1988 e no Estatuto da Criança e do Adolescente, de 1990, o Centro de Defesa dos Direitos da Criança e do Adolescente de Interlagos (CEDECA Interlagos traz um relato de experiência de uma metodologia alternativa de acompanhamento de adolescentes inseridos em medidas socioeducativas em meio aberto na região da Capela do Socorro e Parelheiros. Essa proposta utiliza o futebol como meio que possibilita ao adolescente refletir sobre sua realidade e suas práticas cotidianas, reconhecendo suas possibilidades de se desenvolver como sujeito de direito e de se tornar protagonista no que diz respeito às ações que busquem sua promoção social e a construção e o exercício da cidadania ativa. É possível observar que, com esse tipo de linguagem, mais próximo do desejo desses jovens, os mesmos atribuem um novo sentido ao acompanhamento a que foram submetidos. Na lógica socioeducativa, procuram superar obstáculos no sentido de buscar cada vez mais seu protagonismo, sua autoria, para reafirmar o que o ato infracional revelou, que é a busca por ser sujeito.
1978-08-01
installed. The performance of the spillway and dike under prior loading can only be inferred by physical evidence at the site. d. Post-Construction...ow epC, Oj f0L o 64w 6* +*’r4- {(lo.d, J*t*. M .C , f. * Stpm ". I47.,, 08%126;~;~ (3u~t 1 CY4 p.,4 5sf- Stc. ’ few&4. I tVC 100 ’ eX4 F:’/POCJ FIDV&4, 4Z
Directory of Open Access Journals (Sweden)
Maria José NAVARRO PERALES
2009-11-01
Full Text Available El analfabetismo es la consecuencia de la desigualdad e injusticia social. Combatirlo es una labor igualmente social. Las medidas deben ser tomadas por los gobiernos a través de instituciones de educación formal y no formal. La prevención y desaparición del analfabetismo, en todas sus modalidades y grados, debe realizarse desde el punto de vista del analfabeto y no contra él.
Hansen, T F; Christensen, R dP; Andersen, R F; Sørensen, F B; Johnsson, A; Jakobsen, A
2013-09-03
This study investigated the clinical importance of linked angiogenetic biomarkers to chemotherapy, combined with the anti-vascular endothelial growth factor A (anti-VEGF-A), as a first-line treatment in patients with metastatic colorectal cancer (mCRC). A total of 230 patients from a randomised phase III study were included. The primary microRNA-126 (pri-miRNA-126) A24G single-nucleotide polymorphism and the mature miRNA-126 were analysed by PCR using genomic DNA (full blood) and formalin-fixed paraffin-embedded tissue sections, respectively. The epidermal growth factor-like domain 7 (EGFL7) protein was visualised and quantified using immunohistochemistry. High tumour expression of miRNA-126 was significantly related to a longer progression-free survival. The independent prognostic value of miRNA-126 was confirmed using a Cox regression analysis (hazard ratio=0.49, 95% confidence interval=0.29-0.84, P=0.009). Although not significant, a relationship between EGFL7 expression and response rates is suggested, with EGFL7 expression at the invasive front being lower in responding patients than in the non-responders (P=0.063). The results validate the previous findings on the prognostic value of miRNA-126 in mCRC and may suggest a relationship between treatment efficacy and EGFL7 expression. As miRNA-126 may target VEGF-A as well as EGFL7, the results may provide predictive information in relation to next-generation anti-angiogenetics.
Directory of Open Access Journals (Sweden)
Navarrete, Roberto
2015-06-01
Full Text Available This paper presents a critique of the decisionist interpretation of the concept of sovereignty which Carl Schmitt proposes in Political Theology. Starting from Schmitt’s theory of secularisation, I try to show that the capacity for decision on the state of exception which defines the Schmittian sovereign is not absolute but remains determined by an immanent concrete order that the State must represent. I question thereby the Hobbesian roots of Schmitt’s political theology, which rather is in debt with Hegel’s theory of the State, and I expose the juridic-political reason of Schmitt’s disagreement with National Socialism.El presente artículo ofrece una crítica de la interpretación decisionista de la doctrina de la soberanía postulada por C. Schmitt en Teología política. Partiendo de la teoría de la secularización del jurista alemán, se mostrará que la capacidad de decisión sobre el estado de excepción definitoria del soberano schmittiano no es absoluta sino que permanece determinada por un orden concreto inmanente cuya representación es tarea del Estado. Así, se pondrá en cuestión la raigambre hobbesiana de la teología política schmittiana, deudora en mayor medida de la teoría hegeliana del Estado, y se presentará la razón jurídico- política de la desavenencia de Schmitt con el nacionalsocialismo.
Directory of Open Access Journals (Sweden)
Bernardo J Krause
Full Text Available Growing evidence shows that metabolic syndrome (MetS is already starting in childhood however there is no consensus regarding how to diagnose this condition in pediatric population. Studies in adults show that altered levels of specific micro-RNAs are related with components of the MetS.We determined the plasma levels of four MetS-associated micro-RNAs (miR-126, miR-132, mir-145 and Let-7e in 10 to 12 years old children with or without MetS traits.Pediatric subjects were selected from a cohort of 3325 school-age children, and clustered by the absence (control, n = 30, or the presence of 1 (n = 50, 2 (n = 41 or 3 (n = 35 MetS traits according to Cook´s criteria. Micro-RNAs were isolated from plasma, and levels of miR-126, miR-132, miR-145 and Let-7e were determined by Taqman qPCR.Regression analysis of the different MetS traits regarding the different miRNAs analyzed showed that Let-7e presented a negative association with HDL-C levels, but a positive correlation with the number of MetS traits. Levels of miR-126 presented a positive correlation with waist circumference, waist to hip ratio, BMI, and plasma triglycerides and VLDL-C. Levels of miR-132 showed a positive correlation with waist to hip ratio. Plasma levels of Let-7e were increased (~3.4 fold in subjects with 3 MetS traits, and showed significant AUC (0.681; 95%CI = [0.58, 0.78]; p < 0.001 in the ROC analysis which were improved when miR-126 was included in the analysis (AUC 0.729; p < 0.001. In silico analysis of the interaction of proteins derived from mRNAs targeted by Let7 and miR-126 showed an important effect of both Let-7e and miR-126 regulating the insulin signaling pathway.These results suggest that changes in the plasma levels of Let-7e and miR-126 could represent early markers of metabolic dysfunction in children with MetS traits.
Directory of Open Access Journals (Sweden)
Leandra Terezinha Roncolato da Silva
2011-12-01
Full Text Available This study aimed to evaluate the quality of health care delivered in an Intensive Care Unit, concerning the use of pneumonia prevention and control measures in high-risk patients on mechanical ventilation. In this descriptive and exploratory research, 839 observations of patients under invasive ventilation care were carried out, between November 2009 and January 2010, using the Indicator of Evaluation of Adherence to Prevention and Control Measures in High-risk Patients (IRPR. Some isolated measures that compose the mentioned indicator reached rates close to 100%, but the general compliance rate with all prevention and control measures of ventilator-associated pneumonia was 26.94%. It is concluded that, although the evaluated practices are accomplished at the unit, systematic evaluations of the interventions is needed so as to permit the discussion and practice of other educational strategies by the health team.Este estudio objetivó evaluar la calidad de la asistencia a la salud prestada en una Unidad de Terapia Intensiva, en lo que se refiere al uso de medidas de prevención y control de neumonía en pacientes de alto riesgo sometidos a ventilación mecánica. Se trató de una investigación descriptiva exploratoria en la cual fueron realizadas 839 observaciones de pacientes en asistencia ventilatoria invasora, en el período de noviembre de 2009 a enero de 2010, utilizando el Indicador de Evaluación de la Adhesión a las Medidas de Prevención y Control de Neumonía en Pacientes de Alto Riesgo (IRPR. Algunas medidas aisladas que componen el Indicador alcanzaron índices próximos a 100%, sin embargo el índice de la conformidad general en todas las medidas de prevención y control de neumonía asociada a la ventilación mecánica correspondió a 26,94%. Se concluye que a pesar de que estas prácticas evaluadas estuviesen instituidas en la unidad, hay necesidad de realizar evaluaciones sistemáticas de las intervenciones para que otras
13 CFR 126.401 - What is a program examination and what will SBA examine?
2010-01-01
... location and ownership of the concern, the employee percentage requirements, and the concern's “attempt to maintain” (see § 126.103) this percentage. The concern must document each employee's residence address..., and other relevant documents. The concern must retain documentation demonstrating satisfaction of the...
Integral cross sections for π+p scattering between 52 and 126 MeV
International Nuclear Information System (INIS)
Friedman, E.; Goldring, A.; Wagner, G.J.; Altman, A.; Johnson, R.R.; Meirav, O.; Hanna, M.; Jennings, B.K.
1989-06-01
Integral cross-sections for the elastic scattering of π + on p from 20 degrees and 30 degrees to 180 degrees were measured at seven energies between 52 and 126 MeV. These integrals are found to be in good agreement with predictions made with currently accepted phase-shifts. (Author) 15 refs., tab., 2 figs
Directory of Open Access Journals (Sweden)
Arcádio de Los Reys Borjas
2008-04-01
Full Text Available Four hundred and eighty cattle were used to verify alterations and correlations among corporal measures in Nelore zebu herd with cows and heifers. Body weight and length, corporal condition, heart girth, withers height and hip measures were evaluated. Eight collections were accomplished along the months of October of 2002 and October of 2003. In heifers there was increase of the averages of corporal measures with significant difference (p <0,05 among collections only the heart girth was different (p <0,05 in cows. The relationship between the body weight and body condition with the time were quadratic parallel curves (p <0,001. There were correlations among lineal measures body with hip measures (p<0,001 except for heart girth with hip length. The correlations of body weight and body condition among body measures were significant (p<0,001 except body condition with hip length in cows. It could be concluded that there was a growing variation of the body measures in heifers in the experimental period. The body weight, the body condition and heart girth were related with different periods of the year that the evaluation was accomplished. In cows the variations along the year were of 14,79%, 31,53% and 6,74%, respectively. The isquiun – iliun external measures, as height and width were correlated with size measures and weight. The body weight and body condition in heifers behave in way similar to cows. Further researches in relationship among body measures, body weight and body condition with productive and reproductive aspect are necessary. Con el objetivo de verificar alteraciones y correlaciones entre medidas corporales en un rebaño bovino de vaquillonas y vacas de la raza Nelore. Evaluaron-se 487 hembras en peso vivo, condición corporal, perímetro toráxico, largura corporal, altura de la cruz y medidas da anca. Fueron realizadas ocho coletas a lo largo de los meses de octubre de 2002 y octubre de 2003. En las vaquillonas hubo un aumento de
Bustos-Pérez, Guillermo
2016-01-01
El uso de medios digitales para el análisis arqueológico está a la orden del día. Un ejemplo es el uso de fotografías digitales para la obtención de medidas en diferentes objetos. Se presenta aquí un repaso al procedimiento de medida de filos en lascas publicado por Eren et al., (2008), una experiencia de reproductividad del método, y una ampliación experimental de sus potenciales usos para el análisis de industria lítica. Los resultados muestran que se trata de un procedimient...
Directory of Open Access Journals (Sweden)
Simone M Santos
2013-06-01
Full Text Available OBJETIVO: Descrever o processo de adaptação de escalas de medida de características de vizinhança para o português brasileiro. MÉTODOS: As dimensões abordadas foram coesão social, ambiente propício para atividade física, disponibilidade de alimentos saudáveis, segurança em relação a crimes, violência percebida e vitimização. No processo de adaptação foram avaliados aspectos de equivalência entre as escalas originais e respectivas versões para o português. A confiabilidade teste-reteste foi avaliada em submostra de 261 participantes do Estudo Longitudinal de Saúde do Adulto (ELSA-Brasil que responderam ao mesmo questionário em dois momentos distintos em um intervalo de tempo de sete a 14 dias entre as duas aplicações. RESULTADOS: Os aspectos de equivalência avaliados mostraram-se adequados. O coeficiente de correlação intraclasse variou entre 0,83 (IC95% 0,78;0,87 para Coesão Social e 0,90 (IC95% 0,87;0,92 para Ambiente para Atividade Física. As escalas apresentaram consistência interna (alfa de Cronbach que variaram entre 0,60 e 0,84. CONCLUSÕES: As medidas autorreferidas de características de vizinhança tiveram reprodutibilidade muito boa e boa consistência interna. Os resultados sugerem que essas escalas podem ser utilizadas em estudos com população brasileira que apresente características similares àquelas do ELSA-Brasil.
Directory of Open Access Journals (Sweden)
Solange Diccini
2011-01-01
Full Text Available OBJETIVO: Avaliar as alterações nas medidas da oximetria de pulso em indivíduos sadios com esmaltes de unha. MÉTODOS: Estudo transversal com 80 voluntárias sadias. As cores de esmalte utilizadas para avaliar a saturação periférica de oxigênio (SpO2 foram: café com leite, café, chocolate, vermelho e ameixa. Estas cores foram distribuídas entre as unhas dos dedos da mão esquerda. Os dedos da mão direita foram os controles. RESULTADOS: As cores vermelha (p=0,047 e café (p=0,024 mostraram valores menores na SpO2 quando comparados ao controle. As outras cores não alteraram a medida da SpO2. CONCLUSÃO: As cores vermelha e café causaram redução na medida da SpO2, porém a relevância clínica deste achado é questionável, pois os valores estavam dentro do intervalo de normalidade.OBJETIVO: Evaluar las alteraciones en las medidas de la oximetría de pulso en individuos sanos con esmalte de uña. MÉTODOS: Estudio transversal realizado con 80 voluntarias sanas. Los colores de esmalte utilizados para evaluar la saturación periférica de oxígeno (SpO2 fueron: café con leche, café, chocolate, rojo y ciruela. Estos colores fueron distribuidos entre las uñas de los dedos de la mano izquierda. Los dedos de la mano derecha fueron los controles. RESULTADOS: Los colores rojo (p=0,047 y café (p=0,024 mostraron valores menores en la SpO2 cuando fueron comparados al control. Los otros colores no alteraron la medida del SpO2. CONCLUSIÓN: Los colores rojo y café causaron reducción en la medida del SpO2, sin embargo la relevancia clínica de este hallazgo es cuestionable, pues los valores estaban dentro del intervalo de normalidad.OBJECTIVE: To evaluate the changes in measurements of pulse oximetry in healthy individuals with nail polish. METHODS: Cross sectional study with 80 healthy volunteers. The colors of enamel used to assess oxygen saturation (SpO2 were: coffee with milk, coffee, chocolate, red and plum. These colors were
Jönsson, Maria E.; Kubota, Akira; Timme-Laragy, Alicia; Woodin, Bruce; Stegeman, John J.
2012-01-01
The teleost swimbladder is assumed a homolog of the tetrapod lung. Both swimbladder and lung are developmental targets of persistent aryl hydrocarbon receptor (AHR1) agonists; in zebrafish (Danio rerio) the swimbladder fails to inflate with exposure to 3,3’,4,4’,5-pentachlorobiphenyl (PCB126). The mechanism for this effect is unknown, but studies have suggested roles of cytochrome P4501 (CYP1) and cyclooxygenase 2 (Cox-2) in some Ahr-mediated developmental effects in zebrafish. We determined relationships between swimbladder inflation and CYP1 and Cox-2 mRNA expression in PCB126-exposed zebrafish embryos. We also examined effects on β-catenin dependent transcription, histological effects, and Ahr2 dependance of the effect of PCB126 on swimbladder using morpholinos targeting ahr2. One-day-old embryos were exposed to waterborne PCB126 or carrier (DMSO) for 24 h and then held in clean water until day 4, a normal time for swimbladder inflation. The effects of PCB126 were concentration-dependent with EC50 values of 1.4 to 2.0 nM for induction of the CYP1s, 3.7 and 5.1 nM (or higher) for cox-2a and cox-2b induction, and 2.5 nM for inhibition of swimbladder inflation. Histological defects included a compaction of the developing bladder. Ahr2-morpholino treatment rescued the effect of PCB126 (5 nM) on swimbladder inflation and blocked induction of CYP1A, cox-2a, and cox-2b. With 2 nM PCB126 approximately 30% of eleutheroembryos2 failed to inflate the swimbladder, but there was no difference in CYP1 or cox-2 mRNA expression between those embryos and embryos showing inflated swimbladder. Our results indicate that PCB126 blocks swimbladder inflation via an Ahr2-mediated mechanism. This mechanism seems independent of CYP1 or cox-2 mRNA induction but may involve abnormal development of swimbladder cells. PMID:23036320
Cleanup Verification Package for the 126-F-1, 184-F Powerhouse Ash Pit
International Nuclear Information System (INIS)
Clark, S.W.; Sulloway, H.M.
2007-01-01
This cleanup verification package documents completion of remedial action for the 126-F-1, 184-F Powerhouse Ash Pit. This waste site received coal ash from the 100-F Area coal-fired steam plant. Leakage of process effluent from the 116-F-14 , 107-F Retention Basins flowed south into the ash pit, contaminating the northern portion
International Nuclear Information System (INIS)
Jönsson, Maria E.; Kubota, Akira; Timme-Laragy, Alicia R.; Woodin, Bruce; Stegeman, John J.
2012-01-01
The teleost swim bladder is assumed a homolog of the tetrapod lung. Both swim bladder and lung are developmental targets of persistent aryl hydrocarbon receptor (AHR) agonists; in zebrafish (Danio rerio) the swim bladder fails to inflate with exposure to 3,3′,4,4′,5-pentachlorobiphenyl (PCB126). The mechanism for this effect is unknown, but studies have suggested roles of cytochrome P450 1 (CYP1) and cyclooxygenase 2 (Cox-2) in some Ahr-mediated developmental effects in zebrafish. We determined relationships between swim bladder inflation and CYP1 and Cox-2 mRNA expression in PCB126-exposed zebrafish embryos. We also examined effects on β-catenin dependent transcription, histological effects, and Ahr2 dependence of the effect of PCB126 on swim bladder using morpholinos targeting ahr2. One-day-old embryos were exposed to waterborne PCB126 or carrier (DMSO) for 24 h and then held in clean water until day 4, a normal time for swim bladder inflation. The effects of PCB126 were concentration-dependent with EC 50 values of 1.4 to 2.0 nM for induction of the CYP1s, 3.7 and 5.1 nM (or higher) for cox-2a and cox-2b induction, and 2.5 nM for inhibition of swim bladder inflation. Histological defects included a compaction of the developing bladder. Ahr2-morpholino treatment rescued the effect of PCB126 (5 nM) on swim bladder inflation and blocked induction of CYP1A, cox-2a, and cox-2b. With 2 nM PCB126 approximately 30% of eleutheroembryos failed to inflate the swim bladder, but there was no difference in CYP1 or cox-2 mRNA expression between those embryos and embryos showing inflated swim bladder. Our results indicate that PCB126 blocks swim bladder inflation via an Ahr2-mediated mechanism. This mechanism seems independent of CYP1 or cox-2 mRNA induction but may involve abnormal development of swim bladder cells. -- Highlights: ► PCB126 caused cellular changes in the developing swim bladder. ► Swim bladder inflation was not related to expression of CYP1 or cox-2.
Energy Technology Data Exchange (ETDEWEB)
Jönsson, Maria E., E-mail: maria.jonsson@ebc.uu.se [Dept. of Environmental Toxicology, Evolutionary Biology, Centre, Uppsala University, Norbyvägen 18A, 752 36 Uppsala (Sweden); Biology Department, Redfield 3-42 MS 32, Woods Hole Oceanographic Institution, Woods Hole, MA, 02543 (United States); Kubota, Akira, E-mail: akubota@whoi.edu [Biology Department, Redfield 3-42 MS 32, Woods Hole Oceanographic Institution, Woods Hole, MA, 02543 (United States); Timme-Laragy, Alicia R., E-mail: atimmelaragy@whoi.edu [Biology Department, Redfield 3-42 MS 32, Woods Hole Oceanographic Institution, Woods Hole, MA, 02543 (United States); Division of Environmental Health, Department of Public Health, School of Public Health and Health Sciences, University of Massachusetts, Amherst, MA, 01003 (United States); Woodin, Bruce, E-mail: bwoodin@whoi.edu [Biology Department, Redfield 3-42 MS 32, Woods Hole Oceanographic Institution, Woods Hole, MA, 02543 (United States); Stegeman, John J., E-mail: jstegeman@whoi.edu [Biology Department, Redfield 3-42 MS 32, Woods Hole Oceanographic Institution, Woods Hole, MA, 02543 (United States)
2012-12-01
The teleost swim bladder is assumed a homolog of the tetrapod lung. Both swim bladder and lung are developmental targets of persistent aryl hydrocarbon receptor (AHR) agonists; in zebrafish (Danio rerio) the swim bladder fails to inflate with exposure to 3,3′,4,4′,5-pentachlorobiphenyl (PCB126). The mechanism for this effect is unknown, but studies have suggested roles of cytochrome P450 1 (CYP1) and cyclooxygenase 2 (Cox-2) in some Ahr-mediated developmental effects in zebrafish. We determined relationships between swim bladder inflation and CYP1 and Cox-2 mRNA expression in PCB126-exposed zebrafish embryos. We also examined effects on β-catenin dependent transcription, histological effects, and Ahr2 dependence of the effect of PCB126 on swim bladder using morpholinos targeting ahr2. One-day-old embryos were exposed to waterborne PCB126 or carrier (DMSO) for 24 h and then held in clean water until day 4, a normal time for swim bladder inflation. The effects of PCB126 were concentration-dependent with EC{sub 50} values of 1.4 to 2.0 nM for induction of the CYP1s, 3.7 and 5.1 nM (or higher) for cox-2a and cox-2b induction, and 2.5 nM for inhibition of swim bladder inflation. Histological defects included a compaction of the developing bladder. Ahr2-morpholino treatment rescued the effect of PCB126 (5 nM) on swim bladder inflation and blocked induction of CYP1A, cox-2a, and cox-2b. With 2 nM PCB126 approximately 30% of eleutheroembryos failed to inflate the swim bladder, but there was no difference in CYP1 or cox-2 mRNA expression between those embryos and embryos showing inflated swim bladder. Our results indicate that PCB126 blocks swim bladder inflation via an Ahr2-mediated mechanism. This mechanism seems independent of CYP1 or cox-2 mRNA induction but may involve abnormal development of swim bladder cells. -- Highlights: ► PCB126 caused cellular changes in the developing swim bladder. ► Swim bladder inflation was not related to expression of CYP1 or cox
Directory of Open Access Journals (Sweden)
Satoshi Katagiri
2014-01-01
Full Text Available Purpose. To investigate genetic and clinical features of patients with rhodopsin (RHO mutations in two Japanese families with autosomal dominant retinitis pigmentosa (adRP. Methods. Whole-exome sequence analysis was performed in ten adRP families. Identified RHO mutations for the cosegregation analysis were confirmed by Sanger sequencing. Ophthalmic examinations were performed to evaluate the RP phenotypes. The impact of the RHO mutation on the rhodopsin conformation was examined by molecular modeling analysis. Results. In two adRP families, we identified two RHO mutations (c.377G>T (p.W126L and c.1036G>C (p.A346P, one of which was novel. Complete cosegregation was confirmed for each mutation exhibiting the RP phenotype in both families. Molecular modeling predicted that the novel mutation (p.W126L might impair rhodopsin function by affecting its conformational transition in the light-adapted form. Clinical phenotypes showed that patients with p.W126L exhibited sector RP, whereas patients with p.A346P exhibited classic RP. Conclusions. Our findings demonstrated that the novel mutation (p.W126L may be associated with the phenotype of sector RP. Identification of RHO mutations is a very useful tool for predicting disease severity and providing precise genetic counseling.
Wu, Xianai; Yang, Jun; Morisseau, Christophe; Robertson, Larry W.; Hammock, Bruce; Lehmler, Hans-Joachim
2016-01-01
Disruption of the homeostasis of oxygenated regulatory lipid mediators (oxylipins), potential markers of exposure to aryl hydrocarbon receptor (AhR) agonists, such as 3,3′,4,4′,5-pentachlorobiphenyl (PCB 126), is associated with a range of diseases, including nonalcoholic fatty liver disease and nonalcoholic steatohepatitis. Here we test the hypothesis that PCB 126 exposure alters the levels of oxylipins in rats. Male Sprague-Dawley rats (5-weeks old) were treated over a 3-month period every 2 weeks with intraperitoneal injections of PCB 126 in corn oil (cumulative doses of 0, 19.8, 97.8, and 390 µg/kg b.w.; 6 injections total). PCB 126 treatment caused a reduction in growth rates at the highest dose investigated, a dose-dependent decrease in thymus weights, and a dose-dependent increase in liver weights. Liver PCB 126 levels increased in a dose-dependent manner, while levels in plasma were below or close to the detection limit. The ratios of several epoxides to diol metabolites formed via the cytochrome P450 (P450) monooxygenase/soluble epoxide hydrolase (sEH) pathway from polyunsaturated fatty acids displayed a dose-dependent decrease in the liver and plasma, whereas levels of oxylipins formed by other metabolic pathways were generally not altered by PCB 126 treatment. The effects of PCB 126 on epoxide-to-diol ratios were associated with an increased CYP1A activity in liver microsomes and an increased sEH activity in liver cytosol and peroxisomes. These results suggest that oxylipins are potential biomarkers of exposure to PCB 126 and that the P450/sEH pathway is a therapeutic target for PCB 126-mediated hepatotoxicity that warrants further attention. PMID:27208083
Along the N=126 closed shell: study of $^{205}$Au through its $\\pi h_{11/2}^{-1}$ isomeric decay
2002-01-01
Excited states have been identified in only three of the N=126 closed shell nuclei 'below' $^{208}$Pb, $^{207}$Tl, $^{206}$Hg and very recently $^{204}$Pt. We aim to extend our knowledge of the neutron-rich N=126 nuclei by observing the internal decay of the $\\pi h^{-1}_{11/2}$ excited state in $^{205}$Au, which is expected to be isomeric. In addition, the decay of the analogous states in the N=122 and N=124 $^{201,203}$Au will be studied. The lifetimes of the expected isomeric states are crucial for the success of the experiment, and they are estimated to be in the range of 0.3-20 s. These are long enough to enable the extraction from the source, but shorter than the $\\beta$-decay half-lives. Proton single-particle energies and transition rates will be extracted, providing information about the robustness of the N=126 shell-closure. Three days of beam-time is requested.
Summary of Meteorological Observations, Surface (SMOS) Pensacola, Florida.
1978-07-01
flSV~MAYN IC’~4~ 126;~;~ ) ‘) .) ‘ - J IISPS -LS0I 151,1 I — — — _ — ________— — — -126;~; -126;~; 126;~~~~~~~~~~~~~~~~~~~; -, I F126;~;~ ’ 126;~~~~~~~~~;~ —126;~; . 126;~; J-~4S
Avaliação da inteligência emocional: a relação entre medidas de desempenho e de autorrelato
Directory of Open Access Journals (Sweden)
Ana Cristina Fontes Costa
Full Text Available Apresenta-se a adaptação e validação do Teste de Vocabulário Emocional (TVE ao contexto português, uma medida de desempenho de inteligência emocional, explorando as suas qualidades psicométricas e a validade de critério e convergente com uma medida de autorrelato, o Questionário de Competência Emocional - Revisto (QCE-R. O TVE, com 35 itens, desenvolvido por Takšic, Herambasic e Velemir (2003 no contexto croata, mede a capacidade para compreender emoções. A amostra incluiu 682 alunos do 10.º ano, entre 14 e 21 anos (M = 15,5; DP = 0,77 de diferentes cursos científico-humanísticos. Genericamente, o TVE revelou boas qualidades psicométricas, tendo-se correlacionado positivamente com o rendimento académico e evidenciado maior capacidade para o predizer do que o QCE-R, com o qual não estabeleceu qualquer associação.
Medidas de biossegurança adotadas por profissionais atuantes em audiologia
Directory of Open Access Journals (Sweden)
Ana Paula Ferreira Rocha
2015-03-01
Full Text Available OBJETIVO: explicitar as práticas de biossegurança adotadas por fonoaudiólogos atuantes na área de Audiologia e relacioná-las com a educação continuada e o tempo de formação dos profissionais. MÉTODOS: participaram deste estudo 70 fonoaudiólogos atuantes na área de Audiologia, nos municípios de Belo Horizonte e Contagem. Foi aplicado um questionário sobre biossegurança em Audiologia, com base na Norma Regulamentadora 32, composto por 27 perguntas fechadas, abordando os aspectos de higienização das mãos, equipamentos de proteção individual e organização e higienização dos artigos e do ambiente. RESULTADOS: a maioria dos fonoaudiólogos relatou que adota as seguintes medidas de biossegurança: higienização das mãos antes dos atendimentos (71%, uso de jaleco com mangas longas (74% e abotoado (91%, cabelos presos (79%, unhas limpas e cortadas (91%, separação e desinfecção dos artigos usados (83% e organização do ambiente (97%. No entanto somente 40% dos profissionais referiram higienizar as mãos entre os atendimentos e 9% referiram o uso de luvas na realização da meatoscopia. Observou-se que a destinação dos artigos para desinfecção é uma prática mais rotineira para profissionais com especialização (p< 0,05. Os profissionais com maior tempo de formação aderiram melhor à prática de higienização das mãos. CONCLUSÃO: higienizar as mãos antes dos atendimentos, vestir-se corretamente, destinar os artigos para desinfecção e organizar o ambiente de trabalho são práticas de biossegurança adotadas pela maioria dos fonoaudiólogos. Fatores como tempo de formação e educação continuada influenciam de maneira positiva na adoção de corretas medidas de biossegurança.
Ghorbanzadeh, Vajihe; Mohammadi, Mustafa; Dariushnejad, Hassan; Abhari, Alireza; Chodari, Leila; Mohaddes, Gisou
2017-07-01
Crocin is reported to have a wide range of biological activities such as cardiovascular protection. Recent epidemiologic studies have shown that exercise reduces cardiovascular morbidity and mortality in the general population. The aim of this study was to evaluate the effect of crocin and voluntary exercise on miR-126 and miR-210 expression levels and angiogenesis in the heart tissue. Animals were divided into 4 groups: control, exercise, crocin, and exercise-crocin. Animals received oral administration of crocin (50 mg/kg) or performed voluntary exercise alone or together for 8 weeks. Akt, ERK1/2 protein levels, miR-126 and miR-210 expression were measured in the heart tissue. Immunohistochemical method was used to detect CD31 in the heart tissue. Akt and ERK1/2 levels of the heart tissue were higher in crocin treated group and voluntary exercise trained group after 8 weeks. Combination of crocin and exercise also significantly enhanced Akt and ERK1/2 levels in the heart tissue. MiR-126, miR-210 expression and CD31 in the heart increased in both crocin and voluntary exercise groups compared with control group. In addition, combination of exercise and crocin amplified their effect on miR-126 and miR-210 expression, and angiogenesis. Crocin and voluntary exercise improve heart angiogenesis possibly through enhancement of miR-126 and miR-210 expression. Voluntary exercise and diet supplementation with crocin could have beneficial effects in prevention of cardiovascular disease. A crocina tem uma vasta gama de atividades biológicas, tais como a proteção cardiovascular. Estudos epidemiológicos recentes demonstraram que o exercício reduz a morbidade e a mortalidade cardiovasculares na população em geral. O objetivo deste estudo foi avaliar o efeito da crocina e do exercício voluntário nos níveis de expressão miR-126 e miR-210 e na angiogênese no tecido cardíaco. Os animais foram divididos em 4 grupos: controle, exercício, crocina e exercício-crocina. Os
Heavy nuclei far from stability in the N < 126, Z > 82 region
Energy Technology Data Exchange (ETDEWEB)
Back, B.B.; Blumenthal, D.J.; Carpenter, M.P. [and others
1995-08-01
There are long-standing calculations suggesting that nuclei in the N < 126, Z > 82 region far from stability exhibit deformation effects. Away from stability an observable permanent quadrupole deformation should be achieved but, as yet, there is no experimental evidence for such an effect. A series of experiments was performed to assess the production of nuclei in this region and to study their structure. These experiments were performed using gamma-ray spectroscopy to investigate the low-lying level schemes and alpha-particle spectroscopy in order to isolate fine structure in the decay. The low-lying level structure of the neutron-deficient isotope {sup 202}Rn was studied, for the first time, using the {sup 181}Ta({sup 27}Al,6n) and {sup 192}Pt({sup 16}O,6n) reactions. Gamma-ray transitions between excited states in {sup 202}Rn were identified by mass tagging the Fragment Mass Analyzer and by observation of coincident X rays. Transitions in {sup 203}Rn were also identified. The level scheme deduced from these data is consistent with the systematics of light radon isotopes below the N = 126 shell closure and with theoretical calculations indicating that the ground-state shape should not be strongly deformed at N = 116.
Un criterio robusto para la medida del margen –coeficiente– de seguridad
Directory of Open Access Journals (Sweden)
Cervera, J.
2010-06-01
Full Text Available This paper offers a brief analysis of the drawbacks that can be found with the usual partial security coefficients, as loads multipliers, when employed for the measurement of the distance to the collapse condition in such structures, as masonry arches, that have important anisotropies or lacks tensile strength. To deal with such difficulties the paper presents a simple and robust security criterium based on a contraction of the yield surface. That criterium, that performs identically in isotropic structures to those usually employed, can however deal consistently with situations where former criteria fail. The criterium is applied to sections with double symmetry under axial load and unsymmetrical bending, in materials with and without tension resistance. It is also applied to the prism stability problem, showing the advantages in the caracterization of such problems.
En este trabajo se analizan en primer lugar algunos inconvenientes de los habituales coeficientes parciales de seguridad —factores multiplicadores de las cargas— como medida del alejamiento a las condiciones de colapso en el caso de las estructuras con anisotropías importantes, como son especialmente aquellas sin resistencia a la tracción —los arcos de fábrica, como ejemplo paradigmático— Para superar dichas dificultades se propone un criterio sencillo y robusto basado en la contracción de la superficie límite, criterio que aporta una medida coincidente con la habitual para los casos isótropos, pero que permite medir igualmente de forma consistente el alejamiento a las condiciones del colapso para el resto de las situaciones. Se aplica finalmente el modelo a la determinación de los márgenes de seguridad en secciones de doble simetría sometidas a compresión esviada para materiales sin, y con resistencia a tracción, así como al problema de la estabilidad de un prisma frente al vuelco, mostrando las mejoras que aporta para caracterizar dichos problemas.
EL CONTROL A LAS CLÁUSULAS ABUSIVAS EN LOS CONTRATOS DE ADHESIÓN CON CONSUMIDORES
Directory of Open Access Journals (Sweden)
Verónica María Echeverri Salazar
2011-11-01
Full Text Available Una cláusula abusiva es aquella que implica un atentado contra el principio de la buena fe en la medida en que involucra una desproporción significativa entre las obligaciones y beneficios que adquieren las partes. El Estado debe controlar la implementación de las mismas, lo cual implica una intervención en la autonomía de la voluntad privada de los contratantes, razón por la que se ha discutido en el ámbito internacional el ámbito de dicho control. Pese a dichas discusiones, esclaro que el control (que puede ser legislativo, administrativo o judicial procede cuando se presenta un contrato de adhesión con un consumidor. El control judicial que se hace de ellas puede ser a través de la declaratoria de inexistencia, de ineficacia, de nulidad absoluta o de nulidad relativa
Directory of Open Access Journals (Sweden)
Davood Naziri
2014-03-01
Full Text Available Purpose: Carotenoids are of great interest in many scientific disciplines because of their wide distribution, diverse functions and interesting properties. The present report describes a new natural source for carotenoid production. Methods: Halorubrum sp., TBZ126, an extremely halophilic archaeon, was isolated from Urmia Lack following culture of water sample on marine agar medium and incubation at 30 °C. Then single colonies were cultivated in broth media. After that the cells were collected and carotenoids were extracted with acetone-methanol (7:3 v/v. The identification of carotenoids was performed by UV-VIS spectroscopy and confirmed by thin layer chromatography (TLC in the presence of antimony pentachloride (SbCl5. The production profile was analyzed using liquid-chromatography mass spectroscopy (LC-MS techniques. Phenotypic characteristics of the isolate were carried out and the 16S rRNA gene was amplified using polymerase chain reaction (PCR. Results: LC-MS analytical results revealed that produced carotenoids are bacterioruberin, lycopene and β-carotene. Bacterioruberin was found to be the predominant produced carotenoid. 16S rRNA analysis showed that TBZ126 has 100% similarity with Halorubrum chaoviator Halo-G*T (AM048786. Conclusion: Halorubrum sp. TBZ126, isolated from Urmia Lake has high capacity in the production of carotenoids. This extremely halophilic archaeon could be considered as a prokaryotic candidate for carotenoid production source for future studies.
Directory of Open Access Journals (Sweden)
Luis Galeano-Vasco
2013-11-01
Full Text Available Objetivo. Modelar la curva del crecimiento de aves de la línea Lohmann LSL utilizando modelos no lineales (MNL, no lineales mixtos (MNLM y redes neuronales artificiales (RNA. Materiales y métodos. Periódicamente se pesaron 33 aves en promedio, desde el día 21 al 196 de vida para un total de 558 registros individuales de peso. En el ajuste de la curva de crecimiento se utilizaron los modelos: no lineal de Von Bertalanffy (MNL, no lineal Mixto de Von Bertalanffy (MNLM y redes neuronales artificiales (RNA. Los modelos se compararon con coeficiente de correlación y medidas de presicion cuadrado medio del error (CME, desviación media absoluta (MAD y porcentaje de la media absoluta del error (MAPE. Resultados. Los valores de correlación entre los datos reales y estimados, fueron 0.999, 0.990 y 0.986 para MNLM, RNA y MNL respectivamente. El modelo más preciso con base en los criterios MAPE, MAD y CME fue el MNLM, seguido por la RNA. La grafica de predicción generada la RNA es similar a la del MNLM. La RNA presentó un desempeño superior al MLN. Conclusiones. El mejor modelo para la predicción de curvas de crecimiento de aves comerciales de la línea Lohmman LSL hasta los 196 días de edad, con múltiples mediciones por animal en el tiempo, fue el MNLM. La RNA presento un desempeño superior al MNL.
Directory of Open Access Journals (Sweden)
Armando Augusto Henriques Vieira
1982-01-01
Full Text Available Foram efetuadas várias medidas de excreção de matéria orgânica dissolvida (MOD, utilizando-se populações naturais de fitoplâncton, provenientes da Enseada do Flamengo - litoral Norte do Estado de São Paulo - e enriquecidas artificialmente com nutrientes. A quantidade absoluta da MOD excretada, de um modo geral, acompanhou a quantidade de carbono total assimilado. Entretanto, nas populações com deficiência de nitrogênio, ocorreu um aumento das taxas relativas de excreção, não só devido à diminuição da assimilação total de carbono, mas, efetivamente, tambem ao aumento da quantidade absoluta de MOD excretada.Measurements of excreted dissolved organic matter (DOM were carried out twice (in simmer and winter using natural phytoplankton populations from "Enseada do Flamengo" (Lot. 23° 30'S-Long. 045°069'W and enriched artificially with nutrients. The bioassays were carried out inoculating samples of an integral sea water in ten liters flasks, incubated "in situ". Measures were taken in populations growing in: integral " f " media, "f" - N, "f" - P, "f" - (H + P, "f" - (Vit. + Metal traces, and in a control without enrichment. The absolute amount of excreted DOM generally followed the quantity of total carbon assimilated. In the meantime, with the populations with nitrogen deficiency occurred an increase of relatives rates of excretion, not only due to the total carbon assimilation diminution, but effectively also to the absolute increase of the quantity of excreted DOM.
Requirements for forecasting harmful algal blooms in the Benguela
CSIR Research Space (South Africa)
Bernard, S
2006-01-01
Full Text Available ~...;"0§~s~u ]~. o ~ ~ ~ ~ ~ -,-a;; ; 126;~;:m , .,'~ ": 5": ~ ~ 8. . ~e > 8~ ~ ~ . I; ,,~ . - c . '" ' ." c - "'o:!! . ~§ ~".cO ~(/) o " .N ~> @ M~ ~0') ~ ~ -EI,. . ~ :I:0')c: ;< n... ~(JGo ) I,. . 0u. ~ I,.. Go ) .E ~
DEFF Research Database (Denmark)
Hansen, T. F.; Nielsen, Boye Schnack; Jakobsen, Anders
2015-01-01
factor-like domain 7 (EGFL7) and microRNA-126 (miRNA-126) in primary tumours from patients with stage II-IV colorectal cancer (CRC) and in paired samples of primary tumours, regional lymph node metastases and distant metastases. Methods: A total of 126 patients were included. Analyses were performed...
DEFF Research Database (Denmark)
Koene, S; Rodenburg, R J; van der Knaap, M S
2012-01-01
cases and 126 from literature) with mutations in nuclear genes encoding structural complex I proteins or those involved in its assembly. Complex I deficiency caused by a nuclear gene defect is usually a non-dysmorphic syndrome, characterized by severe multi-system organ involvement and a poor prognosis...
Department of Defense Contractor Establishment Code (CEC). Alphabet Listing. Volume II
1992-11-01
u4 WC4 MA tun w w )4 044 .- 044 4 4-WZ .Z40 W£4 00C 0O O> w10 %4 f~ t 04 04 .- "War, t)e MA tC 40C 10 804:ng W I-0 mint- U 4-M0 W-0 -M :5 : Nz -9 M U...81J~ c -n. 666- -ow a. o aRc ’o ~ . ciaz 1 cia co C.i OW.aa in126;~;~- zaW m.4 4 "iW Z u I.0 Co" i > 0 W0 0 0I4 01-0011.I0 4IWO 00 )126;~~~~~~~4~~~~;~ KD I...q I 94 .4 -CMa 0 w maimaZ a4 0A1 U* am 160 ow 4 - 2 17 I 126;~; ~, 0L1 1 0H at4.0 t3 zZ4M I 1 .4 hij ZAW 126;~;*1-I 0~H126;~;INNM ME10.46 CL0E11 H0 f04 .U.4
European Scientific Notes. Volume 7, Number 6.
1953-03-15
b — l o — s 3 T1126;~;~ :cI i i tics f cr Research In Nu; leer Phva :cs aol Co5mic .t..ys 126;~; .. A.’_ ...:.:..s...-~ by 126;~~~~~;~ aria t126;~; r , bI~tge: C. 1
Directory of Open Access Journals (Sweden)
Neisy Bernal Reyes
2015-10-01
Conclusiones: Las mediciones de las aberraciones de la superficie anterior medidas por imágenes de Sheimpflug son útiles en la detección precoz de queratocono en niños. Las aberraciones de superficie posterior corneal no son útiles ya que no están acordes a las propiedades ópticas de la córnea.
Sentidos da trajetória de vida para adolescentes em medida de liberdade assistida
Directory of Open Access Journals (Sweden)
Clara Costa Gomes
2014-03-01
Full Text Available O presente artigo trata de uma pesquisa que teve como objetivo compreender os sentidos atribuídos por adolescentes que cumpriam medida socioeducativa de liberdade assistida às trajetórias de vida e ao envolvimento com infrações à lei. Foram realizados sete sociodramas semanais com 21 adolescentes da comunidade, dos quais 18 eram do sexo masculino. As informações foram organizadas com base no modelo construtivo-interpretativo de González-Rey e analisadas à luz do aporte teórico da Psicossociologia. Da análise resultaram três zonas de sentido: 1 "Parecia uma vida fácil" - referente à sedução do mundo do crime; 2 "Minhas tábuas de salvação" - sobre as estratégias usadas ante os infortúnios da incursão infracional; 3 "A vida no crime não compensa" - concernente ao saldo das escolhas: dores, perdas e arrependimento. As discussões dos encontros desencadearam nos adolescentes relatos acerca do passado, presente e futuro e reflexões que conduzem à reconstrução de projetos de vida desvinculados de atos de infração. Concluiu-se que os métodos socionômico e de história de vida favoreceram a produção de sentidos pelos adolescentes a partir de sua proposta de ação e reflexão e forneceram informações relevantes para se compreender a trajetória infracional dos adolescentes, constituindo-se em poderosa ferramenta de pesquisa-intervenção junto a adolescentes em cumprimento de medidas socioeducativas.
Divisional Electronic Warfare Combat (DEWCOM) Model - User Manual.
1980-09-01
0 :TL H ’T I I I ;ll126;~~~~~~~~~; L(~ I .. I(, z-r , ,--r,’ j" . !3 1" I°U 146p14 Iov~ :. ,E { 1 I I 1 3 1 1/ -LWI[I 1 A H 6f IVF ttI 1 . 1 1 1 1 11...cre- ated to allow managers and programmers to selectively access and display information from existing data files. It reduces the costs and delays
1977-06-10
Faculty Accepte d th is _________ day of126;~;~U)~4 l977~c~y.11 -126;~~~~~~~~~~~;D i rector , Master of Militar y Art Science . The opinions and...j~ s’ri : ‘126;~~~; ~ IC . _ __126;~~~~~; i 1126;~~~;~n Unhi 126;~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~;~126;~ 150 _ _ _ _ _ _ _ _ _ _ L~ MASTER OF MILITARY ART ... SCIENCE THESIS APPROVAL PAGE Name of Candidate Joseph Bertrand Berger, Jr. Major, Air Defense Artillery T it le of Thes i s W i l l Japan Rearm
DEFF Research Database (Denmark)
Hansen, Torben Frøstrup; Sørensen, Flemming Brandt; Lindebjerg, Jan
2012-01-01
MicroRNA-126 is the only microRNA (miRNA) known to be endothelial cell-specific influencing angiogenesis in several ways. The aim of the present study was to analyse the possible predictive value of miRNA-126 in relation to first line capecitabine and oxaliplatin (XELOX) in patients with metastatic...
Forensic investigation of plutonium metal: a case study of CRM 126
International Nuclear Information System (INIS)
Byerly, B.L.; Floyd Stanley; Khal Spencer; Colletti, Lisa; Garduno, Katherine; Kuhn, Kevin; Lujan, Elmer; Martinez, Alex; Porterfield, Donivan; Jung Rim
2016-01-01
In this study, a certified plutonium metal reference material (CRM 126) with a known production history is examined using analytical methods that are commonly employed in nuclear forensics for provenancing and attribution. The measured plutonium isotopic composition and actinide assay are consistent with values reported on the reference material certificate. Model ages from U/Pu and Am/Pu chronometers agree with the documented production timeline. The results confirm the utility of these analytical methods and highlight the importance of a holistic approach for forensic study of unknown materials. (author)
Ojwang, Leonnard O; Banerjee, Nivedita; Noratto, Giuliana D; Angel-Morales, Gabriela; Hachibamba, Twambo; Awika, Joseph M; Mertens-Talcott, Susanne U
2015-01-01
Cowpea (Vigna unguiculata) is a drought tolerant crop with several agronomic advantages over other legumes. This study evaluated varieties from four major cowpea phenotypes (black, red, light brown and white) containing different phenolic profiles for their anti-inflammatory property on non-malignant colonic myofibroblasts (CCD18Co) cells challenged with an endotoxin (lipopolysaccharide, LPS). Intracellular reactive oxygen species (ROS) assay on the LPS-stimulated cells revealed antioxidative potential of black and red cowpea varieties. Real-time qRT-PCR analysis in LPS-stimulated cells revealed down-regulation of proinflammatory cytokines (IL-8, TNF-α, VCAM-1), transcription factor NF-κB and modulation of microRNA-126 (specific post-transcriptional regulator of VCAM-1) by cowpea polyphenolics. The ability of cowpea polyphenols to modulate miR-126 signaling and its target gene VCAM-1 were studied in LPS-stimulated endothelial cells transfected with a specific inhibitor of miR-126, and treated with 10 mg GAE/L black cowpea extract where the extract in part reversed the effect of the miR-126 inhibitor. This suggests that cowpea may exert their anti-inflammatory activities at least in part through induction of miR-126 that then down-regulate VCAM-1 mRNA and protein expressions. Overall, Cowpea therefore is promising as an anti-inflammatory dietary component.
U.S. EPA, Pesticide Product Label, SEVIN 5% DUST, 11/19/1981
2011-04-21
... "e;;t126;~;i~:i'·:,~r:.;~. eT~;:': i:, .O126;~;~:~J It;;;'"lh~''I~;.rP:~,~: t;126;~; ';JI.126;~; n>nl~ .nd "',"'nlll frU'1 m"lh KPI>I .. d( 1',",41 r.11 and .""rv II) to 14 ...
1978-05-01
s ’ 126;~~~~~~~; ——- - --- - - - - (Ic s ’ sis l abls ’ t’ i’s i i u u [u l ’ s’s ’i s_ i u sIt ’ dt ’o ’ sisl s ’d oI~it a , o h _ i s ’ i’ss’i so
Directory of Open Access Journals (Sweden)
Tomás Xavier Francisco
2015-03-01
Full Text Available Este artigo tem por fim analisar, por um lado, a problemática dos adolescentes em conflito com a lei em Moçambique, e por outro lado, fazer reflexões sobre as medidas socioeducativas e limites para a sua aplicação prática. O trabalho contempla uma introdução, desenvolvimento onde arrola-se considerações sobre o histórico da legislação sobre adolescentes ou menores no país, reflexões sobre medidas socioeducativas e seus limites para sua aplicação prática, e por fim, contempla considerações finais e referências bibliográficas. A metodologia usada foi estudo exploratório, recorrendo-se a pesquisa bibliográfica e análise documental.
13 CFR 126.700 - What are the performance of work requirements for HUBZone contracts?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the performance of work... ADMINISTRATION HUBZONE PROGRAM Contract Performance Requirements § 126.700 What are the performance of work... meet the performance of work requirements set forth in § 125.6(c) of this chapter. (b) In addition to...
Medida Socioeducativa de Internação: dos Corpos Dóceis às Vidas Nuas
Directory of Open Access Journals (Sweden)
Andrea Cristina Coelho Scisleski
Full Text Available O presente artigo tem como objetivo a problematização dos modos pelos quais a tecnologia disciplinar, presente nas medidas socioeducativas de internação direcionadas aos jovens em conflito com a lei, vem sendo operacionalizada. Tomamos como fio condutor as reflexões de Michel Foucault e Giorgio Agamben para problematizar a vida enquanto objeto político a ser governado para determinado fim e que sofre intervenções não apenas para seu fortalecimento, mas que levam à desproteção jurídica e à morte política, ou mesmo biológica. A investigação se desenvolveu em três momentos metodológicos: oitiva de audiências na Vara da Infância e da Juventude, visita a uma unidade educacional de internação e leitura de processos jurídicos e das normativas legais voltadas para a população em questão. Assim, por meio do que encontramos na pesquisa, entende-se que a tecnologia disciplinar, do modo que vem sendo utilizada nas medidas socioeducativas de internação, assemelha-se mais a um dispositivo de controle com o objetivo meramente de docilizá-los, reduzindo o sujeito à vida nua; isto é, como mero corpo biológico que sofre efeitos de uma ação, do que propriamente um método socioeducativo como estabelecem o Estatuto da Criança e do Adolescente e o Sistema Nacional de Atendimento Socioeducativo.
Directory of Open Access Journals (Sweden)
Adams P
2014-12-01
Full Text Available The Technical Committee ISO/TC 126 ‘Tobacco and tobacco products’ of the International Organization for Standardization set up Working Group 7 to develop and test a method for the determination of ‘tar’ and nicotine yield when fine-cut smoking articles (FCSAs are smoked by routine-analytical smoking machines. FCSAs are individually made by consumers using tobaccos manufactured for enclosure in paper wrappers (i.e. leaflets and tubes - with or without filters. This paper records the history of method development, defines terms and explains the differences between measurements made on FCSAs and commercially factory made cigarettes. Individual consumer making practices are represented by the specification of four hand-made article types using two wrappers of different physical properties each with either 400 mg or 750 mg tobacco.
DEFF Research Database (Denmark)
Hansen, T F; Christensen, René dePont; Andersen, R F
2013-01-01
Background:This study investigated the clinical importance of linked angiogenetic biomarkers to chemotherapy, combined with the anti-vascular endothelial growth factor A (anti-VEGF-A), as a first-line treatment in patients with metastatic colorectal cancer (mCRC).Methods:A total of 230 patients......-like domain 7 (EGFL7) protein was visualised and quantified using immunohistochemistry.Results:High tumour expression of miRNA-126 was significantly related to a longer progression-free survival. The independent prognostic value of miRNA-126 was confirmed using a Cox regression analysis (hazard ratio=0.49, 95...... on the prognostic value of miRNA-126 in mCRC and may suggest a relationship between treatment efficacy and EGFL7 expression. As miRNA-126 may target VEGF-A as well as EGFL7, the results may provide predictive information in relation to next-generation anti-angiogenetics....
Directory of Open Access Journals (Sweden)
M. University of Tehran
2017-01-01
Full Text Available Introduction: Tomato leaf miner Tuta absoluta Meyrick (Lep.: Gelechiidae is one of the most important pest of tomato around the world which have been introduced to Iran in recent years. Pesticides can usually reduce the damage caused by the pest, however the extensive use of pesticides substantially increase production costs and lead to development of insecticide resistance. Thus, pest resistance and also adverse effects of pesticides on the human health and the environment make search for alternative control method/s inevitable. The aim of this study was to examine the effect of proteinaceous extracts of Datura (Datura stramonium L., Bean (Phaseolus vulgaris L., Wild Oat (Avena fatua L., Broad bean (Vicia faba L., Amaranth (Amaranthus retroflexus L., Mung bean (Vigna radiate L., Pea (Pisum sativum L., Canola (Brassica napus L., Triticale (Triticosecale wittmack and Sivand, Aflak and Alborz wheat (Triticum aestivum L. cultivars seeds on protease activity of tomato leaf miner. Also in this study optimum pH for protease activity and effects of pH on inhibitory activity of extracts were determined. Materials and Methods: For this work fourth instar larvae of Tuta absoluta was used for enzyme extraction. Plant proteinaceous extracts were obtained using 0.1 M NaCl. For protease activity assay 10 μl enzyme extract and 50 μl substrate solution (Azocasein 2% were mixed with 40 μl of the 20 mM Glycine-NaOH buffer at pH 10.0 After 60 min incubation, 100 μl of 30% trichloroacetic acid (TCA was added to the reaction mixture, and kept at 4 °C for 30 min, followed by centrifugation at 15,000gfor 15 min to precipitate non-hydrolysis substrate. 100 μl of 1 M NaOH was added to 100μl supernatant and the absorbance at 405 nm was measured. To determine the effect of the seed proteinaceous extracts on the protease activities, enzymes were pre-incubated with each seed extracts for 30 min at 35 °C followed by determination of the residual enzyme activity as
PCB eksponering i Farum Midtpunkt
DEFF Research Database (Denmark)
Meyer, Harald William; Frederiksen, Marie; Ebbehøj, Niels Erik
I marts og april 2011 blev i alt 104 lejligheder og 289 beboere fra Farum Midtpunkt undersøgt for niveauer af PolyChlorerede Biphenyler (PCB) i henholdsvis fuger og indeluft i lejligheder-ne, og i blodplasma. Til analyserne i denne rapport indgik 273 beboere, 139 fra PCB-forurenede lejligheder og...... 134 fra ikke-forurenede lejligheder. Der blev indsamlet luftprøver fra 83 forure-nede og 21 ikke-forurenede lejligheder og fugeprøver fra 20 forurenede lejligheder. Ni ud af 24 målte PCB-kongenere var under detektionsgrænsen i luften, inkl. de to mest toksiske kongenere nr. 126 og 169. For de...... forurenede lejlig-heder, undtagen for nr. 183 og 190, samt for nr. 182 som alle lå under detektionsgrænsen. For ni ud af tolv dioxin-lignende PCB-forbindelser var alle, eller næsten alle prøver under detektions-grænsen. For nr. 105 og 118 sås signifikant højere niveau blandt eksponerede. Mænd havde et lidt...
U.S. EPA, Pesticide Product Label, BIO-GUARD ET-70 CHLORINE CONCENTRATE, 10/02/1971
2011-04-14
... I ~ • 1 I. • . ~ j 126;~~~;fa'j~ :::,e:!:~lt126;~;n;,~: ; r~"w7rhl126;~~~;:I!~:'! C:--==J irritating and bozardous gose •. Store In a cool dry place. ...
Directory of Open Access Journals (Sweden)
Bajonero Johanna
2008-12-01
Full Text Available
Apanteles gelechiidivoris es un parasitoide de larvas de Tuta absoluta (Lepidoptera: Gelechiidae, una plaga importante de cultivos como el tomate y la papa. El uso de este insecto para el control biológico no se ha implementado eficientemente debido a la falta de conocimiento de la biología, específicamente del ciclo de vida y el efecto de factores externos, como la temperatura, en su capacidad parasítica. Se evaluó el desarrollo y la capacidad reproductiva de A. gelechiidivoris en cuatro condiciones térmicas: 14, 20, 26 y 32 °C. En la evaluación del desarrollo se realizó una descripción del ciclo, se determinó la duración total de este, se estimaron los umbrales térmicos para cada estadio utilizando el modelo de Lactin y se hallaron los grados día. En la evaluación de la capacidad reproductiva se variaron las densidades del hospedero ofrecidas a una pareja recién emergida de la avispa de 5 hasta 160 y se contó el número de adultos emergidos con los cuales se evaluó longevidad y fecundidad. Adicionalmente se ajustó un modelo de respuesta funcional. La duración del ciclo de vida para las temperaturas evaluadas fue de 39 días en 14 °C, 34 en 20 °C, 19 en 26 °C y 17 en 32 °C. La longevidad fue de 7,5 (14 °C, 7 (20 °C, 5 (26 °C y 2,4 (32 °C días. La temperatura a la cual se pueden optimizar los parámetros reproductivos de esta avispa se encuentra entre 20 y 26 °C.
1981-01-14
STAIO42 NA ,8 PIEIO I Mz10-- .5. _ __1 ’A ’US-iTAC I126;~~~~~~~~~~~~~; -OR -ECNTG -RQ C -F-EAV HUIDT G-AE T-A M- A -A -777 4w OT EATV OQ 10% 0% 0% 4% 5
MicroRNA-126 induces autophagy by altering cell metabolism in malignant mesothelioma
Czech Academy of Sciences Publication Activity Database
Tomasetti, M.; Monaco, F.; Manzella, N.; Rohlena, Jakub; Rohlenová, Kateřina; Staffolani, S.; Gaetani, S.; Ciarapica, V.; Amati, M.; Bracci, M.; Valentino, M.; Goodwin, J.; Nguyen, M.; Truksa, Jaroslav; Sobol, Margaryta; Hozák, Pavel; Dong, L.F.; Santarelli, L.; Neužil, Jiří
2016-01-01
Roč. 7, č. 24 (2016), s. 36338-36352 ISSN 1949-2553 R&D Projects: GA ČR(CZ) GAP301/10/1937; GA MŠk LM2015062; GA TA ČR(CZ) TE01020118; GA ČR(CZ) GA16-22823S; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 ; RVO:68378050 Keywords : pyruvate-dehydrogenase kinase * mir-126 * angiogenesis * tumor suppression Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.168, year: 2016
Efetividade do treinamento auditivo na plasticidade do sistema auditivo central: relato de caso
Directory of Open Access Journals (Sweden)
Tatiana Rocha Silva
2014-08-01
Full Text Available O objetivo do estudo foi descrever, por meio de relato de caso, a efetividade do treinamento auditivo na modificação do sistema auditivo central de uma criança com queixas de alteração de fala e linguagem. Trata-se de um estudo retrospectivo, por meio de relato de caso, de uma criança do gênero masculino de 02 anos e 06 meses com queixas de alteração de fala e/ou linguagem. Na avaliação de potencial evocado auditivo de tronco encefálico observou-se presença de ondas eletrofisiológicas I, III e V com latência absoluta e intervalos interpicos dentro da normalidade na orelha direita e presença de ondas I, III e V com latência absoluta da onda V elevada e intervalos interpicos III-V e I-V elevados na orelha esquerda. O limiar eletrofisiológico foi de 70dBNA à direita e 40dBNA à esquerda. Após a avaliação a criança foi encaminhada para terapia fonoaudiológica baseada no treinamento auditivo informal. Para monitorar a função auditiva, após 06 meses de terapia fonoaudiológica, a criança foi encaminhada para reavaliação auditiva. Na reavaliação auditiva os resultados foram presença de ondas eletrofisiológicas I, III e V com latência absoluta e intervalos interpicos dentro da normalidade em ambas as orelhas com limiares eletrofisiológicos de 20dBNA bilateral. O programa de treinamento auditivo foi eficaz na reabilitação das habilidades auditivas.
An Image Segmentation System Based on Thresholding.
1978-12-01
referred to as tuoe gjj~ j flj t~zoe 126;~;~ errg r~ res p e c t i v e l y . Examples of these errors are provided in F ig ure 2 This figure also shows a...h it’ . IV& ’ I’~ I126;~; t ’ dl St~ flt~ C t ~ t he ide ~ td ~ a’.’ en t p1 xe I i 0 0 ~ r ~ - c 126;~; dI~ + 126;~; — 2 I I~ r dr 126;~; o — O r* . - ’ 0 — 0
1982-09-01
CIli N N N LJ I> UU () u ~I - 6 0 0 -+ o4’ C. - z 00 > -~2 1126;~~~; VCW *- oil-- La 4I (i126;~;bs S.oj *1iu i 9 I VIH 9-sn c ..-.. w ~ LkJo~ 0L 0 B )0...2100 __2000 w*gpg S-U slV-. Is OOU 1O OOU S OOU . a . 0#0 MR., ? -2200Pautsaj Ist COl toot 00,v An 300 -126;~~~; -, ---- ---- I $to U ,S0M 00*aSow STA
Rodríguez-Guzmán, R.; Robledo, L. M.; Sharma, M. M.
2015-06-01
The quadrupole collectivity in Nd, Sm, Gd, Dy, Er, Yb, Hf and W nuclei with neutron numbers 122 ≤ N ≤ 156 is studied, both at the mean field level and beyond, using the Gogny energy density functional. Besides the robustness of the N = 126 neutron shell closure, it is shown that the onset of static deformations in those isotopic chains with increasing neutron number leads to an enhanced stability and further extends the corresponding two-neutron drip lines far beyond what could be expected from spherical calculations. Independence of the mean-field predictions with respect to the particular version of the Gogny energy density functional employed is demonstrated by comparing results based on the D1S and D1M parameter sets. Correlations beyond mean field are taken into account in the framework of the angular momentum projected generator coordinate method calculation. It is shown that N = 126 remains a robust neutron magic number when dynamical effects are included. The analysis of the collective wave functions, average deformations and excitation energies indicate that, with increasing neutron number, the zero-point quantum corrections lead to dominant prolate configurations in the 0{1/+}, 0{2/+}, 2{1/+} and 2{2/+} states of the studied nuclei. Moreover, those dynamical deformation effects provide an enhanced stability that further supports the mean-field predictions, corroborating a shift of the r-process path to higher neutron numbers. Beyond mean-field calculations provide a smaller shell gap at N = 126 than the mean-field one in good agreement with previous theoretical studies. However, the shell gap still remains strong enough in the two-neutron drip lines.
Sayritupac Gutierrez, Javier
2013-01-01
En el presente trabajo de investigación se analiza los significados personales e institucionales de las medidas de tendencia central en un estudio con alumnos de primeros ciclos de las carreras de humanidades de la Pontificia Universidad Católica del Perú. Para realizar este análisis se consideró como marco teórico el Enfoque Ontosemiótico de la Cognición e Instrucción Matemática (EOS), el cual nos brindó las herramientas necesarias para el análisis de nuestro objeto de estu...
Haidar, Malak
2018-03-23
Theileria annulata is an apicomplexan parasite that infects and transforms bovine macrophages that disseminate throughout the animal causing a leukaemia-like disease called tropical theileriosis. Using deep RNAseq of T. annulata-infected B cells and macrophages we identify a set of microRNAs induced by infection, whose expression diminishes upon loss of the hyper-disseminating phenotype of virulent transformed macrophages. We describe how infection-induced upregulation of miR-126-5p ablates JIP-2 expression to release cytosolic JNK to translocate to the nucleus and trans-activate AP-1-driven transcription of mmp9 to promote tumour dissemination. In non-disseminating attenuated macrophages miR-126-5p levels drop, JIP-2 levels increase, JNK1 is retained in the cytosol leading to decreased c-Jun phosphorylation and dampened AP-1-driven mmp9 transcription. We show that variation in miR-126-5p levels depends on the tyrosine phosphorylation status of AGO2 that is regulated by Grb2-recruitment of PTP1B. In attenuated macrophages Grb2 levels drop resulting in less PTP1B recruitment, greater AGO2 phosphorylation, less miR-126-5p associated with AGO2 and a consequent rise in JIP-2 levels. Changes in miR-126-5p levels therefore, underpin both the virulent hyper-dissemination and the attenuated dissemination of T. annulata-infected macrophages.
Las olas embravecidas. La antropología propugnada en <i>El engaño de las razasi> de Fernando Ortiz
Directory of Open Access Journals (Sweden)
Lastra de Matías, Gilles
2008-12-01
Full Text Available The following paper approaches Fernando Ortiz’s thought through his book <i>El engaño de las razasi> (1946. The cuban author proposes an anthropology free from the distinctive and discriminatory criterion of races, free from the use of the word “race”. This work, which implies a decidedly critical conception of history, is linked to the reflection on “transculturation”, and in a certain extent, a continuation of it.
El siguiente artículo estudia el pensamiento de Fernando Ortiz a través de su libro <i>El engaño de las razasi> (1946. El autor cubano asienta las bases de una antropología libre del criterio distintivo y discriminatorio de las razas, libre del uso de la palabra “raza”. Esta obra, que supone una concepción plenamente crítica de la historia, resulta inseparable de la reflexión sobre la “transculturación”, y en cierta medida, la prolonga.
Directory of Open Access Journals (Sweden)
Jaime Carmona-Fonseca
2007-06-01
Resultados. Se evaluaron 827 trabajadores. Según la técnica Lovibond® se clasificaron en cuatro categorías: 821 con valores de 75% o más de actividad colinesterásica (categorías 75%, 87,5% y 100% y otros seis con actividad inferior a 75%. Con cada técnica cuantitativa los valores promedios de colinesterasa eritrocitaria y plasmática correspondientes a los cuatro valores de Lovibond® fueron estadísticamente diferentes entre sí. Los promedios de cada técnica cuantitativa fueron mayores a medida que creció el valor de la técnica semicuantitativa. Con Lovibond® se clasificó muy mal (61%-73% la baja actividad enzimática eritrocitaria, pero la clasificación de la baja actividad plasmática fue absolutamente errónea (94%-96%. Conclusión. Es posible estimar en forma adecuada los valores de colinesterasa eritrocitaria o plasmática que corresponden a las técnicas de Michel y EQM® a partir de datos de la técnica Lovibond® y viceversa, pero sólo cuando la actividad colinesterásica es normal, pues Lovibond® tiene una capacidad muy deficiente para identificar como "bajos" los valores que realmente lo son según las pruebas cuantitativas.
Utilização da medida do clorofilômetro no manejo da adubação nitrogenada em plantas de pimentão
Directory of Open Access Journals (Sweden)
Godoy L. J. G.
2003-01-01
Full Text Available O adequado manejo da adubação nitrogenada ao longo do ciclo da cultura do pimentão é complicado pela falta de um índice do N disponível no solo e por ser a análise química de folhas um método de diagnose demorado. Foi realizado um experimento em vasos, em um túnel de plástico pertencente ao Departamento de Recursos Naturais/Ciência do Solo, da FCA/UNESP, Botucatu (SP, com o objetivo de avaliar o índice de suficiência de nitrogênio (ISN, calculado com base nas medidas do clorofilômetro, como ferramenta auxiliar no manejo da adubação nitrogenada em plantas de pimentão. O experimento foi composto de doses de N (4,9; 9,8; 14,7; 19,6; e 24,5 g de N 50 kg-1 de solo - uma planta aplicadas de modo convencional ou pela fertirrigação e um tratamento em que as plantas não receberam apenas a adubação nitrogenada, com sete repetições. As medidas do clorofilômetro foram realizadas a cada 15 dias em cinco folhas recém-maduras por planta. O ISN foi calculado pela relação entre a média das medidas do clorofilômetro nas plantas dos tratamentos (MCT e a média das medidas do clorofilômetro nas plantas que receberam a maior dose (MCR, na área de referência (ISN = MCT/MCR x 100. O ISN pode ser um bom indicador do momento de aplicação do adubo nitrogenado e auxiliar no ajuste da dose de N de acordo com a exigência das plantas de pimentão, com a finalidade de aumentar a eficiência de utilização do N aplicado.
Signatures of shell evolution in alpha decay across the N = 126 shell closure
Rui-Wang; Wang, Rui-Yao; Qian, Yi-Bin; Ren, Zhong-Zhou
2017-06-01
Within the alpha-cluster model, we particularly investigate the alpha decay of exotic nuclei in the vicinity of the N = 126 neutron shell plus the Z = 82 proton shell. The systematics of alpha-preformation probability (P α ), as an indicator of the shell effect, is deduced from the ratio of the experimental decay width to the calculated one. Through the comparative analysis of the P α trend in the N = 124-130 isotonic chain, the N = 126 and Z = 82 shell closures are believed to strongly affect the formation of the alpha particle before its penetration. Additionally, the P α variety in Po and Rn isotopes is presented as another proof for such an influence. More importantly, it may be concluded that the expected neutron (or proton) shell effect gradually fades away along with the increasing valence proton (or neutron) number. The odd-even staggering presented in the P α value is also discussed. Supported by National Natural Science Foundation of China (11375086, 11535004, 11605089, 11120101005), Natural Science Youth Fund of Jiangsu Province (BK20150762), Fundamental Research Funds for the Central Universities (30916011339), 973 National Major State Basic Research and Development Program of China (2013CB834400), and a Project Funded by the Priority Academic Programme Development of JiangSu Higher Education Institutions (PAPD)
U.S. EPA, Pesticide Product Label, GLY N GO, 05/11/2009
2011-04-21
... conjunction with tillage practices in fallow systems or preplant ... natural rainfall or via a sprinkler system. ... I126;~~~; T~kSE126;~;~i126;~;~ 126;~;VDE126;~~~;~Rt126;~~~;E ...
Directory of Open Access Journals (Sweden)
Yara Oyram Ramos Lima
2015-02-01
Full Text Available O estudo objetiva identificar as principais características das medidas de controle restritivas de liberdade, adotadas nos países signatários do Regulamento Sanitário Internacional (RSI, em situações de epidemias/pandemias, com ênfase nas relações entre leis e princípios, benefícios e desvantagens da utilização dessas medidas. Realizou-se revisão até julho de 2012 nas bases de dados Medline, Web of Science e Scielo com os descritores: “Restrictives Measures”, “Quarantine”, “Nonpharmaceutical”, “Quarantine and Isolation”, “medidas restritivas”, “Quarentena”, “não-farmacêuticas”, “isolamento”. Encontrou-se diferentes posições entre os países e que o problema central no debate sobre medidas restritivas de liberdade não é exatamente a quarentena e o isolamento e sim questões de cunho econômico, social e administrativo. Percebe-se concordância tácita quanto à importância das medidas restritivas nas Emergências em Saúde Pública e que a efetivação de sua aplicação enseja problemas ainda não harmonizados entre os países signatários do RSI (2005. ----------------------------------------------------------------------------------------------- This study aimed to identify the main features of the freedom-restricting control measures adopted by the signatories to the international health regulations (IHR in case of epidemics/pandemics. Relationships were emphasized between laws and principles and benefits and disadvantages from adopting them. A literature review search was conducted in Medline, Scielo, and Web of Science databases using the key words “Restrictives Measures,” “Quarantine,” “Nonpharmaceutical,” “Quarantine and Isolation,” “medidas restritivas,” “Quarentena,” “não-farmacêuticas,” and “isolamento” in articles published in or before July 2012. Different countries showed different approaches, and economic, social, and administrative issues
Directory of Open Access Journals (Sweden)
Esperanza Macarena Sierra Benítez
2013-05-01
Full Text Available La situación económica y de crisis en la zona euro obligó al Gobierno, en el año 2010, a iniciar una era de reformas estructurales de gran calado en ámbitos tan importantes como el financiero, y en particular el de la banca. En el ámbito laboral el periodo 2010-2012 se caracteriza por una producción importante de reformas que debería culminar con la Ley 3/2012, de 6 de julio, de medidas urgentes para la reforma laboral, objeto de este trabajo. El estudio contempla también el comienzo de la segunda generación de reformas estructurales, el Real Decreto-ley 4/2013, de 22 de febrero, de medidas de apoyo al emprendedor y de estímulo del crecimiento y de la creación de empleo, para finalizar con una mención al Real Decreto-ley 5/2013, de 15 de marzo, de medidas para favorecer la continuidad de la vida laboral de los trabajadores de mayor edad y promover el envejecimiento activo. Se trata de un comentario que ha atendido fundamentalmente al contenido laboral de la reforma del mercado de trabajo, dejando al margen el de la Seguridad Social, pero incluyendo el RD-ley 20/2012, de 13 de julio, de medidas para garantizar la estabilidad presupuestaria y de fomento de la competitividad. In 2010 the economical situation and the eurozone crisis forced the Spanish Government to commence an era of deep structural reforms in important areas such as finance, with special regard to the banking sector. In the labour sphere the period 2010-2012 is marked by a significant production of reforms that should culminate with the Law 3/2012, of July 6th, on urgent measures for labour reform, which is the aim of this essay. The study also includes the start of a second generation of structural reforms, the Royal Decree-Law 4/2013, of February 22nd, on support measures for entrepreneurs and incentives to growth and employment, and it finishes with a mention to the Royal Decree-Law 5/2013, of March 15th, on measures to keep older workers within the labour market
Equipo comparativo para la medida de conductividad térmica de materiales cerámicos
Directory of Open Access Journals (Sweden)
Barea, R.
2006-04-01
Full Text Available Among the different techniques available for measuring thermal conductivity, the comparative method (ASTM E1225-99 is the most appropriate for porous materials. This method determines the thermal conductivity in steady state conditions in the 100 - 1300 K temperature range and for conductivities between 0.2 and 200 W/mK, respectively, depending on the equipment characteristics. In the present paper, the design and development, as well as the start up process, of an apparatus based on this method is described. Thermal conductivity data on a mullite based refractory, measured by both the laser flash and the comparative methods, are presented and comparatively discussed in order to validate the developed equipment.
Entre las distintas técnicas de medida de la conductividad térmica de materiales, el método comparativo, recogido en la norma ASTM E1225-99, es el más adecuado para muestras porosas o materiales compuestos. Este método permite determinar conductividades térmicas en estado estacionario, en el intervalo de valores de 0,2 a 200 W/mK, y a temperaturas de ensayo en el rango 100-1300 K, dependiendo del diseño del equipo. En este trabajo se expone el diseño, desarrollo y puesta a punto de un equipo de medida de conductividad térmica basado en este método. Paralelamente, se realiza una validación del equipo mediante el estudio comparativo de los resultados obtenidos usando el equipo comparativo y la técnica del pulso láser en materiales porosos de mullita.
Segura Garcia, Jaume
La contaminacion ambiental por campos electromagneticos ha resultado ser en estos ultimos anos uno de los problemas mas acuciantes del panorama tecnologico y de salud publica. En el primero de los casos porque las inversiones realizadas son enormes y en el segundo porque cada vez es mayor el numero de articulos, "technical reports" e informes medicos que afirman la existencia de una cierta causalidad, aunque sea debil, entre los campos electromagneticos y ciertos cuadros sintomatologicos. En nuestro caso, hemos dedicado bastantes esfuerzos a investigar el llamado "sindrome de radiofrecuencia / microondas", denominado asi en la literatura cientifica por presentarse en operarios de estaciones de radar y en trabajadores de potentes emisoras de radio y television. En esta memoria presentamos un resumen del trabajo realizado durante los ultimos anos en la medida de la contaminacion electromagnetica ambiental asociado a las comunicaciones inalambricas. En ella se recogen los fundamentos fisicos y propiedades de las ondas electromagneticas, la tecnologia empleada en los sistemas de telefonia celular y los antecedentes relativos a la investigacion de la interaccion de las ondas electromagneticas con organismos vivos. Se desarrolla un procedimiento de medida que ha conducido a la elaboracion de los primeros "mapas de radiofrecuencia" similares, en el aspecto descriptivo, a los mapas de ruido desarrollados en el area de la contaminacion acustica. Por ultimo, se analiza la respuesta subjetiva de los residentes, personas que viven en el entorno de cobertura de las estaciones base de telefonia movil y que se ven sometidos a determinados niveles de radiacion electromagnetica, con el fin de situar este fenomeno al nivel que le corresponde en el ambito de la respuesta subjetiva ciudadana.
Terapia regenerativa con plasma rico en plaquetas en pacientes con quemaduras
Directory of Open Access Journals (Sweden)
María del Carmen Franco Mora
2015-10-01
Full Text Available Se realizó un estudio comparativo, longitudinal y prospectivo de 60 adultos con quemaduras profundas, atendidos en el Hospital General docente "Dr. Juan Bruno Zayas Alfonso" de Santiago de Cuba, desde febrero de 2013 hasta igual mes de 2014, para evaluar la efectividad de la terapia regenerativa con plasma rico en plaquetas para la cicatrización de estas lesiones. La muestra fue dividida en 2 grupos de 30 integrantes cada uno: a los del primero se les aplicó plasma rico en plaquetas y a los del segundo sulfadiazina de plata. Se utilizaron las frecuencias absolutas y el porcentaje como medidas de resumen para variables cualitativos, así como la media aritmética y la desviación estándar para las cuantitativas. Con el proceder aplicado la cicatrización se completó en un tiempo menor, de manera que se demostró la efectividad de esta alternativa terapéutica en relación con el tratamiento convencional
Energy Technology Data Exchange (ETDEWEB)
Vorrink, Sabine U. [Interdisciplinary Graduate Program in Human Toxicology, The University of Iowa, Iowa City, IA (United States); Department of Radiation Oncology, The University of Iowa, Iowa City, IA (United States); Severson, Paul L. [Department of Pharmacology and Toxicology, The University of Arizona, Tucson, AZ (United States); Kulak, Mikhail V. [Department of Surgery, The University of Iowa, Iowa City, IA (United States); Futscher, Bernard W. [Department of Pharmacology and Toxicology, The University of Arizona, Tucson, AZ (United States); Domann, Frederick E., E-mail: frederick-domann@uiowa.edu [Interdisciplinary Graduate Program in Human Toxicology, The University of Iowa, Iowa City, IA (United States); Department of Radiation Oncology, The University of Iowa, Iowa City, IA (United States); Department of Surgery, The University of Iowa, Iowa City, IA (United States)
2014-02-01
The aryl hydrocarbon receptor (AhR) is an important mediator of toxic responses after exposure to xenobiotics including 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) and dioxin-like polychlorinated biphenyls (PCBs). Activation of AhR responsive genes requires AhR dimerization with the aryl hydrocarbon receptor nuclear translocator (ARNT), a heterodimeric partner also shared by the hypoxia-inducible factor-1α (HIF-1α) protein. TCDD-stimulated AhR transcriptional activity can be influenced by hypoxia; however, it less well known whether hypoxia interferes with AhR transcriptional transactivation in the context of PCB-mediated AhR activation in human cells. Elucidation of this interaction is important in liver hepatocytes which extensively metabolize ingested PCBs and experience varying degrees of oxygen tension during normal physiologic function. This study was designed to assess the effect of hypoxia on AhR transcriptional responses after exposure to 3,3′,4,4′,5-pentachlorobiphenyl (PCB 126). Exposure to 1% O{sub 2} prior to PCB 126 treatment significantly inhibited CYP1A1 mRNA and protein expression in human HepG2 and HaCaT cells. CYP1A1 transcriptional activation was significantly decreased upon PCB 126 stimulation under conditions of hypoxia. Additionally, hypoxia pre-treatment reduced PCB 126 induced AhR binding to CYP1 target gene promoters. Importantly, ARNT overexpression rescued cells from the inhibitory effect of hypoxia on XRE-luciferase reporter activity. Therefore, the mechanism of interference of the signaling crosstalk between the AhR and hypoxia pathways appears to be at least in part dependent on ARNT availability. Our results show that AhR activation and CYP1A1 expression induced by PCB 126 were significantly inhibited by hypoxia and hypoxia might therefore play an important role in PCB metabolism and toxicity. - Highlights: • Significant crosstalk exists between AhR and HIF-1α signaling. • Hypoxia perturbs PCB 126 induced AhR function and
Directory of Open Access Journals (Sweden)
Bianca Izoton Coelho
2013-01-01
Full Text Available A pesquisa analisou as representações sociais de ato infracional e medida socioeducativa em adolescentes em conflito com a lei. Utilizou-se, como aporte teórico e metodológico, a Teoria das Representações Sociais. Participaram da pesquisa quarenta e seis adolescentes que cumpriam, há mais de três meses, a medida de Liberdade Assistida. Os dados foram coletados, por meio de entrevistas, com um roteiro semiestruturado e consistiram na técnica das evocações livres por meio dos termos ato infracional e medida socioeducativa. Utilizou-se o software EVOC para análise das evocações emitidas. Os resultados apontaram como caracterização socioeconômica dos adolescentes: renda familiar baixa, baixo nível de escolaridade, local de residência precário, etnias afro-descendentes predominantes e distanciamento da religião. As representações sociais de ato infracional relacionaram-se aos tipos de atos infracionais e às suas causas e consequências. As representações sociais de medida socioeducativa relacionaram-se a ações positivas em que, além da aprendizagem, houve a possibilidade de mudança.The research has analised social representations of infraction and socio-educational measures in adolescents in conflict with the law. It has been used, as theoretical and methodological contribution, the Theory of Social Representations. Forty-six adolescents, who were serving for more than three months the measure of probation, have participated in the survey. Data were collected through interviews with a semi-structured screenplay and have consisted of the technique of free evocation, using the terms infraction and socio-educational measure. It has used the software EVOC for analysis of evocations issued. The results suggest the socio-economic status of adolescents: low family income, low educational level, place of residence precarious, African ethnicity predominant and distance from the religion. Social representations of infraction were
First Measurement of Several β-Delayed Neutron Emitting Isotopes Beyond N=126.
Caballero-Folch, R; Domingo-Pardo, C; Agramunt, J; Algora, A; Ameil, F; Arcones, A; Ayyad, Y; Benlliure, J; Borzov, I N; Bowry, M; Calviño, F; Cano-Ott, D; Cortés, G; Davinson, T; Dillmann, I; Estrade, A; Evdokimov, A; Faestermann, T; Farinon, F; Galaviz, D; García, A R; Geissel, H; Gelletly, W; Gernhäuser, R; Gómez-Hornillos, M B; Guerrero, C; Heil, M; Hinke, C; Knöbel, R; Kojouharov, I; Kurcewicz, J; Kurz, N; Litvinov, Yu A; Maier, L; Marganiec, J; Marketin, T; Marta, M; Martínez, T; Martínez-Pinedo, G; Montes, F; Mukha, I; Napoli, D R; Nociforo, C; Paradela, C; Pietri, S; Podolyák, Zs; Prochazka, A; Rice, S; Riego, A; Rubio, B; Schaffner, H; Scheidenberger, Ch; Smith, K; Sokol, E; Steiger, K; Sun, B; Taín, J L; Takechi, M; Testov, D; Weick, H; Wilson, E; Winfield, J S; Wood, R; Woods, P; Yeremin, A
2016-07-01
The β-delayed neutron emission probabilities of neutron rich Hg and Tl nuclei have been measured together with β-decay half-lives for 20 isotopes of Au, Hg, Tl, Pb, and Bi in the mass region N≳126. These are the heaviest species where neutron emission has been observed so far. These measurements provide key information to evaluate the performance of nuclear microscopic and phenomenological models in reproducing the high-energy part of the β-decay strength distribution. This provides important constraints on global theoretical models currently used in r-process nucleosynthesis.
Directory of Open Access Journals (Sweden)
Carla Rachel Ono
2006-02-01
Full Text Available OBJETIVO: O trabalho teve por objetivo padronizar o método e estabelecer valores normais da captação renal absoluta do99mTc-DMSA em crianças. MATERIAIS E MÉTODOS: Vinte e duas crianças (idade de 7 meses a 10 anos; média de 4,5 anos sem doença renal prévia foram submetidas a cintilografia renal estática com 99mTc-DMSA. Dezoito apresentavam ultra-sonografia, uretrocistografia miccional, "clearance" de creatinina e padrão visual da cintilografia renal estática normais. Quatro crianças foram excluídas por não terem completado ou por apresentarem redução do "clearance" de creatinina. A captação absoluta de DMSA (DMSA-Abs foi calculada como a porcentagem da atividade administrada retida em cada rim após seis horas da administração do radiofármaco. RESULTADOS: Os valores de DMSA-Abs foram de 21,8% ± 3,2% para o rim direito e de 23,1% ± 3,3% para o rim esquerdo. Os valores da captação absoluta não mostraram correlação com a idade dos pacientes estudados, apesar da tendência de aumento do "clearance" de creatinina com a idade. CONCLUSÃO: A definição de valores normais da DMSA-Abs permite o emprego deste parâmetro na avaliação inicial e acompanhamento de doenças renais, principalmente em pacientes com acometimento bilateral ou com rim único (nos quais a função diferencial direita X esquerda tem valor limitado.OBJECTIVE: To standardize a method and determine normal values for absolute renal uptake of 99mTc-DMSA in children with normal creatinine clearance. MATERIALS AND METHODS: Twenty-two children (between 7 months and 10 years of age; mean 4.5 years without clinical evidence of renal disease were studied using 99mTc-DMSA scintigraphy. Eighteen had normal renal ultrasonography, micturating urethrocystography, creatinine clearance and visual interpretation of the scintigraphy with 99mTc-DMSA. Four children were excluded, one with incomplete creatinine clearance and three due to reduction in the creatinine clearance
Multiparticle octupole coupling and magnetic moments of hn9/2 isomers in N=126 isotones
International Nuclear Information System (INIS)
Stuchbery, A.E.; Byrne, A.P.; Dracoulis, G.D.; Fabricius, B.; Kibedi, T.
1992-12-01
The influence of particle-vibration coupling on the g-factors of the (h 9/2 ) n > isomers in the N = 126 isotones is assessed using the multiparticle octupole coupling model. According to the model, admixtures of the configuration (h 9/2 ) n-1 f 7/2 > in the yrast 8 + and 21/2 - states, nominally associated with the configuration (h 9/2 ) n >, increase with n. On its own, the octupole mixing mechanism therefore predicts g-factors for these states that increase with the number of valence protons. This trend is the opposite of that predicted by core-polarization blocking. Combining multiparticle octupole coupling and first order core-polarization blocking significantly reduces the discrepancy between the experimental and theoretical g-factors of these states. It is concluded that the observed breakdown in additivity for the g-factors of the (h 9/2 ) n > isomers in the N = 126 isotones arises primarily from first order core-polarization blocking and the combination of configuration mixing due to multiparticle octupole coupling and shell model residual interactions. 40 refs., 5 tabs., 3 figs
AMC-SWMO Countermeasures Study. Volume 1. Guide to How Countermeasures Affect Smart Weapons
1992-01-01
orco126;~;ictrI~ N1@OAC, VISILE WI~tMWI LWI MQ 1126;~;~ 126;~; O( . it MM 1111, 0IIET1111( l I t Is ~ r.ll D~hOULAIT, I(V~tUA0 P~Ili~l2O0 0~ IMAil TlLLSCO126;~;~l126;~;., W 0
IMPACTOS DE LAS CARRETERAS SOBRE LA FAUNA SILVESTRE Y SUS PRINCIPALES MEDIDAS DE MANEJO
Directory of Open Access Journals (Sweden)
María del Pilar Arroyave
Full Text Available El objetivo de este artículo es presentar el impacto de los proyectos viales sobre la fauna silvestre y evaluar las medidas de manejo de estos efectos. Se revisó y analizó la información de diversos estudios realizados en el mundo, al igual que algunos estudios de impacto ambiental de carreteras que se han desarrollado en Antioquia. Se encontró que los principales impactos son el atropellamiento, el aislamiento de poblaciones y el cambio en los patrones reproductivos de la fauna; esto trae como consecuencia la disminución de las poblaciones de especies de fauna silvestre. También se plantean las estrategias comúnmente implementadas para el manejo de los impactos.
Directory of Open Access Journals (Sweden)
Wenceslao Peñate Castro
2004-01-01
Full Text Available El presente estudio ex post facto trata de poner a prueba cómo algunos predictores del nivel de depresión también son una función de la medida utilizada. Los predictores tenidos en cuenta corresponden al nivel de actividad, el estilo atribucional y las actitudes disfuncionales. Para medir la depresión se han utilizado el BDI, con una representación importante de los contenidos relacionados con la distorsión cognitiva y el CBD-r con contenidos relacionados con la afectividad triste. A una muestra de 123 estudiantes se les administraron, además del BDI y el CBD-r, los siguientes cuestionarios: la escala relacionada al estado de ánimo del cuestionario de eventos agradables (PES-MR, el Cuestionario de Estilos Atribucionales (ASQ y la Escala de Actitudes Disfuncionales (DAS. Los resultados muestran parcialmente la relación predicha entre predictores y medidas de la depresión, ya que el nivel de actividad está relacionado con cualquiera de las dos medidas, pero parece observarse que, mientras a nivel atribucional está más cercano a la medida del CBD-r, las actitudes disfuncionales están más vinculadas a la depresión medida por el BDI. Estos resultados se discuten de acuerdo con los distintos componentes de la depresión y en qué medida la búsqueda de sus predictores es también la búsqueda de la compleja composición del fenómeno depresivo.
Directory of Open Access Journals (Sweden)
Federico Losurdo
2017-06-01
Full Text Available As medidas protetivas de urgência representam uma tutela estatal na relação vítima e agressor, de modo a impossibilitar que a situação de violência seja continuada, assim como as consequências morais e econômicas da mesma prejudiquem a vítima. A natureza jurídica de tais medidas ainda é ponto controverso na doutrina, dificultando, em alguns casos, sua implementação ou julgamento de mérito. Nesse sentido, pretende-se analisar, tendo como plano de fundo o direito comparado, a figura das medidas de urgência em casos de violência doméstica, de modo a se averiguar qual a tendência doutrinária mais adequada ao uso no direito brasileiro.
Directory of Open Access Journals (Sweden)
PINZÓN, Lorena Viviana Calderón
2012-11-01
Full Text Available El presente artículo pretende realizar el estudio de los principales retos jurídicos que ha tenido el proceso de implementación de la normatividad sobre etiquetado y empaquetado de productos de tabaco en Colombia. Para este fi n, es necesario conocer los procesos de elaboración de la legislación sobre control de tabaco, los avances que la jurisprudencia de la Corte Constitucional colombiana ha adelantado sobre el tema y las medidas administrativas llevadas a cabo por parte del Ministerio de Salud, punto focal sobre control de tabaco en el país. Es indispensable, de igual forma, reconocer la articulación que debe tener esta disposición respecto de su estudio, a partir del plan de medidas MPOWER, especialmente con la medida de prohibición de toda forma de publicidad, promoción y patrocinio de productos de tabaco. Lo anterior ha permitido, a partir de la armonización de los contenidos de la normativa internacional con el ordenamiento interno colombiano, estructurar los lineamientos de política del Gobierno e implementar efi cazmente la legislación actual.
Medidas de control de tuberculosis en una institución de salud de Bogotá D.C
Muñoz-Sánchez, Alba I; Castro-Cely, Yesenia
2016-01-01
Objetivo: evaluar la implementación de medidas de control, de tipo administrativo, ambiental y de protección respiratoria, de la infección de tuberculosis en un hospital de III nivel de atención en la ciudad de Bogotá D.C. Metodología: estudio de tipo descriptivo, transversal. Para la recolección de datos se aplicó una herramienta de autorreporte a 158 trabajadores de la salud del hospital, se realizó una entrevista estructurada al responsable del programa institucional de control de tubercul...
Medidas de control de tuberculosis en una institución de salud de Bogotá D.C
Alba I. Muñoz-Sánchez; Yesenia Castro-Cely
2016-01-01
Resumen Objetivo: evaluar la implementación de medidas de control, de tipo administrativo, ambiental y de protección respiratoria, de la infección de tuberculosis en un hospital de III nivel de atención en la ciudad de Bogotá D.C. Metodología: estudio de tipo descriptivo, transversal. Para la recolección de datos se aplicó una herramienta de autorreporte a 158 trabajadores de la salud del hospital, se realizó una entrevista estructurada al responsable del programa institucional de control ...
"A Liberdade absoluta e o terror" - Fenomenologia do Espírito
Directory of Open Access Journals (Sweden)
Georg Friedrich Hegel
2017-02-01
Full Text Available A presente tradução que ora se apresenta ao público brasileiro, realizou-se no seio do Projeto de Investigação «A recepção da Revolução Francesa pela Filosofia Alemã do final do século XVIII e início do século XIX» (PTDC / FIL / 74365 / 2006, financiado pela Fundação para a Ciência e Tecnologia de Portugal, e fora realizada pela equipe de investigação composta por: Prof. Carlos Morujão, Profa. Inês Bolinhas, Prof. Miguel Santos Silva, Profa. Cláudia Oliveira e Profa. Teresa Pedro. Indicamos, ent r e p a r ênt e s i s r e c to s , ind i c amo s a p a gina ç ão d a ed i ç ão c r í t i c a d a s o b r as d e Hege l , Ge samme l t e We r k e , Band 9 , Hamb ur g, Fe l ix Me ine r , 1 9 8 0 . . Email de contato: cmorujao@fch.lisboa.ucp.pt
MEDIDA DA ATIVIDADE FÍSICA EM JOVENS BRASILEIROS: REPRODUTIBILIDADE E VALIDADE DO PAQ-C E DO PAQ-A
Guedes,Dartagnan Pinto; Guedes,Joana Elisabete Ribeiro Pinto
2015-01-01
Introdução: O Physical Activity Questionnaire for Children (PAQ-C) e o Physical Activity Questionnaire for Adolescents (PAQ-A) foram originalmente propostos para oferecer medidas autorrelatadas da prática de atividade física de jovens. Objetivos: Traduzir para o idioma português, realizar adaptação transcultural e analisar reprodutibilidade e validade concorrente do PAQ-C e do PAQ-A em amostra de jovens brasileiros. Métodos: Versões originais foram traduzidas de acordo com recomendações ...
Directory of Open Access Journals (Sweden)
José A. Guijarro
2007-12-01
Full Text Available Se han comparado las medidas de horas de sol realizadas en paralelo con el heliógrafo Campbell-Stokes, utilizado tradicionalmente en los observatorios españoles, con las medidas de los nuevos instrumentos de Kipp&Zonen, basados en el umbral de irradiación directa de 120 Wm-2. La comparación se ha realizado con los datos de dos observatorios de Baleares, ubicados en los aeropuertos de Menorca e Ibiza, en los que las nuevas medidas son generalmente inferiores a las antiguas, con diferencias medias diarias de -0,97 y -0,58 horas respectivamente. En términos relativos, la disminución respecto al promedio anual del periodo 1971-2000 es de un 13,2% en Menorca y un 7,8% en Ibiza. Se han realizado ajustes por regresión lineal simple y múltiple que explican un 94% de la varianza de la insolación diaria. Las ecuaciones obtenidas pueden servir para homogeneizar las series de datos diarios de horas de sol, con errores típicos de 0,98 horas en el aeropuerto de Menorca y 0,86 en el de Ibiza, pero no son aplicables a otros observatorios.
International Nuclear Information System (INIS)
Keinert, J.
1982-06-01
In providing THERM-126 with cross section matrices for deuterium bound in heavy water the IKE phonon spectrum was reevaluated. The changes are modifications in the acoustic part and in the frequency of the second oscillator. Contrary to the phonon spectrum model for D in D 2 O in ENDF/B-IV the broad band of hindered rotations is assumed to be temperature dependent taking into account the diffusive motion of the molecule. With the new model scattering law data S (α, β) are generated in the temperature range 293.6 K-673.6 K. The THERM-126 scattering cross section matrices are calculated up to P 3 . As a validity check a lot of differential and integral cross sections are compared to experiments and benchmarks are recalculated. (orig.) [de
Oxidative stress induced in PCB 126-exposed northern leopard frogs, Rana pipiens
Huang, Y.-W.; Hoffman, D.J.; Karasov, W.H.
2007-01-01
Northern leopard frogs Rana pipiens exposed to PCB 126 (3,3',4,4',5-pentachlorobiphenyl) were examined for hepatic oxidative stress. In a dose-response study, northern leopard frogs were injected intraperitoneally with either PCB 126 in corn oil (0.2, 0.7, 2.3, or 7.8 mg/kg body weight) or corn oil alone. In a time-course study, frogs received 7.8 mg/kg or corn oil alone, and were examined at 1, 2, 3, and 4 wk after dosing. Hepatic concentrations of reduced glutathione (GSH), thiobarbituric acid-reactive substances (TBARS), and total sulfhydryls (total SH), as well as activities of glutathione peroxidase (GSH-P), GSSG reductase (GSSG-R), glucose-6-phosphate dehydrogenase (G-6-PDH), and glutathione S-transferase (GSH-S-T) were measured. In the dose-response experiment, few effects were apparent 1 wk after dosing. In the time-course experiment, significant changes were observed in the 7.8-mg/kg group at 2 wk or more posttreatment. Hepatic concentrations of GSH and TBARS were higher than in corresponding controls at wk 3 and 4; the activities of GSSG-R and GSH-S-T were higher than in controls at wk 2 and 4; and the activity of G-6-PDH was increased at wk 2 and 4. These data collectively indicate that altered glutathione metabolism and oxidative stress occurred and were indicative of both toxicity and induction of protective mechanisms in frogs exposed to PCB. A similar delay in response was reported in fish and may relate to lower metabolic rate and physiological reactions in ectothermic vertebrates
Oxidative stress induced in PCB 126-exposed northern leopard frogs, Rana pipiens.
Huang, Yue-wern; Hoffman, David J; Karasov, William H
2007-04-15
Northern leopard frogs Rana pipiens exposed to PCB 126 (3,3',4,4',5-pentachlorobiphenyl) were examined for hepatic oxidative stress. In a dose-response study, northern leopard frogs were injected intraperitoneally with either PCB 126 in corn oil (0.2, 0.7, 2.3, or 7.8 mg/kg body weight) or corn oil alone. In a time-course study, frogs received 7.8 mg/kg or corn oil alone, and were examined at 1, 2, 3, and 4 wk after dosing. Hepatic concentrations of reduced glutathione (GSH), thiobarbituric acid-reactive substances (TBARS), and total sulfhydryls (total SH), as well as activities of glutathione peroxidase (GSH-P), GSSG reductase (GSSG-R), glucose-6-phosphate dehydrogenase (G-6-PDH), and glutathione S-transferase (GSH-S-T) were measured. In the dose-response experiment, few effects were apparent 1 wk after dosing. In the time-course experiment, significant changes were observed in the 7.8-mg/kg group at 2 wk or more posttreatment. Hepatic concentrations of GSH and TBARS were higher than in corresponding controls at wk 3 and 4; the activities of GSSG-R and GSH-S-T were higher than in controls at wk 2 and 4; and the activity of G-6-PDH was increased at wk 2 and 4. These data collectively indicate that altered glutathione metabolism and oxidative stress occurred and were indicative of both toxicity and induction of protective mechanisms in frogs exposed to PCB. A similar delay in response was reported in fish and may relate to lower metabolic rate and physiological reactions in ectothermic vertebrates.
Directory of Open Access Journals (Sweden)
Edwin Rodríguez Peña
2011-01-01
Full Text Available Resumen:El presente trabajo tiene como finalidad argumentar desde una postura teórico-conceptual, a partir de una reflexión jurídico-filosófica, de la justificación y alcance de las medidas de seguridad privativas de la libertad como ejercicio de control punitivo del Estado, a partir de los principios de justicia, proporcionalidad y legalidad de las actuaciones del operador de justicia y posibles violaciones al principio de inocencia y de libertad. Mediante la puesta en escena de un marco jurisprudencial, también pretende ilustrar el alcance de estas medidas frente a los derechos fundamentales y su carácter político. Así las cosas, se parte de los antecedentes de las medidas de seguridad frente a la penas y sus distintas modalidades para luego establecer las relaciones y concesiones entre la sentencia de condena y las medidas impuestas durante la etapa de sindicación e imputación dentro del proceso penal garantizando así el ejercicio del mismo y su carácter garantista frente a la víctima y a la sociedad. Así mismo, se mira la institución del Derecho Penal a través del proceso, en donde el Estado persigue al sindicado hasta llegar a la idea de justicia y reparación. Por último, se imprime un carácter holista a la evaluación social de los perjuicios y situaciones de tensión que se presentan al momento de poner de manifiesto la vulneración de derechos fundamentales.Palabras Claves:Garantismo, debido proceso, control de legalidad, medidas de seguridad.Abstract:This paper aims to argue from a theoretical and conceptual approach, from a legal-philosophical reflection, justification and scope of safety measures involving deprivation of liberty as an exercise of punitive control of the state, from the beginning justice, proportionality and legality of the actions of the operator of justice. By means of the jurisprudential framework, this article also aims to illustrate the scope of these measures facing the fundamental rights and
Raich, Rosa M. (Rosa Maria)
1993-01-01
Aquí s'exposa una visió panoramica i una serie d'implicacions del coneixement que actualment s'ha assolit des de la psicologia envers un fenomen creixent i dramatic associat als nostres temps, l'anorexia. Com podem explicar-nos que una persona mori de fam, en presencia de menjar disponible? Com podem entendre que una necessitat tan primaria desaparegui davant d'altres premisses i imposicions? Com podem comprendre que el menjar es converteixi en una obsessió i/o en una fobia absoluta? Caldria ...
First measurement of several $\\beta$-delayed neutron emitting isotopes beyond N=126
Caballero-Folch, R.; Agramunt, J.; Algora, A.; Ameil, F.; Arcones, A.; Ayyad, Y.; Benlliure, J.; Borzov, I.N.; Bowry, M.; Calvino, F.; Cano-Ott, D.; Cortés, G.; Davinson, T.; Dillmann, I.; Estrade, A.; Evdokimov, A.; Faestermann, T.; Farinon, F.; Galaviz, D.; García, A.R.; Geissel, H.; Gelletly, W.; Gernhäuser, R.; Gómez-Hornillos, M.B.; Guerrero, C.; Heil, M.; Hinke, C.; Knöbel, R.; Kojouharov, I.; Kurcewicz, J.; Kurz, N.; Litvinov, Y.; Maier, L.; Marganiec, J.; Marketin, T.; Marta, M.; Martínez, T.; Martínez-Pinedo, G.; Montes, F.; Mukha, I.; Napoli, D.R.; Nociforo, C.; Paradela, C.; Pietri, S.; Podolyák, Zs.; Prochazka, A.; Rice, S.; Riego, A.; Rubio, B.; Schaffner, H.; Scheidenberger, Ch.; Smith, K.; Sokol, E.; Steiger, K.; Sun, B.; Taín, J.L.; Takechi, M.; Testov, D.; Weick, H.; Wilson, E.; Winfield, J.S.; Wood, R.; Woods, P.; Yeremin, A.
2016-01-01
The $\\beta$-delayed neutron emission probabilities of neutron rich Hg and Tl nuclei have been measured together with $\\beta$-decay half-lives for 20 isotopes of Au, Hg, Tl, Pb and Bi in the mass region N$\\gtrsim$126. These are the heaviest species where neutron emission has been observed so far. These measurements provide key information to evaluate the performance of nuclear microscopic and phenomenological models in reproducing the high-energy part of the $\\beta$-decay strength distribution. In doing so, it provides important constraints to global theoretical models currently used in $r$-process nucleosynthesis.
Impacto sonoro do aeroporto Santos Dumont/RJ: análise e medidas de controle
Directory of Open Access Journals (Sweden)
José R. de Lima Neto
2014-09-01
Full Text Available A poluição sonora é parte cotidiana da vida nas grandes cidades. Dentre as fontes sonoras relevantes no contexto das cidades, tais como o ruído viário, uma que oferece desafios particulares é a relacionada ao sobrevoo de aeronaves, sejam aviões comerciais, jatos particulares ou helicópteros. Por se tratar de fontes intensas de ruído e das características das suas trajetórias (extensas e acima das habitações, tanto a avaliação do incômodo gerado, como eventuais medidas de mitigação são complexas e de difícil implementação.Dessa forma, o desconforto acústico gerado nas comunidades próximas as rotas de pouso e decolagem de grandes aeroportos tornou-se alvo de grandes reclamações por parte dos moradores que tem seu conforto ameaçado, o que reforça a necessidade de enfrentar estes desafios e atacar este problema.Assim, nesse trabalho, buscamos avaliar o impacto sonoro das aeronaves que possuem como destino ou são oriundas do aeroporto Santos Dumont/RJ (SBRJ, através de simulação computacional de ruído, em uma região próxima ao aeroporto com área de aproximadamente 39 km². A partir da quantificação e determinação das áreas efetivamente afetadas pelo ruído aeronáutico, e da comparação dos valores obtidos com as normas da legislação brasileira, esse trabalho visa mapear possíveis regiões de conflito e fornecer informações que orientem possíveis medidas mitigadoras e de controle de ruído plausíveis para a realidade atual. Palavras-Chave: Acústica, Ruído aeronáutico, Impacto Sonoro de Aeroportos.
1966-08-15
J- M.J126;~; .S N z*h v wN J 35 4, q . 44 OW126;~;I - 4 U I i 34 :12 N0 0. 4 -. A0 -N w 0M zN02 S Id hi w 6 f - IN h a. I 4 M10 IL vS N 05 hi N6 N6- VIh w... ist a a L4a2 is a0 a 4w -ts 4 0 gis is i.Ko a126;~~~;~A is’ksaC 4, Iaai 2 ft _a sit is a asi s s4 I 4~ 4 0 4i 44 o 126;~; is a isaa 4a iaJ 39 4 19 isv4 is a
1978-10-01
GRA&I UnTucea B WILLIAMS POND DAM 126;~;1Z~ CT 00551 _ Distribution/ Availabilit Y Codes Avail and/or Dis~tj pecialS RIVER BASIN ~lIILEBANON, COXNNECTICUT...Inspection Report. Alternatives to these recommendations r 1 would include reducing the Williams Pond water levels during expected periods of intense storm...Materials Branch Engi’neering Division FRED J. VNS. Jr., Member Chief, De ’ggn Branch Engineering Division SAUL COOPER, -r Chief, Water Control Branch
Medidas da condutividade térmica efetiva de modelos de polpas de frutas no estado congelado
Directory of Open Access Journals (Sweden)
Resende Jaime Vilela de
2002-01-01
Full Text Available As propriedades termofísicas de alimentos, necessárias nas simulações e cálculos do processo de congelamento, incluem principalmente a densidade, condutividade térmica e calor específico. Neste trabalho, as difusividades e condutividades térmicas da solução, usadas como modelo para o congelamento de polpas de frutas, foram medidas pelo método da sonda com aquecimento. Os experimentos foram conduzidos na faixa de -25 a 0masculineC com modelos alimentícios constituídos de 0,5% de K- carrageenan + 10% de sacarose (massa/volume de água. Modelos estruturais foram usados para as avaliações da condução de calor, combinada com a fração de gelo predita para as amostras a partir dos modelos de Heldman e foram comparados com os valores das condutividades térmicas efetivas medidas. Os modelos estruturais empregados foram: em série, paralelo e Maxwell-Eucken, com o gelo considerado como a fase dispersa. Em todos os ensaios, o modelo de Maxwell-Eucken apresentou os melhores resultados (erro máximo de 6,13% quando comparado com os valores experimentais medidos e foi escolhido para a predição da condutividade térmica efetiva de soluções-modelo de polpas de frutas congeladas. Os valores calculados da condutividade térmica foram ajustados em termos de funções polinomiais, divididas em quatro faixas de temperatura e podem ser usadas na resolução dos problemas de transferência de calor, nos processos de congelamento.
Elaboração de uma hipermídia educacional para o ensino do procedimento de medida da pressão arterial
Directory of Open Access Journals (Sweden)
Debora Cristina Alavarce
2011-08-01
Full Text Available A medida da pressão arterial é um procedimento imprescindível na avaliação do sistema cardiovascular. O ambiente digital de aprendizagem tem-se constituído em uma poderosa ferramenta do processo de ensino aprendizagem, pois acrescenta significado e concretude aos conteúdos que precisam ser aprendidos, podendo ser útil para o ensino deste procedimento. O objetivo deste trabalho foi construir uma hipermídia educacional para o ensino da técnica de medida da pressão arterial e descrever as etapas do processo de construção. O referencial pedagógico adotado foi o de Robert Gagné; para a construção, segue-se o modelo proposto por Price. O produto final apresenta vídeos, fotos, animações e simulações demonstrando e ensinando a realização do procedimento. Embora a construção da hipermídia tenha sido complexa, sua utilização pode incrementar positivamente o ensino de procedimentos de enfermagem.
Estado actual de la programación del riego en limonero mediante medidas del estado hídrico
Moreno, F.; Ortuño, M.F.; García-Orellana, Y.; Alarcón, J.J.; Conejero, W.; Nicolás, E.; Fernández, J.E.; Martín-Palomo, M.J.; Torrecillas, A.
2007-01-01
En el presente trabajo se realiza una visión sobre aspectos relativos a la utilización de medidas continuas del estado hídrico del limonero en la programación del riego. Para ello, se analizó, la sensibilidad de distintos indicadores del estado hídrico medidos de forma continua o discontinua en las plantas, su significado fisiológico, la obtención de niveles de referencia de los indicadores y los primeros resultados sobre programación de riego. Peer Reviewed
Directory of Open Access Journals (Sweden)
Tomás Xavier Francisco
2014-06-01
Full Text Available Este artigo tem por fim analisar, por um lado, a problemática dos adolescentes em conflito com a lei em Moçambique, e por outro lado, fazer reflexões sobre as medidas socioeducativas e limites para a sua aplicação prática. O trabalho contempla uma introdução, desenvolvimento onde arrola-se considerações sobre o histórico da legislação sobre adolescentes ou menores no país, reflexões sobre medidas socioeducativas e seus limites para sua aplicação prática, e por fim, contempla considerações finais e referências bibliográficas. A metodologia usada foi estudo exploratório, recorrendo-se a pesquisa bibliográfica e análise documental.
Directory of Open Access Journals (Sweden)
Miguel Revenga-Sánchez
2010-03-01
Full Text Available En este trabajo se describen las medidas de seguridad y defensa nacional impulsadas por el gobierno de Álvaro Uribe durante la vigencia del Estado de conmoción interior, así como el posicionamiento que la Corte Constitucional ha adoptado sobre estas, en ejercicio de su función de control de constitucionalidad. La negativa reiterada de la Alta Corte a dar su visto bueno a determinados preceptos restrictivos de los derechos fundamentales ha provocado que el Ejecutivo colombiano imponga el estatuto antiterrorista como parte del programa de seguridad democrática que lidera, mediante una reforma constitucional que es analizada en el presente artículo.
2012-03-01
considered in this opinion: or ( 4) a ncv . spt:cies is listed or criticCJI habitat designated that may be affected by the action. I r ym1 have...these <>ddresses in ycur web browse.- *"’ -track gH~’ ~ ~!g~u126;~;:*"’( ~e ’f126;~; * f~:126;~~~;s;’ :~U~9Sh i~.!:~* 5 ~5"’~i"* I 0 il) SHIPME>NT QUESTIONS
U.S. EPA, Pesticide Product Label, BIO-GUARD OBQ-SUPRA 100 ORANGE BOUQUET, 09/03/1975
2011-04-14
... I I j i ' i) :1 I '~F t r: I t \\ N rlll'( \\' I}f' ll," cI t h I () II q I d II t () 111,j I Ie f I () ( ) I ,I,,:d,lflil "qIJlp'l\\i':'~ • OBa-SUPRA 100 126;~;~ ... DBQ-SUPRA 100 tJ126;~; -. / I ...
International Nuclear Information System (INIS)
Sharma, Poonam; Dhawan, Anil; Jayraj, J.; Kamachi Mudali, U.
2013-01-01
The potentiodynamic polarization studies were carried out on Zr based bulk amorphous alloy Zr 57 Cu 15.4 Ni 12.6 Al 10 Nb 5 and Zr 59 Cu 20 Ni 8 Al 10 Ti 3 in solutions of 1 M, 6 M and 11.5 M HNO 3 aqueous media at room temperature. As received specimens of Zr 57 Cu 15.4 Ni 12.6 Al 10 Nb 5 (5 mm diameter rod) and Zr 59 Cu 20 Ni 8 Al 10 Ti 3 (3 mm diameter rod) were polished with SiC paper before testing them for potentiodynamic polarization studies. The amorphous nature of the specimens was checked by X-ray diffraction. The bulk amorphous alloy Zr 59 Cu 20 Ni 8 Al 10 Ti 3 shows the better corrosion resistance than Zr 57 Cu 15.4 Ni 12.6 Al 10 Nb 5 alloy in the aqueous HNO 3 media as the value of the corrosion current density (I corr ) for Zr 57 Cu 15.4 Ni 12.6 Al 10 Nb 5 alloy were found to be more than Zr 59 Cu 20 Ni 8 Al 10 Ti 3 alloy in aqueous HNO 3 media. The improved corrosion resistance of Zr 59 Cu 20 Ni 8 Al 10 Ti 3 alloy is possibly due to the presence of Ti and formation of TiO 2 during anodic oxidation. Both Zr based bulk amorphous alloys shows wider passive range at lower concentration of nitric acid and the passive region gets narrowed down with the increase in concentration. A comparison of data obtained from both the Zr-based bulk amorphous alloys is made and results are discussed in the paper. (author)
Directory of Open Access Journals (Sweden)
Clayton Amaral Domingues
2008-06-01
Full Text Available The present study aimed at investigating changes in behavior (shooting precision and electrophysiological variables (absolute alpha power during the motor learning of practical pistol shooting. The sample was composed of 23 healthy subjects, right-handed, male, between 18 and 20 years of age. The task consisted of four learning blocks. A One-way ANOVA with repeated measures and a post hoc analysis were employed to observe modifications on behavioral and electrophysiological measures (pO presente estudo teve por objetivo investigar alterações nas variáveis comportamentais (precisão do tiro e eletrofisiológicas (potência absoluta de alfa durante o aprendizado motor do tiro prático de pistola. A amostra constituiu-se de 20 sujeitos saudáveis, destros, sexo masculino, faixa etária entre 18 e 20 anos. A tarefa consistiu de quatro blocos de aprendizagem. A análise estatística das variáveis comportamentais e eletrofisiológicas foram realizadas por meio de uma ANOVA one-way e uma análise post hoc (p<0,05. Os resultados demonstraram diferenças significativas entre os blocos em função do aprendizado motor, bem como uma sensível melhora na precisão do tiro de ambos os blocos. Foi observada uma diminuição na potência de alfa em todos os eletrodos analisados durante a execução da tarefa, quando comparados aos blocos de linha de base e controle da aprendizagem. Os achados sugerem que a potência em alfa diminui devido o aprendizado motor quando sujeitos estão engajados na execução de uma tarefa motora complexa.
U.S. EPA, Pesticide Product Label, AN1004 EOGAS 4, 01/05/2006
2011-04-21
... spores known at 50oG,within thelsterilization pycle providing that the spores have not ... color change reaching i126;~;' t:ri~i126;~;~;p'q, ~!:f?t2'126;~~~;s~l~ Pi ...
Cuidado y Protección. Las Medidas de Protección de Derechos en la Provincia de Santa Fe, Argentina.
Directory of Open Access Journals (Sweden)
Silvina Laura Fernández
2016-04-01
Full Text Available Resumo: As adaptações normativas dos países á Convenção Internacional sobre os direitos da criança (1990 foram suscitando debates, controvérsias e ensaios entre os atores sociais, políticos e judiciários sob como tornar consistentes as mudanças propostas. Este artigo tem o objetivo de contribuir a expor as racionalidades, tensões e disputas entre os atores do campo da criança e do adolescente sob as medidas excepcionais estabelecidas pela lei de proteção integral a criança e ao adolescente no Estado de Santa Fe, Argentina (No 12927/09 Tais medidas têm revertidos nos procedimentos no qual se decreta a perda o suspensão do poder familiar. No caso da pesquisa e no analise dos depoimentos coletados, o estudo reconstrói os argumentos que guiaram o tema tanto no grupo de pais adotantes como no Foro de Infâncias Rosário nos primeiros anos do Sistema de Proteção de Direitos no Estado. Assim, o cuidado torna se hoje uma categoria privilegiada a fim de objetivar os diferentes argumentos sobre as responsabilidades sociais e da família em relação à minoria de idade nos processo administrativos e judiciários. O estudo nota seu ponto de condensação na transformação normativa do ano 2011. Palavras-chave: Infância; Políticas; Proteção; Direitos; Cuidado *** Resumen: Las adecuaciones normativas de los países a la Convención Internacional sobre los Derechos del Niño (1989 fueron suscitando interrogantes, controversias y ensayos entre los actores sociales, políticos y judiciales sobre cómo tornar consistentes las transformaciones propuestas. El artículo tiene como objeto exponer las racionalidades, tensiones y disputas entre los actores del campo de la infancia sobre las medidas excepcionales establecidas por la ley de protección de derechos de niñas, niños y adolescentes en la provincia de Santa Fe, Argentina (N°12.927/09. Dichas medidas consisten en el proceso burocrático a través del cual un infante es separado
Emerging Role of the Army Family Physician in Primary Health Care Delivery.
1976-12-13
ev.~ ~ ~ i Defe nse or any of its egeflC .eS. l~ iIs ~ ‘j~ Uii~ fi ~ 126;~~~; ~ t e tSh5 ~S~ t t~ )i O~. efl pub hiCati0 fl unt il it has been c)eafe...t, dedicated capable staff , talented residents, adequate resources , teaching depth, credibility with the resi- dents and the rest of the medical...CLASSIFICATION OF THIS PAOI(W&126;~; D126;~;a I&e.,.4) —.---. 126;~;~ support , dedicated capable staff, talented’res~dents, adequate resources, ‘ teaching depth
Obtención de una medida del consumo nacional de comidas.
Directory of Open Access Journals (Sweden)
Álvarez Martínez, Pedro
2004-01-01
Full Text Available En España el gasto de alimentos representa un alto porcentaje del total de presupuesto de los hogares. El presupuesto se reparte como sigue: carne (29%, frutas, legumbres, veduras y patatas (19%, productos lácteos, huevos y quesos (14%, pan y cereales (13%, pescado (13%, grasas y aceites (4%, otros alimentos (8%. El consumo de alimentos está afectado no solo por factores económicos sino también por hábitos, gustos, antecedentes culturales y forma de vida. Por tanto un importante un objetivo importante para los investigadores es medir la importancia relativa de estos factores, y cuales de ellos determinan la preferencia. Estas preferencias son diferentes para gente que viven en ciudades de distintas población. Este hecho es debido a diferentes antecedentes culturales, factores sociales, y cambios de sistemas de distribución. El objetivo de este trabajo es aplicar una nueva metodología que nos permita obtener una medida de las preferencias en el consumo de los alimentos conociendo solo la cantidad de dinero semanal que los hogares gastan en cada una de los alimentos, y detectar así posibles hábitos de consumo.
Directory of Open Access Journals (Sweden)
Priscilla de Nazaré Silva dos SANTOS
2015-10-01
Full Text Available Objetivo:Avaliar o gasto energético e as medidas antropométricas de mulheres durante o primeiro ano de uso do método contraceptivo de acetato de medroxiprogesterona de depósito.Métodos:Estudo prospectivo com grupo de comparação. Foram incluídas mulheres saudáveis, não obesas, nunca usuárias de acetato de medroxiprogesterona de depósito e sem antecedentes que pudessem contribuir para a variação do peso corporal; foram distribuídas em dois grupos, 28 usuárias de acetato de medroxiprogesterona e 24 usuárias de dispositivo intrauterino de cobre, pareadas por idade (±1 ano e índice de massa corporal (kg/m2. As variáveis estudadas foram sociodemográficas (idade, etnia, tabagismo, etilismo, atividade física, classe econômica e escolaridade, peso (kg, índice de massa corporal, gasto energético basal e total, medidas de circunferência de cintura e quadril (cm e relação cintura-quadril.Resultados:A idade das mulheres variou de 20-39 anos. As médias de idade/índice de massa corporal foram 29,6 (DP=±5,2 anos/23,9 (±3,6 kg/m2, no grupo de acetato de medroxiprogesterona de depósito, e de 28,6 (DP=±5,2 anos/ 24,5 (±2,7 kg/m2, no grupo de dispositivo intrauterino de cobre. Após análise de variância para medidas repetidas, as usuárias de acetato de medroxiprogesterona de depósito apresentaram ganho de 2,2 kg no peso corporal e de -0,2 kg no grupo do dispositivo intrauterino de cobre, sem diferença estatisticamente significativa entre eles. Não houve discrepância nas demais variáveis estudadas.Conclusão:Mulheres saudáveis e jovens não apresentaram mudança no peso, nas medidas e nos gastos energéticos durante o primeiro ano de uso do contraceptivo acetato de medroxiprogesterona. A orientação em relação aos hábitos saudáveis de vida e o monitoramento de medidas são importantes para o controle do peso corporal em usuárias de métodos contraceptivos.
Analise de risco e retorno: o índice “beta" como medida de risco sistemático
Directory of Open Access Journals (Sweden)
Luzia Maria Mazzeo
1988-08-01
Full Text Available This study shows the validity of the index "beta" as a measure of systematic risk in financial markets. It discusses the theoretical model of asset valuation and the close correlation between asset prices and their risk levels. O presente estudo mostra a validade do índice "beta" como medida de risco sistemático no mercado financeiro. Discute-se modelo teórico de avaliação de ativos -CAPM -e a estreita correlação existente entre os preços dos ativos e seus respectivos níveis de risco.
Genetic factors influencing ferritin levels in 14,126 blood donors
DEFF Research Database (Denmark)
Sørensen, Erik; Rigas, Andreas S; Thørner, Lise W
2015-01-01
BACKGROUND: Many biologic functions depend on sufficient iron levels, and iron deficiency is especially common among blood donors. Genetic variants associated with iron levels have been identified, but the impact of genetic variation on iron levels among blood donors remains unclear. STUDY DESIGN...... AND METHODS: The effect of six single-nucleotide polymorphisms (SNPs) on ferritin levels in 14,126 blood donors were investigated in four genes: in Human Hemochromatosis Protein gene (HFE; rs1800562 and rs179945); in Transmembrane Protease gene, Serine 6 (TMPRSS6-regulating hepcidin; rs855791); in BTB domain...... with iron deficiency in women. Results for all other genetic variants were insignificant. CONCLUSION: Genetic variants associated with hemochromatosis may protect donors against depleted iron stores. In addition, we showed that presence of the T-allele at rs855791 in TMPRSS6 was associated with lower iron...
MMAND •• ~:(.NTR(.I...ANI. 4~••MM IJNI.126;~;ATlf.NS
African Journals Online (AJOL)
modern armies, contained four specialised staff elements - personnel, intelligence, operations and supply (logistics).16 Other elements have ... between management and command as lying in ... these trends are taking place, and the demands.
Inmaculada García Sánchez; Bernardo Requena Sánchez
2011-01-01
En la actualidad, investigadores y entrenadores utilizan la repetición máxima (1RM) en el ejercicio de sentadilla como la medida más identificativa y representativa de la máxima fuerza muscular en el movimiento de extensión de cadera y rodilla. El presente trabajo de revisión tiene el propósito de describir los procedimientos utilizados en investigación para evaluar la 1RM en el ejercicio de sentadilla y analizar los factores determinantes de su rendimiento. Con muestras de sujetos entrenados...
U.S. EPA, Pesticide Product Label, CUTLASS AQUEOUS FLOWABLE BIOINSECTICIDE, 04/21/1994
2011-04-21
... _ of P .. tlclde Product ... West Langhorne, PA 19047-1810 • ·126;~;'ti;g" •.. 1a~1";¥tfU1119 111 .• w.taiocoI.#~Mt~;,IiYi!k!;i,!126;~;. Vi126;~;~l.fi~H~:126;~; ; ...
Corach, Irene; Di Tella, Yago
2009-01-01
Nuestro país no cuenta con estadísticas (oficiales o no oficiales) sobre la aplicación de medidas alternativas a la privación de libertad y tampoco con estudios cualitativos que den cuenta de su eficacia y eficiencia. Es en este sentido que nuestro Proyecto se propone en sus objetivos generales generar un mapa de la situación de las medidas alternativas en Ciudad Autónoma de Buenos Aires y Provincia de Buenos Aires, en términos estadísticos La investigación se propone establecer por primera v...
Directory of Open Access Journals (Sweden)
Diana María López Celis
2010-01-01
Full Text Available El propósito de la investigación es determinar las relaciones existentes entre los niveles de Target Rating Point (TRP´S entendidos como el índice acumulado de rating de Televisión mensual frente a los niveles de notoriedad (conocimiento de marca y publicitario, preferencia (favoritismo y comportamiento (compra y próxima compra, a fin de identificar las principales tendencias derivadas de dichas asociaciones en una categoría de consumo masivo. Para esto, se tomaron los niveles de TRP´S en Televisión, como variable predictora central, así como las medidas de notoriedad de marca (top of mind, espontánea y ayudada, las medidas de notoriedad publicitaria (top of mind, espontánea y ayudada, las medidas de preferencia (marca favorita y las variables de compra (marca comprada en el último mes y próxima marca a comprar clasificadas en el conjunto de las variables criterio. El diseño de este estudio es de corte longitudinal de tendencia con K muestras, la muestra general del estudio comprende un conjunto de 4.104 registros agregados derivados de la replicación de 58 muestras mensuales de 500 participantes de ambos géneros con edades entre los 12 y 60 años pertenecientes a los estratos 2 al 6 dentro del período comprendido entre enero de 2004 y octubre de 2008. Los principales hallazgos resaltan el establecimiento de asociaciones estadísticamente significativas entre los niveles de TRP'S (bajo-medio y alto y el comportamiento diferencial de cada una de las 3 marcas evaluadas dentro de la categoría en relación con sus niveles de notoriedad, preferencia y compra.
1987-01-01
4.S Wa O-a a Řa a ~ ~ ~ ~ ~ ~ ~ C OOL)a-aa-a a - .. aC -c- a a Ma a d aC - A. a -L 5 a aC 5>a C 5.,126;~;c acca aS o a a 41 C) a CaI a~ 126;~;~ Z a . 4 a0...O 000C> 0 r029 m~ 1 00 ’r C 0 000 U1(I co - - Ln (D -0 0 OD 0 01 IDClICC 0000 fn (nI). ( J0C0 toI -n 10 OD~I o 1c 0 1 0126;~~~; o I0 t - - OMOOl Mmm on p7
Directory of Open Access Journals (Sweden)
Antonio García Pino
2004-12-01
Full Text Available This work deals about measurement procedures of non-ionizing radiations and their recorded levels in practice. The analyzed radiation sources cover the most common broadcasting media such as AM and FM transmissions and the GSM mobile telephony base stations. These sources currently radiate locations with high density of population. Spanish radiation level regulations are briefly described and some possible improvements are pointed out. The measurement results are discussed.Este trabajo trata sobre los procedimientos de medida de las radiaciones no ionizantes y sus niveles registrados en medidas reales. Las fuentes de radiación analizadas cubren los medios de radiodifusión más corrientes, tales como las transmisiones AM y FM y también las estaciones base de telefonía móvil GSM. Estas fuentes habitualmente radian sobre áreas con alta densidad de población. Se describe brevemente el marco legal que regula los niveles de radiación en España y se señalan algunas posibles mejoras. Se valorarán los resultados encontrados en las medidas.
On the Dynamics of Space Plasma
1992-09-01
emisions . kii dluctutions (i tne. Coiteidet witho the hirTntg ot tesw~n in126;~~~~~~~~~~~;~ps otcleisinatiutdtpatcepeittion Julavn dayche of2 1 iheerye9tr83.r...sraefled plasma by a supersonic body plasma diagnostic techniques. Hr holds membership in Tau Beta P’i. A VS. on the basils of the Poilaoun-Vlaaov
Adaptive Robust Estimation of Location and Scale Parameters of Symmetric Populations.
1978-09-01
8513 .9111 .8785 (d)(3) .7311 .8255 .9325 .8868 .7116 .8222 .8934 . 8583 (e) . 6481 .7649 .9269 .8557 .6204 . 7 6 1 0 .8902 . 8 2 7 2 16 (a)(1...F T F? r ~TT126;~;~TF (PHA5E I ~3 ) IF P I U L M 126;~;~ 1S K’.U126;~; SAMP LE S1ZE,N PO126;~;UL~ 1I3~ ‘1SF (p ) MSE ( a) fr’SF(Fa ) ISO ( ~ ) 2 4 L I 0 . 0 0 0
Directory of Open Access Journals (Sweden)
Bernardo Van Raij
1989-01-01
Full Text Available Em laboratórios de rotina de fertilidade do solo, a medida de quantidade de terra para análise é feita em volume, mediante utensílios chamados "cachimbos", que permitem medir volumes de terra. Admite-se que essas medidas reflitam a quantidade de terra existente em volume de solo similar em condições de campo. Essa hipótese foi avaliada neste trabalho, por doze amostras dos horizontes A e B de seis perfis de solos. A densidade em condições de campo foi avaliada por anel volumétrico e, no laboratório, por meio de cachimbos de diversos tamanhos. A cachimbagem revelou-se bastante precisa. Os valores de densidade global calculada variaram de 0,63 a 1,46g/cm³ para medidas de campo e de 0,91 a 1,33g/cm³ para medidas com cachimbos. Portanto, a medida de laboratório subestimou valores altos de densidade e deu resultados mais elevados para valores de campo mais baixos.In soil testing laboratories, soil samples for chemical analysis are usually measured by volume, using appropriate measuring spoons. It is tacitly assumed that such measurements would reflect amounts of soil existing in the same volume under field conditions. This hypothesis was tested, using 12 soil samples of the A and B horizons of six soil profiles. Bulk density in the field was evaluated through a cylindrical metal sampler of 50cm³ and in the laboratory using spoons of different sizes. Measurements of soil volumes by spoons were quite precise. Values of bulk density varied between 0.63 and 1.46g/cm³ for field measurements and between 0.91 and 1.33g/cm³ for laboratory measurements with spoons. Thus, laboratory measurements overestimated lower values of bulk densities and underestimated the higher ones.
1979-06-01
inadequate ly ref lects ind iv idua l d i f f e rences in values inaccurately implies that met expectat ions can com pensate for deficiencies in the...investigation of this issue is beyond the scope of this thesis. Rowever , the results provided her e show that sufficient deficiencies exist in the...Industria~ Classification Nan126;~~~;. US Childrens’s Bureau. 1960, 1963, 1964, 1965. ~tatj l126;~;~ 22 126;~~~;~ 126;~~~~~;~. tk2 126;~; 126;~;~ 126;~~~~~; 126;~~~~~~~; 1 91k ii~2.L i126;~; .Lt
DEFF Research Database (Denmark)
Cerda-Cuellar, M.; Laureano, L.; Corujo, A.
Actualmente, la implementación y mejora de las medidas de bioseguridad en granjas de broilers a nivel de nave es la una de las principales herramientas disponibles para el control de Campylobacter en el primer eslabón de la cadena alimentaria. Una de las principales actuaciones a acometer implica...
Víctor Soto; Enrique Olano
2004-01-01
Objetivo: Determinar el nivel de conocimientos y cumplimiento de las medidas de bioseguridad del personal profesional y técnico de enfermería que labora en áreas de alto riesgo. Material y Métodos: Estudio transversal, descriptivo, siendo la población el personal profesional y técnico de enfermería que laboraba en Emergencia, Unidad de Cuidados Intensivos (UCI), Unidad de Cuidados Intermedios (UCEMIN), Cirugía General, Centro Quirúrgico, Neonatología y Hemodiálisis del Hospital Nacional Alman...
Sepahi, Neda; Kohan, Leila; Jahromi, Athar Rasekh; Daneshbod, Yahya; Hoveidi, Elahe Nimi
2017-06-01
microRNAs (miRNAs) are negative regulators in a variety of cellular processes that occur in endometriosis. Therefore, functional polymorphisms in miRNA and miRNA binding sites may affect gene expression and contribute to susceptibility of endometriosis. In this study, we evaluated the association of two miRNA related polymorphisms, mir-126 rs4636297 and TGFβRI rs334348, with endometriosis risk and its severity. This case-control study was done on 157 endometriosis patients and 252 healthy women as a control group. Tetra amplification refractory mutation system-polymerase chain reaction (tetra-ARMS PCR) was designed to determine the polymorphisms. Our finding showed significant differences in genotype frequency of mir-126 rs4636297 between the groups (χ 2 = 6.26, p = 0.044). A significant protection against endometriosis was found for mir-126 rs4636297 in allele (G versus A allele: OR = 0.695, 95% CI = 0.519-0.931, p = 0.015) and genotype (GG versus AA genotype: OR = 0.451, 95%CI = 0.233-0.873, p = 0.018). Significant association was also observed between the A allele and severity of endometriosis (OR = 0.478, 95%CI = 0.297-0.768, p = 0.002). Moreover, we found a significant association between AA genotype with the risk of endometriosis (OR = 0.493, 95%CI = 0.250-0.970, p = 0.041) and its severity (OR = 0.240, 95%CI = 0.065-0.883, p = 0.032) regarding TGFβRI rs334348 polymorphism. These finding suggest that, for the first time, mir-126 rs4636297 and TGFβRI rs334348 polymorphisms may influence individual's susceptibility to endometriosis and its severity.
Dollar Summary of Federal Supply Classification and Service Category by Company. Part 2 (B502-J066)
1990-01-01
U 0 V ) V ( w126;~~~; ae a11 - 4 W 4 0126;~~~; a a4 " A 0 1> z126;~~~; a. a0 4 0 4 1 4 ,0 4 - 4a%- %. 0 4a4 t4 i acca Lu awHIu 0a 0 0 0 Iw awa In InI I IK t0 n 4...6. 1 4. P7 4 % -. I-J x >- .4.-H %- t- 10 *- C 4 c 6. 01 C 4 .4 &i >, L. *.4 9U 10 0. l4. .- H C 0 3’ 0 c .4 X -4.4 ); Al 31 1. 0. 40V-4 3. Il- I... acca o - z ow zi1- crw z aa 0 0 w w-U 1-00 0 .Z 0 0 <~ ~0 0 : ac 0 ow 0w xD 0 0 1-w 0. < z :I- 0~ OcOZ0 0- H z< U n Z>- ao1 w 0 WI H Z 0 0 0 00-0 al
Directory of Open Access Journals (Sweden)
F. de la Torre Silva
2008-01-01
Full Text Available Este trabajo muestra el estudio realizado en turbinas de vapor de pequeña capacidad de generación de las centralestermoeléctricas cubanas, relacionadas con la influencia estadística entre parámetros de proceso de la turbina, respecto alparámetro vibración absoluta, medidos en las chumaceras de la turbina. Se utilizan las bases de datos de los sistemas demonitoreado on-line de la turbina. Se exponen las relaciones existentes entre los principales parámetros seleccionados paraeste estudio.Palabras claves: Monitorado on-line, Monitorado de la condición, Parámetros de proceso, Vibraciónabsoluta, Turbinas de vapor.______________________________________________________________________________AbstractThis work show the estudy in small steam turbine capacity of generation in cubans thermoelectric power station to relative withstatistical influence between steam process parameters regarding absolute vibration parameter, in the steam housing measurements.Themselves use database as steam on-line monitoring systems. Expose the existing relation between the principal selection parametersfor this study.Key Words: On.line monitoring, Condition monitoring, Process parameters, Absolute vibration, SteamTurbine.
I-124 and its applications in nuclear medicine and biology
International Nuclear Information System (INIS)
Weinreich, R.; Wyer, L.; Crompton, N.; Nievergelt-Egido, M.C.; Guenther, I.; Roelcke, U.; Leenders, K.L.; Knust, E.J.; Blasberg, R.G.
1998-01-01
4.15-d 124 I decays simultaneously by positron emission (25.6 %) and by electron capture (74.4 %). This dualistic decay allows in principle to use 124 I in both diagnostic and therapeutic approaches. In some high-current measurements, 124 I was produced via the nuclear reaction 124 Te(p,n) 124 I using 12.6 MeV protons in yields 25% below those of the mainly used reaction 124 Te(d,2n) 124 I, but with a very much lower contamination by long-lived 125 I and 126 I. The minimum obtained value for the sum of all impurities was 0.14% of the 124 I activity, at 6 days after end of bombardment, using 99.8% enriched 124 TeO 2 as target material. This yield/purity ratio also permits the production of 124 I by low-energy ''baby'' cyclotrons which could considerably increase the general availability of this nuclide. [ 124 ]IUdR was synthesized by direct electrophilic labelling in good yield (45-65 %), high radiochemical purity (>95%) and high specific activity for functional PET imaging of brain tumours. One day after administration to patients and after completion of the ''washout'', the only remaining activity was that in tumour structures. The comparison with the tumour labelling index showed that PET with [ 124 ]IUdR introduces a novel imaging approach: tumour diagnostics by the measurement of cell proliferation. [ 124 ]IodoHoechst 33258 was synthesized by direct electrophilic labelling in yields of 70 % and in a radiochemical purity of 99 %. In cell culture experiments using HTB-40 (human adenocarcinoma line), it was shown to be taken up by the DNA as well as the unlabelled fluorescence dye H 33258. Furthermore, its radiobiological activity was equal to that of the 125 I-labelled H 33258, but markedly stronger than that of the 131 I-labelled derivative. This suggests a mechanism for Auger-electron induced radiobiological activity as a novel therapeutical approach. p-[ 124 ]Iodophenylalanine and [ 124 ]iodo-α-methyltyrosine are two other compounds labelled with 124 I that
Energy Technology Data Exchange (ETDEWEB)
Silva, Ronaldo Lins da; Delgado, Jose Ubiratan; Araujo, Miriam Taina Ferreira de; Laranjeira, Adilson da Silva; Poledna, Roberto; Veras, Eduardo de; Almeida, Maria Candida M. [Instituto de Radioprotecao e Dosimetria, (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil); Braghirolli, Ana Maria S. [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil)
2014-07-01
{sup 124}I, positron emitter is produced in the IEN/CNEN-RJ and used in diagnosis image of tumors. In this radioisotope production process impurities appear and health agency requires that the level of these characteristics is quantified. These radionuclides emit gamma and X-radiation, allowing the identification and quantitation by gamma spectrometry. With the use of HPGE detector, coupled with the efficiency curve, was identified {sup 125}I and {sup 126}I. The impurity levels measured in the sample were in the range of 0.5% to 90%, respectively, indicating the feasibility of the method for controlling the quality of the radiopharmaceutical.
2013-05-07
A.Jat_ __ Macaroni and cheese ,,_ ________ ____ I126;~; o __ .... £:,-__ ---~- _ ~fl:... .. __ ’:__j .,. ~-~-~ Chicken , induding nuggets, wings, I >;:Q...1 A~- - Some----~ : Po~:_ l126;~;~ 126;~;· roast , ribs I!·~· · __ C: .. _ ·>~ __ C:_ t,~ ... _ o ___ ~ ... ~- o o •Popcorn ·:<’’.b ’ o .:’Q o ·:l
You, Chaoqun; Wu, Hongshuai; Wang, Mingxin; Gao, Zhiguo; Zhang, Xiangyang; Sun, Baiwang
2018-01-01
Polymeric biomaterials that can be smartly disassembled through the cleavage of the covalent bonds in a controllable way upon an environmental stimulus such as pH change, redox, special enzymes, temperature, or ultrasound, as well as light irradiation, but are otherwise stable under normal physiological conditions have attracted great attention in recent decades. The 2-(4-aminophenyl) benzothiazole molecule (CJM-126), as one of the benzothiazole derivatives, has exhibited a synergistic effect with cisplatin (CDDP) and restrains the bioactivities of a series of human breast cancer cell lines. In our study, novel NIR-responsive targeted binary-drug-loaded nanoparticles encapsulating indocyanine green (ICG) dye were prepared as a new co-delivery and combined therapeutic vehicle. The prepared drug-loaded polymeric nanoparticles (TNPs/CDDP-ICG) are stable under normal physiological conditions, while burst drugs release upon NIR laser irradiation in a mild acidic environment. The results further confirmed that the designed co-delivery platform showed higher cytotoxicity than the single free CDDP due to the synergistic treatment of CJM-126 and CDDP in vitro. Taken together, the work might provide a promising approach for effective site-specific antitumor therapy.
Directory of Open Access Journals (Sweden)
Antonio García Correa
2001-01-01
Full Text Available Uno de los temas y fenómenos educativos que más preocupa a la política educativa de varios paísesoccidentales es la violencia, agresión y maltrato físico y psíquico que se producen en los centros escolares.Basta ver como cada día se investiga, publica y escribe más sobre este hecho.Tenemos que reconocer que los profesores e investigadores y la misma política educativa ha esta-do más preocupada por el rendimiento académico, fracaso escolar, que por la violencia escolar. Pero nosestamos dando cuenta que cada día hay menos analfabetos académicos pero más analfabetos emocionales,sociales y sentimentales.El autor nos ofrece en este trabajo un recorrido breve de la violencia escolar y medidas políticastomadas en países occidentales y los resultados obtenidos con estas medidas.
Directory of Open Access Journals (Sweden)
Lulu Ning
Full Text Available The fragment 106-126 of prion protein exhibits similar properties to full-length prion. Experiments have shown that the A117V mutation enhances the aggregation of PrP106-126, while the H111S mutation abolishes the assembly. However, the mechanism of the change in the aggregation behavior of PrP106-126 upon the two mutations is not fully understood. In this study, replica exchange molecular dynamics simulations were performed to investigate the conformational ensemble of the WT PrP106-126 and its two mutants A117V and H111S. The obtained results indicate that the three species are all intrinsically disordered but they have distinct morphological differences. The A117V mutant has a higher propensity to form β-hairpin structures than the WT, while the H111S mutant has a higher population of helical structures. Furthermore, the A117V mutation increases the hydrophobic solvent accessible surface areas of PrP106-126 and the H111S mutation reduces the exposure of hydrophobic residues. It can be concluded that the difference in populations of β-hairpin structures and the change of hydrophobic solvent accessible areas may induce the different aggregation behaviors of the A117V and the H111S mutated PrP106-126. Understanding why the two mutations have contrary effects on the aggregation of PrP106-126 is very meaningful for further elucidation of the mechanism underlying aggregation and design of inhibitor against aggregation process.
PedonnanceofE3rly MatUring MutantS Derived from ''SuPa'~ Rice ...
African Journals Online (AJOL)
T~a, the second largest rice producer after . and' KanyeIci, (1978), Kihupi and Pillai (i 989). Malagasy .(IRRI, 1994) ... 1986),:' - catio,~; lit p126;~;~ti~g"tilletingaI!d 126;~;ni126;~;ei.ni126;~;.;l,. :-.-. ...... Cooking-qualitY Gravois" KA, and¥~New:R.W.:1993.
Directory of Open Access Journals (Sweden)
Neiva de Alencar Salmeron
2012-01-01
Full Text Available OBJETIVOS: Identificar o perfil socioepidemiológico de profissionais do sexo e estabelecer medidas de redução de danos. MÉTODOS: Estudo descritivo, exploratório; realizado com 50 profissionais do sexo de cinco casas noturnas de São Paulo, com uso de um questionário. Os dados foram apresentados em forma de figuras e tabelas. Durante a coleta de dados, foram adotadas medidas de redução de danos. RESULTADOS: Os resultados mostraram que a idade variou entre 21 e 41 anos, que os sujeitos recebem entre R$ 1001,00 e R$ 3000,00. Quanto aos antecedentes pessoais, 28% provocaram, pelo menos um aborto, e fazem, em média, 15 programas semanais; observou-se que 68% utilizavam algum tipo de droga e 86% já usaram pílula do dia seguinte. CONCLUSÕES: A mudança de comportamento pode ser influenciada pelo meio, da informação, mas não é suficiente para mudar suas atitudes. É necessário que estas mulheres tenham perspectivas de melhoria de vida, valorizando e respeitando a individualidade.OBJETIVOS: Identificar el perfil socioepidemiológico de profesionales del sexo y establecer medidas de reducción de daños. MÉTODOS: Se trata de un estudio descriptivo, exploratorio realizado con 50 profesionales del sexo de cinco casas nocturnas de Sao Paulo, a quienes se les aplicó un cuestionario. Los datos fueron presentados en forma de figuras y tablas. Durante la recolección de datos, se adoptaron medidas de reducción de daños. RESULTADOS: Los resultados mostraron que la edad varió entre 21 y 41 años, que los sujetos reciben entre R$ 1001,00 y R$ 3000,00. En cuanto a los antecedentes personales, el 28% se provocaron por lo menos un aborto, y hacen, en promedio, 15 programas semanales; se observó que el 68% utilizaba algún tipo de droga y el 86% ya usaron la píldora del dia siguiente. CONCLUSIONES: El cambio de comportamiento puede ser influenciado por el medio, la información, mas no es suficiente para cambiar sus actitudes. Es necesario que
Remaining Sites Verification Package for the 126-B-2, 183-B Clearwells
International Nuclear Information System (INIS)
Dittmer, L.M.
2007-01-01
The 126-B-2, 183-B Clearwells were built as part of the 183-B Water Treatment Facility and are composed of 2 covered concrete reservoirs. The bulk of the water stored in the clearwells was used as process water to cool the 105-B Reactor and as a source of potable water. Residual conditions were determined to meet the remedial action objectives specified in the Remaining Sites ROD through an evaluation of the available process knowledge. The results of the evaluation do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also indicate that residual concentrations are protective of groundwater and the Columbia River.
Directory of Open Access Journals (Sweden)
Gustavo Silva Souto Rocha
2015-07-01
Full Text Available Trata-se de estudo de corte transversal, realizado mediante a aplicação de questionário em uma amostra aleatória e representativa de 489 agentes comunitários de saúde (ACS a respeito da tuberculose (TB, suas medidas de controle e o tratamento diretamente observado (TDO, em Belo Horizonte, Minas Gerais, Brasil. A proporção média de itens acertados foi de 74,6%. A proporção média de acertos no domínio TB foi 81%; no domínio medidas de controle, 84,1%; e sobre TDO, 59,4%. Verificou-se uma lacuna no conhecimento sobre a identificação de pacientes com TB pulmonar, o público-alvo do TDO, e a técnica adequada para supervisão do tratamento. Foi observada associação entre maior conhecimento e tempo de atuação igual ou superior a três anos (RC = 2,3 e acompanhamento de casos nos 12 meses anteriores à entrevista (RC = 1,7. Este trabalho apresentou informações inéditas na literatura científica sobre o nível de conhecimento dos ACS sobre TDO, e poderá subsidiar estratégias destinadas ao aperfeiçoamento das atividades de controle da tuberculose.
Propuesta de medida del desempeño innovador: aplicación en las empresas innovadoras españolas
Arévalo Tomé, Raquel; Urgal, Begoña; Quintás, María A.
2013-01-01
En este artículo se aporta una medida del grado de desempeño innovador de la empresa. Este indicador resume los efectos de las actividades de innovación tecnológica en los productos, en los procesos y en la sostenibilidad de la empresa. Los datos proceden de las empresas españolas, representadas en el Panel de Innovación Tecnológica (PITEC) del 2006, que han desarrollado actividades de innovación tecnológica en el período 2004-2006. Además, se realiza una caracterización de las empresas innov...
Nivel de conocimiento y aplicación de las medidas de bioseguridad del personal de enfermería
Luz Marina Bautista-Rodríguez; Carmen Celene Delgado-Madrid; Zulma Fabiola Hernández-Zárate; Fanny Edith Sanguino-Jaramillo; Martha Liliana Cuevas-Santamaría; Yessenia Tatiana Arias-Contreras; Isabel Carolina Mojica-Torres
2013-01-01
Objetivo. Identificar el nivel de conocimiento y aplicación de las medidas de bioseguridad que tiene el personal de Enfermería. Materiales y Métodos. Se realizó investigación cuantitativa, de tipo descriptivo transversal, con una muestra de 96 personas pertenecientes. La información se recolectó a través de una encuesta y una lista de chequeo, la cual se analizó por medio de tabulaciones y representaciones gráficas. Resultados. El personal de Enfermería de la Clínica San José tiene un conoc...