WorldWideScience

Sample records for hypothetical station blackout

  1. Delayed Station Blackout Event and Nuclear Safety

    Directory of Open Access Journals (Sweden)

    Andrija Volkanovski

    2015-01-01

    Full Text Available The loss of off-site power (LOOP event occurs when all electrical power to the nuclear power plant from the power grid is lost. Complete failure of both off-site and on-site alternating current (AC power sources is referred to as a station blackout (SBO. Combined LOOP and SBO events are analyzed in this paper. The analysis is done for different time delays between the LOOP and SBO events. Deterministic safety analysis is utilized for the assessment of the plant parameters for different time delays of the SBO event. Obtained plant parameters are used for the assessment of the probabilities of the functional events in the SBO event tree. The results show that the time delay of the SBO after the LOOP leads to a decrease of the core damage frequency (CDF from the SBO event tree. The reduction of the CDF depends on the time delay of the SBO after the LOOP event. The results show the importance of the safety systems to operate after the plant shutdown when the decay heat is large. Small changes of the basic events importance measures are identified with the introduction of the delay of the SBO event.

  2. ANALYSIS OF A STATION BLACKOUT SCENARIO WITH AN ATLAS TEST

    Directory of Open Access Journals (Sweden)

    YEON-SIK KIM

    2013-04-01

    Full Text Available A station blackout experiment called SBO-01 was performed at the ATLAS facility. From the SBO-01 test, the station blackout scenario can be characterized into two typical phases: A first phase characterized by decay heat removal through secondary safety valves until the SG dryouts, and a second phase characterized by an energy release through a blowdown of the primary system after the SG dryouts. During the second phase, some physical phenomena of the change over a pressurizer function, i.e., the pressurizer being full before the POSRV 1st opening and then its function being taken by the RV, and the termination of normal natural circulation flow were identified. Finally, a core heatup occurred at a low core water level, although under a significant amount of PZR inventory, whose drainage seemed to be hindered owing to the pressurizer function by the RV. The transient of SBO-01 is well reproduced in the calculation using the MARS code.

  3. A Passive System Reliability Analysis for a Station Blackout

    Energy Technology Data Exchange (ETDEWEB)

    Brunett, Acacia; Bucknor, Matthew; Grabaskas, David; Sofu, Tanju; Grelle, Austin

    2015-05-03

    The latest iterations of advanced reactor designs have included increased reliance on passive safety systems to maintain plant integrity during unplanned sequences. While these systems are advantageous in reducing the reliance on human intervention and availability of power, the phenomenological foundations on which these systems are built require a novel approach to a reliability assessment. Passive systems possess the unique ability to fail functionally without failing physically, a result of their explicit dependency on existing boundary conditions that drive their operating mode and capacity. Argonne National Laboratory is performing ongoing analyses that demonstrate various methodologies for the characterization of passive system reliability within a probabilistic framework. Two reliability analysis techniques are utilized in this work. The first approach, the Reliability Method for Passive Systems, provides a mechanistic technique employing deterministic models and conventional static event trees. The second approach, a simulation-based technique, utilizes discrete dynamic event trees to treat time- dependent phenomena during scenario evolution. For this demonstration analysis, both reliability assessment techniques are used to analyze an extended station blackout in a pool-type sodium fast reactor (SFR) coupled with a reactor cavity cooling system (RCCS). This work demonstrates the entire process of a passive system reliability analysis, including identification of important parameters and failure metrics, treatment of uncertainties and analysis of results.

  4. Extended station blackout analyses of an APR1400 with MARS-KS

    Directory of Open Access Journals (Sweden)

    Kim Woongbae

    2016-01-01

    Full Text Available The Fukushima Daiichi nuclear power plant accident shows that natural disasters such as earthquakes and the subsequent tsunamis can cause station blackout for several days. The electric energy required for essential systems during a station blackout is provided from emergency backup batteries installed at the nuclear power plant. In South Korea, in the event of an extended station blackout, the life of these emergency backup batteries has recently been extended from 8 hours to 24 hours at Shin-Kori 5, 6, and APR1400 for design certification. For a battery life of 24 hours, available safety means system, equipment and procedures are studied and analyzed in their ability to cope with an extended station blackout. A sensitivity study of reactor coolant pump seal leakage is performed to verify how different seal leakages could affect the system. For simulating extended station blackout scenarios, the best estimate MARS-KS computer code was used. In this paper, an APR1400 RELAP5 input deck was developed for station blackout scenario to analyze operation strategy by manually depressurizing the reactor coolant system through the steam generator's secondary side. Additionally, a sensitivity study on reactor coolant pump seal leakage was carried out.

  5. Extended Station Blackout Analyses of an APR1400 with MARS-KS

    Energy Technology Data Exchange (ETDEWEB)

    Kim, WoongBae; Jang, HyungWook; Oh, Seungjong; Lee, Sangyong [KEPCO International Nuclear Graduate School, Ulsan (Korea, Republic of)

    2016-10-15

    The Fukushima Dai-ichi nuclear power plant accident shows that natural disasters such as earthquakes and the subsequent tsunamis can cause station blackout for several days. The electricity required for essential systems during a station blackout is provided from the emergency backup batteries installed at the nuclear power plant. In South Korea, in the event of an extended station blackout, the life of these emergency backup batteries has recently been extended from 8 hours to 24 hours at Shin-Kori 5, 6 and APR1400 for design certification. For a battery life of 24 hours, available safety means system, equipment and procedures are studied and analyzed in their ability to cope with an extended station blackout. A sensitivity study of reactor coolant pump seal leakage is performed to verify how different seal leakages could affect the system. For simulating of extended station blackout scenarios, the best estimate MARS-KS was used. In this paper, an APR1400 RELAP5 input deck was developed for station blackout scenario to analyze operation strategy by manually depressurizing the reactor coolant system through the steam generator's secondary side. Additionally, a sensitivity study was performed on reactor coolant pump seal leakage.

  6. Light Water Reactor Sustainability Program: Analysis of Pressurized Water Reactor Station Blackout Caused by External Flooding Using the RISMC Toolkit

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Curtis [Idaho National Lab. (INL), Idaho Falls, ID (United States); Mandelli, Diego [Idaho National Lab. (INL), Idaho Falls, ID (United States); Prescott, Steven [Idaho National Lab. (INL), Idaho Falls, ID (United States); Alfonsi, Andrea [Idaho National Lab. (INL), Idaho Falls, ID (United States); Rabiti, Cristian [Idaho National Lab. (INL), Idaho Falls, ID (United States); Cogliati, Joshua [Idaho National Lab. (INL), Idaho Falls, ID (United States); Kinoshita, Robert [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2014-08-01

    The existing fleet of nuclear power plants is in the process of extending its lifetime and increasing the power generated from these plants via power uprates. In order to evaluate the impact of these factors on the safety of the plant, the Risk Informed Safety Margin Characterization (RISMC) project aims to provide insight to decision makers through a series of simulations of the plant dynamics for different initial conditions (e.g., probabilistic analysis and uncertainty quantification). This report focuses, in particular, on the application of a RISMC detailed demonstration case study for an emergent issue using the RAVEN and RELAP-7 tools. This case study looks at the impact of a couple of challenges to a hypothetical pressurized water reactor, including: (1) a power uprate, (2) a potential loss of off-site power followed by the possible loss of all diesel generators (i.e., a station black-out event), (3) and earthquake induces station-blackout, and (4) a potential earthquake induced tsunami flood. The analysis is performed by using a set of codes: a thermal-hydraulic code (RELAP-7), a flooding simulation tool (NEUTRINO) and a stochastic analysis tool (RAVEN) – these are currently under development at the Idaho National Laboratory.

  7. The AP1000{sup R} nuclear power plant innovative features for extended station blackout mitigation

    Energy Technology Data Exchange (ETDEWEB)

    Vereb, F.; Winters, J.; Schulz, T.; Cummins, E.; Oriani, L. [Westinghouse Electric Company LLC, 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States)

    2012-07-01

    Station Blackout (SBO) is defined as 'a condition wherein a nuclear power plant sustains a loss of all offsite electric power system concurrent with turbine trip and unavailability of all onsite emergency alternating current (AC) power system. Station blackout does not include the loss of available AC power to buses fed by station batteries through inverters or by alternate AC sources as defined in this section, nor does it assume a concurrent single failure or design basis accident...' in accordance with Reference 1. In this paper, the innovative features of the AP1000 plant design are described with their operation in the scenario of an extended station blackout event. General operation of the passive safety systems are described as well as the unique features which allow the AP1000 plant to cope for at least 7 days during station blackout. Points of emphasis will include: - Passive safety system operation during SBO - 'Fail-safe' nature of key passive safety system valves; automatically places the valve in a conservatively safe alignment even in case of multiple failures in all power supply systems, including normal AC and battery backup - Passive Spent Fuel Pool cooling and makeup water supply during SBO - Robustness of AP1000 plant due to the location of key systems, structures and components required for Safe Shutdown - Diverse means of supplying makeup water to the Passive Containment Cooling System (PCS) and the Spent Fuel Pool (SFP) through use of an engineered, safety-related piping interface and portable equipment, as well as with permanently installed onsite ancillary equipment. (authors)

  8. SOARCA Peach Bottom Atomic Power Station Long-Term Station Blackout Uncertainty Analysis: Knowledge Advancement.

    Energy Technology Data Exchange (ETDEWEB)

    Gauntt, Randall O.; Mattie, Patrick D.; Bixler, Nathan E.; Ross, Kyle W.; Cardoni, Jeffrey N; Kalinich, Donald A.; Osborn, Douglas.; Sallaberry, Cedric Jean-Marie; Ghosh, S. Tina

    2014-02-01

    This paper describes the knowledge advancements from the uncertainty analysis for the State-of- the-Art Reactor Consequence Analyses (SOARCA) unmitigated long-term station blackout accident scenario at the Peach Bottom Atomic Power Station. This work assessed key MELCOR and MELCOR Accident Consequence Code System, Version 2 (MACCS2) modeling uncertainties in an integrated fashion to quantify the relative importance of each uncertain input on potential accident progression, radiological releases, and off-site consequences. This quantitative uncertainty analysis provides measures of the effects on consequences, of each of the selected uncertain parameters both individually and in interaction with other parameters. The results measure the model response (e.g., variance in the output) to uncertainty in the selected input. Investigation into the important uncertain parameters in turn yields insights into important phenomena for accident progression and off-site consequences. This uncertainty analysis confirmed the known importance of some parameters, such as failure rate of the Safety Relief Valve in accident progression modeling and the dry deposition velocity in off-site consequence modeling. The analysis also revealed some new insights, such as dependent effect of cesium chemical form for different accident progressions. (auth)

  9. Investigation of station blackout scenario in VVER440/v230 with RELAP5 computer code

    Energy Technology Data Exchange (ETDEWEB)

    Gencheva, Rositsa Veselinova, E-mail: roseh@mail.bg; Stefanova, Antoaneta Emilova, E-mail: antoanet@inrne.bas.bg; Groudev, Pavlin Petkov, E-mail: pavlinpg@inrne.bas.bg

    2015-12-15

    Highlights: • We have modeled SBO in VVER440. • RELAP5/MOD3 computer code has been used. • Base case calculation has been done. • Fail case calculation has been done. • Operator and alternative operator actions have been investigated. - Abstract: During the development of symptom-based emergency operating procedures (SB-EOPs) for VVER440/v230 units at Kozloduy Nuclear Power Plant (NPP) a number of analyses have been performed using the RELAP5/MOD3 (Carlson et al., 1990). Some of them investigate the response of VVER440/v230 during the station blackout (SBO). The main purpose of the analyses presented in this paper is to identify the behavior of important VVER440 parameters in case of total station blackout. The RELAP5/MOD3 has been used to simulate the SBO in VVER440 NPP model (Fletcher and Schultz, 1995). This model was developed at the Institute for Nuclear Research and Nuclear Energy, Bulgarian Academy of Sciences (INRNE-BAS), Sofia, for analyses of operational occurrences, abnormal events and design based scenarios. The model provides a significant analytical capability for specialists working in the field of NPP safety.

  10. Demonstration of fully coupled simplified extended station black-out accident simulation with RELAP-7

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Haihua [Idaho National Lab. (INL), Idaho Falls, ID (United States); Zhang, Hongbin [Idaho National Lab. (INL), Idaho Falls, ID (United States); Zou, Ling [Idaho National Lab. (INL), Idaho Falls, ID (United States); Anders, David [Idaho National Lab. (INL), Idaho Falls, ID (United States); Martineau, Richard [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2014-10-01

    The RELAP-7 code is the next generation nuclear reactor system safety analysis code being developed at the Idaho National Laboratory (INL). The RELAP-7 code develop-ment effort started in October of 2011 and by the end of the second development year, a number of physical components with simplified two phase flow capability have been de-veloped to support the simplified boiling water reactor (BWR) extended station blackout (SBO) analyses. The demonstration case includes the major components for the primary system of a BWR, as well as the safety system components for the safety relief valve (SRV), the reactor core isolation cooling (RCIC) system, and the wet well. Three scenar-ios for the SBO simulations have been considered. Since RELAP-7 is not a severe acci-dent analysis code, the simulation stops when fuel clad temperature reaches damage point. Scenario I represents an extreme station blackout accident without any external cooling and cooling water injection. The system pressure is controlled by automatically releasing steam through SRVs. Scenario II includes the RCIC system but without SRV. The RCIC system is fully coupled with the reactor primary system and all the major components are dynamically simulated. The third scenario includes both the RCIC system and the SRV to provide a more realistic simulation. This paper will describe the major models and dis-cuss the results for the three scenarios. The RELAP-7 simulations for the three simplified SBO scenarios show the importance of dynamically simulating the SRVs, the RCIC sys-tem, and the wet well system to the reactor safety during extended SBO accidents.

  11. Investigation of accident management procedures related to loss of feedwater and station blackout in PSB-VVER integral test facility

    Energy Technology Data Exchange (ETDEWEB)

    Bucalossi, A. [EC JRC, (JRC F.5) PO Box 2, 1755 ZG Petten (Netherlands); Del Nevo, A., E-mail: alessandro.delnevo@enea.it [ENEA, C.R. Brasimone, 40032 Camugnano (Italy); Moretti, F.; D' Auria, F. [GRNSPG, Universita di Pisa, via Diotisalvi 2, 56100 Pisa (Italy); Elkin, I.V.; Melikhov, O.I. [Electrogorsk Research and Engineering Centre, Electrogorsk, Moscow Region (Russian Federation)

    2012-09-15

    Highlights: Black-Right-Pointing-Pointer Four integral test facility experiments related to VVER-1000 reactor. Black-Right-Pointing-Pointer TH response of the VVER-1000 primary system following total loss of feedwater and station blackout scenarios. Black-Right-Pointing-Pointer Accident management procedures in case of total loss of feedwater and station blackout. Black-Right-Pointing-Pointer Experimental data represent an improvement of existing database for TH code validation. - Abstract: VVER 1000 reactors have some unique and specific features (e.g. large primary and secondary side fluid inventory, horizontal steam generators, core design) that require dedicated experimental and analytical analyses in order to assess the performance of safety systems and the effectiveness of possible accident management strategies. The European Commission funded project 'TACIS 2.03/97', Part A, provided valuable experimental data from the large-scale (1:300) PSB-VVER test facility, investigating accident management procedures in VVER-1000 reactor. A test matrix was developed at University of Pisa (responsible of the project) with the objective of obtaining the experimental data not covered by the OECD VVER validation matrix and with main focus on accident management procedures. Scenarios related to total loss of feed water and station blackout are investigated by means of four experiments accounting for different countermeasures, based on secondary cooling strategies and primary feed and bleed procedures. The transients are analyzed thoroughly focusing on the identification of phenomena that will challenge the code models during the simulations.

  12. The integrity of NSSS and containment during extended station blackout for Kuosheng BWR plant

    Energy Technology Data Exchange (ETDEWEB)

    Hsu, Keng-Hsien; Yuann, Yng-Ruey; Lin, Ansheng [Atomic Energy Council, Taoyuan City, Taiwan (China). Inst. of Nuclear Energy Research

    2017-11-15

    The Fukushima Daiichi accident occurring on March 11, 2011, reveals that Station Blackout (SBO) may last longer than 8 h. However, the original design may not have sufficient capacity to cope with a SBO for more than 8 h. In view of this, Taiwan Power Company has initiated several enhancements to mitigate the severity of the extended SBO. Based on the improved plant configuration, a SBO coping analysis is performed in this study to assess whether the Kuosheng BWR plant has sufficient capability to cope with SBO for 24 h with respect to maintaining the integrity of the reactor core and containment. The analyses in the Nuclear Steam Supply System (NSSS) and the containment are based on the RETRAN-3D and GOTHIC models, respectively. The flow conditions calculated by RETRAN-3D during the event are retrieved and input to the GOTHIC containment model to determine the containment pressure and temperature response. These boundary conditions include SRV flow rate, SRV flow enthalpy, and total reactor coolant system leakage flow rate.

  13. The Optimum Operation Strategy of Hybrid SIT with PAFS following a Station Blackout Accident

    Energy Technology Data Exchange (ETDEWEB)

    Heo, Sun; Ha, Hui-Un [Korea Hydro and Nuclear Power Co., Daejeon (Korea, Republic of)

    2014-10-15

    A coolant storage tank of PAFS can provide coolant for reactor cooling more than 8 hours and a dedicated battery system of PAFS can provide electricity for I-C more than 72 hours. PAFS is 2-train system, that is, PAFS has two water tanks, two battery systems and two heat exchangers. PAFS provides feedwater to steam generator more than 8 hours, even if single train was unavailable, AC power was not provided and water tank is not refilled. Following Fukushima Daiichi Accident, we have made many improvements and challenging research to prevent and mitigate accidents which can be caused by earthquake, tsunami or station blackout. It includes the Hybrid SIT to deliver cooling water into core even if RCS pressure is high. To prevent a waste of SIT water and maintain core cooling more long time, an optimum operation strategy of Hybrid SIT has been developed. It considers the operation of PAFS and the optimum coolability of SIT water. For the optimum coolability of Hybrid SIT with PAFS, some operation methods were considered. It shows that the coolant injected before the swelling of RCS water is released during the first POSRV opening and has very little effect on core cooling. The core cooling period is longest when the Hybrid SIT is actuated one by one after a exhaustion of PAFS and POSRV opening.

  14. Analysis of Safety Margins in an Initial Stage during the KALIMER Station Blackout

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Won Pyo; Jeong, Hae Yong; Lee, Yong Bum

    2008-01-15

    The main effort in the present study contributes to investigating the safety margins by analyzing the KALIMER station blackout accident. Natural circulation becomes the main heat transfer mechanism. The flow depends mostly on pump's halving time, friction factor for the wire-wrapped rod bundles in the core, and heat transfer coefficient. Therefore, physical models concerned with heat transfer in both pipe internals (IHX/DHX tube sides) and tube bundles (core, IHX/DHX shell sides), including the core wire-wrapped rod bundles, are also to be assessed in the study. In results, the heat transfer coefficient currently featured in SSC-K for an IHX rod bundle has been found acceptable. The heat transfer coefficient used for the core rod bundle, however, has not shown suitability and thus an alternative one has been proposed. Meanwhile, the friction factor model in SSC-K has not shown a prominent discrepancy in prediction trend but it has not been backed by an enough theoretical basis so that it has been replaced by the Cheng and Todreas model. An assessment matrix has been made to analyze systematically the effects of those parameters affecting on the conservatism of the safety analysis, and the matrix is constituted with the average value and the upper/lower limits in the correlation's applicable ranges. The preliminary calculation has shown negligible effect on the fuel temperature, while the pump halving time and the friction factor for the wire-wrapped rod bundle in the core have affected on the analysis results.

  15. Simulation of station blackout scenario in low-power and shutdown condition of Westinghouse two-loop plant with RELAP5 code

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Se Yun; Ha, Sang Jun [KHNP Central Research Institute, Daejeon (Korea, Republic of)

    2013-10-15

    A station blackout scenario in low power and shutdown condition of Westinghouse two-loop plant is simulated with RELAP5 code. To evaluate plant safety in station blackout scenario for low-power and shutdown condition, the transient calculation with RELAP5 code has been carried out for a Westinghouse two-loop plant. Without core cooling, the boiling in core and spent fuel pit occurs. The core uncovery is observed about 160 hours and the peak cladding temperature exceeds 1206K at 161.1. Station blackout is the complete loss of alternating current (AC) electrical power to the essential and nonessential switchgear buses in a nuclear power plant. Because many safety systems required for reactor core cooling and containment heat removal depend on AC power, the consequences of a station blackout could be severe. Especially, station blackout in low-power and shutdown condition is one of the current issues. Therefore, the evaluation of plant safety with safety analysis code is opportune.

  16. Evaluation of steam generator U-tube integrity during PWR station blackout with secondary system depressurization

    Energy Technology Data Exchange (ETDEWEB)

    Hidaka, Akihide; Asaka, Hideaki; Sugimoto, Jun [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Ueno, Shingo; Yoshino, Takehito

    1999-12-01

    In PWR severe accidents such as station blackout, the integrity of steam generator U-tube would be threatened early at the transient among the pipes of primary system. This is due to the hot leg countercurrent natural circulation (CCNC) flow which delivers the decay heat of the core to the structures of primary system if the core temperature increases after the secondary system depressurization. From a view point of accident mitigation, this steam generator tube rupture (SGTR) is not preferable because it results in the direct release of primary coolant including fission products (FP) to the environment. Recent SCDAP/RELAP5 analyses by USNRC showed that the creep failure of pressurizer surge line which results in release of the coolant into containment would occur earlier than SGTR during the secondary system depressurization. However, the analyses did not consider the decay heat from deposited FP on the steam generator U-tube surface. In order to investigate the effect of decay heat on the steam generator U-tube integrity, the hot leg CCNC flow model used in the USNRC's calculation was, at first, validated through the analysis for JAERI's LSTF experiment. The CCNC model reproduced well the thermohydraulics observed in the LSTF experiment and thus the model is mostly reliable. An analytical study was then performed with SCDAP/RELAP5 for TMLB' sequence of Surry plant with and without secondary system depressurization. The decay heat from deposited FP was calculated by JAERI's FP aerosol behavior analysis code, ART. The ART analysis showed that relatively large amount of FPs may deposit on steam generator U-tube inlet mainly by thermophoresis. The SCDAP/RELAP5 analyses considering the FP decay heat predicted small safety margin for steam generator U-tube integrity during secondary system depressurization. Considering associated uncertainties in the analyses, the potential for SGTR cannot be ignored. Accordingly, this should be considered in the

  17. AP1000 station blackout study with and without depressurization using RELAP5/SCDAPSIM

    Energy Technology Data Exchange (ETDEWEB)

    Trivedi, A.K. [Nuclear Engineering and Technology Program, Indian Institute of Technology, Kanpur 208016 (India); Allison, C. [Innovative Systems Software Idaho Falls, ID 83406 (United States); Khanna, A., E-mail: akhanna@iitk.ac.in [Nuclear Engineering and Technology Program, Indian Institute of Technology, Kanpur 208016 (India); Munshi, P. [Nuclear Engineering and Technology Program, Indian Institute of Technology, Kanpur 208016 (India)

    2016-10-15

    Highlights: • A representative RELAP5/SCDAPSIM model of AP1000 has been developed. • Core is modeled using SCDAP. • A SBO for the AP1000 has been simulated for high pressure (no depressurization) and low pressure (depressurization). • Significant differences in the damage progression have been observed for the two cases. • Results also reinforced the fact that surge line fails before vessel failure in case of high pressure scenario. - Abstract: Severe accidents like TMI-2, Chernobyl, Fukushima made it inevitable to analyze station blackout (SBO) for all the old as well as new designs although it is not a regulatory requirement in most of the countries. For such improbable accidents, a SBO for the AP1000 using RELAP5/SCDAPSIM has been simulated. Many improvements have been made in fuel damage progression models of SCDAP after the Fukushima accident which are now being tested for the new reactor designs. AP1000 is a 2-loop pressurized water reactor (PWR) with all the emergency core cooling systems based on natural circulation. Its core design is very similar to 3-loop PWR with 157 fuel assemblies. The primary circuit pumps, pressurizer and steam generators (with necessary secondary side) are modeled using RELAP5. The core has been divided into 20 axial nodes and 6 radial rings; the corresponding six groups of assemblies have been modeled as six pipe components with proportionate flow area. Fuel assemblies are modeled using SCDAP fuel and control components. SCDAP has 2d-heat conduction and radiative heat transfer, oxidation and complete severe fuel damage progression models. The final input deck achieved all the steady state thermal hydraulic conditions comparable to the design control document of AP1000. To quantify the core behavior, under unavailability of all safety systems, various time profiles for SBO simulations @ high pressure and low pressure have been compared. This analysis has been performed for 102% (3468 MWt) of the rated core power. The

  18. A STRONGLY COUPLED REACTOR CORE ISOLATION COOLING SYSTEM MODEL FOR EXTENDED STATION BLACK-OUT ANALYSES

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Haihua [Idaho National Laboratory; Zhang, Hongbin [Idaho National Laboratory; Zou, Ling [Idaho National Laboratory; Martineau, Richard Charles [Idaho National Laboratory

    2015-03-01

    The reactor core isolation cooling (RCIC) system in a boiling water reactor (BWR) provides makeup cooling water to the reactor pressure vessel (RPV) when the main steam lines are isolated and the normal supply of water to the reactor vessel is lost. The RCIC system operates independently of AC power, service air, or external cooling water systems. The only required external energy source is from the battery to maintain the logic circuits to control the opening and/or closure of valves in the RCIC systems in order to control the RPV water level by shutting down the RCIC pump to avoid overfilling the RPV and flooding the steam line to the RCIC turbine. It is generally considered in almost all the existing station black-out accidents (SBO) analyses that loss of the DC power would result in overfilling the steam line and allowing liquid water to flow into the RCIC turbine, where it is assumed that the turbine would then be disabled. This behavior, however, was not observed in the Fukushima Daiichi accidents, where the Unit 2 RCIC functioned without DC power for nearly three days. Therefore, more detailed mechanistic models for RCIC system components are needed to understand the extended SBO for BWRs. As part of the effort to develop the next generation reactor system safety analysis code RELAP-7, we have developed a strongly coupled RCIC system model, which consists of a turbine model, a pump model, a check valve model, a wet well model, and their coupling models. Unlike the traditional SBO simulations where mass flow rates are typically given in the input file through time dependent functions, the real mass flow rates through the turbine and the pump loops in our model are dynamically calculated according to conservation laws and turbine/pump operation curves. A simplified SBO demonstration RELAP-7 model with this RCIC model has been successfully developed. The demonstration model includes the major components for the primary system of a BWR, as well as the safety

  19. THE APPLICATION OF MAMMOTH FOR A DETAILED TIGHTLY COUPLED FUEL PIN SIMULATION WITH A STATION BLACKOUT

    Energy Technology Data Exchange (ETDEWEB)

    Gleicher, Frederick; Ortensi, Javier; DeHart, Mark; Wang, Yaqi; Schunert, Sebastian; Novascone, Stephen; Hales, Jason; Williamson, Rich; Slaughter, Andrew; Permann, Cody; Andrs, David; Martineau, Richard

    2016-09-01

    Accurate calculation of desired quantities to predict fuel behavior requires the solution of interlinked equations representing different physics. Traditional fuels performance codes often rely on internal empirical models for the pin power density and a simplified boundary condition on the cladding edge. These simplifications are performed because of the difficulty of coupling applications or codes on differing domains and mapping the required data. To demonstrate an approach closer to first principles, the neutronics application Rattlesnake and the thermal hydraulics application RELAP-7 were coupled to the fuels performance application BISON under the master application MAMMOTH. A single fuel pin was modeled based on the dimensions of a Westinghouse 17x17 fuel rod. The simulation consisted of a depletion period of 1343 days, roughly equal to three full operating cycles, followed by a station blackout (SBO) event. The fuel rod was depleted for 1343 days for a near constant total power loading of 65.81 kW. After 1343 days the fission power was reduced to zero (simulating a reactor shut-down). Decay heat calculations provided the time-varying energy source after this time. For this problem, Rattlesnake, BISON, and RELAP-7 are coupled under MAMMOTH in a split operator approach. Each system solves its physics on a separate mesh and, for RELAP-7 and BISON, on only a subset of the full problem domain. Rattlesnake solves the neutronics over the whole domain that includes the fuel, cladding, gaps, water, and top and bottom rod holders. Here BISON is applied to the fuel and cladding with a 2D axi-symmetric domain, and RELAP-7 is applied to the flow of the circular outer water channel with a set of 1D flow equations. The mesh on the Rattlesnake side can either be 3D (for low order transport) or 2D (for diffusion). BISON has a matching ring structure mesh for the fuel so both the power density and local burn up are copied accurately from Rattlesnake. At each depletion time

  20. Analysis of a Station Black-Out transient in SMR by using the TRACE and RELAP5 code

    Science.gov (United States)

    De Rosa, F.; Lombardo, C.; Mascari, F.; Polidori, M.; Chiovaro, P.; D'Amico, S.; Moscato, I.; Vella, G.

    2014-11-01

    The present paper deals with the investigation of the evolution and consequences of a Station Black-Out (SBO) initiating event transient in the SPES3 facility [1]. This facility is an integral simulator of a small modular reactor being built at the SIET laboratories, in the framework of the R&D program on nuclear fission funded by the Italian Ministry of Economic Development and led by ENEA. The SBO transient will be simulated by using the RELAP5 and TRACE nodalizations of the SPES3 facility. Moreover, the analysis will contribute to study the differences on the code predictions considering the different modelling approach with one and/or three-dimensional components and to compare the capability of these codes to describe the SPES3 facility behaviour.

  1. Developing Fully Coupled Dynamical Reactor Core Isolation System Models in RELAP-7 for Extended Station Black-Out Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Haihua Zhao; Ling Zou; Hongbin Zhang; David Andrs; Richard Martineau

    2014-04-01

    The reactor core isolation cooling (RCIC) system in a boiling water reactor (BWR) provides makeup water to the reactor vessel for core cooling when the main steam lines are isolated and the normal supply of water to the reactor vessel is lost. It was one of the very few safety systems still available during the Fukushima Daiichi accidents after the tsunamis hit the plants and the system successfully delayed the core meltdown for a few days for unit 2 & 3. Therefore, detailed models for RCIC system components are indispensable to understand extended station black-out accidents (SBO) for BWRs. As part of the effort to develop the new generation reactor system safety analysis code RELAP-7, major components to simulate the RCIC system have been developed. This paper describes the models for those components such as turbine, pump, and wet well. Selected individual component test simulations and a simplified SBO simulation up to but before core damage is presented. The successful implementation of the simplified RCIC and wet well models paves the way to further improve the models for safety analysis by including more detailed physical processes in the near future.

  2. Long-Term Station Blackout Accident Analyses of a PWR with RELAP5/MOD3.3

    Directory of Open Access Journals (Sweden)

    Andrej Prošek

    2013-01-01

    Full Text Available Stress tests performed in Europe after accident at Fukushima Daiichi also required evaluation of the consequences of loss of safety functions due to station blackout (SBO. Long-term SBO in a pressurized water reactor (PWR leads to severe accident sequences, assuming that existing plant means (systems, equipment, and procedures are used for accident mitigation. Therefore the main objective was to study the accident management strategies for SBO scenarios (with different reactor coolant pumps (RCPs leaks assumed to delay the time before core uncovers and significantly heats up. The most important strategies assumed were primary side depressurization and additional makeup water to reactor coolant system (RCS. For simulations of long term SBO scenarios, including early stages of severe accident sequences, the best estimate RELAP5/MOD3.3 and the verified input model of Krško two-loop PWR were used. The results suggest that for the expected magnitude of RCPs seal leak, the core uncovery during the first seven days could be prevented by using the turbine-driven auxiliary feedwater pump and manually depressurizing the RCS through the secondary side. For larger RCPs seal leaks, in general this is not the case. Nevertheless, the core uncovery can be significantly delayed by increasing RCS depressurization.

  3. Effect of Coolant Inventories and Parallel Loop Interconnections on the Natural Circulation in Various Heat Transport Systems of a Nuclear Power Plant during Station Blackout

    Directory of Open Access Journals (Sweden)

    Avinash J. Gaikwad

    2008-01-01

    Full Text Available Provision of passive means to reactor core decay heat removal enhances the nuclear power plant (NPP safety and availability. In the earlier Indian pressurised heavy water reactors (IPHWRs, like the 220 MWe and the 540 MWe, crash cooldown from the steam generators (SGs is resorted to mitigate consequences of station blackout (SBO. In the 700 MWe PHWR currently being designed an additional passive decay heat removal (PDHR system is also incorporated to condense the steam generated in the boilers during a SBO. The sustainability of natural circulation in the various heat transport systems (i.e., primary heat transport (PHT, SGs, and PDHRs under station blackout depends on the corresponding system's coolant inventories and the coolant circuit configurations (i.e., parallel paths and interconnections. On the primary side, the interconnection between the two primary loops plays an important role to sustain the natural circulation heat removal. On the secondary side, the steam lines interconnections and the initial inventory in the SGs prior to cooldown, that is, hooking up of the PDHRs are very important. This paper attempts to open up discussions on the concept and the core issues associated with passive systems which can provide continued heat sink during such accident scenarios. The discussions would include the criteria for design, and performance of such concepts already implemented and proposes schemes to be implemented in the proposed 700 MWe IPHWR. The designer feedbacks generated, and critical examination of performance analysis results for the added passive system to the existing generation II & III reactors will help ascertaining that these safety systems/inventories in fact perform in sustaining decay heat removal and augmenting safety.

  4. An uncertainty analysis of the hydrogen source term for a station blackout accident in Sequoyah using MELCOR 1.8.5

    Energy Technology Data Exchange (ETDEWEB)

    Gauntt, Randall O.; Bixler, Nathan E.; Wagner, Kenneth Charles.

    2014-03-01

    A methodology for using the MELCOR code with the Latin Hypercube Sampling method was developed to estimate uncertainty in various predicted quantities such as hydrogen generation or release of fission products under severe accident conditions. In this case, the emphasis was on estimating the range of hydrogen sources in station blackout conditions in the Sequoyah Ice Condenser plant, taking into account uncertainties in the modeled physics known to affect hydrogen generation. The method uses user-specified likelihood distributions for uncertain model parameters, which may include uncertainties of a stochastic nature, to produce a collection of code calculations, or realizations, characterizing the range of possible outcomes. Forty MELCOR code realizations of Sequoyah were conducted that included 10 uncertain parameters, producing a range of in-vessel hydrogen quantities. The range of total hydrogen produced was approximately 583kg 131kg. Sensitivity analyses revealed expected trends with respected to the parameters of greatest importance, however, considerable scatter in results when plotted against any of the uncertain parameters was observed, with no parameter manifesting dominant effects on hydrogen generation. It is concluded that, with respect to the physics parameters investigated, in order to further reduce predicted hydrogen uncertainty, it would be necessary to reduce all physics parameter uncertainties similarly, bearing in mind that some parameters are inherently uncertain within a range. It is suspected that some residual uncertainty associated with modeling complex, coupled and synergistic phenomena, is an inherent aspect of complex systems and cannot be reduced to point value estimates. The probabilistic analyses such as the one demonstrated in this work are important to properly characterize response of complex systems such as severe accident progression in nuclear power plants.

  5. 77 FR 16175 - Station Blackout

    Science.gov (United States)

    2012-03-20

    ... earthquakes, tornadoes, hurricanes, floods, tsunami, and seiches without loss of capability to perform their... highly reliable ac electric power systems and, as additional defense-in-depth, assuring that plants can... additional defense-in-depth margin to mitigate SBO for such events, should analysis of an SBO consider a...

  6. Alcohol-Induced Blackout

    Directory of Open Access Journals (Sweden)

    Dai Jin Kim

    2009-11-01

    Full Text Available For a long time, alcohol was thought to exert a general depressant effect on the central nervous system (CNS. However, currently the consensus is that specific regions of the brain are selectively vulnerable to the acute effects of alcohol. An alcohol-induced blackout is the classic example; the subject is temporarily unable to form new long-term memories while relatively maintaining other skills such as talking or even driving. A recent study showed that alcohol can cause retrograde memory impairment, that is, blackouts due to retrieval impairments as well as those due to deficits in encoding. Alcoholic blackouts may be complete (en bloc or partial (fragmentary depending on severity of memory impairment. In fragmentary blackouts, cueing often aids recall. Memory impairment during acute intoxication involves dysfunction of episodic memory, a type of memory encoded with spatial and social context. Recent studies have shown that there are multiple memory systems supported by discrete brain regions, and the acute effects of alcohol on learning and memory may result from alteration of the hippocampus and related structures on a cellular level. A rapid increase in blood alcohol concentration (BAC is most consistently associated with the likelihood of a blackout. However, not all subjects experience blackouts, implying that genetic factors play a role in determining CNS vulnerability to the effects of alcohol. This factor may predispose an individual to alcoholism, as altered memory function during intoxication may affect an individual‟s alcohol expectancy; one may perceive positive aspects of intoxication while unintentionally ignoring the negative aspects. Extensive research on memory and learning as well as findings related to the acute effects of alcohol on the brain may elucidate the mechanisms and impact associated with the alcohol- induced blackout.

  7. Alternative cooling water flow path for RHR heat exchanger and its effect on containment response during extended station blackout for Chinshan BWR-4 plant

    Energy Technology Data Exchange (ETDEWEB)

    Yuann, Yng-Ruey, E-mail: ryyuann@iner.gov.tw

    2016-04-15

    Highlights: • Motivating alternative RHR heat exchanger tube-side flow path and determining required capacity. • Calculate NSSS and containment response during 24-h SBO for Chinshan BWR-4 plant. • RETRAN and GOTHIC models are developed for NSSS and containment, respectively. • Safety relief valve blowdown flow and energy to drywell are generated by RETRAN. • Analyses are performed with and without reactor depressurization, respectively. - Abstract: The extended Station Blackout (SBO) of 24 h has been analyzed with respect to the containment response, in particular the suppression pool temperature response, for the Chinshan BWR-4 plant of MARK-I containment. The Chinshan plant, owned by Taiwan Power Company, has twin units with rated core thermal power of 1840 MW each. The analysis is aimed at determining the required alternative cooling water flow capacity for the residual heat removal (RHR) heat exchanger when its tube-side sea water cooling flow path is blocked, due to some reason such as earthquake or tsunami, and is switched to the alternative raw water source. Energy will be dissipated to the suppression pool through safety relief valves (SRVs) of the main steam lines during SBO. The RETRAN model is used to calculate the Nuclear Steam Supply System (NSSS) response and generate the SRV blowdown conditions, including SRV pressure, enthalpy, and mass flow rate. These conditions are then used as the time-dependent boundary conditions for the GOTHIC code to calculate the containment pressure and temperature response. The shaft seals of the two recirculation pumps are conservatively assumed to fail due to loss of seal cooling and a total leakage flow rate of 36 gpm to the drywell is included in the GOTHIC model. Based on the given SRV blowdown conditions, the GOTHIC containment calculation is performed several times, through the adjustment of the heat transfer rate of the RHR heat exchanger, until the criterion that the maximum suppression pool temperature

  8. Modelling, controlling, predicting blackouts

    CERN Document Server

    Wang, Chengwei; Baptista, Murilo S

    2016-01-01

    The electric power system is one of the cornerstones of modern society. One of its most serious malfunctions is the blackout, a catastrophic event that may disrupt a substantial portion of the system, playing havoc to human life and causing great economic losses. Thus, understanding the mechanisms leading to blackouts and creating a reliable and resilient power grid has been a major issue, attracting the attention of scientists, engineers and stakeholders. In this paper, we study the blackout problem in power grids by considering a practical phase-oscillator model. This model allows one to simultaneously consider different types of power sources (e.g., traditional AC power plants and renewable power sources connected by DC/AC inverters) and different types of loads (e.g., consumers connected to distribution networks and consumers directly connected to power plants). We propose two new control strategies based on our model, one for traditional power grids, and another one for smart grids. The control strategie...

  9. Alcohol-Induced Blackout

    OpenAIRE

    Dai Jin Kim; Sungwon Roh; Hamin Lee

    2009-01-01

    For a long time, alcohol was thought to exert a general depressant effect on the central nervous system (CNS). However, currently the consensus is that specific regions of the brain are selectively vulnerable to the acute effects of alcohol. An alcohol-induced blackout is the classic example; the subject is temporarily unable to form new long-term memories while relatively maintaining other skills such as talking or even driving. A recent study showed that alcohol can cause retrograde memory ...

  10. Criticality in a cascading failure blackout model

    Energy Technology Data Exchange (ETDEWEB)

    Nedic, Dusko P.; Kirschen, Daniel S. [University of Manchester (United Kingdom). School of Electrical and Electronic Engineering; Dobson, Ian [University of Wisconsin, Madison, WI (United States). ECE Department; Carreras, Benjamin A.; Lynch, Vickie E. [Oak Ridge National Laboratory, Oak Ridge, TN (United States)

    2006-11-15

    We verify and examine criticality in a 1000 bus network with an AC blackout model that represents many of the interactions that occur in cascading failure. At the critical loading there is a sharp rise in the mean blackout size and a power law probability distribution of blackout size that indicates a significant risk of large blackouts. (author)

  11. 78 FR 44035 - Station Blackout Mitigation Strategies

    Science.gov (United States)

    2013-07-23

    ... Writing Act of 2010, (Pub. L. 111-274) requires Federal agencies to write documents in a clear, concise... available documents online in the NRC Library at http://www.nrc.gov/reading-rm/adams.html . To begin the...

  12. 78 FR 21275 - Station Blackout Mitigation Strategies

    Science.gov (United States)

    2013-04-10

    ... proposed issuance of rules and regulations. The purpose of these #0;notices is to give interested persons... rulemaking. In addition, Appendix A contains a set of questions soliciting stakeholder feedback in areas that.... Appendix A also contains a set of questions soliciting stakeholder feedback in areas that would support the...

  13. Blackout cloth for dormancy induction

    Science.gov (United States)

    Tom Jopson

    2007-01-01

    The use of blackout cloth to create long night photoperiods for the induction of dormancy in certain conifer species has been an established practice for a long time. Its use was suggested by Tinus and McDonald (1979) as an effective technique, and the practice has been commonly used in Canadian forest nurseries for a number of years. Cal-Forest Nursery installed its...

  14. 47 CFR 76.127 - Satellite sports blackout.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Satellite sports blackout. 76.127 Section 76... Sports Blackout § 76.127 Satellite sports blackout. (a) Upon the request of the holder of the broadcast rights to a sports event, or its agent, no satellite carrier shall retransmit to subscribers within the...

  15. 47 CFR 76.111 - Cable sports blackout.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Cable sports blackout. 76.111 Section 76.111... CABLE TELEVISION SERVICE Network Non-duplication Protection, Syndicated Exclusivity and Sports Blackout § 76.111 Cable sports blackout. (a) No community unit located in whole or in part within the specified...

  16. Simulation and transient analyses of a complete passive heat removal system in a downward cooling pool-type material testing reactor against a complete station blackout and long-term natural convection mode using the RELAP5/3.2 code

    Energy Technology Data Exchange (ETDEWEB)

    Hedayat, Afshin [Reactor and Nuclear Safety School, Nuclear Science and Technology Research Institute (NSTRI), Tehran (Iran, Islamic Republic of)

    2017-08-15

    In this paper, a complete station blackout (SBO) or complete loss of electrical power supplies is simulated and analyzed in a downward cooling 5-MW pool-type Material Testing Reactor (MTR). The scenario is traced in the absence of active cooling systems and operators. The code nodalization is successfully benchmarked against experimental data of the reactor's operating parameters. The passive heat removal system includes downward water cooling after pump breakdown by the force of gravity (where the coolant streams down to the unfilled portion of the holdup tank), safety flapper opening, flow reversal from a downward to an upward cooling direction, and then the upward free convection heat removal throughout the flapper safety valve, lower plenum, and fuel assemblies. Both short-term and long-term natural core cooling conditions are simulated and investigated using the RELAP5 code. Short-term analyses focus on the safety flapper valve operation and flow reversal mode. Long-term analyses include simulation of both complete SBO and long-term operation of the free convection mode. Results are promising for pool-type MTRs because this allows operators to investigate RELAP code abilities for MTR thermal–hydraulic simulations without any oscillation; moreover, the Tehran Research Reactor is conservatively safe against the complete SBO and long-term free convection operation.

  17. Hypersonic Cruise and Re-Entry Radio Frequency Blackout Mitigation: Alleviating the Communications Blackout Problem

    Science.gov (United States)

    Manning, Robert M.

    2017-01-01

    The work presented here will be a review of a NASA effort to provide a method to transmit and receive RF communications and telemetry through a re-entry plasma thus alleviating the classical RF blackout phenomenon.

  18. Engaging Honors Students through Newspaper Blackout Poetry

    Science.gov (United States)

    Ladenheim, Melissa

    2014-01-01

    This article describes the author's attempt to convince her students that poetry can be "their thing," and also show them how much it can shape the way they think about the world and their place in it. In this article Melissa Ladenheim describes the technique known as "newspaper blackout" poetry. The exciting thing about this…

  19. Exploring Complex Systems Aspects of Blackout Risk and Mitigation

    Energy Technology Data Exchange (ETDEWEB)

    Newman, David E [University of Alaska; Carreras, Benjamin A [ORNL; Lynch, Vickie E [ORNL; Dobson, Ian [University of Wisconsin, Madison

    2011-01-01

    Electric power transmission systems are a key infrastructure, and blackouts of these systems have major consequences for the economy and national security. Analyses of blackout data suggest that blackout size distributions have a power law form over much of their range. This result is an indication that blackouts behave as a complex dynamical system. We use a simulation of an upgrading power transmission system to investigate how these complex system dynamics impact the assessment and mitigation of blackout risk. The mitigation of failures in complex systems needs to be approached with care. The mitigation efforts can move the system to a new dynamic equilibrium while remaining near criticality and preserving the power law region. Thus, while the absolute frequency of blackouts of all sizes may be reduced, the underlying forces can still cause the relative frequency of large blackouts to small blackouts to remain the same. Moreover, in some cases, efforts to mitigate small blackouts can even increase the frequency of large blackouts. This result occurs because the large and small blackouts are not mutually independent, but are strongly coupled by the complex dynamics.

  20. Fractal Characteristics Analysis of Blackouts in Interconnected Power Grid

    DEFF Research Database (Denmark)

    Wang, Feng; Li, Lijuan; Li, Canbing

    2017-01-01

    The power failure models are a key to understand the mechanism of large scale blackouts. In this letter, the similarity of blackouts in interconnected power grids (IPGs) and their sub-grids is discovered by the fractal characteristics analysis to simplify the failure models of the IPG. The distri......The power failure models are a key to understand the mechanism of large scale blackouts. In this letter, the similarity of blackouts in interconnected power grids (IPGs) and their sub-grids is discovered by the fractal characteristics analysis to simplify the failure models of the IPG....... The distribution characteristics of blackouts in various sub-grids are demonstrated based on the Kolmogorov-Smirnov (KS) test. The fractal dimensions (FDs) of the IPG and its sub-grids are then obtained by using the KS test and the maximum likelihood estimation (MLE). The blackouts data in China were used...

  1. Blackouts among male and female youth seeking emergency department care.

    Science.gov (United States)

    Voloshyna, Diana M; Bonar, Erin E; Cunningham, Rebecca M; Ilgen, Mark A; Blow, Frederic C; Walton, Maureen A

    2016-12-29

    Alcohol-related blackouts are a common consequence of heavy drinking, and these blackouts pose risk for injury and other adverse health outcomes. To examine the prevalence and correlates of blackouts among underage drinkers. Youth (ages 14-20) presenting to a suburban Emergency Department (ED) completed screening surveys. Among those reporting past-year alcohol consumption, we examined past 3-month blackouts in relation to: background characteristics (e.g., demographics, fraternity/sorority involvement), substance use, sexual risk behaviors and incapacitated sexual assault (unaware/unable to consent due to alcohol/drugs), forced sexual assault, positive depression screening, and reason for ED visit (injury vs. medical). In total, 2,300 past-year drinkers participated: 58% female, 75% Caucasian, and mean age = 18.4. Regarding past 3-month blackouts, 72.7% reported none, 19.3% reported monthly or less, and 8% reported monthly or more. Multivariate cumulative logit regression indicated that blackout frequency was positively associated with: college involvement in Greek life, alcohol use severity, prescription drug misuse, marijuana, screening positive for depression, incapacitated sexual assault, and a gender by alcohol use severity interaction. With one-quarter of this clinical sample reporting recent blackouts, as well as the association between blackout frequency and health risk behaviors and other outcomes, findings underscore the need for programs focusing on substance use, depression, and preventing sexual assault. Interventions should also address poly-substance use and drinking motives. Although findings highlight how college students in Greek life may be at high risk for blackouts, many participants not in college also reported blackouts, suggesting that interventions in other settings are also needed.

  2. Large blackouts in North America: Historical trends and policy implications

    Energy Technology Data Exchange (ETDEWEB)

    Hines, Paul [School of Engineering, 301 Votey Hall, University of Vermont, 33 Colchester Avenue, Burlington, VT 05405 (United States); Apt, Jay [Carnegie Mellon Electricity Industry Center, Department of Engineering and Public Policy and Tepper School of Business, Carnegie Mellon University, 5000 Forbes Avenue, Pittsburgh, PA 15213 (United States); Talukdar, Sarosh [Carnegie Mellon Electricity Industry Center, Department of Engineering and Public Policy and Department of Electrical and Computer Engineering, Carnegie Mellon University, 5000 Forbes Avenue, Pittsburgh, PA 15213 (United States)

    2009-12-15

    Using data from the North American Electric Reliability Council (NERC) for 1984-2006, we find several trends. We find that the frequency of large blackouts in the United States has not decreased over time, that there is a statistically significant increase in blackout frequency during peak hours of the day and during late summer and mid-winter months (although non-storm-related risk is nearly constant through the year) and that there is strong statistical support for the previously observed power-law statistical relationship between blackout size and frequency. We do not find that blackout sizes and blackout durations are significantly correlated. These trends hold even after controlling for increasing demand and population and after eliminating small events, for which the data may be skewed by spotty reporting. Trends in blackout occurrences, such as those observed in the North American data, have important implications for those who make investment and policy decisions in the electricity industry. We provide a number of examples that illustrate how these trends can inform benefit-cost analysis calculations. Also, following procedures used in natural disaster planning we use the observed statistical trends to calculate the size of the 100-year blackout, which for North America is 186,000 MW. (author)

  3. An electromagnetic method for removing the communication blackout with a space vehicle upon re-entry into the atmosphere

    Science.gov (United States)

    Cheng, Jianjun; Jin, Ke; Kou, Yong; Hu, Ruifeng; Zheng, Xiaojing

    2017-03-01

    When a hypersonic vehicle travels in the Earth and Mars atmosphere, the surface of the vehicle is surrounded by a plasma layer, which is an envelope of ionized air, created from the compression and heat of the atmosphere by the shock wave. The vehicles will lose contact with ground stations known as the reentry communication blackout. Based on the magnetohydrodynamic framework and electromagnetic wave propagation theory, an analytical model is proposed to describe the effect of the effectiveness of electromagnetic mitigation scheme on removing the reentry communication blackout. C and Global Positioning System (GPS) bands, two commonly used radio bands for communication, are taken as the cases to discuss the effectiveness of the electromagnetic field mitigation scheme. The results show that the electron density near the antenna of vehicles can be reduced by the electromagnetic field, and the required external magnetic field strength is far below the one in the magnetic window method. The directions of the external electric field and magnetic field have a significant impact on the effectiveness of the mitigation scheme. Furthermore, the effect of electron collisions on the required applied electromagnetic field is discussed, and the result indicates that electron collisions are a key factor to analyze the electromagnetic mitigation scheme. Finally, the feasible regions of the applied electromagnetic field for eliminating blackout are given. These investigations could have a significant benefit on the design and optimization of electromagnetic mitigation scheme for the blackout problem.

  4. Investigation of plasma-surface interaction effects on pulsed electrostatic manipulation for reentry blackout alleviation

    Science.gov (United States)

    Krishnamoorthy, S.; Close, S.

    2017-03-01

    The reentry blackout phenomenon affects most spacecraft entering a dense planetary atmosphere from space, due to the presence of a plasma layer that surrounds the spacecraft. This plasma layer is created by ionization of ambient air due to shock and frictional heating, and in some cases is further enhanced due to contamination by ablation products. This layer causes a strong attenuation of incoming and outgoing electromagnetic waves including those used for command and control, communication and telemetry over a period referred to as the ‘blackout period’. The blackout period may last up to several minutes and is a major contributor to the landing error ellipse at best, and a serious safety hazard in the worst case, especially in the context of human spaceflight. In this work, we present a possible method for alleviation of reentry blackout using electronegative DC pulses applied from insulated electrodes on the reentry vehicle’s surface. We study the reentry plasma’s interaction with a DC pulse using a particle-in-cell (PIC) model. Detailed models of plasma-insulator interaction are included in our simulations. The absorption and scattering of ions and electrons at the plasma-dielectric interface are taken into account. Secondary emission from the insulating surface is also considered, and its implications on various design issues is studied. Furthermore, we explore the effect of changing the applied voltage and the impact of surface physics on the creation and stabilization of communication windows. The primary aim of this analysis is to examine the possibility of restoring L- and S-band communication from the spacecraft to a ground station. Our results provide insight into the effect of key design variables on the response of the plasma to the applied voltage pulse. Simulations show the creation of pockets where electron density in the plasma layer is reduced three orders of magnitude or more in the vicinity of the electrodes. These pockets extend to

  5. 17 CFR 245.101 - Prohibition of insider trading during pension fund blackout periods.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Prohibition of insider trading during pension fund blackout periods. 245.101 Section 245.101 Commodity and Securities Exchanges...-Blackout Trading Restriction) § 245.101 Prohibition of insider trading during pension fund blackout periods...

  6. Natural hazard impact on the technosphere: "blackouts

    Science.gov (United States)

    Petrova, E. G.

    2012-04-01

    In recent years, natural-technological accidents (NTA) and disasters are increasing in their number and severity all over the world. The term "natural-technological accident (disaster)" applies for an accident (disaster) in the technosphere triggered by any natural process or phenomenon. Their growth is caused, on the one hand, by observed increasing in the frequency and intensity of some natural hazards and hazardous events due to climate change and, on the other hand, by a growing complication of the modern technosphere exposed to natural impacts and advancement of economic activities into the area at natural risk. The most large-scaled natural-technological disaster happened on March 11, 2011 in Japan, as a result of a massive earthquake and tsunami that caused a number of serious technological accidents, including accidents at "Fukushima-1" nuclear power plant, etc. Severe social, ecological and economic consequences of large-scaled NTA make investigation of these events especially important. The most frequent among NTA occurring in Russia are breakdowns in electric power supply systems that lead to so-called "blackouts" (accidental power outages). They are mainly caused by strong winds, snowstorms, deposition of ice, sleet, and snow, rainfalls, floods, and hailstones. Among other triggers earthquakes, hard frost, fierce heat, thunderstorms, landslides, snow avalanches, and debris flows should be mentioned. The great part of transmission facilities in Russia falls on overhead lines that are especially vulnerable to natural impacts. In general, natural triggers are responsible for more than 70 percent of all accidents in power supply systems. They occur more often in Far East, in the Southern and North-Western federal districts, and in some regions of the Central Russia, which are prone to hurricanes, cyclones, snowstorms, and heavy rainfalls accompanying by hailstones, icing, and sleet. A distinctive feature of these events is their synergistic nature, as power

  7. Mitigating reentry radio blackout by using a traveling magnetic field

    Science.gov (United States)

    Zhou, Hui; Li, Xiaoping; Xie, Kai; Liu, Yanming; Yu, Yuanyuan

    2017-10-01

    A hypersonic flight or a reentry vehicle is surrounded by a plasma layer that prevents electromagnetic wave transmission, which results in radio blackout. The magnetic-window method is considered a promising means to mitigate reentry communication blackout. However, the real application of this method is limited because of the need for strong magnetic fields. To reduce the required magnetic field strength, a novel method that applies a traveling magnetic field (TMF) is proposed in this study. A mathematical model based on magneto-hydrodynamic theory is adopted to analyze the effect of TMF on plasma. The mitigating effects of the TMF on the blackout of typical frequency bands, including L-, S-, and C-bands, are demonstrated. Results indicate that a significant reduction of plasma density occurs in the magnetic-window region by applying a TMF, and the reduction ratio is positively correlated with the velocity of the TMF. The required traveling velocities for eliminating the blackout of the Global Positioning System (GPS) and the typical telemetry system are also discussed. Compared with the constant magnetic-window method, the TMF method needs lower magnetic field strength and is easier to realize in the engineering field.

  8. Mitigating reentry radio blackout by using a traveling magnetic field

    Directory of Open Access Journals (Sweden)

    Hui Zhou

    2017-10-01

    Full Text Available A hypersonic flight or a reentry vehicle is surrounded by a plasma layer that prevents electromagnetic wave transmission, which results in radio blackout. The magnetic-window method is considered a promising means to mitigate reentry communication blackout. However, the real application of this method is limited because of the need for strong magnetic fields. To reduce the required magnetic field strength, a novel method that applies a traveling magnetic field (TMF is proposed in this study. A mathematical model based on magneto-hydrodynamic theory is adopted to analyze the effect of TMF on plasma. The mitigating effects of the TMF on the blackout of typical frequency bands, including L-, S-, and C-bands, are demonstrated. Results indicate that a significant reduction of plasma density occurs in the magnetic-window region by applying a TMF, and the reduction ratio is positively correlated with the velocity of the TMF. The required traveling velocities for eliminating the blackout of the Global Positioning System (GPS and the typical telemetry system are also discussed. Compared with the constant magnetic-window method, the TMF method needs lower magnetic field strength and is easier to realize in the engineering field.

  9. Complex systems analysis of series of blackouts: cascading failure, critical points, and self-organization

    Energy Technology Data Exchange (ETDEWEB)

    Dobson, Ian [University of Wisconsin, Madison; Carreras, Benjamin A [ORNL; Lynch, Vickie E [ORNL; Newman, David E [University of Alaska

    2007-01-01

    We give an overview of a complex systems approach to large blackouts of electric power transmission systems caused by cascading failure. Instead of looking at the details of particular blackouts, we study the statistics and dynamics of series of blackouts with approximate global models. Blackout data from several countries suggest that the frequency of large blackouts is governed by a power law. The power law makes the risk of large blackouts consequential and is consistent with the power system being a complex system designed and operated near a critical point. Power system overall loading or stress relative to operating limits is a key factor affecting the risk of cascading failure. Power system blackout models and abstract models of cascading failure show critical points with power law behavior as load is increased. To explain why the power system is operated near these critical points and inspired by concepts from self-organized criticality, we suggest that power system operating margins evolve slowly to near a critical point and confirm this idea using a power system model. The slow evolution of the power system is driven by a steady increase in electric loading, economic pressures to maximize the use of the grid, and the engineering responses to blackouts that upgrade the system. Mitigation of blackout risk should account for dynamical effects in complex self-organized critical systems. For example, some methods of suppressing small blackouts could ultimately increase the risk of large blackouts.

  10. Reducing blackouts via wind power, a sparse grid case in Lebanon

    Directory of Open Access Journals (Sweden)

    B. Assaf

    2017-06-01

    Full Text Available Assaf, B. and Zihri, G. 2017. Reducing blackouts via wind power, a sparse grid case in Lebanon. Lebanese Science Journal. 18(1: 106-121. The statistical analysis of wind speed is an essential requirement in estimating the wind energy potential to generate electrical power by grouping and assessing the yearly observations of a selected site. In our attempt to study the wind energy potential in Lebanon we propose an estimation of wind potential by analyzing the wind characteristics of nine regions where the meteorological stations are located. The Weibull distribution function and its parameters were determined and the energy potential of the wind was assessed in each of the studied sites. The comparison of the resulting power density with the PNL classification scheme in Dahr-El-Baidar, Ksara, Marjayoun and Qlaiat proved that Lebanon posses an important opportunity to generate electric power from wind especially during seasons of peak consumption.

  11. Latent growth classes of alcohol-related blackouts over the first 2 years of college.

    Science.gov (United States)

    Merrill, Jennifer E; Treloar, Hayley; Fernandez, Anne C; Monnig, Mollie A; Jackson, Kristina M; Barnett, Nancy P

    2016-12-01

    Alcohol-related blackouts are common among college student drinkers. The present study extends prior work by examining latent growth classes of blackouts and several predictors of class membership. Participants (N = 709 college drinkers) completed a baseline survey at college entry and biweekly online assessments throughout freshman and sophomore years. Results revealed 5 latent growth class trajectories, reflecting varying experiences of blackouts at the beginning of college and differential change in blackouts over time. The largest class represented a relatively low-risk group (low decrease; 47.3%) characterized by endorsement of no or very low likelihood of blackouts, and decreasing likelihood of blackouts over time. Another decreasing risk group (high decrease; 11.1%) initially reported a high proportion of blackouts and had the steepest decrease in blackout risk over time. A small percentage showed consistently high likelihood of blackouts over time (high stable; 4.1%). The remaining 2 groups were distinguished by relatively moderate (moderate stable; 14.9%) and lower (low stable; 22.6%) likelihood of blackouts, which remained stable over time. Comparisons between classes revealed that students with greater perceived peer drinking, perceived peer approval of drinking, and enhancement motives upon entry to college tended to be in higher risk groups with consistent experiences of blackouts over time, whereas blackout likelihood decreased over time for students with greater conformity motives. Findings suggest that precollege preventive interventions may be strengthened by considering not only factors related to current risk for blackouts and other alcohol-related consequences, but also those factors related to persistence of these behaviors over time. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  12. Estimating Failure Propagation in Models of Cascading Blackouts

    Energy Technology Data Exchange (ETDEWEB)

    Dobson, Ian [University of Wisconsin, Madison; Carreras, Benjamin A [ORNL; Lynch, Vickie E [ORNL; Nkei, Bertrand [ORNL; Newman, David E [University of Alaska

    2005-09-01

    We compare and test statistical estimates of failure propagation in data from versions of a probabilistic model of loading-dependent cascading failure and a power systems blackout model of cascading transmission line overloads. The comparisons suggest mechanisms affecting failure propagation and are an initial step towards monitoring failure propagation from practical system data. Approximations to the probabilistic model describe the forms of probability distributions of cascade sizes.

  13. Communications Blackout Predictions for Atmospheric Entry of Mars Science Laboratory

    Science.gov (United States)

    Morabito, David D.; Edquist, Karl

    2005-01-01

    The Mars Science Laboratory (MSL) is expected to be a long-range, long-duration science laboratory rover on the Martian surface. MSL will provide a significant milestone that paves the way for future landed missions to Mars. NASA is studying options to launch MSL as early as 2009. MSL will be the first mission to demonstrate the new technology of 'smart landers', which include precision landing and hazard avoidance in order to -land at scientifically interesting sites that would otherwise be unreachable. There are three elements to the spacecraft; carrier (cruise stage), entry vehicle, and rover. The rover will have an X-band direct-to-Earth (DTE) link as well as a UHF proximity link. There is also a possibility of an X-band proximity link. Given the importance of collecting critical event telemetry data during atmospheric entry, it is important to understand the ability of a signal link to be maintained, especially during the period near peak convective heating. The received telemetry during entry (or played back later) will allow for the performance of the Entry-Descent-Landing technologies to be assessed. These technologies include guided entry for precision landing, hazard avoidance, a new sky-crane landing system and powered descent. MSL will undergo an entry profile that may result in a potential communications blackout caused by ionized plasma for short periods near peak heating. The vehicle will use UHF and possibly X-band during the entry phase. The purpose of this report is to quantify or bound the likelihood of any such blackout at UHF frequencies (401 MHz) and X-band frequencies (8.4 GHz). Two entry trajectory scenarios were evaluated: a stressful entry trajectory to quantify an upper-bound for any possible blackout period, and a nominal likely trajectory to quantify likelihood of blackout for such cases.

  14. Communications Blackout Prediction for Atmospheric Entry of Mars Science Laboratory

    Science.gov (United States)

    Morabito, David; Edquist, Karl

    2005-01-01

    When a supersonic spacecraft enters a planetary atmosphere with v >> v(sub sound), a shock layer forms in the front of the body. An ionized sheath of plasma develops around the spacecraft, which results from the ionization of the atmospheric constituents as they are compressed and heated by the shock or heated within the boundary layer next to the surface. When the electron density surrounding the spacecraft becomes sufficiently high, communications can be disrupted (attenuation/blackout). During Mars Science Laboratory's (MSL's) atmospheric entry there will likely be a communication outage due to charged particles on the order of 60 to 100 seconds using a UHF link frequency looking out the shoulders of the wake region to orbiting relay asset. A UHF link looking out the base region would experience a shorter duration blackout, about 35 seconds for the stressed trajectory and possibly no blackout for the nominal trajectory. There is very little likelihood of a communications outage using X-band (however, X-band is not currently planned to be used during peak electron density phase of EDL).

  15. Hypothetical Insurance and Higher Education

    Science.gov (United States)

    Colburn, Ben; Lazenby, Hugh

    2016-01-01

    What level of government subsidy of higher education is justified, in what form, and for what reasons? We answer these questions by applying the hypothetical insurance approach, originally developed by Ronald Dworkin in his work on distributive justice. On this approach, when asking how to fund and deliver public services in a particular domain,…

  16. Large scale experiments simulating hydrogen distribution in a spent fuel pool building during a hypothetical fuel uncovery accident scenario

    Energy Technology Data Exchange (ETDEWEB)

    Mignot, Guillaume; Paranjape, Sidharth; Paladino, Domenico; Jaeckel, Bernd; Rydl, Adolf [Paul Scherrer Institute, Villigen (Switzerland)

    2016-08-15

    Following the Fukushima accident and its extended station blackout, attention was brought to the importance of the spent fuel pools' (SFPs) behavior in case of a prolonged loss of the cooling system. Since then, many analytical works have been performed to estimate the timing of hypothetical fuel uncovery for various SFP types. Experimentally, however, little was done to investigate issues related to the formation of a flammable gas mixture, distribution, and stratification in the SFP building itself and to some extent assess the capability for the code to correctly predict it. This paper presents the main outcomes of the Experiments on Spent Fuel Pool (ESFP) project carried out under the auspices of Swissnuclear (Framework 2012–2013) in the PANDA facility at the Paul Scherrer Institut in Switzerland. It consists of an experimental investigation focused on hydrogen concentration build-up into a SFP building during a predefined scaled scenario for different venting positions. Tests follow a two-phase scenario. Initially steam is released to mimic the boiling of the pool followed by a helium/steam mixture release to simulate the deterioration of the oxidizing spent fuel. Results shows that while the SFP building would mainly be inerted by the presence of a high concentration of steam, the volume located below the level of the pool in adjacent rooms would maintain a high air content. The interface of the two-gas mixture presents the highest risk of flammability. Additionally, it was observed that the gas mixture could become stagnant leading locally to high hydrogen concentration while steam condenses. Overall, the experiments provide relevant information for the potentially hazardous gas distribution formed in the SFP building and hints on accident management and on eventual retrofitting measures to be implemented in the SFP building.

  17. 211 service reassures callers during August 2003 blackout

    Energy Technology Data Exchange (ETDEWEB)

    May, C.

    2004-07-01

    Community Information Toronto (CIT) in partnership with the City of Toronto and the United Way of Greater Toronto launched Canada's first 211 customer service to link residents to essential services in the event of unusual occurrences such as power outages. During the August 2003 blackout, the service proved to be responsible and capable of addressing the concerns of residents and providing information on available community services. CIT provided uninterrupted service to more than 1,000 callers during the early hours of the blackout, despite the fact that the staff were undergoing the same difficulties that callers were facing. This paper describes how the CIT staff responded to the blackout and demonstrates the organizational commitment of CIT to customer service. CIT staff played an important role in reassuring the population on how to look after themselves without power, water and the ability to cook meals. They also provided information on shelters and other community services. The information technology staff also verified the extent of the outage. While most residents received the service and support they needed, it was noted that the service could be strengthened further if it were part of a formalized emergency response system and had better resources to provide support for the ill and elderly. Each month, the CIT responds to nearly 30,000 calls and receives 50,000 visits to its website. The fail safe mechanism for the 211 system includes an Uninterrupted Power Supply (UPS) for up to 30 hours, after which time the calls are transferred manually.

  18. 47 CFR 76.120 - Network non-duplication protection, syndicated exclusivity and sports blackout rules for...

    Science.gov (United States)

    2010-10-01

    ... exclusivity and sports blackout rules for satellite carriers: Definitions. 76.120 Section 76.120... CABLE TELEVISION SERVICE Network Non-duplication Protection, Syndicated Exclusivity and Sports Blackout § 76.120 Network non-duplication protection, syndicated exclusivity and sports blackout rules for...

  19. Observing power blackouts from space - A disaster related study

    Science.gov (United States)

    Aubrecht, C.; Elvidge, C. D.; Ziskin, D.; Baugh, K. E.; Tuttle, B.; Erwin, E.; Kerle, N.

    2009-04-01

    In case of emergency disaster managers worldwide require immediate information on affected areas and estimations of the number of affected people. Natural disasters such as earthquakes, hurricanes, tornados, wind and ice storms often involve failures in the electrical power generation system and grid. Near real time identification of power blackouts gives a first impression of the area affected by the event (Elvidge et al. 2007), which can subsequently be linked to population estimations. Power blackouts disrupt societal activities and compound the difficulties associated with search and rescue, clean up, and the provision of food and other supplies following a disastrous event. Locations and spatial extents of power blackouts are key considerations in planning and execution of the primary disaster missions of emergency management organizations. To date only one satellite data source has been used successfully for the detection of power blackouts. Operated by NOAA's National Geophysical Data Center (NGDC) the U.S. Air Force Defense Meteorological Satellite Program (DMSP) Operational Linescan System (OLS) offers a unique capability to observe lights present at the Earth's surface at night. Including a pair of visible and thermal spectral bands and originally designed to detect moonlit clouds, this sensor enables mapping of lights from cities and towns, gas flares and offshore platforms, fires, and heavily lit fishing boats. The low light imaging of the OLS is accomplished using a photomultiplier tube (PMT) which intensifies the visible band signal at night. With 14 orbits collected per day and a 3.000 km swath width, each OLS is capable of collecting a complete set of images of the Earth every 24 hours. NGDC runs the long-term archive for OLS data with the digital version extending back to 1992. OLS data is received by NGDC in near real time (1-2 hours from acquisition) and subscription based services for the near real time data are provided for users all over the

  20. Can the complex networks help us in the resolution of the problem of power outages (blackouts) in Brazil?

    Energy Technology Data Exchange (ETDEWEB)

    Castro, Paulo Alexandre de; Souza, Thaianne Lopes de [Universidade Federal de Goias (UFG), Catalao, GO (Brazil)

    2011-07-01

    Full text. What the Brazilian soccer championship, Hollywood actors, the network of the Internet, the spread of viruses and electric distribution network have in common? Until less than two decade ago, the answer would be 'nothing' or 'almost nothing'. However, the answer today to this same question is 'all' or 'almost all'. The answer to these questions and more can be found through a sub-area of statistical physics | called science of complex networks that has been used to approach and study the most diverse natural and non-natural systems, such as systems/social networks, information, technological or biological. In this work we study the distribution network of electric power in Brazil (DEEB), from a perspective of complex networks, where we associate stations and/or substations with a network of vertices and the links between the vertices we associate with the transmission lines. We are doing too a comparative study with the best-known models of complex networks, such as Erdoes-Renyi, Configuration Model and Barabasi-Albert, and then we compare with results obtained in real electrical distribution networks. Based on this information, we do a comparative analysis using the following variables: connectivity distribution, diameter, clustering coefficient, which are frequently used in studies of complex networks. We emphasize that the main objective of this study is to analyze the robustness of the network DEEB, and then propose alternatives for network connectivity, which may contribute to the increase of robustness in maintenance projects and/or expansion of the network, in other words our goal is to make the network to proof the blackouts or improve the endurance the network against the blackouts. For this purpose, we use information from the structural properties of networks, computer modeling and simulation. (author)

  1. Impact assessment of the 1977 New York City blackout. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Corwin, J. L.; Miles, W. T.

    1978-07-01

    This study was commissioned by the Division of Electric Energy Systems (EES), Department of Energy (DOE) shortly after the July 13, 1977 New York City Blackout. The objectives were two-fold: to assess the availability and collect, where practical, data pertaining to a wide variety of impacts occurring as a result of the blackout; and to broadly define a framework to assess the value of electric power reliability from consideration of the blackout and its effects on individuals, businesses, and institutions. The impacts were complex and included both economic and social costs. In order to systematically classify the most significant of these impacts and provide guidance for data collection, impact classification schemes were developed. Major economic impact categories examined are business; government; utilities (Consolidated Edison); insurance industry; public health services; and other public services. Impacts were classified as either direct or indirect depending upon whether the impact was due to a cessation of electricity or a response to that cessation. The principal economic costs of the blackout are shown. Social impacts, i.e., the changes in social activities and adaptations to these changes were particularly significant in New York due to its unique demographic and geographic characteristics. The looting and arson that accompanied the blackout set aside the NYC experience from other similar power failures. (MCW)

  2. Reentry blackout prediction for atmospheric reentry demonstrator mission considering uncertainty in chemical reaction rate model

    Science.gov (United States)

    Jung, Minseok; Kihara, Hisashi; Abe, Ken-ichi; Takahashi, Yusuke

    2018-01-01

    A numerical simulation model of plasma flows and electromagnetic waves around a vehicle was developed to predict a radio frequency blackout. Plasma flows in the shock layer and the wake region were calculated using a computational fluid dynamics technique with a three-dimensional model. A finite-catalytic wall condition known to affect plasma properties, such as the number density of electrons, was considered for accurate prediction. A parametric study was performed to investigate the effect of uncertainty in the chemical reaction rate model on evaluating a radio frequency blackout. The behavior of electromagnetic waves in plasma was investigated using a frequency-dependent finite-difference time-domain method. Numerical simulations of reentry blackout were performed for the Atmospheric Reentry Demonstrator mission at various altitudes. The plasma flows and the complex movement of electromagnetic waves around the Atmospheric Reentry Demonstrator vehicle were clarified. The predicted signal loss profile was then directly compared with the experimental flight data to validate the present models. The numerical results generally reproduced the trends over altitudes of the measured data. It is suggested that the present simulation model can be used to investigate the radio frequency blackout and signal loss of electromagnetic waves in the communication of a reentry vehicle. It was confirmed that high associative ionization reaction rates contribute to reducing the electron density in the wake region and radio frequency blackout. It is suggested that the accuracy of predicting the signal loss improved when considering the uncertainty in the chemical reaction model for associative ionizations.

  3. Learning from the blackouts. Transmission system security in competitive electricity markets

    Energy Technology Data Exchange (ETDEWEB)

    none

    2005-07-01

    Electricity market reform has fundamentally changed the environment for maintaining reliable and secure power supplies. Growing inter-regional trade has placed new demands on transmission systems, creating a more integrated and dynamic network environment with new real-time challenges for reliable and secure transmission system operation. Despite these fundamental changes, system operating rules and practices remain largely unchanged. The major blackouts of 2003 and 2004 raised searching questions about the appropriateness of these arrangements. Management of system security needs to be transformed to maintain reliable electricity services in this more dynamic operating environment. These challenges raise fundamental issues for policymakers. This publication presents case studies drawn from recent large-scale blackouts in Europe, North America, and Australia. It concludes that a comprehensive, integrated policy response is required to avoid preventable large-scale blackouts in the future.

  4. Development of Abnormal Operating Strategies for Station Blackout in Shutdown Operating Mode in Pressurized Water Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Duk-Joo; Lee, Seung-Chan; Sung, Je-Joong; Ha, Sang-Jun [KHNP CRI, Daejeon (Korea, Republic of); Hwang, Su-Hyun [FNC Tech. Co., Yongin (Korea, Republic of)

    2016-10-15

    Loss of all AC power is classified as one of multiple failure accident by regulatory guide of Korean accident management program. Therefore we need develop strategies for the abnormal operating procedure both of power operating and shutdown mode. This paper developed abnormal operating guideline for loss of all AC power by analysis of accident scenario in pressurized water reactor. This paper analyzed the loss of ultimate heat sink (LOUHS) in shutdown operating mode and developed the operating strategy of the abnormal procedure. Also we performed the analysis of limiting scenarios that operator actions are not taken in shutdown LOUHS. Therefore, we verified the plant behavior and decided operator action to taken in time in order to protect the fuel of core with safety. From the analysis results of LOUHS, the fuel of core maintained without core uncovery for 73 minutes respectively for opened RCS states after the SBO occurred. Therefore, operator action for the emergency are required to take in 73 minutes for opened RCS state. Strategy is to cooldown by using spent fuel pool cooling system. This method required to change the plant design in some plant. In RCS boundary closed state, first abnormal operating strategy in shutdown LOUHS is first abnormal operating strategy in shutdown LOUHS is to remove the residual heat of core by steam dump flow and auxiliary feedwater of SG.

  5. A Flooding Induced Station Blackout Analysis for a Pressurized Water Reactor Using the RISMC Toolkit

    Directory of Open Access Journals (Sweden)

    Diego Mandelli

    2015-01-01

    Full Text Available In this paper we evaluate the impact of a power uprate on a pressurized water reactor (PWR for a tsunami-induced flooding test case. This analysis is performed using the RISMC toolkit: the RELAP-7 and RAVEN codes. RELAP-7 is the new generation of system analysis codes that is responsible for simulating the thermal-hydraulic dynamics of PWR and boiling water reactor systems. RAVEN has two capabilities: to act as a controller of the RELAP-7 simulation (e.g., component/system activation and to perform statistical analyses. In our case, the simulation of the flooding is performed by using an advanced smooth particle hydrodynamics code called NEUTRINO. The obtained results allow the user to investigate and quantify the impact of timing and sequencing of events on system safety. In addition, the impact of power uprate is determined in terms of both core damage probability and safety margins.

  6. Modeling of a Flooding Induced Station Blackout for a Pressurized Water Reactor Using the RISMC Toolkit

    Energy Technology Data Exchange (ETDEWEB)

    Mandelli, Diego; Prescott, Steven R; Smith, Curtis L; Alfonsi, Andrea; Rabiti, Cristian; Cogliati, Joshua J; Kinoshita, Robert A

    2011-07-01

    In the Risk Informed Safety Margin Characterization (RISMC) approach we want to understand not just the frequency of an event like core damage, but how close we are (or are not) to key safety-related events and how might we increase our safety margins. The RISMC Pathway uses the probabilistic margin approach to quantify impacts to reliability and safety by coupling both probabilistic (via stochastic simulation) and mechanistic (via physics models) approaches. This coupling takes place through the interchange of physical parameters and operational or accident scenarios. In this paper we apply the RISMC approach to evaluate the impact of a power uprate on a pressurized water reactor (PWR) for a tsunami-induced flooding test case. This analysis is performed using the RISMC toolkit: RELAP-7 and RAVEN codes. RELAP-7 is the new generation of system analysis codes that is responsible for simulating the thermal-hydraulic dynamics of PWR and boiling water reactor systems. RAVEN has two capabilities: to act as a controller of the RELAP-7 simulation (e.g., system activation) and to perform statistical analyses (e.g., run multiple RELAP-7 simulations where sequencing/timing of events have been changed according to a set of stochastic distributions). By using the RISMC toolkit, we can evaluate how power uprate affects the system recovery measures needed to avoid core damage after the PWR lost all available AC power by a tsunami induced flooding. The simulation of the actual flooding is performed by using a smooth particle hydrodynamics code: NEUTRINO.

  7. Tests of Shaft Seal Systems of Circulation Pumps during Station Blackout

    Energy Technology Data Exchange (ETDEWEB)

    Beisiegel, A.; Foppe, F.; Wich, M.

    2014-07-01

    AREVA GmbH operates a unique Thermal-hydraulic plat form in Germany, France and USA. It is recognised as a test body according to ISO 17025. The Deutsche Akkreditierungsstelle GmbH (DAkkS - German Society for Accreditation) has also certified the Thermal-hydraulic platform as an independent inspection body Type C according to ISO 17020. A part of this platform is the Component Laboratory located in Karlstein, Germany which is in operation since more than 50 years. The testing activities cover a wide range as: Critical Heat Flux Tests, Valve Testing and Environmental Qualification for safety related components. Since 2011 the Component Qualification Karlstein extended their testing scope for different types of Shaft Seal Systems. (Author)

  8. Modelling of blackout sequence at Atucha-1 using the MARCH3 code; Modelado de una sequencia de blackout en Atucha 1 con el codigo MARCH3

    Energy Technology Data Exchange (ETDEWEB)

    Baron, J. [Ente Nacional Regulador Nuclear (ENREN), Buenos Aires (Argentina); Bastianelli, B. [Universidad Nacional de Cuyo, Mendoza (Argentina). Facultad de Ingenieria. Centro de Estudios de Ingenieria Asistida por Computadora

    1997-12-01

    This paper presents the modelling of a complete blackout at the Atucha-1 NPP as preliminary phase for a Level II safety probabilistic analysis. The MARCH3 code of the STCP (Source Term Code Package) is used, based on a plant model made in accordance with particularities of the plant design. The analysis covers all the severe accident phases. The results allow to view the time sequence of the events, and provide the basis for source term studies. (author). 6 refs., 2 figs.

  9. Reducing hypothetical bias in choice experiments

    DEFF Research Database (Denmark)

    Ladenburg, Jacob; Olsen, Søren Bøye; Nielsen, Rasmus Christian Fejer

    eliminate some of the hypothetical bias. The present paper tests an addition to Cheap Talk, an Opt-Out Reminder. The Opt-Out Reminder is an objective short script presented prior to the choice sets, prompting the respondent to choose the opt-out alternative, if he/she finds the proposed policy generated...... alternatives in a choice set too expensive. The results suggest that adding an Opt-Out Reminder to Cheap Talk can in fact reduce hypothetical bias even further and reduces some of the ineffectiveness of CT in relation to the survey bid range and experienced respondents....

  10. Expression analysis and characteristics of hypothetical protein ...

    African Journals Online (AJOL)

    W Zhang, H Lan, T Wu, C Jiang, Z Lv, Z Nie, X Wu, Y Zhang. Abstract. We cloned a cDNA from silkworm pupal cDNA library and found that, it encodes LOC778500 protein (a “hypothetical protein” in the National Center for Biotechnology Information (NCBI) database). Thus, we named it BmLOC778500 (Bombyx mori ...

  11. Control and prediction for blackouts caused by frequency collapse in smart grids.

    Science.gov (United States)

    Wang, Chengwei; Grebogi, Celso; Baptista, Murilo S

    2016-09-01

    The electric power system is one of the cornerstones of modern society. One of its most serious malfunctions is the blackout, a catastrophic event that may disrupt a substantial portion of the system, playing havoc to human life and causing great economic losses. Thus, understanding the mechanisms leading to blackouts and creating a reliable and resilient power grid has been a major issue, attracting the attention of scientists, engineers, and stakeholders. In this paper, we study the blackout problem in power grids by considering a practical phase-oscillator model. This model allows one to simultaneously consider different types of power sources (e.g., traditional AC power plants and renewable power sources connected by DC/AC inverters) and different types of loads (e.g., consumers connected to distribution networks and consumers directly connected to power plants). We propose two new control strategies based on our model, one for traditional power grids and another one for smart grids. The control strategies show the efficient function of the fast-response energy storage systems in preventing and predicting blackouts in smart grids. This work provides innovative ideas which help us to build up a robuster and more economic smart power system.

  12. Control and prediction for blackouts caused by frequency collapse in smart grids

    Science.gov (United States)

    Wang, Chengwei; Grebogi, Celso; Baptista, Murilo S.

    2016-09-01

    The electric power system is one of the cornerstones of modern society. One of its most serious malfunctions is the blackout, a catastrophic event that may disrupt a substantial portion of the system, playing havoc to human life and causing great economic losses. Thus, understanding the mechanisms leading to blackouts and creating a reliable and resilient power grid has been a major issue, attracting the attention of scientists, engineers, and stakeholders. In this paper, we study the blackout problem in power grids by considering a practical phase-oscillator model. This model allows one to simultaneously consider different types of power sources (e.g., traditional AC power plants and renewable power sources connected by DC/AC inverters) and different types of loads (e.g., consumers connected to distribution networks and consumers directly connected to power plants). We propose two new control strategies based on our model, one for traditional power grids and another one for smart grids. The control strategies show the efficient function of the fast-response energy storage systems in preventing and predicting blackouts in smart grids. This work provides innovative ideas which help us to build up a robuster and more economic smart power system.

  13. Acute alcohol effects on narrative recall and contextual memory: an examination of fragmentary blackouts.

    Science.gov (United States)

    Wetherill, Reagan R; Fromme, Kim

    2011-08-01

    The present study examined the effects of alcohol consumption on narrative recall and contextual memory among individuals with and without a history of fragmentary blackouts in an attempt to better understand why some individuals experience alcohol-induced memory impairments whereas others do not, even at comparable blood alcohol concentrations (BACs). Standardized beverage (alcohol and no alcohol) administration procedures and neuropsychological assessments measured narrative recall and context memory performance before and after alcohol consumption in individuals with (n=44) and without (n=44) a history of fragmentary blackouts. Findings indicate that acute alcohol intoxication led to impairments in free recall, but not next-day cued recall. Further, participants showed similar memory performance when sober, but individuals who consumed alcohol and had a positive history of fragmentary blackouts showed greater contextual memory impairments than those who had not previously experienced a fragmentary blackout. Thus, it appears that some individuals may have an inherent vulnerability to alcohol-induced memory impairments due to alcohol's effects on contextual memory processes. Copyright © 2011 Elsevier Ltd. All rights reserved.

  14. Alcohol-induced blackout as a criminal defense or mitigating factor: an evidence-based review and admissibility as scientific evidence.

    Science.gov (United States)

    Pressman, Mark R; Caudill, David S

    2013-07-01

    Alcohol-related amnesia--alcohol blackout--is a common claim of criminal defendants. The generally held belief is that during an alcohol blackout, other cognitive functioning is severely impaired or absent. The presentation of alcohol blackout as scientific evidence in court requires that the science meets legal reliability standards (Frye, FRE702/Daubert). To determine whether "alcohol blackout" meets these standards, an evidence-based analysis of published scientific studies was conducted. A total of 26 empirical studies were identified including nine in which an alcohol blackout was induced and directly observed. No objective or scientific method to verify the presence of an alcoholic blackout while it is occurring or to confirm its presence retrospectively was identified. Only short-term memory is impaired and other cognitive functions--planning, attention, and social skills--are not impaired. Alcoholic blackouts would not appear to meet standards for scientific evidence and should not be admissible. © 2013 American Academy of Forensic Sciences.

  15. Lightning rod ionizing natural ionca - Ionic electrode active trimetallictriac of grounding - Definitive and total solution against 'blackouts' and electrical faults generated by atmospheric charges (lightning)

    Energy Technology Data Exchange (ETDEWEB)

    Cabareda, Luis

    2010-09-15

    The Natural Ionizing System of Electrical Protection conformed by: Lightning Rod Ionizing Natural Ionca and Ionic Electrode Active Trimetallic Triac of Grounding offers Total Protection, Maximum Security and Zero Risk to Clinics, Hospitals, Integral Diagnostic Center, avoiding ''the burning'' of Electronics Cards; Refineries, Tanks and Stations of Fuel Provision; Electrical Substations, Towers and Transmission Lines with transformer protection, motors, elevators, A/C, mechanicals stairs, portable and cooling equipment, electrical plants, others. This New High Technology is the solution to the paradigm of Benjamin Franklin and it's the mechanism to end the 'Blackouts' that produces so many damages and losses throughout the world.

  16. Evaluating the Effect of a Campus-wide Social Norms Marketing Intervention on Alcohol Use Perceptions, Consumption, and Blackouts.

    Science.gov (United States)

    Su, Jinni; Hancock, Linda; Wattenmaker McGann, Amanda; Alshagra, Mariam; Ericson, Rhianna; Niazi, Zackaria; Dick, Danielle M; Adkins, Amy

    2017-09-22

    Objective To evaluate the effect of a campus-wide social norms marketing intervention on alcohol-use perceptions, consumption, and blackouts at a large, urban, public university. Participants 4,172 college students (1,208 freshmen, 1,159 sophomores, 953 juniors, 852 seniors) who completed surveys in Spring 2015 for the Spit for Science Study, a longitudinal study of students' substance use and emotional health. Methods Participants were emailed an online survey that queried campaign readership, perception of peer alcohol use, alcohol consumption, frequency of consumption and frequency of blackouts. Associations between variables were evaluated using path analysis. Results We found that campaign readership was associated with more accurate perceptions of peer alcohol use, which, in turn, was associated with self-reported lower number of drinks per sitting and experiencing fewer blackouts. Conclusions This evaluation supports the use of social norms marketing as a population-level intervention to correct alcohol use misperceptions and reduce blackouts.

  17. On power system blackout modeling and analysis based on self-organized criticality

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    This paper makes a comprehensive survey on power system blackout modeling and analysis based on SOC (self-organized criticality). Firstly,a generalized SOC theory from the viewpoint of cybernetics is introduced. Then the evolution model of power system and its relative mathematical description,which serves as a concrete example of the proposed generalized SOC,are given. Secondly,five blackout models capturing various critical properties of power systems in different time-scales are listed. Finally,this paper analyzes SOC in power systems,such as,the revelation of criticalities of proposed models in both micro-scale and macro-scale which can be used to assess the security of power system,and cas-cading failures process.

  18. Communication: Hypothetical ultralow-density ice polymorphs

    Science.gov (United States)

    Matsui, Takahiro; Hirata, Masanori; Yagasaki, Takuma; Matsumoto, Masakazu; Tanaka, Hideki

    2017-09-01

    More than 300 kinds of porous ice structures derived from zeolite frameworks and space fullerenes are examined using classical molecular dynamics simulations. It is found that a hypothetical zeolitic ice phase is less dense and more stable than the sparse ice structures reported by Huang et al. [Chem. Phys. Lett. 671, 186 (2017)]. In association with the zeolitic ice structure, even less dense structures, "aeroices," are proposed. It is found that aeroices are the most stable solid phases of water near the absolute zero temperature under negative pressure.

  19. Prediction Performance of Blackout and Plasma Attenuation in Atmospheric Reentry Demonstrator Mission

    OpenAIRE

    Takahashi, Yusuke; Yamada, Kazuhiko; Abe, Takashi

    2014-01-01

    A numerical simulation model that combines the plasma ows and electromagnetic waves around a reentry vehicle during atmospheric reentry was developed to evaluate the radio frequency blackout and plasma attenuation. The physical properties of the plasma ow in the shock layer and wake region were obtained using a computational uid dynamics technique. The electromagnetic waves were expressed using a frequency- dependent nite-difference time-domain method with the plasma ...

  20. High-Tech, Low-Tech, No-Tech: Communications Strategies During Blackouts

    Science.gov (United States)

    2013-12-01

    straight-line “ derecho ”1 windstorms hit the mid-Atlantic region of the United States. In the National Capital Region (NCR), many residents lost...flooding (Grand Forks, North Dakota, 1997), rolling blackouts (California, 2001), multi-state power outage (Ohio and seven other 1 “ Derecho ” is a...flawlessly throughout the 2012 “super- derecho ”20 storm event.21 During its 2012 typhoon, the government of the Philippines used Twitter to

  1. Acute Alcohol Effects on Narrative Recall and Contextual Memory: An Examination of Fragmentary Blackouts

    OpenAIRE

    Wetherill, Reagan R.; Fromme, Kim

    2011-01-01

    The present study examined the effects of alcohol consumption on narrative recall and contextual memory among individuals with and without a history of fragmentary blackouts in an attempt to better understand why some individuals experience alcohol-induced memory impairments whereas others do not, even at comparable blood alcohol concentrations (BACs). Standardized beverage (alcohol, no alcohol) administration procedures and neuropsychological assessments measured narrative recall and context...

  2. Signs of hypothetical fauna of Venus

    Directory of Open Access Journals (Sweden)

    Ksanfomality Leonid V.

    2014-04-01

    Full Text Available On March 1 and 5, 1982, experiments in television photography instrumented by the landers VENERA-13 and -14, yielded 37 panoramas (or their fragments of the Venus surface at the landing site. Over the past 31 years, no similar missions have been sent to Venus. Using a modern technique the VENERA panoramas were re-examined. A new analysis of Venusian surface panoramas’ details has been made. A few relatively large objects of hypothetical fauna of Venus were found with size ranging from a decimeter to half meter and with unusual morphology. Treated once again VENERA-14 panoramic images revealed ‘amisada’ object about 15 cm in size possessing apparent terramorphic features. The amisada’s body stands out with its lizard-like shape against the stone plates close by. The amisada can be included into the list of the most significant findings of the hypothetical Venusian fauna. The amisada’s body show slow movements, which is another evidence of the Venusian fauna’s very slow style of activity, which appears to be associated with its energy constraints or, and that is more likely, with the properties of its internal medium. The terramorphic features of the Venusian fauna, if they are confirmed, may point out at outstandingly important and yet undiscovered general laws of the animated nature on different planets.

  3. Lexical exponents of hypothetical modality in Polish and Lithuanian

    OpenAIRE

    Roman Roszko

    2015-01-01

    Lexical exponents of hypothetical modality in Polish and Lithuanian The article focuses on the lexical exponents of hypothetical modality in Polish and Lithuanian. The purpose for comparing and contrasting the lexical exponents of hypothetical modality is not only to identify all the lexemes in both languages but also find the answer to the following question: whether the morphological exponents of hypothetical modality (so-called modus relativus) familiar to the Lithuanian language have/...

  4. Testing QCD with Hypothetical Tau Leptons

    Energy Technology Data Exchange (ETDEWEB)

    Brodsky, Stanley J.

    1998-10-21

    We construct new tests of perturbative QCD by considering a hypothetical {tau} lepton of arbitrary mass, which decays hadronically through the electromagnetic current. We can explicitly compute its hadronic width ratio directly as an integral over the e{sup +}e{sup -} annihilation cross section ratio, R{sub e{sup +}e{sup -}}. Furthermore, we can design a set of commensurate scale relations and perturbative QCD tests by varying the weight function away from the form associated with the V-A decay of the physical {tau}. This method allows the wide range of the R{sub e{sup +}e{sup -}} data to be used as a probe of perturbative QCD.

  5. Hypothetical conflict situations with friends and peers

    Directory of Open Access Journals (Sweden)

    Petrović Danijela S.

    2012-01-01

    Full Text Available This paper deals with age and sex differences in preferred strategies of conflict resolution in friendship and peer relationships. The study was conducted on the sample of 286 adolescents. Conflict resolution strategies have been investigated by the method of hypothetical conflict situations. For the purposes of this research, we have created an instrument consisting of 20 hypothetical situations, with the following subjects of conflict: breaking the agreement, non-compliance with opinion differences, provocations, dishonesty and stubbornness. Conflict resolution strategies we examined were giving in, withdrawal, competition and problem solving. The results have shown that problem solving is the dominant strategy of adolescents in conflict with friends, while in peer conflicts they more often opt for competition. Age differences are reflected in the fact that older adolescents are more likely to choose problem solving than younger, whereas younger adolescents are more likely to choose a retreat (withdrawal strategy than older. Girls are more prone to choosing problem solving than boys, who, on the other hand, tend to withdraw more than girls. Also, gender of the other person in the conflict is proved to be important - in conflict with male peers, adolescents choose competition to a greater extent and withdraw to a minor extent, compared to when they are in conflict with female peers. The results have practical implications as well. In programs for teaching constructive conflict resolution that are designed for younger adolescents there should be more emphasis on empowerment and training for assertive behaviour. In addition, when teaching about constructive conflict resolution strategies, it is important to consider the gender of adolescents as well as the gender of the person with whom they are in conflict.

  6. Real-time stability in power systems techniques for early detection of the risk of blackout

    CERN Document Server

    Savulescu, Savu

    2014-01-01

    This pioneering volume has been updated and enriched to reflect the state-of-the-art in blackout prediction and prevention. It documents and explains background and algorithmic aspects of the most successful steady-state, transient and voltage stability solutions available today in real-time. It also describes new, cutting-edge stability applications of synchrophasor technology, and captures industry acceptance of metrics and visualization tools that quantify and monitor the distance to instability. Expert contributors review a broad spectrum of additionally available techniques, such as traje

  7. Characterization of weakly ionized argon flows for radio blackout mitigation experiments

    Science.gov (United States)

    Steffens, L.; Koch, U.; Esser, B.; Gülhan, A.

    2017-06-01

    For reproducing the so-called E × B communication blackout mitigation scheme inside the L2K arc heated facility of the DLR in weakly ionized argon §ows, a §at plate model has been equipped with a superconducting magnet, electrodes, and a setup comprising microwave plasma transmission spectroscopy (MPTS). A thorough characterization of the weakly ionized argon §ow has been performed including the use of microwave interferometry (MWI), Langmuir probe measurements, Pitot probe pro¦les, and spectroscopic methods like diode laser absorption spectroscopy (DLAS) and emission spectroscopy.

  8. Formaldehyde as hypothetical primer of biohomochirality

    Energy Technology Data Exchange (ETDEWEB)

    Goldanskii, V.I. [N. N. Semenov Institute of Chemical Physics of the Russian Academy of Sciences, Kosygin Street 4, Moscow, 117334 (Russia)

    1996-07-01

    One of the most intriguing and crucial problems of the prebiotic evolution and the origin of life is the explanation of the origin of biohomochirality. A scheme of conversions originated by formaldehyde (FA) as hypothetical primer of biohomochirality is proposed. The merit of FA as executor of this function is based -inter alia - on the distinguished role of FA as one of the earliest and simplest molecules in both warm, terrestrial and cold, extraterrestrial scenarios of the origin of life. The confirmation of the role of FA as primer of biohomochirality would support the option of an RNA world as an alternative to the protein world. The suggested hypothesis puts forward for the first time a concrete sequence of chemical reactions which can lead to biohomochirality. The spontaneous breaking of the mirror symmetry is secured by the application of the well-known Frank scheme (combination of autocatalysis and {open_quote}{open_quote}annihilation{close_quote}{close_quote} of L and D enantiomers) to the series of interactions of FA {open_quote}{open_quote}trimers{close_quote}{close_quote} (i.e. C{sub 3}H{sub 6}O{sub 3} compounds) of (aaa), (apa) and (app) types, where the monomeric groups (a) means {open_quote}{open_quote}achirons{close_quote}{close_quote} (a=CH{sub n}, n{ge}2 and C=M, M=C,O) and (p) mean {open_quote}{open_quote}prochirons{close_quote}{close_quote} (p=HC{asterisk}OM, M=H,C). {copyright} {ital 1996 American Institute of Physics.}

  9. An adaptive reentry guidance method considering the influence of blackout zone

    Science.gov (United States)

    Wu, Yu; Yao, Jianyao; Qu, Xiangju

    2018-01-01

    Reentry guidance has been researched as a popular topic because it is critical for a successful flight. In view that the existing guidance methods do not take into account the accumulated navigation error of Inertial Navigation System (INS) in the blackout zone, in this paper, an adaptive reentry guidance method is proposed to obtain the optimal reentry trajectory quickly with the target of minimum aerodynamic heating rate. The terminal error in position and attitude can be also reduced with the proposed method. In this method, the whole reentry guidance task is divided into two phases, i.e., the trajectory updating phase and the trajectory planning phase. In the first phase, the idea of model predictive control (MPC) is used, and the receding optimization procedure ensures the optimal trajectory in the next few seconds. In the trajectory planning phase, after the vehicle has flown out of the blackout zone, the optimal reentry trajectory is obtained by online planning to adapt to the navigation information. An effective swarm intelligence algorithm, i.e. pigeon inspired optimization (PIO) algorithm, is applied to obtain the optimal reentry trajectory in both of the two phases. Compared to the trajectory updating method, the proposed method can reduce the terminal error by about 30% considering both the position and attitude, especially, the terminal error of height has almost been eliminated. Besides, the PIO algorithm performs better than the particle swarm optimization (PSO) algorithm both in the trajectory updating phase and the trajectory planning phases.

  10. Silencing Boko Haram: Mobile Phone Blackout and Counterinsurgency in Nigeria’s Northeast region

    Directory of Open Access Journals (Sweden)

    Jacob Udo-Udo Jacob

    2015-03-01

    Full Text Available In the summer of 2013, the Nigerian military, as part of its counterinsurgency operations against Boko Haram insurgents, shut down GSM mobile telephony in three northeast states – Adamawa, Borno and Yobe. This article explores the rationale, impact and citizens’ opinion of the mobile phone blackout. It draws on focus group discussions with local opinion leaders and in-depth personal interviews with military and security insiders, as well as data of Boko Haram incidences before, during and after the blackout from military sources and conflict databases. It argues that, although the mobile phone shutdown was ‘successful’ from a military- tactical point of view, it angered citizens and engendered negative opinions toward the state and new emergency policies. While citizens developed various coping and circumventing strategies, Boko Haram evolved from an open network model of insurgency to a closed centralized system, shifting the center of its operations to the Sambisa Forest. This fundamentally changed the dynamics of the conflict. The shutdown demonstrated, among others, that while ICTs serve various desirable purposes for developing states, they will be jettisoned when their use challenges the state’s legitimacy and raison d'être, but not without consequences.

  11. Blackout Drinking Predicts Sexual Revictimization in a College Sample of Binge-Drinking Women.

    Science.gov (United States)

    Valenstein-Mah, Helen; Larimer, Mary; Zoellner, Lori; Kaysen, Debra

    2015-10-01

    Sexual victimization is prevalent on U.S. college campuses. Some women experience multiple sexual victimizations with heightened risk among those with prior victimization histories. One risk factor for sexual revictimization is alcohol use. Most research has focused on associations between alcohol consumption and revictimization. The current study's objective was to understand potential mechanisms by which drinking confers risk for revictimization. We hypothesized that specific drinking consequences would predict risk for revictimization above and beyond the quantity of alcohol consumed. There were 162 binge-drinking female students (mean age = 20.21 years, 71.3% White, 36.9% juniors) from the University of Washington who were assessed for baseline victimization (categorized as childhood vs. adolescent victimization), quantity of alcohol consumed, and drinking consequences experienced, then assessed 30 days later for revictimization. There were 40 (24.6%) women who were revictimized in the following 30 days. Results showed that blackout drinking at baseline predicted incapacitated sexual revictimization among women previously victimized as adolescents, after accounting for quantity of alcohol consumed (OR = 1.79, 95% CI [1.07, 3.01]). Other drinking consequences were not strongly predictive of revictimization. Adolescent sexual victimization was an important predictor of sexual revictimization in college women; blackout drinking may confer unique risk for revictimization. Copyright © 2015 Wiley Periodicals, Inc., A Wiley Company.

  12. Advanced validation of CFD-FDTD combined method using highly applicable solver for reentry blackout prediction

    Science.gov (United States)

    Takahashi, Yusuke

    2016-01-01

    An analysis model of plasma flow and electromagnetic waves around a reentry vehicle for radio frequency blackout prediction during aerodynamic heating was developed in this study. The model was validated based on experimental results from the radio attenuation measurement program. The plasma flow properties, such as electron number density, in the shock layer and wake region were obtained using a newly developed unstructured grid solver that incorporated real gas effect models and could treat thermochemically non-equilibrium flow. To predict the electromagnetic waves in plasma, a frequency-dependent finite-difference time-domain method was used. Moreover, the complicated behaviour of electromagnetic waves in the plasma layer during atmospheric reentry was clarified at several altitudes. The prediction performance of the combined model was evaluated with profiles and peak values of the electron number density in the plasma layer. In addition, to validate the models, the signal losses measured during communication with the reentry vehicle were directly compared with the predicted results. Based on the study, it was suggested that the present analysis model accurately predicts the radio frequency blackout and plasma attenuation of electromagnetic waves in plasma in communication.

  13. Analysis of Radio Frequency Blackout for a Blunt-Body Capsule in Atmospheric Reentry Missions

    Directory of Open Access Journals (Sweden)

    Yusuke Takahashi

    2016-01-01

    Full Text Available A numerical analysis of electromagnetic waves around the atmospheric reentry demonstrator (ARD of the European Space Agency (ESA in an atmospheric reentry mission was conducted. During the ARD mission, which involves a 70% scaled-down configuration capsule of the Apollo command module, radio frequency blackout and strong plasma attenuation of radio waves in communications with data relay satellites and air planes were observed. The electromagnetic interference was caused by highly dense plasma derived from a strong shock wave generated in front of the capsule because of orbital speed during reentry. In this study, the physical properties of the plasma flow in the shock layer and wake region of the ESA ARD were obtained using a computational fluid dynamics technique. Then, electromagnetic waves were expressed using a frequency-dependent finite-difference time-domain method using the plasma properties. The analysis model was validated based on experimental flight data. A comparison of the measured and predicted results showed good agreement. The distribution of charged particles around the ESA ARD and the complicated behavior of electromagnetic waves, with attenuation and reflection, are clarified in detail. It is suggested that the analysis model could be an effective tool for investigating radio frequency blackout and plasma attenuation in radio wave communication.

  14. Operative and technological management of super-large united power grids: lessons of major world's blackouts

    Science.gov (United States)

    Brinkis, K.; Kreslins, V.; Mutule, A.

    2014-02-01

    Power system (PS) blackouts still persist worldwide, evidencing that the existing protective structures need to be improved. The discussed requirements and criteria to be met for joint synchronous operation of large and super-large united PSs should be based on close co-ordination of operative and technological management of all PSs involved in order to ensure secure and stable electricity supply and minimise or avoid the threat of a total PS blackout. The authors analyse the July 2012 India blackout - the largest power outage in history, which affected over 620 million people, i.e. half of India's population and spread across its 22 states. The analysis is of a general character, being applicable also to similar blackouts that have occurred in Europe and worldwide since 2003. The authors summarise and develop the main principles and methods of operative and technological management aimed at preventing total blackouts in large and super-large PSs. Neskatoties uz sasniegumiem elektroenerģētikas jomā un energosistēmu nepārtrauktu modernizāciju, pasaulē regulāri notiek sabrukumu avārijas. Rakstā apskatīti lielu un superlielu energosistēmu apvienību savstarpējas sinhronas darbības nodrošinājuma prasības un kritēriji, kas pamatojas uz operatīvās un tehnoloģiskās vadības ciešu koordināciju starp energosistēmām. Savstarpējas sinhronas darbības nodrošinājuma prasībām un kritērijiem ir izšķiroša nozīme, lai panāktu elektroapgādes drošumu un stabilitāti katrā energosistēmā, kas darbojas apvienotas energosistēmas sastāvā. Šo prasību un kritēriju ievērošana sekmē totālo avāriju izcelšanās iespēju samazināšanu un to novēršanu. Indijas 2012.gada totālo avāriju un citu analogo avāriju Eiropā un Amerikā analīze un izvērtējums laika posmā no 2003.gada, deva iespēju apkopot un izstrādāt lielu un superlielu energosistēmu operatīvās un tehnoloģiskās vadības principus un metodoloģiju, lai novērstu vai

  15. In Silico screening for functional candidates amongst hypothetical proteins

    DEFF Research Database (Denmark)

    Desler, Claus; Suravajhala, Prashanth; Sanderhoff, May

    2009-01-01

    BACKGROUND: The definition of a hypothetical protein is a protein that is predicted to be expressed from an open reading frame, but for which there is no experimental evidence of translation. Hypothetical proteins constitute a substantial fraction of proteomes of human as well as of other...

  16. Predictive characterization of hypothetical proteins in Staphylococcus aureus NCTC 8325.

    Science.gov (United States)

    School, Kuana; Marklevitz, Jessica; K Schram, William; K Harris, Laura

    2016-01-01

    Staphylococcus aureus is one of the most common hospital acquired infections. It colonizes immunocompromised patients and with the number of antibiotic resistant strains increasing, medicine needs new treatment options. Understanding more about the proteins this organism uses would further this goal. Hypothetical proteins are sequences thought to encode a functional protein but for which little to no evidence of that function exists. About half of the genomic proteins in reference strain S. aureus NCTC 8325 are hypothetical. Since annotation of these proteins can lead to new therapeutic targets, a high demand to characterize hypothetical proteins is present. This work examines 35 hypothetical proteins from the chromosome of S. aureus NCTC 8325. Examination includes physiochemical characterization; sequence homology; structural homology; domain recognition; structure modeling; active site depiction; predicted protein-protein interactions; protein-chemical interactions; protein localization; protein stability; and protein solubility. The examination revealed some hypothetical proteins related to virulent domains and protein-protein interactions including superoxide dismutase, O-antigen, bacterial ferric iron reductase and siderophore synthesis. Yet other hypothetical proteins appear to be metabolic or transport proteins including ABC transporters, major facilitator superfamily, S-adenosylmethionine decarboxylase, and GTPases. Progress evaluating some hypothetical proteins, particularly the smaller ones, was incomplete due to limited homology and structural information in public repositories. These data characterizing hypothetical proteins will contribute to the scientific understanding of S. aureus by identifying potential drug targets and aiding in future drug discovery.

  17. Use of a helicon source for development of a re-entry blackout amelioration system

    Science.gov (United States)

    Lemmer, Kristina Marian

    During atmospheric re-entry and hypersonic flight, a bow shock forms around the vehicle leading edge. The air becomes super-heated as it passes through the shock, ionizes and forms a plasma sheath. This sheath prevents transmission of electromagnetic waves with frequencies similar to those used for radio communications. This phenomenon is referred to as the "communications blackout." In this dissertation, hypersonic communications blackout is studied, and a method for ameliorating the blackout is presented. A plasma source was designed and built for the purpose of simulating a re-entry plasma sheath. The plasma number density in a re-entry plasma sheath ranges from 1014 m--3 to 1018 m--3. A helicon source was chosen to simulate the conditions during atmospheric re-entry because it produces high-density plasma while maintaining that density downstream of the source. For this reason, and because the electron temperature downstream of the source (1 eV to 6.5 eV) is of a similar order of magnitude as that found during re-entry (0.4 eV to 1 eV), the helicon source was deemed appropriate. The Plasmadynamics and Electric Propulsion Laboratory helicon source was found to produce an upstream ion number density of 2.5 x 1019 m--3. Downstream, where experiments with the plasma amelioration system were performed, the number density ranged from 0.55 x 1017 m--3 to 3.3 x 1017 m--3, which represent altitudes between 65 km and 75 km. After characterizing the helicon plasma source, the amelioration system was placed downstream. The re-entry and hypersonic vehicle plasma communications (ReComm) system consists of a single solenoid electromagnet with two electrodes perpendicular to the magnetic field. The crossed fields direct plasma away from a region surrounding an antenna, creating a "window" in the sheath through which radio signals can pass. Langmuir probe, hairpin resonance probe and signal attenuation measurements show that the system is effective at reducing the number

  18. Early Onset Drinking Predicts Greater Level But Not Growth of Alcohol-Induced Blackouts Beyond the Effect of Binge Drinking During Emerging Adulthood.

    Science.gov (United States)

    Marino, Elise N; Fromme, Kim

    2016-03-01

    Early onset drinking is associated with later heavy drinking and related consequences. Early drinking onset and binge drinking are also independently associated with blackouts, which are periods of amnesia for events during a drinking episode. The objective of this study was to examine how early onset drinking relates to changes in the frequency of experiencing blackouts across 3 years controlling for year-specific binge drinking. Participants (N = 1,145; 67.9% female) from a 6-year, longitudinal study are included in these analyses. Measures of self-reported age at drinking onset included ages at first drink, first high, and first drunk, which were used to create a latent early onset drinking factor. Frequency of binge drinking and blackouts were assessed annually during Years 4 to 6. Overall, 69.2% of participants reported experiencing blackouts. After controlling for year-specific binge drinking, a growth curve model indicated that early onset drinkers reported more frequent blackouts at Year 4. There were, however, no significant effects of acceleration or deceleration in the frequency of blackouts across the 3 years. Early onset drinkers continued to experience more frequent blackouts compared with those who initiated alcohol use later, despite decreases in binge drinking over time. Early onset drinkers reported more frequent blackouts across all 3 years, indicating that early alcohol initiation predisposes those individuals to continue to experience more frequent blackouts, despite a decrease in their binge drinking. This may be due to various factors, such as altered hippocampal development and functioning resulting from early alcohol exposure. Copyright © 2016 by the Research Society on Alcoholism.

  19. In Silico screening for functional candidates amongst hypothetical proteins

    Directory of Open Access Journals (Sweden)

    Sanderhoff May

    2009-09-01

    Full Text Available Abstract Background The definition of a hypothetical protein is a protein that is predicted to be expressed from an open reading frame, but for which there is no experimental evidence of translation. Hypothetical proteins constitute a substantial fraction of proteomes of human as well as of other eukaryotes. With the general belief that the majority of hypothetical proteins are the product of pseudogenes, it is essential to have a tool with the ability of pinpointing the minority of hypothetical proteins with a high probability of being expressed. Results Here, we present an in silico selection strategy where eukaryotic hypothetical proteins are sorted according to two criteria that can be reliably identified in silico: the presence of subcellular targeting signals and presence of characterized protein domains. To validate the selection strategy we applied it on a database of human hypothetical proteins dating to 2006 and compared the proteins predicted to be expressed by our selecting strategy, with their status in 2008. For the comparison we focused on mitochondrial proteins, since considerable amounts of research have focused on this field in between 2006 and 2008. Therefore, many proteins, defined as hypothetical in 2006, have later been characterized as mitochondrial. Conclusion Among the total amount of human proteins hypothetical in 2006, 21% have later been experimentally characterized and 6% of those have been shown to have a role in a mitochondrial context. In contrast, among the selected hypothetical proteins from the 2006 dataset, predicted by our strategy to have a mitochondrial role, 53-62% have later been experimentally characterized, and 85% of these have actually been assigned a role in mitochondria by 2008. Therefore our in silico selection strategy can be used to select the most promising candidates for subsequent in vitro and in vivo analyses.

  20. In Silico screening for functional candidates amongst hypothetical proteins.

    Science.gov (United States)

    Desler, Claus; Suravajhala, Prashanth; Sanderhoff, May; Rasmussen, Merete; Rasmussen, Lene Juel

    2009-09-16

    The definition of a hypothetical protein is a protein that is predicted to be expressed from an open reading frame, but for which there is no experimental evidence of translation. Hypothetical proteins constitute a substantial fraction of proteomes of human as well as of other eukaryotes. With the general belief that the majority of hypothetical proteins are the product of pseudogenes, it is essential to have a tool with the ability of pinpointing the minority of hypothetical proteins with a high probability of being expressed. Here, we present an in silico selection strategy where eukaryotic hypothetical proteins are sorted according to two criteria that can be reliably identified in silico: the presence of subcellular targeting signals and presence of characterized protein domains. To validate the selection strategy we applied it on a database of human hypothetical proteins dating to 2006 and compared the proteins predicted to be expressed by our selecting strategy, with their status in 2008. For the comparison we focused on mitochondrial proteins, since considerable amounts of research have focused on this field in between 2006 and 2008. Therefore, many proteins, defined as hypothetical in 2006, have later been characterized as mitochondrial. Among the total amount of human proteins hypothetical in 2006, 21% have later been experimentally characterized and 6% of those have been shown to have a role in a mitochondrial context. In contrast, among the selected hypothetical proteins from the 2006 dataset, predicted by our strategy to have a mitochondrial role, 53-62% have later been experimentally characterized, and 85% of these have actually been assigned a role in mitochondria by 2008.Therefore our in silico selection strategy can be used to select the most promising candidates for subsequent in vitro and in vivo analyses.

  1. Comparing hypothetical versus non-hypothetical methods for measuring willingness to pay in a food context

    Directory of Open Access Journals (Sweden)

    Laura Martínez-Carrasco

    2015-12-01

    Full Text Available Choosing a valid procedure to measure willingness to pay (WTP is crucial for designating optimum price policies or for evaluating the demand for new products. This study compares two methods for obtaining WTP in a food context: a random nth price auction and an open-ended contingent valuation (CV question. Participants were regular salad tomato buyers of Alicante and they were randomly assigned to one of the two treatments. The products about which they would show their WTP were traditional tomato varieties. Both treatments were divided into three stages: in the first stage the only available information was a reference price for the tomatoes. In stages 2 and 3 we revealed the local origin and the organic grown of the tomatoes respectively. Our results show that in the auction the percentage of participants willing to pay the same or more than the reference price was between 20 and 30%. In the CV method this percentage was between 40 and 65%. The mean WTP in the auction, considering the whole of the individuals, was situated between 1.90 and 2.13 €/kg. These same results obtained through the CV were situated between 2.54 and 3.21 €/kg. The results confirmed the findings of previous papers in which the hypothetical bias of CV was clarified because it yields higher values for WTP than the auction, especially when referring to the number of individuals willing to pay more. Additionally, hedonic price models were estimated for the prices obtained by both methods with the result that in all the models, WTP was directly related to the price paid for the latest purchase of tomatoes.

  2. Comparing hypothetical versus non-hypothetical methods for measuring willingness to pay in a food context

    Energy Technology Data Exchange (ETDEWEB)

    Martínez-Carrasco, L.; Brugarolas, M.; Martínez-Poveda, A.; Ruiz-Martínez, J.J.

    2015-07-01

    Choosing a valid procedure to measure willingness to pay (WTP) is crucial for designating optimum price policies or for evaluating the demand for new products. This study compares two methods for obtaining WTP in a food context: a random nth price auction and an open-ended contingent valuation (CV) question. Participants were regular salad tomato buyers of Alicante and they were randomly assigned to one of the two treatments. The products about which they would show their WTP were traditional tomato varieties. Both treatments were divided into three stages: in the first stage the only available information was a reference price for the tomatoes. In stages 2 and 3 we revealed the local origin and the organic grown of the tomatoes respectively. Our results show that in the auction the percentage of participants willing to pay the same or more than the reference price was between 20 and 30%. In the CV method this percentage was between 40 and 65%. The mean WTP in the auction, considering the whole of the individuals, was situated between 1.90 and 2.13 €/kg. These same results obtained through the CV were situated between 2.54 and 3.21 €/kg. The results confirmed the findings of previous papers in which the hypothetical bias of CV was clarified because it yields higher values for WTP than the auction, especially when referring to the number of individuals willing to pay more. Additionally, hedonic price models were estimated for the prices obtained by both methods with the result that in all the models, WTP was directly related to the price paid for the latest purchase of tomatoes. (Author)

  3. Performance Evaluation of Target Detection with a Near-Space Vehicle-Borne Radar in Blackout Condition.

    Science.gov (United States)

    Li, Yanpeng; Li, Xiang; Wang, Hongqiang; Deng, Bin; Qin, Yuliang

    2016-01-06

    Radar is a very important sensor in surveillance applications. Near-space vehicle-borne radar (NSVBR) is a novel installation of a radar system, which offers many benefits, like being highly suited to the remote sensing of extremely large areas, having a rapidly deployable capability and having low vulnerability to electronic countermeasures. Unfortunately, a target detection challenge arises because of complicated scenarios, such as nuclear blackout, rain attenuation, etc. In these cases, extra care is needed to evaluate the detection performance in blackout situations, since this a classical problem along with the application of an NSVBR. However, the existing evaluation measures are the probability of detection and the receiver operating curve (ROC), which cannot offer detailed information in such a complicated application. This work focuses on such requirements. We first investigate the effect of blackout on an electromagnetic wave. Performance evaluation indexes are then built: three evaluation indexes on the detection capability and two evaluation indexes on the robustness of the detection process. Simulation results show that the proposed measure will offer information on the detailed performance of detection. These measures are therefore very useful in detecting the target of interest in a remote sensing system and are helpful for both the NSVBR designers and users.

  4. Fire Stations

    Data.gov (United States)

    Department of Homeland Security — Fire Stations in the United States Any location where fire fighters are stationed or based out of, or where equipment that such personnel use in carrying out their...

  5. Shifting college students' epistemological framing using hypothetical debate problems

    Science.gov (United States)

    Hu, Dehui; Rebello, N. Sanjay

    2014-06-01

    Developing expertise in physics problem solving requires the ability to use mathematics effectively in physical scenarios. Novices and experts often perceive the use of mathematics in physics differently. Students' perceptions and how they frame the use of mathematics in physics play an important role in their physics problem solving. In this study, we examined students' epistemological framing about using mathematics in physics in two types of problems: a conventional problem and a hypothetical debate problem. We found that when solving a conventional physics problem, students tended to frame problem solving in physics as rote equation chasing, i.e., plugging quantities into a memorized physics equation. In hypothetical debate problems, students were more likely to be involved in quantitative or qualitative sense making. We conclude that hypothetical debate problems might be used as an instructional tool for engaging students in sense making while using mathematics in physics. Thus, it might be potentially useful for developing more expertlike problem solving expertise.

  6. Shifting college students’ epistemological framing using hypothetical debate problems

    Directory of Open Access Journals (Sweden)

    Dehui Hu

    2014-05-01

    Full Text Available Developing expertise in physics problem solving requires the ability to use mathematics effectively in physical scenarios. Novices and experts often perceive the use of mathematics in physics differently. Students’ perceptions and how they frame the use of mathematics in physics play an important role in their physics problem solving. In this study, we examined students’ epistemological framing about using mathematics in physics in two types of problems: a conventional problem and a hypothetical debate problem. We found that when solving a conventional physics problem, students tended to frame problem solving in physics as rote equation chasing, i.e., plugging quantities into a memorized physics equation. In hypothetical debate problems, students were more likely to be involved in quantitative or qualitative sense making. We conclude that hypothetical debate problems might be used as an instructional tool for engaging students in sense making while using mathematics in physics. Thus, it might be potentially useful for developing more expertlike problem solving expertise.

  7. Lexical exponents of hypothetical modality in Polish and Lithuanian

    Directory of Open Access Journals (Sweden)

    Roman Roszko

    2015-11-01

    To analyse both the languages there is used the method of theoretical contrastive studies, which the most important features are: (1 orienting the studies from the content grounds to the formal grounds, (2 using a semantic interlanguage as tertium comparationis. First of all, the content of hypothetical modality and its definition and paraphrase is given here. Next, the gradational character of this category is discussed. There are distinguished six groups of lexemes expressing the corresponding degrees of hypothetical modality — from a shadow of uncertainty (minimal degree of probability to an almost complete certainty (maximum degree of probability. The experimental Polish-Lithuanian corpus is widely applied in the studies.

  8. Acute alcohol effects on contextual memory BOLD response: differences based on fragmentary blackout history.

    Science.gov (United States)

    Wetherill, Reagan R; Schnyer, David M; Fromme, Kim

    2012-06-01

    Contextual memory, or memory for source details, is an important aspect of episodic memory and has been implicated in alcohol-induced fragmentary blackouts (FBs). Little is known, however, about how neural functioning during contextual memory processes may differ between individuals with and without a history of FB. This study examined whether neural activation during a contextual memory task differed by history of FB and acute alcohol consumption. Twenty-four matched individuals with (FB+; n = 12) and without (FB-; n = 12) a history of FBs were recruited from a longitudinal study of alcohol use and behavioral risks and completed a laboratory beverage challenge followed by 2 functional magnetic resonance imaging (fMRI) sessions under no alcohol and alcohol (breath alcohol concentration = 0.08%) conditions. Task performance and brain hemodynamic activity during a block design contextual memory task were examined across 48 fMRI sessions. Groups demonstrated no differences in performance on the contextual memory task, yet exhibited different brain response patterns after alcohol intoxication. A significant FB group by beverage interaction emerged in bilateral dorsolateral prefrontal cortex and posterior parietal cortex with FB- individuals showing greater blood oxygenation level-dependent response after alcohol exposure (p Alcohol had differential effects on neural activity for FB+ and FB- individuals during recollection of contextual information, perhaps suggesting a neurobiological mechanism associated with alcohol-induced FB. Copyright © 2012 by the Research Society on Alcoholism.

  9. Transmission properties and physical mechanisms of X-ray communication for blackout mitigation during spacecraft reentry

    Science.gov (United States)

    Liu, Yunpeng; Li, Huan; Li, Yanlong; Hang, Shuang; Tang, Xiaobin

    2017-11-01

    Recent advances in X-ray science have witnessed the X-ray communication (XCOM), a new revolutionary technology first proposed by NASA since 2007. In combination with the advanced modulated X-ray source, XCOM shows a promising prospect for helping to alleviate the occurrence of inevitable blackout communication by using the regular radio frequency (RF) signal, paving the way towards realizing real-time communication during spacecraft reentry into atmosphere. Here, we acquired the detailed information of electron density distribution of plasma sheath encountered during vehicle reentry through Computational Fluid Dynamics simulation. Based on these derived parameters, Finite-difference Time-domain method was employed to investigate the transmission properties of X-rays through the plasma sheath, and the results indicated that X-ray transmission was not influenced by the reentry plasma sheath at different reentry altitudes and spacecraft surface positions compared with RF signal. In addition, 2D Particle-In-Cell simulation was also adopted to provide deeper insight into the transmission properties and physical mechanisms of X-ray carrier propagating through the plasma sheath, and results showed that the transmission coefficient was over 0.994 and the observation of plasma channel effect was also an important signature, which was of great importance to X-ray propagating through the plasma sheath.

  10. College Student Reporting Responses to Hypothetical and Actual Safety Concerns

    Science.gov (United States)

    Hollister, Brandon A.; Scalora, Mario J.; Hoff, Sarah M.; Hodges, Heath J.; Marquez, Allissa

    2017-01-01

    Campus violence prevention often includes proactively reducing crime through noticing and resolving concerning situations. Within these efforts, interventions aimed at enhancing reporting have been considered necessary. The current study explored several reporting influences on college students' responses to hypothetical and actual campus safety…

  11. Towards a formalization of the Hypothetical Monopoly Test

    NARCIS (Netherlands)

    Hinloopen, J.

    2008-01-01

    We provide the first formalization ever of the HypotheticalMonopoly Test (HMT) to identify relevant markets. This reveals that the outcome of the test crucially depends on the intensity of competition. For two types of competition intensities, one related to market structure and one related to firm

  12. Scaffolding for Argumentation in Hypothetical and Theoretical Biology Concepts

    Science.gov (United States)

    Weng, Wan-Yun; Lin, Yu-Ren; She, Hsiao-Ching

    2017-01-01

    The present study investigated the effects of online argumentation scaffolding on students' argumentation involving hypothetical and theoretical biological concepts. Two types of scaffolding were developed in order to improve student argumentation: continuous scaffolding and withdraw scaffolding. A quasi-experimental design was used with four…

  13. A Hypothetical Learning Trajectory for Conceptualizing Matrices as Linear Transformations

    Science.gov (United States)

    Andrews-Larson, Christine; Wawro, Megan; Zandieh, Michelle

    2017-01-01

    In this paper, we present a hypothetical learning trajectory (HLT) aimed at supporting students in developing flexible ways of reasoning about matrices as linear transformations in the context of introductory linear algebra. In our HLT, we highlight the integral role of the instructor in this development. Our HLT is based on the "Italicizing…

  14. Hypothetical Markets: Educational Application of Ronald Dworkin's "Sovereign Virtue"

    Science.gov (United States)

    Gough, Stephen

    2006-01-01

    The purpose of this paper is to consider, in principle and at the most general level, a particular possible approach to educational policy-making. This approach involves an education-specific application of the notion of hypothetical markets first developed in Ronald Dworkin's book "Sovereign Virtue: The theory and practice of equality" (2000).…

  15. Station Capacity

    DEFF Research Database (Denmark)

    Landex, Alex

    2011-01-01

    Stations are often limiting the capacity of railway networks. This is due to extra need of tracks when trains stand still, trains turning around, and conflicting train routes. Although stations are often the capacity bottlenecks, most capacity analysis methods focus on open line capacity. Therefore......, this paper presents methods to analyze station capacity. Four methods to analyze station capacity are developed. The first method is an adapted UIC 406 capacity method that can be used to analyze switch zones and platform tracks at stations that are not too complex. The second method examines the need...... the probability of conflicts and the minimum headway times into account. The last method analyzes how optimal platform tracks are used by examining the arrival and departure pattern of the trains. The developed methods can either be used separately to analyze specific characteristics of the capacity of a station...

  16. Amtrak Stations

    Data.gov (United States)

    Department of Homeland Security — Updated database of the Federal Railroad Administration's (FRA) Amtrak Station database. This database is a geographic data set containing Amtrak intercity railroad...

  17. Genome-wide screens for expressed hypothetical proteins

    DEFF Research Database (Denmark)

    Madsen, Claus Desler; Durhuus, Jon Ambæk; Rasmussen, Lene Juel

    2012-01-01

    A hypothetical protein (HP) is defined as a protein that is predicted to be expressed from an open reading frame, but for which there is no experimental evidence of translation. HPs constitute a substantial fraction of proteomes of human as well as of other organisms. With the general belief that...... that the majority of HPs are the product of pseudogenes, it is essential to have a tool with the ability of pinpointing the minority of HPs with a high probability of being expressed....

  18. Structural and Functional Annotation of Hypothetical Proteins of O139

    Directory of Open Access Journals (Sweden)

    Md. Saiful Islam

    2015-06-01

    Full Text Available In developing countries threat of cholera is a significant health concern whenever water purification and sewage disposal systems are inadequate. Vibrio cholerae is one of the responsible bacteria involved in cholera disease. The complete genome sequence of V. cholerae deciphers the presence of various genes and hypothetical proteins whose function are not yet understood. Hence analyzing and annotating the structure and function of hypothetical proteins is important for understanding the V. cholerae. V. cholerae O139 is the most common and pathogenic bacterial strain among various V. cholerae strains. In this study sequence of six hypothetical proteins of V. cholerae O139 has been annotated from NCBI. Various computational tools and databases have been used to determine domain family, protein-protein interaction, solubility of protein, ligand binding sites etc. The three dimensional structure of two proteins were modeled and their ligand binding sites were identified. We have found domains and families of only one protein. The analysis revealed that these proteins might have antibiotic resistance activity, DNA breaking-rejoining activity, integrase enzyme activity, restriction endonuclease, etc. Structural prediction of these proteins and detection of binding sites from this study would indicate a potential target aiding docking studies for therapeutic designing against cholera.

  19. The Threshold of the State: Civil Defence, the Blackout and the Home in Second World War Britain.

    Science.gov (United States)

    Greenhalgh, James

    2017-06-01

    This article reconsiders the way that the British state extended its control of the home during the Second World War, using the implementation of air raid precautions and the blackout as a lens through which to view the state's developing attitudes to domestic space. Presented here is not the familiar story of pitch-dark, dangerous streets or altered cityscapes of fear and destruction; instead, by examining personal testimony the article inverts traditional treatments of the blackout to look at the interior of dwellings, demonstrating how the realities of total warfare impinged upon the psychological elements that constituted the home. What emerges not only expands historical understandings of the wartime experience of civilians, it also shows civil defence measures as highly visible points on an often antagonistic trajectory of state interactions with citizens concerning the privacy and security of the dwelling in the modern city. The requirements of civil defence, I argue, were not merely the product of exceptional wartime circumstances, but symptomatic of long-standing attempts to open up dwellings to state scrutiny. These attempts had both a significant pre-war lineage and, crucially, implications beyond the end of the war in private homes and on social housing estates. © The Author [2017]. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  20. Characteristics of electromagnetic wave propagation in time-varying magnetized plasma in magnetic window region of reentry blackout mitigation

    Directory of Open Access Journals (Sweden)

    Hui Zhou

    2017-02-01

    Full Text Available The “magnetic window” is considered a promising means to eliminate reentry communication blackout. However, the turbulence of plasma sheath results in phase jitter and amplitude turbulence of electromagnetic (EM wave and may influence the eliminating effect. Therefore, the effect of fluctuating property of reentry plasma sheath on EM wave propagation when a magnetic field is used for eliminating blackout is investigated. For this purpose, a time-varying electron density model, which includes both temporal variation and spatial turbulence, is proposed. Hybrid matrix method is also employed to investigate the interaction between time-varying magnetized plasma and EM wave. The EM wave transmission coefficients in time-varying magnetized and unmagnetized plasmas are likewise compared. Simulation results show that amplitude variation and phase jitter also exist on transmitted EM wave, and the turbulent deviation increases as the degree of plasma fluctuates. Meanwhile, the fluctuation of transmitted EM wave attenuates at low-frequency passband and increases at high-frequency passband with the increasing magnetic field. That is, comparing with unmagnetized time-varying plasma, the fluctuation effect can be mitigated by using a magnetic field when the EM wave frequency is at low-frequency passband. However, the mitigating effect can be influenced by the nonuniformity of magnetic field.

  1. Numerical analysis on the effect of angle of attack on evaluating radio-frequency blackout in atmospheric reentry

    Science.gov (United States)

    Jung, Minseok; Kihara, Hisashi; Abe, Ken-ichi; Takahashi, Yusuke

    2016-06-01

    A three-dimensional numerical simulation model that considers the effect of the angle of attack was developed to evaluate plasma flows around reentry vehicles. In this simulation model, thermochemical nonequilibrium of flowfields is considered by using a four-temperature model for high-accuracy simulations. Numerical simulations were performed for the orbital reentry experiment of the Japan Aerospace Exploration Agency, and the results were compared with experimental data to validate the simulation model. A comparison of measured and predicted results showed good agreement. Moreover, to evaluate the effect of the angle of attack, we performed numerical simulations around the Atmospheric Reentry Demonstrator of the European Space Agency by using an axisymmetric model and a three-dimensional model. Although there were no differences in the flowfields in the shock layer between the results of the axisymmetric and the three-dimensional models, the formation of the electron number density, which is an important parameter in evaluating radio-frequency blackout, was greatly changed in the wake region when a non-zero angle of attack was considered. Additionally, the number of altitudes at which radio-frequency blackout was predicted in the numerical simulations declined when using the three-dimensional model for considering the angle of attack.

  2. The Rising Frequency of IT Blackouts Indicates the Increasing Relevance of IT Emergency Concepts to Ensure Patient Safety.

    Science.gov (United States)

    Sax, Ulrich; Lipprandt, M; Röhrig, R

    2016-11-10

    As many medical workflows depend vastly on IT support, great demands are placed on the availability and accuracy of the applications involved. The cases of IT failure through ransomware at the beginning of 2016 are impressive examples of the dependence of clinical processes on IT. Although IT risk management attempts to reduce the risk of IT blackouts, the probability of partial/total data loss, or even worse, data falsification, is not zero. The objective of this paper is to present the state of the art with respect to strategies, processes, and governance to deal with the failure of IT systems. This article is conducted as a narrative review. Worst case scenarios are needed, dealing with methods as to how to survive the downtime of clinical systems, for example through alternative workflows. These workflows have to be trained regularly. We categorize the most important types of IT system failure, assess the usefulness of classic counter measures, and state that most risk management approaches fall short on exactly this matter. To ensure that continuous, evidence-based improvements to the recommendations for IT emergency concepts are made, it is essential that IT blackouts and IT disasters are reported, analyzed, and critically discussed. This requires changing from a culture of shame and blame to one of error and safety in healthcare IT. This change is finding its way into other disciplines in medicine. In addition, systematically planned and analyzed simulations of IT disaster may assist in IT emergency concept development.

  3. Demand curves for hypothetical cocaine in cocaine-dependent individuals.

    Science.gov (United States)

    Bruner, Natalie R; Johnson, Matthew W

    2014-03-01

    Drug purchasing tasks have been successfully used to examine demand for hypothetical consumption of abused drugs including heroin, nicotine, and alcohol. In these tasks, drug users make hypothetical choices whether to buy drugs, and if so, at what quantity, at various potential prices. These tasks allow for behavioral economic assessment of that drug's intensity of demand (preferred level of consumption at extremely low prices) and demand elasticity (sensitivity of consumption to price), among other metrics. However, a purchasing task for cocaine in cocaine-dependent individuals has not been investigated. This study examined a novel Cocaine Purchasing Task and the relation between resulting demand metrics and self-reported cocaine use data. Participants completed a questionnaire assessing hypothetical purchases of cocaine units at prices ranging from $0.01 to $1,000. Demand curves were generated from responses on the Cocaine Purchasing Task. Correlations compared metrics from the demand curve to measures of real-world cocaine use. Group and individual data were well modeled by a demand curve function. The validity of the Cocaine Purchasing Task was supported by a significant correlation between the demand curve metrics of demand intensity and O max (determined from Cocaine Purchasing Task data) and self-reported measures of cocaine use. Partial correlations revealed that after controlling for demand intensity, demand elasticity and the related measure, P max, were significantly correlated with real-world cocaine use. Results indicate that the Cocaine Purchasing Task produces orderly demand curve data, and that these data relate to real-world measures of cocaine use.

  4. [Study on optimal model of hypothetical work injury insurance scheme].

    Science.gov (United States)

    Ye, Chi-yu; Dong, Heng-jin; Wu, Yuan; Duan, Sheng-nan; Liu, Xiao-fang; You, Hua; Hu, Hui-mei; Wang, Lin-hao; Zhang, Xing; Wang, Jing

    2013-12-01

    To explore an optimal model of hypothetical work injury insurance scheme, which is in line with the wishes of workers, based on the problems in the implementation of work injury insurance in China and to provide useful information for relevant policy makers. Multistage cluster sampling was used to select subjects: first, 9 small, medium, and large enterprises were selected from three cities (counties) in Zhejiang Province, China according to the economic development, transportation, and cooperation; then, 31 workshops were randomly selected from the 9 enterprises. Face-to-face interviews were conducted by trained interviewers using a pre-designed questionnaire among all workers in the 31 workshops. After optimization of hypothetical work injury insurance scheme, the willingness to participate in the scheme increased from 73.87%to 80.96%; the average willingness to pay for the scheme increased from 2.21% (51.77 yuan) to 2.38% of monthly wage (54.93 Yuan); the median willingness to pay for the scheme increased from 1% to 1.2% of monthly wage, but decreased from 35 yuan to 30 yuan. The optimal model of hypothetical work injury insurance scheme covers all national and provincial statutory occupational diseases and work accidents, as well as consultations about occupational diseases. The scheme is supposed to be implemented worldwide by the National Social Security Department, without regional differences. The premium is borne by the state, enterprises, and individuals, and an independent insurance fund is kept in the lifetime personal account for each of insured individuals. The premium is not refunded in any event. Compensation for occupational diseases or work accidents is unrelated to the enterprises of the insured workers but related to the length of insurance. The insurance becomes effective one year after enrollment, while it is put into effect immediately after the occupational disease or accident occurs. The optimal model of hypothetical work injury insurance

  5. Further tests of entreaties to avoid hypothetical bias in referendum contingent valuation

    Science.gov (United States)

    Thomas C. Brown; Icek Ajzen; Daniel Hrubes

    2003-01-01

    Over-estimation of willingness to pay in contingent markets has been attributed largely to hypothetical bias. One promising approach for avoiding hypothetical bias is to tell respondents enough about such bias that they self-correct for it. A script designed for this purpose by Cummings and Taylor was used in hypothetical referenda that differed in payment amount. In...

  6. 47 CFR 69.608 - Carrier Common Line hypothetical net balance.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Carrier Common Line hypothetical net balance... SERVICES (CONTINUED) ACCESS CHARGES Exchange Carrier Association § 69.608 Carrier Common Line hypothetical net balance. The hypothetical net balance shall be equal to a Carrier Common Line revenue requirement...

  7. Observation Station

    Science.gov (United States)

    Rutherford, Heather

    2011-01-01

    This article describes how a teacher integrates science observations into the writing center. At the observation station, students explore new items with a science theme and use their notes and questions for class writings every day. Students are exposed to a variety of different topics and motivated to write in different styles all while…

  8. Emergent transformation games: exploring social innovation agency and activation through the case of the Belgian electricity blackout threat

    Directory of Open Access Journals (Sweden)

    Bonno Pel

    2016-06-01

    Full Text Available The persistence of current societal problems has given rise to a quest for transformative social innovations. As social innovation actors seek to become change makers, it has been suggested that they need to play into impactful macrodevelopments or "game-changers". Here, we aim to deepen the understanding of the social innovation agency in these transformation games. We analyze assumptions about the game metaphor, invoking insights from actor-network theory. The very emergence of transformation games is identified as a crucial but easily overlooked issue. As explored through the recent electricity blackout threat in Belgium, some current transformation games are populated with largely passive players. This illustrative case demonstrates that socially innovative agency cannot be presupposed. In some transformation games, the crucial game-changing effect is to start the game by activating the players.

  9. Radiological Consequence Analyses Following a Hypothetical Severe Accident in Japan

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Juyub; Kim, Juyoul [FNC Technology Co., Yongin (Korea, Republic of)

    2016-10-15

    In order to reflect the lessons learned from the Fukushima Daiichi nuclear power plant accident, a simulator which is named NANAS (Northeast Asia Nuclear Accident Simulator) for overseas nuclear accident has been developed. It is composed of three modules: source-term estimation, atmospheric dispersion prediction and dose assessment. For the source-term estimation module, the representative reactor types were selected as CPR1000, BWR5 and BWR6 for China, Japan and Taiwan, respectively. Considering the design characteristics of each reactor type, the source-term estimation module simulates the transient of design basis accident and severe accident. The atmospheric dispersion prediction module analyzes the transport and dispersion of radioactive materials and prints out the air and ground concentration. Using the concentration result, the dose assessment module calculates effective dose and thyroid dose in the Korean Peninsula region. In this study, a hypothetical severe accident in Japan was simulated to demonstrate the function of NANAS. As a result, the radiological consequence to Korea was estimated from the accident. PC-based nuclear accident simulator, NANAS, has been developed. NANAS contains three modules: source-term estimation, atmospheric dispersion prediction and dose assessment. The source-term estimation module simulates a nuclear accident for the representative reactor types in China, Japan and Taiwan. Since the maximum calculation speed is 16 times than real time, it is possible to estimate the source-term release swiftly in case of the emergency. The atmospheric dispersion prediction module analyzes the transport and dispersion of radioactive materials in wide range including the Northeast Asia. Final results of the dose assessment module are a map projection and time chart of effective dose and thyroid dose. A hypothetical accident in Japan was simulated by NANAS. The radioactive materials were released during the first 24 hours and the source

  10. Large-scale screening of hypothetical metal-organic frameworks

    Science.gov (United States)

    Wilmer, Christopher E.; Leaf, Michael; Lee, Chang Yeon; Farha, Omar K.; Hauser, Brad G.; Hupp, Joseph T.; Snurr, Randall Q.

    2012-02-01

    Metal-organic frameworks (MOFs) are porous materials constructed from modular molecular building blocks, typically metal clusters and organic linkers. These can, in principle, be assembled to form an almost unlimited number of MOFs, yet materials reported to date represent only a tiny fraction of the possible combinations. Here, we demonstrate a computational approach to generate all conceivable MOFs from a given chemical library of building blocks (based on the structures of known MOFs) and rapidly screen them to find the best candidates for a specific application. From a library of 102 building blocks we generated 137,953 hypothetical MOFs and for each one calculated the pore-size distribution, surface area and methane-storage capacity. We identified over 300 MOFs with a predicted methane-storage capacity better than that of any known material, and this approach also revealed structure-property relationships. Methyl-functionalized MOFs were frequently top performers, so we selected one such promising MOF and experimentally confirmed its predicted capacity.

  11. Errors affect hypothetical intertemporal food choice in women.

    Directory of Open Access Journals (Sweden)

    Manuela Sellitto

    Full Text Available Growing evidence suggests that the ability to control behavior is enhanced in contexts in which errors are more frequent. Here we investigated whether pairing desirable food with errors could decrease impulsive choice during hypothetical temporal decisions about food. To this end, healthy women performed a Stop-signal task in which one food cue predicted high-error rate, and another food cue predicted low-error rate. Afterwards, we measured participants' intertemporal preferences during decisions between smaller-immediate and larger-delayed amounts of food. We expected reduced sensitivity to smaller-immediate amounts of food associated with high-error rate. Moreover, taking into account that deprivational states affect sensitivity for food, we controlled for participants' hunger. Results showed that pairing food with high-error likelihood decreased temporal discounting. This effect was modulated by hunger, indicating that, the lower the hunger level, the more participants showed reduced impulsive preference for the food previously associated with a high number of errors as compared with the other food. These findings reveal that errors, which are motivationally salient events that recruit cognitive control and drive avoidance learning against error-prone behavior, are effective in reducing impulsive choice for edible outcomes.

  12. Disability and marginal utility of income: evidence from hypothetical choices.

    Science.gov (United States)

    Tengstam, Sven

    2014-03-01

    It is often assumed that disability reduces the marginal utility of income. In this article, individuals' marginal utility of income in two states-(i) paralyzed in both legs from birth and (ii) not mobility impaired at all-is measured through hypothetical choices between imagined lotteries behind a so-called veil of ignorance. The outcomes of the lotteries include both income and disability status. It is found that most people have higher marginal utility when paralyzed than when not mobility impaired at all. The two marginal utilities are evaluated at the same levels of income. Having personal experience of mobility impairment and supporting the Left Party, the Social Democratic Party, the Green Party, or the Liberal Party are associated with having a higher marginal utility when paralyzed. The results suggest that more than full insurance of income losses connected to being disabled is optimal. The results further suggest that, given a utilitarian social welfare function, resources should be transferred to rather than from disabled people. Finally, if the transfers are not large enough to smooth out the marginal utilities of the disabled and the nondisabled, distributional weights based on disability status should be used in cost-benefit analysis. Copyright © 2013 John Wiley & Sons, Ltd.

  13. Real-Time Smart Grids Control for Preventing Cascading Failures and Blackout using Neural Networks: Experimental Approach for N-1-1 Contingency

    Science.gov (United States)

    Zarrabian, Sina; Belkacemi, Rabie; Babalola, Adeniyi A.

    2016-12-01

    In this paper, a novel intelligent control is proposed based on Artificial Neural Networks (ANN) to mitigate cascading failure (CF) and prevent blackout in smart grid systems after N-1-1 contingency condition in real-time. The fundamental contribution of this research is to deploy the machine learning concept for preventing blackout at early stages of its occurrence and to make smart grids more resilient, reliable, and robust. The proposed method provides the best action selection strategy for adaptive adjustment of generators' output power through frequency control. This method is able to relieve congestion of transmission lines and prevent consecutive transmission line outage after N-1-1 contingency condition. The proposed ANN-based control approach is tested on an experimental 100 kW test system developed by the authors to test intelligent systems. Additionally, the proposed approach is validated on the large-scale IEEE 118-bus power system by simulation studies. Experimental results show that the ANN approach is very promising and provides accurate and robust control by preventing blackout. The technique is compared to a heuristic multi-agent system (MAS) approach based on communication interchanges. The ANN approach showed more accurate and robust response than the MAS algorithm.

  14. Delay discounting of hypothetical monetary rewards with decoys.

    Science.gov (United States)

    Kowal, Benjamin P; Faulkner, Jennifer L

    2016-01-01

    The current research attempted to decrease individuals' rates of delay discounting by introducing decoys that are similar but inferior to delayed rewards. Two experiments in the current study compared patterns of delay discounting generated by repeated choices between two hypothetical monetary rewards in the absence or presence of a decoy. Binary questionnaires (i.e., decoy absent) included questions with two options: a smaller-sooner (SS) reward and a larger-later (LL) reward. Trinary questionnaires (i.e., decoy present) included questions with three options: an SS reward, an LL reward, and a decoy. If an option is at least as rewarding on every dimension of value as an alternative and the option is more rewarding than an alternative on at least one dimension, then the option is considered to dominate the alternative (Wedell, 1991). The first experiment assessed the influence of decoys dominated by LL rewards (LL(-) decoys), which were constructed to be similar (on the dimension of amount) but inferior (on the dimension of delay) to LL rewards. The second experiment examined the effects of counterbalancing the order of binary and trinary questionnaires. In the first experiment, participants discounted to a lesser degree when LL(-) decoys were present as compared to when they were absent. In the second experiment, participants only discounted to a lesser degree on trinary questionnaires with LL(-) decoys when they had not previously completed binary questionnaires. Patterns of discounting generated by binary questionnaires were similar to those generated by trinary questionnaires when decoys are present; however, the degree to which individuals discounted delayed rewards was affected by the number of and type of options that were available. The current results join previous evidence suggesting that rates of delay discounting are sensitive to a variety of contextual influences. Copyright © 2015 Elsevier B.V. All rights reserved.

  15. Alcohol-related blackouts among college students: impact of low level of response to alcohol, ethnicity, sex, and environmental characteristics

    Directory of Open Access Journals (Sweden)

    Priscila D. Gonçalves

    2017-08-01

    Full Text Available Objective: To explore how a genetically-influenced characteristic (the level of response to alcohol [LR], ethnicity, and sex relate to environmental and attitudinal characteristics (peer drinking [PEER], drinking to cope [COPE], and alcohol expectancies [EXPECT] regarding future alcohol-related blackouts (ARBs. Methods: Structural equation models (SEMs were used to evaluate how baseline variables related to ARB patterns in 462 college students over 55 weeks. Data were extracted from a longitudinal study of heavy drinking and its consequences at a U.S. university. Results: In the SEM analysis, female sex and Asian ethnicity directly predicted future ARBs (beta weights 0.10 and -0.11, respectively, while all other variables had indirect impacts on ARBs through alcohol quantities (beta weights ~ 0.23 for European American ethnicity and low LR, 0.21 for cannabis use and COPE, and 0.44 for PEER. Alcohol quantities then related to ARBs with beta = 0.44. The SEM explained 23% of the variance. Conclusion: These data may be useful in identifying college students who are more likely to experience future ARBs over a 1-year period. They enhance our understanding of whether the relationships of predictors to ARBs are direct or mediated through baseline drinking patterns, information that may be useful in prevention strategies for ARBs.

  16. Pharmacy practice in times of civil crisis: The experience of SARS and the blackout in Ontario, Canada.

    Science.gov (United States)

    Austin, Zubin; Martin, J Craig; Gregory, Paul A M

    2007-09-01

    Crises affecting civilian infrastructure (including electricity supply, clean water, and access to institutional health services) may have an effect on the delivery of pharmacy services in the community. The objectives were to describe and analyze the impact of 2 major crises (the severe acute respiratory syndrome [SARS] outbreak, and the electrical system failure ["blackout"]) on pharmacy practice and pharmacists in Toronto, Canada. An exploratory, qualitative study was undertaken. Pharmacists were recruited, provided informed consent, and were interviewed. Data from transcripts were coded and categorized to identify themes related to adaptive strategies undertaken by pharmacists during times of civil crisis. Five key themes emerged from this research: (1) during times of crisis, pharmacies become frontline health care facilities, (2) a vacuity of leadership/lack of utility of emergency preparedness guidelines and policies, (3) role of and reliance on experience and professional judgment, (4) importance of documentation, and (5) the importance of "teamness" in enabling successful adaptation during times of crisis. Emergencies and civil crises will continue to occur. Findings of this study include the importance of effective documentation systems and teamwork practices, as well as confident reliance on professional judgment and experience, as determinants of successful adaptation to civil crises.

  17. Thermal characterization of organic matter along a (hypothetical) coalification gradient

    Science.gov (United States)

    Cavallo, Ornella; Provenzano, Maria Rosaria; Zaccone, Claudio

    2017-04-01

    Geochemical transformations of organic carbon (C) in aquatic and terrestrial ecosystems are important starting points for genesis of peats, brown coals and other coal precursors. The humification process plays a key role in biogeochemical transformations of organic C and, as a result, in the first stages of coal precursors formation. Thermal analysis was used by Schnitzer and other scientists since 1950-1960s, in order to investigate the stability of several organic materials of industrial value including peat and coal. What soil scientists found was the general occurrence of two exothermic peaks (exotherm 1 and 2) due to decomposition and combustion reactions of organic compounds having different thermal stability and, consequently, different degree of humification. Thermogravimetric analysis (TG) was carried out on different samples reproducing a "hypothetical" coalification gradient as follows: peat (IHSS Pahokee peat standard), fulvic acid (FA), a peat humic acid (HA), leonardite (IHSS Gascoyne standard) and charcoal. An aliquot of about 20 mg of each sample was heated in a ceramic crucible from 50 to 850˚ C at 30˚ C min-1, at a gas flow rate of 30 mL min-1 using a PerkinElmer TGA4000 thermobalance. Samples were analysed both under nitrogen and under synthetic air. All analyses were carried out in triplicate and the average coefficient of variation was exothermic mass loss has occurred (TG-T50) was also calculated. Preliminary results obtained from TG analysis under air showed that WL2/WL1 ratio was lower for the FA sample and higher for leonardite and charcoal, following the order FA

  18. Explaining the discrepancy between intentions and actions: the case of hypothetical bias in contingent valuation

    Science.gov (United States)

    Icek Ajzen; Thomas C. Brown; Franklin Carvajal

    2004-01-01

    An experiment was designed to account for intention-behavior discrepancies by applying the theory of planned behavior to contingent valuation. College students (N = 160) voted in hypothetical and real payment referenda to contribute $8 to a scholarship fund. Overestimates of willingness to pay in the hypothetical referendum could not be attributed to moderately...

  19. Combining aptamers and in silico interaction studies to decipher the function of hypothetical proteins

    DEFF Research Database (Denmark)

    Suravajhala, Prashanth; Burri, Harsha Vardhan Reddy; Heiskanen, Arto

    2014-01-01

    We present the potential role of aptamers in elucidating the function of hypothetical proteins, as well as the possibilities provided by bioinformatics for establishing a benchmark for aptamer-protein prediction methods. With these future perspectives, the role of hypothetical proteins as target...

  20. Using respondent uncertainty to mitigate hypothetical bias in a stated choice experiment

    Science.gov (United States)

    Richard C. Ready; Patricia A. Champ; Jennifer L. Lawton

    2010-01-01

    In a choice experiment study, willingness to pay for a public good estimated from hypothetical choices was three times as large as willingness to pay estimated from choices requiring actual payment. This hypothetical bias was related to the stated level of certainty of respondents. We develop protocols to measure respondent certainty in the context of a choice...

  1. 47 CFR 69.609 - End User Common Line hypothetical net balances.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false End User Common Line hypothetical net balances... SERVICES (CONTINUED) ACCESS CHARGES Exchange Carrier Association § 69.609 End User Common Line hypothetical net balances. (a) If the company does not participate in the association tariff for such element, the...

  2. Adolescents' explicit and implicit evaluations of hypothetical and actual peers with different bullying participant roles.

    Science.gov (United States)

    Pouwels, J Loes; Lansu, Tessa A M; Cillessen, Antonius H N

    2017-07-01

    This study examined how adolescents evaluate bullying at three levels of specificity: (a) the general concept of bullying, (b) hypothetical peers in different bullying participant roles, and (c) actual peers in different bullying participant roles. Participants were 163 predominantly ethnic majority adolescents in The Netherlands (58% girls; M age =16.34years, SD=0.79). For the hypothetical peers, we examined adolescents' explicit evaluations as well as their implicit evaluations. Adolescents evaluated the general concept of bullying negatively. Adolescents' explicit evaluations of hypothetical and actual peers in the bullying roles depended on their own role, but adolescents' implicit evaluations of hypothetical peers did not. Adolescents' explicit evaluations of hypothetical peers and actual peers were different. Hypothetical bullies were evaluated negatively by all classmates, whereas hypothetical victims were evaluated relatively positively compared with the other roles. However, when adolescents evaluated their actual classmates, the differences between bullies and the other roles were smaller, whereas victims were evaluated the most negatively of all roles. Further research should take into account that adolescents' evaluations of hypothetical peers differ from their evaluations of actual peers. Copyright © 2017 Elsevier Inc. All rights reserved.

  3. Can a Repeated Opt-Out Reminder remove hypothetical bias in discrete choice experiments?

    DEFF Research Database (Denmark)

    Alemu, Mohammed Hussen; Olsen, Søren Bøye

    hypothetical bias in stated DCE. The data originates from a field experiment concerning consumer preferences for a novel food product made from cricket flour. Utilizing a between-subject design with three treatments, we find significantly higher marginal willingness to pay values in hypothetical than...

  4. Preliminary Assessment of the Possible BWR Core/Vessel Damage States for Fukushima Daiichi Station Blackout Scenarios Using RELAP/SCDAPSIM

    Directory of Open Access Journals (Sweden)

    C. M. Allison

    2012-01-01

    Full Text Available Immediately after the accident at Fukushima Daiichi, Innovative Systems Software and other members of the international SCDAP Development and Training Program started an assessment of the possible core/vessel damage states of the Fukushima Daiichi Units 1–3. The assessment included a brief review of relevant severe accident experiments and a series of detailed calculations using RELAP/SCDAPSIM. The calculations used a detailed RELAP/SCDAPSIM model of the Laguna Verde BWR vessel and related reactor cooling systems. The Laguna Verde models were provided by the Comision Nacional de Seguridad Nuclear y Salvaguardias, the Mexican nuclear regulatory authority. The initial assessment was originally presented to the International Atomic Energy Agency on March 21 to support their emergency response team and later to our Japanese members to support their Fukushima Daiichi specific analysis and model development.

  5. BOLD responses in reward regions to hypothetical and imaginary monetary rewards.

    Science.gov (United States)

    Miyapuram, Krishna P; Tobler, Philippe N; Gregorios-Pippas, Lucy; Schultz, Wolfram

    2012-01-16

    Monetary rewards are uniquely human. Because money is easy to quantify and present visually, it is the reward of choice for most fMRI studies, even though it cannot be handed over to participants inside the scanner. A typical fMRI study requires hundreds of trials and thus small amounts of monetary rewards per trial (e.g. 5p) if all trials are to be treated equally. However, small payoffs can have detrimental effects on performance due to their limited buying power. Hypothetical monetary rewards can overcome the limitations of smaller monetary rewards but it is less well known whether predictors of hypothetical rewards activate reward regions. In two experiments, visual stimuli were associated with hypothetical monetary rewards. In Experiment 1, we used stimuli predicting either visually presented or imagined hypothetical monetary rewards, together with non-rewarding control pictures. Activations to reward predictive stimuli occurred in reward regions, namely the medial orbitofrontal cortex and midbrain. In Experiment 2, we parametrically varied the amount of visually presented hypothetical monetary reward keeping constant the amount of actually received reward. Graded activation in midbrain was observed to stimuli predicting increasing hypothetical rewards. The results demonstrate the efficacy of using hypothetical monetary rewards in fMRI studies. Copyright © 2011 Elsevier Inc. All rights reserved.

  6. Linked Station Neighbors

    Data.gov (United States)

    Federal Communications Commission — This file that is a subset of the Linked-Station Set file. This file specifies, for each U.S. or impeding Canadian station part of a linked station set, the set of...

  7. [Science in the crosshairs of enlightenment. Significance of hypothetical thinking].

    Science.gov (United States)

    Wieland, Wolfgang

    2011-01-01

    To further the enlightenment primarily or even only by means of science was the hope of most representatives of the movement of the enlightenment which gave its name to a whole period of European cultural history. Only a few of its representatives, like Montesquieu and Rousseau, doubted for good reasons, whether and how the goals of the enlightenment can be reached at all by the means of science alone. In his Discours préliminaires to the Encyclopédie D'Alembert still wanted to limit science proper to the narrower field of those kinds of research which were strictly based on observations and calculations alone. In this way he remained committed to Descartes' ideal method of receiving authentic knowledge only by deduction from evident axioms or fundamental theorems. Pascal's casual discovery of the calculation of probabilities allowed to apply mathematics on the hidden laws of the apparent casualties of the human life world. Bacon's project of empirical science as a rational and methodological art of conducting experiments could replace the methodological ideal of science more geometrico. Lichtenberg's refined sensibility for the subjunctive linguistic forms of hypothetical thinking indicates a new understanding of inventing and testing hypotheses as the two most important methods of the experimental sciences when compared to the formal sciences of logic and mathematics. Whoever is studying the history of science of modern times in the cross wire of the enlightenment, will realize soon that science has always been in need of being illuminated about its own chances, risks and side effects. The project of enlightenment through science had to be complemented by the project of an enlightenment about science right from its beginning. Because of the implicit risks and side effects the project of enlightenment has to be enlightenment despite of science and because of science. On the one hand, as a special form of human practice the sciences are directed towards

  8. The 4 november 2006 blackout: an outage of 'technical' democracy?; Le delestage du 4 novembre 2006: une panne de la democratie technique?

    Energy Technology Data Exchange (ETDEWEB)

    Leteurtrois, J.P

    2007-08-15

    With its power plants and exportation of electricity to neighboring lands, France imagined that it was sheltered from blackouts. But in the autumn of 2006, five million French households were deprived of electricity due to an error by a German operator. What to think of this? The internationalization of the electricity market, though useful to consumers, should not mean deregulation or the relinquishment of rules and regulations to power companies. Supervision of the grid must be reinforced on behalf of all European users of electricity. (author)

  9. MODFLOW-NWT model of a hypothetical stream-aquifer system to assess capture map bias

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — A MODFLOW-NWT (version 1.0.9) model of a hypothetical stream-aquifer system is presented for the evaluation and characterization of capture map bias. The...

  10. Explaining the discrepancy between intentions and actions: the case of hypothetical bias in contingent valuation.

    Science.gov (United States)

    Ajzen, Icek; Brown, Thomas C; Carvajal, Franklin

    2004-09-01

    An experiment was designed to account for intention-behavior discrepancies by applying the theory of planned behavior to contingent valuation. College students (N = 160) voted in hypothetical and real payment referenda to contribute $8 to a scholarship fund. Overestimates of willingness to pay in the hypothetical referendum could not be attributed to moderately favorable latent dispositions. Instead, this hypothetical bias was explained by activation of more favorable beliefs and attitudes in the context of a hypothetical rather than a real referendum. A corrective entreaty was found to eliminate this bias by bringing beliefs, attitudes, and intentions in line with those in the real payment situation. As a result, the theory of planned behavior produced more accurate prediction of real payment when participants were exposed to the corrective entreaty.

  11. Alcohol-Related Blackouts, Negative Alcohol-Related Consequences, and Motivations for Drinking Reported by Newly Matriculating Transgender College Students.

    Science.gov (United States)

    Tupler, Larry A; Zapp, Daniel; DeJong, William; Ali, Maryam; O'Rourke, Sarah; Looney, John; Swartzwelder, H Scott

    2017-05-01

    Many transgender college students struggle with identity formation and other emotional, social, and developmental challenges associated with emerging adulthood. A potential maladaptive coping strategy employed by such students is heavy drinking. Prior literature has suggested greater consumption and negative alcohol-related consequences (ARCs) in transgender students compared with their cisgender peers, but little is known about their differing experiences with alcohol-related blackouts (ARBs). We examined the level of alcohol consumption, the frequency of ARBs and other ARCs, and motivations for drinking reported by the largest sample of transgender college students to date. A Web survey from an alcohol-prevention program, AlcoholEdu for College™, assessed student demographics and drinking-related behaviors, experiences, and motivations of newly matriculating first-year college students. A self-reported drinking calendar was used to examine each of the following measures over the previous 14 days: number of drinking days, total number of drinks, and maximum number of drinks on any single day. A 7-point Likert scale was used to measure ARCs, ARBs, and drinking motivations. Transgender students of both sexes were compared with their cisgender peers. A total of 989 of 422,906 students (0.2%) identified as transgender. Over a 14-day period, transgender compared with cisgender students were more likely to consume alcohol over more days, more total drinks, and a greater number of maximum drinks on a single day. Transgender students (36%) were more likely to report an ARB than cisgender students (25%) as well as more negative academic, confrontation-related, social, and sexual ARCs. Transgender respondents more often cited stress reduction, social anxiety, self-esteem issues, and the inherent properties of alcohol as motivations for drinking. For nearly all measures, higher values were yielded by male-to-female than female-to-male transgender students. Transgender

  12. OPTIMUM STEADY STATE LOAD SHEDDING USING SHUFFLED FROG LEAPING ALGORITHM TO AVERT BLACKOUT IN POWER SYSTEMS DURING OVERLOAD AND GENERATION CONTINGENCIES

    Directory of Open Access Journals (Sweden)

    R. MAGESHVARAN

    2015-10-01

    Full Text Available During generation and overload contingencies in a power system, the system voltage and frequency will decline due to the deficiency of real and reactive powers. Consequently cascaded failures may occur which will lead to complete blackout of certain parts of the power system. Load shedding is considered as the ultimate step of emergency control action that is necessary to prevent a blackout in the power system. This paper proposes a memetic meta-heuristic algorithm known as shuffled frog leaping algorithm (SFLA to find a solution for the steady state load shedding problem presented here. The optimum steady state load shedding problem uses squares of the difference between the connected active and the reactive load and the supplied active and reactive power. The supplied active and reactive powers are treated as dependent variables modeled as functions of bus voltages only. The proposed algorithm is tested on IEEE 14 and 30 bus test systems. The viability of the proposed method is established by comparison with the other conventional methods presented earlier in terms of solution quality and convergence properties.

  13. Environmental Performance of Hypothetical Canadian Pre-Combustion Carbon Dioxide Capture Processes Using Life-Cycle Techniques

    Directory of Open Access Journals (Sweden)

    Lakkana Piewkhaow

    2016-03-01

    Full Text Available The methodology of life-cycle assessment was applied in order to evaluate the environmental performance of a hypothetical Saskatchewan lignite-fueled Integrated Gasification Combined Cycle (IGCC electricity generation, with and without pre-combustion carbon dioxide (CO2 capture from a full life-cycle perspective. The emphasis here is placed on environmental performance associated with air contaminants of the comparison between IGCC systems (with and without CO2 capture and a competing lignite pulverized coal-fired electricity generating station in order to reveal which technology offers the most positive environmental effects. Moreover, ambient air pollutant modeling was also conducted by using American Meteorological Society/Environmental Protection Agency Regulatory Model (AERMOD air dispersion modeling to determine the ground-level concentration of pollutants emitted from four different electricity generating stations. This study assumes that all stations are located close to Estevan. The results showed a significant reduction in greenhouse gas (GHG emissions and acidification potential by applying both post-combustion and pre-combustion CO2 capture processes. The GHG emissions were found to have reduced by 27%–86%, and IGCC systems were found to compare favorably to pulverized coal systems. However, in other environmental impact categories, there are multiple environmental trade-offs depending on the capture technology used. In the case of post-combustion capture, it was observed that the environmental impact category of eutrophication potential, summer smog, and ozone depletion increased due to the application of the CO2 capture process and the surface mining coal operation. IGCC systems, on the other hand, showed the same tendency as the conventional coal-fired electricity generation systems, but to a lesser degree. This is because the IGCC system is a cleaner technology that produces lower pollutant emission levels than the electricity

  14. Structure and functional annotation of hypothetical proteins having putative Rubisco activase function from Vitis vinifera.

    Science.gov (United States)

    Kumar, Suresh

    2015-01-01

    Rubisco is a very large, complex and one of the most abundant proteins in the world and comprises up to 50% of all soluble protein in plants. The activity of Rubisco, the enzyme that catalyzes CO2 assimilation in photosynthesis, is regulated by Rubisco activase (Rca). In the present study, we searched for hypothetical protein of Vitis vinifera which has putative Rubisco activase function. The Arabidopsis and tobacco Rubisco activase protein sequences were used as seed sequences to search against Vitis vinifera in UniprotKB database. The selected hypothetical proteins of Vitis vinifera were subjected to sequence, structural and functional annotation. Subcellular localization predictions suggested it to be cytoplasmic protein. Homology modelling was used to define the three-dimensional (3D) structure of selected hypothetical proteins of Vitis vinifera. Template search revealed that all the hypothetical proteins share more than 80% sequence identity with structure of green-type Rubisco activase from tobacco, indicating proteins are evolutionary conserved. The homology modelling was generated using SWISS-MODEL. Several quality assessment and validation parameters computed indicated that homology models are reliable. Further, functional annotation through PFAM, CATH, SUPERFAMILY, CDART suggested that selected hypothetical proteins of Vitis vinifera contain ATPase family associated with various cellular activities (AAA) and belong to the AAA+ super family of ring-shaped P-loop containing nucleoside triphosphate hydrolases. This study will lead to research in the optimization of the functionality of Rubisco which has large implication in the improvement of plant productivity and resource use efficiency.

  15. Expression profiling of hypothetical genes in Desulfovibrio vulgaris leads to improved functional annotation

    Energy Technology Data Exchange (ETDEWEB)

    Elias, Dwayne A.; Mukhopadhyay, Aindrila; Joachimiak, Marcin P.; Drury, Elliott C.; Redding, Alyssa M.; Yen, Huei-Che B.; Fields, Matthew W.; Hazen, Terry C.; Arkin, Adam P.; Keasling, Jay D.; Wall, Judy D.

    2008-10-27

    Hypothetical and conserved hypothetical genes account for>30percent of sequenced bacterial genomes. For the sulfate-reducing bacterium Desulfovibrio vulgaris Hildenborough, 347 of the 3634 genes were annotated as conserved hypothetical (9.5percent) along with 887 hypothetical genes (24.4percent). Given the large fraction of the genome, it is plausible that some of these genes serve critical cellular roles. The study goals were to determine which genes were expressed and provide a more functionally based annotation. To accomplish this, expression profiles of 1234 hypothetical and conserved genes were used from transcriptomic datasets of 11 environmental stresses, complemented with shotgun LC-MS/MS and AMT tag proteomic data. Genes were divided into putatively polycistronic operons and those predicted to be monocistronic, then classified by basal expression levels and grouped according to changes in expression for one or multiple stresses. 1212 of these genes were transcribed with 786 producing detectable proteins. There was no evidence for expression of 17 predicted genes. Except for the latter, monocistronic gene annotation was expanded using the above criteria along with matching Clusters of Orthologous Groups. Polycistronic genes were annotated in the same manner with inferences from their proximity to more confidently annotated genes. Two targeted deletion mutants were used as test cases to determine the relevance of the inferred functional annotations.

  16. Water Level Station History

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Images contain station history information for 175 stations in the National Water Level Observation Network (NWLON). The NWLON is a network of long-term,...

  17. Fire Stations - 2009

    Data.gov (United States)

    Kansas Data Access and Support Center — Fire Stations in Kansas Any location where fire fighters are stationed or based out of, or where equipment that such personnel use in carrying out their jobs is...

  18. Hammond Bay Biological Station

    Data.gov (United States)

    Federal Laboratory Consortium — Hammond Bay Biological Station (HBBS), located near Millersburg, Michigan, is a field station of the USGS Great Lakes Science Center (GLSC). HBBS was established by...

  19. Weather Radar Stations

    Data.gov (United States)

    Department of Homeland Security — These data represent Next-Generation Radar (NEXRAD) and Terminal Doppler Weather Radar (TDWR) weather radar stations within the US. The NEXRAD radar stations are...

  20. Fire Stations - 2007

    Data.gov (United States)

    Kansas Data Access and Support Center — Fire Station Locations in Kansas Any location where fire fighters are stationed at or based out of, or where equipment that such personnel use in carrying out their...

  1. Streamflow Gaging Stations

    Data.gov (United States)

    Department of Homeland Security — This map layer shows selected streamflow gaging stations of the United States, Puerto Rico, and the U.S. Virgin Islands, in 2013. Gaging stations, or gages, measure...

  2. Newport Research Station

    Data.gov (United States)

    Federal Laboratory Consortium — The Newport Research Station is the Center's only ocean-port research facility. This station is located at Oregon State University's Hatfield Marine Science Center,...

  3. Big Game Reporting Stations

    Data.gov (United States)

    Vermont Center for Geographic Information — Point locations of big game reporting stations. Big game reporting stations are places where hunters can legally report harvested deer, bear, or turkey. These are...

  4. Reference Climatological Stations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Reference Climatological Stations (RCS) network represents the first effort by NOAA to create and maintain a nationwide network of stations located only in areas...

  5. Identification of the conserved hypothetical protein BPSL0317 in Burkholderia pseudomallei K96243

    Science.gov (United States)

    Yusoff, Nur Syamimi; Damiri, Nadzirah; Firdaus-Raih, Mohd

    2014-09-01

    Burkholderia pseudomallei K96243 is the causative agent of melioidosis, a disease which is endemic in Northern Australia and Southeastern Asia. The genome encodes several essential proteins including those currently annotated as hypothetical proteins. We studied the conservation and the essentiality of expressed hypothetical proteins in normal and different stress conditions. Based on the comparative genomics, we identified a hypothetical protein, BPSL0317, a potential essential gene that is being expressed in all normal and stress conditions. BPSL0317 is also phylogenetically conserved in the Burkholderiales order suggesting that this protein is crucial for survival among the order's members. BPSL0317 therefore has a potential to be a candidate antimicrobial drug target for this group of bacteria.

  6. The Influence of Hypothetical Death Scenarios on Multidimensional End-of-Life Care Preferences.

    Science.gov (United States)

    Dassel, Kara B; Utz, Rebecca; Supiano, Katherine; McGee, Nancy; Latimer, Seth

    2018-01-01

    Differences in end-of-life (EOL) care preferences (eg, location of death, use of life-sustaining treatments, openness to hastening death, etc) based on hypothetical death scenarios and associated physical and/or cognitive losses have yet to be investigated within the palliative care literature. The purpose of this study was to explore the multidimensional EOL care preferences in relation to 3 different hypothetical death scenarios: pancreatic cancer (acute death), Alzheimer disease (gradual death), and congestive heart failure (intermittent death). General linear mixed-effects regression models estimated whether multidimensional EOL preferences differed under each of the hypothetical death scenarios; all models controlled for personal experience and familiarity with the disease, presence of an advance directive, religiosity, health-related quality of life, and relevant demographic characteristics. A national sample of healthy adults aged 50 years and older (N = 517) completed electronic surveys detailing their multidimensional preferences for EOL care for each hypothetical death scenario. The average age of the participants was 60.1 years (standard deviation = 7.6), 74.7% were female, and 66.1% had a college or postgraduate degree. Results revealed significant differences in multidimensional care preferences between hypothetical death scenarios related to preferences for location of death (ie, home vs medical facility) and preferences for life-prolonging treatment options. Significant covariates of participants' multidimensional EOL care preferences included age, sex, health-related quality of life, and religiosity. Our hypothesis that multidimensional EOL care preferences would differ based on hypothetical death scenarios was partially supported and suggests the need for disease-specific EOL care discussions.

  7. Historical and Hypothetical Future Sedimentation and Water Storage in Kajakai Reservoir, Central Afghanistan

    Science.gov (United States)

    Vining, Kevin C.; Vecchia, Aldo V.

    2008-01-01

    SUMMARY Sedimentation has reduced water storage in Kajakai Reservoir. If current sedimentation rates continue, hypothetical future reservoir water volumes at the spillway elevation of 1,033.5 meters could be reduced about 22 percent from 2006 to 2057. Even if the spillway elevation is raised to 1,045 meters, a severe drought could result in large multiyear irrigation-supply deficits in which reservoir water levels remain below 1,022 meters for more than 4 years. Hypothetical climate change and sedimentation could result in greater water-supply deficits. The chance of having sufficient water supplies in Kajakai Reservoir during the worst month is about 47 percent.

  8. INTERACT Station Catalogue - 2015

    DEFF Research Database (Denmark)

    INTERACT stations are located in all major environmental envelopes of the Arctic providing an ideal platform for studying climate change and its impact on the environment and local communities. Since alpine environments face similar changes and challenges as the Arctic, the INTERACT network also...... includes some alpine stations located outside the Arctic. The INTERACT research stations provide an ideal platform for circumarctic research and monitoring. Activities span from small short term research projects to larger long term monitoring programmes. The stations are thus visited by many researchers...... and research groups. Therefore, INTERACT has produced a catalogue of research stations including descriptions of the physical setting, facilities and services offered at the stations. It is our hope that this catalogue will help researchers identify research stations that suit their specific needs. The 2015...

  9. Structural Analysis of Hypothetical Proteins from Helicobacter pylori: An Approach to Estimate Functions of Unknown or Hypothetical Proteins

    Directory of Open Access Journals (Sweden)

    Bong-Jin Lee

    2012-06-01

    Full Text Available Helicobacter pylori (H. pylori have a unique ability to survive in extreme acidic environments and to colonize the gastric mucosa. It can cause diverse gastric diseases such as peptic ulcers, chronic gastritis, mucosa-associated lymphoid tissue (MALT lymphoma, gastric cancer, etc. Based on genomic research of H. pylori, over 1600 genes have been functionally identified so far. However, H. pylori possess some genes that are uncharacterized since: (i the gene sequences are quite new; (ii the function of genes have not been characterized in any other bacterial systems; and (iii sometimes, the protein that is classified into a known protein based on the sequence homology shows some functional ambiguity, which raises questions about the function of the protein produced in H. pylori. Thus, there are still a lot of genes to be biologically or biochemically characterized to understand the whole picture of gene functions in the bacteria. In this regard, knowledge on the 3D structure of a protein, especially unknown or hypothetical protein, is frequently useful to elucidate the structure-function relationship of the uncharacterized gene product. That is, a structural comparison with known proteins provides valuable information to help predict the cellular functions of hypothetical proteins. Here, we show the 3D structures of some hypothetical proteins determined by NMR spectroscopy and X-ray crystallography as a part of the structural genomics of H. pylori. In addition, we show some successful approaches of elucidating the function of unknown proteins based on their structural information.

  10. Valuing hypothetical wildfire impacts with a Kuhn–Tucker model of recreation demand

    Science.gov (United States)

    Jose Sanchez; Ken Baerenklau; Armando Gonzalez-Caban

    2016-01-01

    This study uses a nonmarket valuation method to investigate the recreation values of the San Jacinto Wilderness in southern California. The analysis utilizes survey data from a stated-choice experiment involving backcountry visitors who responded to questions about hypothetical wildfire burn scenarios. Benefits of landscape preservation are derived using a Kuhn-Tucker...

  11. Conflict Resolution among Preschool Children: The Appeal of Negotiation in Hypothetical Disputes.

    Science.gov (United States)

    Iskandar, Niveen; And Others

    1995-01-01

    Using hypothetical puppet interviews, 48 preschool children were interviewed about their preferences for teacher methods of conflict intervention. Puppet vignettes contrasted conflict issue, peer status, and resolution strategy (negotiation, power assertion, and disengagement). Results showed that preschoolers preferred negotiation strategies over…

  12. The Effects of Real Versus Hypothetical Stimuli upon Preschool Children's Helping Behavior.

    Science.gov (United States)

    Sharpley, Christopher F.; Rodd, Jillian

    1985-01-01

    Examined effects of presentation of a peer-in-need stimulus to preschool children in real versus hypothetical contexts, with results indicating a significantly higher incidence of helping behavior in real situations. Nature of helping response as a preoperational reaction to concrete contextual cues is verified. (Author/DST)

  13. Adolescents' explicit and implicit evaluations of hypothetical and actual peers with different bullying participant roles

    NARCIS (Netherlands)

    Pouwels, J.L.; Lansu, T.A.M.; Cillessen, A.H.N.

    2017-01-01

    This study examined how adolescents evaluate bullying at three levels of specificity: (a) the general concept of bullying, (b) hypothetical peers in different bullying participant roles, and (c) actual peers in different bullying participant roles. Participants were 163 predominantly ethnic majority

  14. In silico Structural and Functional Annotation of Mycoplasma genitalium Hypothetical Protein MG_377

    Directory of Open Access Journals (Sweden)

    Sudip Paul

    2015-04-01

    Full Text Available Mycoplasma genitalium, a Gram-positive sexually transmitted pathogen, has been associated with urethritis in men and several inflammatory reproductive tract syndromes in women including cervicitis, pelvic inflammatory disease, and infertility. The complete sequence of the M. genitalium G37 genome revealed that it consists of 94 hypothetical proteins with unknown function in addition to functional proteins. In the present study, the MG_377 hypothetical protein of M. genitalium was selected for analyzing and modeling by different bioinformatics tools and databases. According to primary and secondary structure analyses, MG_377 is a stable hydrophilic protein containing a significant proportion of α-helices; besides, it is a cytoplasmic protein based on subcellular localization predictions. Homology modeling method was applied to generate its 3D structure using SWISS-MODEL server where the template PDB 1ZXJ with 84.4% sequence identity with the hypothetical protein was exploited. Several evaluations of quality assessment and validation parameters specified the generated protein model as reliable with fairly good quality. Functional genomics analysis carried out by InterProScan, Pfam and NCBI-CDD suggested that the hypothetical protein may contain Trigger factor/SurA domain. Moreover, comparative genomics analysis recommended MG_377 as a non-homologous protein essential for the organism. Further experimental validation would help to identify the actual function of MG_377 as well as to confirm the utility of the protein as drug targets.

  15. study and analysis of asa river hypothetical dam break using hec-ras

    African Journals Online (AJOL)

    A hypothetical dam break on Asa Dam located in Ilorin, Kwara State, Nigeria was analyzed using United States Army Corps of Engineers (USACE), Hydrologic Engineering Center's River Analysis System (HEC-RAS) computer model. Unsteady flow simulation was performed using geometric data obtained from Digital ...

  16. Bioinformatics and structural characterization of a hypothetical protein from Streptococcus mutans

    DEFF Research Database (Denmark)

    Nan, Jie; Brostromer, Erik; Liu, Xiang-Yu

    2009-01-01

    . From the interlinking structural and bioinformatics studies, we have concluded that SMU.440 could be involved in polyketide-like antibiotic resistance, providing a better understanding of this hypothetical protein. Besides, the combination of multiple methods in this study can be used as a general...

  17. fMRI evidence of a hot-cold empathy gapin hypothetical and real aversive choices

    Directory of Open Access Journals (Sweden)

    Min Jeong Kang

    2013-06-01

    Full Text Available Hypothetical bias is the common finding that hypothetical monetary values for goods are higher than real values. We extend this research to the domain of bads such as consumer and household choices made to avoid aversive outcomes (e.g., insurance. Previous evidence of hot-cold empathy gaps suggest food disgust is likely to be strongly underestimated in hypothetical (cold choice. Depending on relative underestimation of food disgust and pain of spending, the hypothetical bias for aversive bads can go in the typical direction for goods, disappear, or reverse in sign. We find that the bias is reversed in sign—subjects pay more to avoid bads when choice is real. fMRI shows that real choice more strongly activates striatum and medial prefrontal cortex (reward regions and shows distinct activity in insula and amygdala (disgust and fear regions. The neural findings suggest ways to exogeneously manipulate or record brain activity in order to create better forecasts of actual consumer choice.

  18. Physicians' willingness to grant requests for assistance in dying for children: a study of hypothetical cases

    NARCIS (Netherlands)

    Vrakking, A.M.; van der Heide, A.; Looman, C.W.; van Delden, J.J.M.; Philipsen, B.D.; van der Maas, P.J.; van der Wal, G.

    2005-01-01

    OBJECTIVE: To study the willingness of Dutch physicians to use potentially life-shortening or lethal drugs for severely ill children. STUDY DESIGN: We asked 63 pediatricians about their approach to 10 hypothetical cases of children with cancer. The age of the child (15, 11, or 6 years), the child's

  19. Adolescents' Reactions to Hypothetical Peer Group Conversations: Evidence for an Imaginary Audience?

    Science.gov (United States)

    Vartanian, Lesa Rae

    2001-01-01

    The nature of early adolescent social cognition as characterized by the theory of adolescent egocentrism was investigated, through three studies, by examining age differences in judgments of hypothetical peer conversations. Findings do not support the notion that adolescents believe others are attentive to and critical of their every move, or that…

  20. The impact of arbitrarily applicable relational responding on evaluative learning about hypothetical money and shock outcomes.

    Science.gov (United States)

    Dymond, Simon; Molet, Mikael; Davies, Lynette

    2017-08-01

    Evaluative learning comprises changes in preferences after co-occurrences between conditioned stimuli (CSs) and an unconditioned stimulus (US) of affective value. Co-occurrences may involve relational responding. Two experiments examined the impact of arbitrary relational responding on evaluative preferences for hypothetical money and shock outcomes. In Experiment 1, participants were trained to make arbitrary relational responses by placing CSs of the same size but different colours into boxes and were then instructed that these CSs represented different intensities of hypothetical USs (money or shock). Liking ratings of the CSs were altered in accordance with the underlying bigger/smaller than relations. A reversal of preference was also observed: the CS associated with the smallest hypothetical shock was rated more positively than the CS associated with the smallest amount of hypothetical money. In Experiment 2, procedures from Relational Frame Theory (RFT) established a relational network of more than/less than relations consisting of five CSs (A-B-C-D-E). Overall, evaluative preferences were altered, but not reversed, depending on (a) how stimuli had been related to one another during the learning phase and (b) whether those stimuli referred to money or shocks. The contribution of RFT to evaluative learning research is discussed.

  1. Consequences in Norway after a hypothetical accident at Sellafield - Predicted impacts on the environment.

    Energy Technology Data Exchange (ETDEWEB)

    Thoerring, H.; Liland, A.

    2010-12-15

    This report deals with the environmental consequences in Norway after a hypothetical accident at Sellafield. The investigation is limited to the terrestrial environment, and focus on animals grazing natural pastures, plus wild berries and fungi. Only 137Cs is considered. The predicted consequences are severe, in particular for mutton and goat milk production. (Author)

  2. Amtrak Rail Stations (National)

    Data.gov (United States)

    Department of Transportation — Updated database of the Federal Railroad Administration's (FRA) Amtrak Station database. This database is a geographic data set containing Amtrak intercity railroad...

  3. Space Station operations

    Science.gov (United States)

    Gray, R. H.

    1985-01-01

    An evaluation of the success of the Space Station will be based on the service provided to the customers by the Station crew, the productivity of the crew, and the costs of operation. Attention is given to details regarding Space Station operations, a summary of operational philosophies and requirements, logistics and resupply operations, prelaunch processing and launch operations, on-orbit operations, aspects of maintainability and maintenance, habitability, and questions of medical care. A logistics module concept is considered along with a logistics module processing timeline, a habitability module concept, and a Space Station rescue mission.

  4. Hekinan thermal power station

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1993-12-31

    Hekinan thermal power station is situated at the port of Kinuura in Aichi Prefecture, Japan. Unit 1 began commercial operation in October 1991, Unit 2 in June 1992 and Unit 3 in April 1993. This brochure gives the specification of the main facilities of the power station, shows its layout; illustrates its pollution control equipment, gives specifications of its flue gas treatment systems and of its large steam turbine, describes its coal handling facilities and gives their specifications, and mentions the power station`s automated control system.

  5. Cooperative Station History Forms

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Various forms, photographs and correspondence documenting the history of Cooperative station instrumentation, location changes, inspections, and...

  6. Life science research objectives and representative experiments for the space station

    Science.gov (United States)

    Johnson, Catherine C. (Editor); Arno, Roger D. (Editor); Mains, Richard (Editor)

    1989-01-01

    A workshop was convened to develop hypothetical experiments to be used as a baseline for space station designer and equipment specifiers to ensure responsiveness to the users, the life science community. Sixty-five intra- and extramural scientists were asked to describe scientific rationales, science objectives, and give brief representative experiment descriptions compatible with expected space station accommodations, capabilities, and performance envelopes. Experiment descriptions include hypothesis, subject types, approach, equipment requirements, and space station support requirements. The 171 experiments are divided into 14 disciplines.

  7. Testing the effectiveness of certainty scales, cheap talk, and dissonance-minimization in reducing hypothetical bias in contingent valuation studies

    Science.gov (United States)

    Mark Morrison; Thomas C. Brown

    2009-01-01

    Stated preference methods such as contingent valuation and choice modeling are subject to various biases that may lead to differences between actual and hypothetical willingness to pay. Cheap talk, follow-up certainty scales, and dissonance minimization are three techniques for reducing this hypothetical bias. Cheap talk and certainty scales have received considerable...

  8. Secure base stations

    NARCIS (Netherlands)

    Bosch, Peter; Brusilovsky, Alec; McLellan, Rae; Mullender, Sape J.; Polakos, Paul

    2009-01-01

    With the introduction of the third generation (3G) Universal Mobile Telecommunications System (UMTS) base station router (BSR) and fourth generation (4G) base stations, such as the 3rd Generation Partnership Project (3GPP) Long Term Evolution (LTE) Evolved Node B (eNB), it has become important to

  9. Station Climatic Summaries, Asia

    Science.gov (United States)

    1989-07-01

    274 MALAYSIA SINGAPORE APRT 486940 8505 (OCDS) ................................................... 278 NORTH KOREA CHANGJON/ONSEIRI 470610 6809 (CB...526 BURSA 171160 8709 (OCDS) ................................................... 528 CIGLI/IZMIR 172180...SUMMARY * STATION: SINGAPORE AIRPORT, MALAYSIA STATION #: 486940 ICAO ID: WSSS LOCATION: 01022N, 10400E ELEVATION (FEET): 21 LST - GMT +8 PREPARED BY

  10. "Inventive" Learning Stations

    Science.gov (United States)

    Jarrett, Olga

    2010-01-01

    Learning stations can be used for myriad purposes--to teach concepts, integrate subject matter, build interest, and allow for inquiry--the possibilities are limited only by the imagination of the teacher and the supplies available. In this article, the author shares suggestions and a checklist for setting up successful learning stations. In…

  11. SPS rectifier stations

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    The first of the twelves SPS rectifier stations for the bending magnets arrived at CERN at the end of the year. The photograph shows a station with the rectifiers on the left and in the other three cubicles the chokes, capacitors and resistor of the passive filter.

  12. Assessment of Limnigraph Data Usefulness for Determining The Hypothetical Flood Waves with The Cracow Method

    Directory of Open Access Journals (Sweden)

    Gądek Wiesław

    2014-07-01

    Full Text Available In our country the data related to the flow volume in the watercourses is recorded in three database systems: water-gauge, limnigraph and telemetric (digital one. In each of those systems the flow value is presented in a different way. The aim of this publication is to present how the non-compliance of the meaning and substantive difference of water-gauge data and limnigraph data influences on the example of 7 hypothetical floods determined by the Cracow method. Cracow method was initially known as Cracow Technical University Method. The received results show that the limnigraph data does not effect significantly the parameters of the hypothetical floods. In absence of the data from the telemetric system, such analysis has not be done.

  13. Central Station Design Options

    DEFF Research Database (Denmark)

    2011-01-01

    . The work identifies the architecture, sizing and siting of prospective Central Stations in Denmark, which can be located at shopping centers, large car parking lots or gas stations. Central Stations are planned to be integrated in the Danish distribution grid. The Danish island of Bornholm, where a high...... penetration of wind power is present, is considered as special case. The distribution grid in Denmark is built using larger secondary distribution transformers (e.g. 630 kVA) which in general allows higher flexibility for the installation of Central Stations, compared to Bornholm’s distribution grid...... kWh battery-EV is not feasible in Bornholm at the 0.4 kV level, due to predominantly small size secondary distribution transformers, in the range of 100 - 200 kVA. This is possible at the 10kV level (MV level), if the Fast Charging station is equipped with its own dedicated transformer. With DC...

  14. [STEM on Station Education

    Science.gov (United States)

    Lundebjerg, Kristen

    2016-01-01

    The STEM on Station team is part of Education which is part of the External Relations organization (ERO). ERO has traditional goals based around BHAG (Big Hairy Audacious Goal). The BHAG model is simplified to a saying: Everything we do stimulates actions by others to advance human space exploration. The STEM on Station education initiate is a project focused on bringing off the earth research and learning into classrooms. Educational resources such as lesson plans, activities to connect with the space station and STEM related contests are available and hosted by the STEM on Station team along with their partners such as Texas Instruments. These educational activities engage teachers and students in the current happenings aboard the international space station, inspiring the next generation of space explorers.

  15. Capacity at Railway Stations

    DEFF Research Database (Denmark)

    Landex, Alex

    2011-01-01

    special focus when conducting UIC 406 capacity analyses.This paper describes how the UIC 406 capacity method can be expounded for stations. Commonly for the analyses of the stations it is recommended to include the entire station including the switch zone(s) and all station tracks. By including the switch...... zone(s) the possible conflicts with other trains (also in the opposite direction) are taken into account leading to more trustworthy results. Although the UIC 406 methodology proposes that the railway network should be divided into line sections when trains turn around and when the train order...... is changed, this paper recommends that the railway lines are not always be divided. In case trains turn around on open (single track) line, the capacity consumption may be too low if a railway line is divided. The same can be the case if only few trains are overtaken at an overtaking station. For dead end...

  16. Using the design of simulation experiments to failures interactive effects analysis in process: a hypothetical case

    OpenAIRE

    Fabiano Leal; Dagoberto Alves De Almeida; José Arnaldo Barra Montevechi; Fernando Augusto Silva Marins

    2007-01-01

    This work presents a failures interactive effects analysis in a process, by means ofsimulations experiments. The chosen process is a hypothetical system, simulated throughsoftware Promodel®. Two conceptual models are generated, representing the system(mapping process) and the failures considered in system (Fault Tree Analysis). Theseconceptual models are translated in a computerized model, for the analysis of individual andcombined effects on the variable “number of produced pieces”. This exp...

  17. LC-MS/MS based proteomic analysis and functional inference of hypothetical proteins in Desulfovibrio vulgaris

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Weiwen; Culley, David E.; Gritsenko, Marina A.; Moore, Ronald J.; Nie, Lei; Scholten, Johannes C.; Petritis, Konstantinos; Strittmatter, Eric F.; Camp, David G.; Smith, Richard D.; Brockman, Fred J.

    2006-11-03

    ABSTRACT In the previous study, the whole-genome gene expression profiles of D. vulgaris in response to oxidative stress and heat shock were determined. The results showed 24-28% of the responsive genes were hypothetical proteins that have not been experimentally characterized or whose function can not be deduced by simple sequence comparison. To further explore the protecting mechanisms employed in D. vulgaris against the oxidative stress and heat shock, attempt was made in this study to infer functions of these hypothetical proteins by phylogenomic profiling along with detailed sequence comparison against various publicly available databases. By this approach we were ableto assign possible functions to 25 responsive hypothetical proteins. The findings included that DVU0725, induced by oxidative stress, may be involved in lipopolysaccharide biosynthesis, implying that the alternation of lipopolysaccharide on cell surface might service as a mechanism against oxidative stress in D. vulgaris. In addition, two responsive proteins, DVU0024 encoding a putative transcriptional regulator and DVU1670 encoding predicted redox protein, were sharing co-evolution atterns with rubrerythrin in Archaeoglobus fulgidus and Clostridium perfringens, respectively, implying that they might be part of the stress response and protective systems in D. vulgaris. The study demonstrated that phylogenomic profiling is a useful tool in interpretation of experimental genomics data, and also provided further insight on cellular response to oxidative stress and heat shock in D. vulgaris.

  18. The Ability of Children With Language Impairment to Dissemble Emotions in Hypothetical Scenarios and Natural Situations.

    Science.gov (United States)

    Brinton, Bonnie; Fujiki, Martin; Hurst, Noel Quist; Jones, Emily Rowberry; Spackman, Matthew P

    2015-10-01

    This study examined the ability of children with language impairment (LI) to dissemble (hide) emotional reactions when socially appropriate to do so. Twenty-two children with LI and their typically developing peers (7;1-10;11 [years;months]) participated in two tasks. First, participants were presented with hypothetical scenarios in which the main character was exposed to situations that would require dissembling an emotional reaction for social purposes (e.g., receiving a disappointing gift from a grandparent). In the second task, children were presented with four naturally occurring opportunities to dissemble emotion (e.g., receiving a disappointing reward for taking part in the study). Although the ability to dissemble emotion was still emerging in children in both groups, typically developing children judged that dissemblance was appropriate significantly more often than did children with LI in the hypothetical scenarios. In naturalistic scenarios, there was little difference between groups in low-cost scenarios (those in which the child had nothing to lose by hiding emotion). In the high-cost scenario (hiding emotion meant accepting a disappointing prize), more typically developing children concealed their disappointment than did children with LI. These differences neared statistical significance (p = .058). Children with typically developing language showed a greater ability to dissemble in hypothetical scenarios. In naturalistic scenarios, performance was more nuanced. In low-cost scenarios, there was little difference between groups. In the high-cost scenario, typically developing children tended to dissemble more often than did children with LI.

  19. Excessive Gestational Weight Gain and Subsequent Maternal Obesity at Age 40: A Hypothetical Intervention.

    Science.gov (United States)

    Abrams, Barbara; Coyle, Jeremy; Cohen, Alison K; Headen, Irene; Hubbard, Alan; Ritchie, Lorrene; Rehkopf, David H

    2017-09-01

    To model the hypothetical impact of preventing excessive gestational weight gain on midlife obesity and compare the estimated reduction with the US Healthy People 2020 goal of a 10% reduction of obesity prevalence in adults. We analyzed 3917 women with 1 to 3 pregnancies in the prospective US National Longitudinal Survey of Youth, from 1979 to 2012. We compared the estimated obesity prevalence between 2 scenarios: gestational weight gain as reported and under the scenario of a hypothetical intervention that all women with excessive gestational weight gain instead gained as recommended by the Institute of Medicine (2009). A hypothetical intervention was associated with a significantly reduced estimated prevalence of obesity for first (3.3 percentage points; 95% confidence interval [CI] = 1.0, 5.6) and second (3.0 percentage points; 95% CI = 0.7, 5.2) births, and twice as high in Black as in White mothers, but not significant in Hispanics. The population attributable fraction was 10.7% (95% CI = 3.3%, 18.1%) in first and 9.3% (95% CI = 2.2%, 16.5%) in second births. Development of effective weight-management interventions for childbearing women could lead to meaningful reductions in long-term obesity.

  20. Waste Transfer Stations

    DEFF Research Database (Denmark)

    Christensen, Thomas Højlund

    2011-01-01

    tion and transport is usually the most costly part of any waste management system; and when waste is transported over a considerable distance or for a long time, transferring the waste from the collection vehicles to more efficient transportation may be economically beneficial. This involves...... a transfer station where the transfer takes place. These stations may also be accessible by private people, offering flexibility to the waste system, including facilities for bulky waste, household hazardous waste and recyclables. Waste transfer may also take place on the collection route from small...... describes the main features of waste transfer stations, including some considerations about the economical aspects on when transfer is advisable....

  1. Space station operations management

    Science.gov (United States)

    Cannon, Kathleen V.

    1989-01-01

    Space Station Freedom operations management concepts must be responsive to the unique challenges presented by the permanently manned international laboratory. Space Station Freedom will be assembled over a three year period where the operational environment will change as significant capability plateaus are reached. First Element Launch, Man-Tended Capability, and Permanent Manned Capability, represent milestones in operational capability that is increasing toward mature operations capability. Operations management concepts are being developed to accomodate the varying operational capabilities during assembly, as well as the mature operational environment. This paper describes operations management concepts designed to accomodate the uniqueness of Space Station Freedoom, utilizing tools and processes that seek to control operations costs.

  2. TV Analog Station Transmitters

    Data.gov (United States)

    Department of Homeland Security — This file is an extract from the Consolidated Database System (CDBS) licensed by the Media Bureau. It consists of Analog Television Stations (see Rule Part47 CFR...

  3. ASOS Station Photos

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The images contained in this library are of stations in the Automated Surface Observing System (ASOS) network. These images were taken between 1998-2001 for the ASOS...

  4. Signal Station Inspection Reports

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Handwritten reports resulting from detailed inspections of US Army Signal Service Stations, 1871-1889. Features reported included instrument exposure and condition,...

  5. Active Marine Station Metadata

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Active Marine Station Metadata is a daily metadata report for active marine bouy and C-MAN (Coastal Marine Automated Network) platforms from the National Data...

  6. Master Station History Report

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Standard/Legacy MSHR, formally identified as the DSI-9767 dataset, is the legacy dataset/report sorted by NCDC Station ID and period of record. This...

  7. Materials Test Station

    Data.gov (United States)

    Federal Laboratory Consortium — When completed, the Materials Test Station at the Los Alamos Neutron Science Center will meet mission need. MTS will provide the only fast-reactor-like irradiation...

  8. Natural Weathering Exposure Station

    Data.gov (United States)

    Federal Laboratory Consortium — The Corps of Engineers' Treat Island Natural Weathering Exposure Station is a long-term natural weathering facility used to study concrete durability. Located on the...

  9. USRCRN Station Information

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Documentation of United States Regional Climate Reference Network (USRCRN) installations in 2009. Installations documented are for USRCRN pilot project stations in...

  10. Station Management Plan

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The following plan is the result of a recent initiative in Region 5 to produce general management guidance based on stated objectives for individual field stations....

  11. "Central Station" Londonis

    Index Scriptorium Estoniae

    2000-01-01

    Londoni galeriis Milch seitsme läti, leedu ja eesti kunstniku projekt "Central Station". Kuraatorid Lisa Panting, Sally Tallant. Eestist osalevad Hanno Soans (Catarina Campinoga koostöös valminud video), Kiwa, Kai Kaljo

  12. Electrostatic pickup station

    CERN Multimedia

    CERN PhotoLab

    1982-01-01

    Electrostatic pickup station, with 4 interleaved electrodes, to measure beam position in the horizontal and vertical plane. This type is used in the transfer lines leaving the PS (TT2, TT70, TTL2). See also 7904075.

  13. Mukilteo Research Station

    Data.gov (United States)

    Federal Laboratory Consortium — Research at the Mukilteo Research Station focuses on understanding the life cycle of marine species and the impacts of ecosystem stressors on anadromous and marine...

  14. Maine Field Station

    Data.gov (United States)

    Federal Laboratory Consortium — In 2000 NOAA's National Marine Fisheries Service established the Maine Field Station in Orono, ME to have more direct involvement in the conservation of the living...

  15. Routes and Stations

    Data.gov (United States)

    Department of Homeland Security — he Routes_Stations table is composed of fixed rail transit systems within the Continental United States, Alaska, Hawaii, the District of Columbia, and Puerto Rico....

  16. Public Transit Stations

    Data.gov (United States)

    Department of Homeland Security — fixed rail transit stations within the Continental United States, Alaska, Hawaii, the District of Columbia, and Puerto Rico. The modes of transit that are serviced...

  17. FEMA DFIRM Station Start

    Data.gov (United States)

    Minnesota Department of Natural Resources — This table contains information about station starting locations. These locations indicate the reference point that was used as the origin for distance measurements...

  18. Space Station galley design

    Science.gov (United States)

    Trabanino, Rudy; Murphy, George L.; Yakut, M. M.

    1986-01-01

    An Advanced Food Hardware System galley for the initial operating capability (IOC) Space Station is discussed. Space Station will employ food hardware items that have never been flown in space, such as a dishwasher, microwave oven, blender/mixer, bulk food and beverage dispensers, automated food inventory management, a trash compactor, and an advanced technology refrigerator/freezer. These new technologies and designs are described and the trades, design, development, and testing associated with each are summarized.

  19. Enhanced Master Station History Report

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Enhanced Master Station History Report (EMSHR) is a compiled list of basic, historical information for every station in the station history database, beginning...

  20. Gas Stations, US, 2010, NAVTEQ

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Gas_Stations dataset is derived from the Navteq 'AUTOSVC' SDC layer (FAC_TYPE=5540) and contains gas stations and petrol stations. This NAVTEQ dataset is...

  1. The Princess Elisabeth Station

    Science.gov (United States)

    Berte, Johan

    2012-01-01

    Aware of the increasing impact of human activities on the Earth system, Belgian Science Policy Office (Belspo) launched in 1997 a research programme in support of a sustainable development policy. This umbrella programme included the Belgian Scientific Programme on Antarctic Research. The International Polar Foundation, an organization led by the civil engineer and explorer Alain Hubert, was commissioned by the Belgian Federal government in 2004 to design, construct and operate a new Belgian Antarctic Research Station as an element under this umbrella programme. The station was to be designed as a central location for investigating the characteristic sequence of Antarctic geographical regions (polynia, coast, ice shelf, ice sheet, marginal mountain area and dry valleys, inland plateau) within a radius of 200 kilometers (approx.124 miles) of a selected site. The station was also to be designed as "state of the art" with respect to sustainable development, energy consumption, and waste disposal, with a minimum lifetime of 25 years. The goal of the project was to build a station and enable science. So first we needed some basic requirements, which I have listed here; plus we had to finance the station ourselves. Our most important requirement was that we decided to make it a zero emissions station. This was both a philosophical choice as we thought it more consistent with Antarctic Treaty obligations and it was also a logistical advantage. If you are using renewable energy sources, you do not have to bring in all the fuel.

  2. Alcohol-related blackouts across 55 weeks of college: Effects of European-American ethnicity, female sex, and low level of response to alcohol.

    Science.gov (United States)

    Schuckit, Marc A; Smith, Tom L; Goncalves, Priscila Dib; Anthenelli, Robert

    2016-12-01

    While high blood alcohol concentrations (BACs) are required for alcohol-related blackouts (ARBs), additional characteristics also contribute to the risk, including a person's ethnicity, sex, and phenotypes relating to heavier drinking. Few prospective studies of ARBs have evaluated how these additional characteristics interact. Data regarding 398 European American (EA), Asian and Hispanic students were extracted from a 55-week prospective study of different approaches to decrease heavy drinking among college freshmen. Information on past month ARB frequency was determined at 8 assessments. While controlling for the prior month maximum BAC and active education vs. control group assignment, the patterns and intensities of ARBs over time across ethnic groups were evaluated with ANOVA at each follow-up for the full sample, and then separately by sex and then by low vs. high levels of response to alcohol status (LR). The overall pattern of ARBs over time was evaluated with a 3 ethnic groups by 2 sexes by 2 LR status by 8 time points mixed-design ANOVA. Higher rates of ARBs over time were associated with EA ethnicity, female sex and a low LR to alcohol, with the ethnic differences in ARBs most robust in females and drinkers with high LRs. Participation in education programs aimed at heavy drinking was associated with decreases in ARBs. The data indicate that in addition to BACs achieved, propensities toward ARBs relate to complex interactions between additional risk factors, including ethnicity, sex, and LR status. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  3. Sensitivity Analysis of Evacuation Speed in Hypothetical NPP Accident by Earthquake

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sung-yeop; Lim, Ho-Gon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-10-15

    Effective emergency response in emergency situation of nuclear power plant (NPP) can make consequences be different therefore it is regarded important when establishing an emergency response plan and assessing the risk of hypothetical NPP accident. Situation of emergency response can be totally changed when NPP accident caused by earthquake or tsunami is considered due to the failure of roads and buildings by the disaster. In this study evacuation speed has been focused among above various factors and reasonable evacuation speed in earthquake scenario has been investigated. Finally, sensitivity analysis of evacuation speed in hypothetical NPP accident by earthquake has been performed in this study. Evacuation scenario can be entirely different in the situation of seismic hazard and the sensitivity analysis of evacuation speed in hypothetical NPP accident by earthquake has been performed in this study. Various references were investigated and earthquake evacuation model has been developed considering that evacuees may convert their evacuation method from using a vehicle to walking when they face the difficulty of using a vehicle due to intense traffic jam, failure of buildings and roads, and etc. The population dose within 5 km / 30 km have been found to be increased in earthquake situation due to decreased evacuation speed and become 1.5 - 2 times in the severest earthquake evacuation scenario set up in this study. It is not agreed that using same emergency response model which is used for normal evacuation situations when performing level 3 probabilistic safety assessment for earthquake and tsunami event. Investigation of data and sensitivity analysis for constructing differentiated emergency response model in the event of seismic hazard has been carried out in this study.

  4. Reducing therapeutic misconception: A randomized intervention trial in hypothetical clinical trials.

    Science.gov (United States)

    Christopher, Paul P; Appelbaum, Paul S; Truong, Debbie; Albert, Karen; Maranda, Louise; Lidz, Charles

    2017-01-01

    Participants in clinical trials frequently fail to appreciate key differences between research and clinical care. This phenomenon, known as therapeutic misconception, undermines informed consent to clinical research, but to date there have been no effective interventions to reduce it and concerns have been expressed that to do so might impede recruitment. We determined whether a scientific reframing intervention reduces therapeutic misconception without significantly reducing willingness to participate in hypothetical clinical trials. This prospective randomized trial was conducted from 2015 to 2016 to test the efficacy of an informed consent intervention based on scientific reframing compared to a traditional informed consent procedure (control) in reducing therapeutic misconception among patients considering enrollment in hypothetical clinical trials modeled on real-world studies for one of five disease categories. Patients with diabetes mellitus, hypertension, coronary artery disease, head/neck cancer, breast cancer, and major depression were recruited from medical clinics and a clinical research volunteer database. The primary outcomes were therapeutic misconception, as measured by a validated, ten-item Therapeutic Misconception Scale (range = 10-50), and willingness to participate in the clinical trial. 154 participants completed the study (age range, 23-87 years; 92.3% white, 56.5% female); 74 (48.1%) had been randomized to receive the experimental intervention. Therapeutic misconception was significantly lower (p = 0.004) in the scientific reframing group (26.4, 95% CI [23.7 to 29.1] compared to the control group (30.9, 95% CI [28.4 to 33.5], and remained so after controlling for education (p = 0.017). Willingness to participate in the hypothetical trial was not significantly different (p = 0.603) between intervention (52.1%, 95% CI [40.2% to 62.4%]) and control (56.3%, 95% CI [45.3% to 66.6%] groups. An enhanced educational intervention augmenting

  5. The Use of the Lexical Exponents of Hypothetical Modality in Polish and Lithuanian

    Directory of Open Access Journals (Sweden)

    Danuta Roszko

    2016-12-01

    Full Text Available The Use of the Lexical Exponents of Hypothetical Modality in Polish and Lithuanian In this article the author focuses on the issue of hypothetical modality[1] in Polish and Lithuanian. A list of the basic exponents of hypothetical modality in both languages is presented. However, the focus is mainly placed on the lexical exponents. On the basis of one of the six groups, which describes a high degree of probability (H5, the differences between the use of the lexical exponents in both languages are examined. In the study, multilingual corpora resources, including The Polish-Lithuanian parallel corpus Clarin-PL., are utilized. [1] [In the academic literature, for the notion described herein, the term of epistemic modality is also used.  Nevertheless, in this paper I will continue to use the term of hypotheticality, which I borrowed from the studies on modality, conducted in Polish-Bulgarian cooperation (Slavic Institute of Polish Academy of Sciences and Institute for Bulgarian Language of the Bulgarian Academy of Sciences.]   O użyciu wykładników leksykalnych modalności hipotetycznej w językach polskim i litewskim W artykule autorka porusza zagadnienie modalności hipotetycznej[1]  w językach polskim i litewskim. Przedstawia wykaz podstawowych wykładników modalności hipotetycznej w obu językach. Główną uwagę skupia jednak na wykładnikach leksykalnych. Na przykładzie jednej z sześciu grup, opisującej wysoki stopień prawdopodobieństwa (H5, omawia różnice użycia wykładników leksykalnych w obu językach. W badaniach wykorzystuje wielojęzyczne zasoby korpusowe, w tym Polsko-litewski korpus równoległy Clarin-PL. [1] [W literaturze przedmiotu na oznaczenie opisywanych tu treści stosowany jest również termin epistemiczności. Niemniej jednak w tej pracy autorka pozostaje przy terminie hipotetyczności, który zapożycza z badań nad modalnością, prowadzonych we współpracy polsko-bułgarskiej (Instytut Slawistyki PAN i

  6. Radiation Dose Calculations for a Hypothetical Accident in Xianning Nuclear Power Plant

    OpenAIRE

    Bo Cao; Junxiao Zheng; Yixue Chen

    2016-01-01

    Atmospheric dispersion modeling and radiation dose calculations have been performed for a hypothetical AP1000 SGTR accident by HotSpot code 3.03. TEDE, the respiratory time-integrated air concentration, and the ground deposition are calculated for various atmospheric stability classes, Pasquill stability categories A–F with site-specific averaged meteorological conditions. The results indicate that the maximum plume centerline ground deposition value of 1.2E+2 kBq/m2 occurred at about 1.4 km ...

  7. A study on the recriticality possibilities of fast reactor cores after a hypothetical core meltdown accident

    Energy Technology Data Exchange (ETDEWEB)

    Na, Byung Chan; Han, Do Hee; Kim, Young Cheol

    1997-04-01

    The preliminary and parametric sensitivity study on recriticality risk of fast reactor cores after a hypothetical total core meltdown accident was performed. Only the neutronic aspects of the accident was considered for this study, independent of the accident scenario. Estimation was made for the quantities of molten fuel which must be ejected out of the core in order to assure a sub-critical state. Diverse parameters were examined: molten pool type (homogenized or stratified), fuel temperature, conditions of the reactor core, core size (small or large), and fuel type (oxide, nitride, metal) (author). 7 refs.

  8. Screening and expression of selected taxonomically conserved and unique hypothetical proteins in Burkholderia pseudomallei K96243

    Science.gov (United States)

    Akhir, Nor Azurah Mat; Nadzirin, Nurul; Mohamed, Rahmah; Firdaus-Raih, Mohd

    2015-09-01

    Hypothetical proteins of bacterial pathogens represent a large numbers of novel biological mechanisms which could belong to essential pathways in the bacteria. They lack functional characterizations mainly due to the inability of sequence homology based methods to detect functional relationships in the absence of detectable sequence similarity. The dataset derived from this study showed 550 candidates conserved in genomes that has pathogenicity information and only present in the Burkholderiales order. The dataset has been narrowed down to taxonomic clusters. Ten proteins were selected for ORF amplification, seven of them were successfully amplified, and only four proteins were successfully expressed. These proteins will be great candidates in determining the true function via structural biology.

  9. Identification of genes encoding hypothetical proteins in open-reading frame expressed sequence tags from mammalian stages of Trypanosoma cruzi.

    Science.gov (United States)

    Martins, C; Reis-Cunha, J L; Silva, M N; Pereira, E G; Pappas, G J; Bartholomeu, D C; Zingales, B

    2011-01-01

    Approximately 50% of the predicted protein-coding genes of the Trypanosoma cruzi CL Brener strain are annotated as hypothetical or conserved hypothetical proteins. To further characterize these genes, we generated 1161 open-reading frame expressed sequence tags (ORESTES) from the mammalian stages of the VL10 human strain. Sequence clustering resulted in 435 clusters, consisting of 339 singletons and 96 contigs. Significant matches to the T. cruzi predicted gene database were found for ~94% contigs and ~69% singletons. These included genes encoding surface proteins, known to be intensely expressed in the parasite mammalian stages and implicated in host cell invasion and/or immune evasion mechanisms. Among 151 contigs and singletons with similarity to predicted hypothetical protein-coding genes and conserved hypothetical protein-coding genes, 83% showed no match with T. cruzi EST and/or proteome databases. These ORESTES are the first experimental evidence that the corresponding genes are in fact transcribed. Sequences with no significant match were searched against several T. cruzi and National Center for Biotechnology Information non-redundant sequence databases. The ORESTES analysis indicated that 124 predicted conserved hypothetical protein-coding genes and 27 predicted hypothetical protein-coding genes annotated in the CL Brener genome are transcribed in the VL10 mammalian stages. Six ORESTES annotated as hypothetical protein-coding genes showing no match to EST and/or proteome databases were confirmed by Northern blot in VL10. The generation of this set of ORESTES complements the T. cruzi genome annotation and suggests new stage-regulated genes encoding hypothetical proteins.

  10. Women's Behavioral Responses to the Threat of a Hypothetical Date Rape Stimulus: A Qualitative Analysis.

    Science.gov (United States)

    Anderson, RaeAnn E; Brouwer, Amanda M; Wendorf, Angela R; Cahill, Shawn P

    2016-05-01

    One in four college women experience sexual assault on campus; yet, campuses rarely provide the in-depth self-defense programs needed to reduce sexual assault risk. Further, little is known about the range of possible behaviors elicited by sexual assault threat stimuli besides assertion. To fill this gap, the aim of the current study was to explore qualitative themes in women's intended behavioral responses to a hypothetical sexual assault threat, date rape, by using a laboratory-controlled threat. College women (N = 139) were randomly assigned to one of four different levels of sexual assault threat presented via an audio-recorded vignette. Participants articulated how they would hypothetically respond to the experimentally assigned threat. Responses were blinded and analyzed using Consensual Qualitative Research methodology. Six major themes emerged: assertion, compliance/acceptance, conditional decision making, avoidance, expressions of discomfort, and allusion to future contact. Although almost all participants described assertion, a number of non-assertive responses were described that are not currently recognized in the literature. These non-assertive responses, including compliance/acceptance, conditional decision making, and avoidance, may represent unique behavioral response styles and likely reflect the complex psychological process of behavioral response to threat. The variety of themes found illustrates the great range of behavioral responses to threat. This broad range is not currently well represented or measured in the literature and better understanding of these responses can inform future interventions, advocacy efforts, and policies focused on sexual assault.

  11. Comparative analysis of chemical similarity methods for modular natural products with a hypothetical structure enumeration algorithm.

    Science.gov (United States)

    Skinnider, Michael A; Dejong, Chris A; Franczak, Brian C; McNicholas, Paul D; Magarvey, Nathan A

    2017-08-16

    Natural products represent a prominent source of pharmaceutically and industrially important agents. Calculating the chemical similarity of two molecules is a central task in cheminformatics, with applications at multiple stages of the drug discovery pipeline. Quantifying the similarity of natural products is a particularly important problem, as the biological activities of these molecules have been extensively optimized by natural selection. The large and structurally complex scaffolds of natural products distinguish their physical and chemical properties from those of synthetic compounds. However, no analysis of the performance of existing methods for molecular similarity calculation specific to natural products has been reported to date. Here, we present LEMONS, an algorithm for the enumeration of hypothetical modular natural product structures. We leverage this algorithm to conduct a comparative analysis of molecular similarity methods within the unique chemical space occupied by modular natural products using controlled synthetic data, and comprehensively investigate the impact of diverse biosynthetic parameters on similarity search. We additionally investigate a recently described algorithm for natural product retrobiosynthesis and alignment, and find that when rule-based retrobiosynthesis can be applied, this approach outperforms conventional two-dimensional fingerprints, suggesting it may represent a valuable approach for the targeted exploration of natural product chemical space and microbial genome mining. Our open-source algorithm is an extensible method of enumerating hypothetical natural product structures with diverse potential applications in bioinformatics.

  12. Hypothetical Case and Scenario Description for International Transportation of Spent Nuclear Fuel.

    Energy Technology Data Exchange (ETDEWEB)

    Williams, Adam David [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Osborn, Douglas [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jones, Katherine A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Kalinina, Elena Arkadievna [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Cohn, Brian [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Thomas, Maikael A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Parks, Mancel Jordan [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Parks, Ethan Rutledge [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mohagheghi, Amir H. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-12-01

    To support more rigorous analysis on global security issues at Sandia National Laboratories (SNL), there is a need to develop realistic data sets without using "real" data or identifying "real" vulnerabilities, hazards or geopolitically embarrassing shortcomings. In response, an interdisciplinary team led by subject matter experts in SNL's Center for Global Security and Cooperation (CGSC) developed a hypothetical case description. This hypothetical case description assigns various attributes related to international SNF transportation that are representative, illustrative and indicative of "real" characteristics of "real" countries. There is no intent to identify any particular country and any similarity with specific real-world events is purely coincidental. To support the goal of this report to provide a case description (and set of scenarios of concern) for international SNF transportation inclusive of as much "real-world" complexity as possible -- without crossing over into politically sensitive or classified information -- this SAND report provides a subject matter expert-validated (and detailed) description of both technical and political influences on the international transportation of spent nuclear fuel. [PAGE INTENTIONALLY LEFT BLANK

  13. A flexible tool for calculating the consequences of a hypothetical nuclear accident

    Directory of Open Access Journals (Sweden)

    Eugenio Tabet

    2011-01-01

    Full Text Available The paper presents a parametric model, implemented on a personal computer, for calculating contamination and doses following a hypothetical nuclear accident. The model is embedded in the high level environment of Mathematica and uses the Gaussian solution for the plume structure at short and medium distances and a wedge-like behaviour for long distances calculation. Along with the usual effects, like the influence of a local wet ground deposition or the corrections due to build-up, the model deals also with other aspects, such as the long distance behaviour of the plume, by taking into account random wind direction variations. A rather sophisticated approach is used, in particular, when evaluating food contamination and doses, allowing also for consideration of a possible ban of food consumption. Several tens of functions are on hand of the user who can take full advantage of the very flexible tools introduced in the recent version 7 of Mathematica. Some examples of the power of the tool are shown with reference to the radiological consequences of an hypothetical accidental release in a EPR reactor.

  14. OPPORTUNITY COSTS OF REWARD DELAYS AND THE DISCOUNTING OF HYPOTHETICAL MONEY AND CIGARETTES

    Science.gov (United States)

    Johnson, Patrick S.; Herrmann, Evan S.; Johnson, Matthew W.

    2015-01-01

    Humans are reported to discount delayed rewards at lower rates than nonhumans. However, nonhumans are studied in tasks that restrict reinforcement during delays, whereas humans are typically studied in tasks that do not restrict reinforcement during delays. In nonhuman tasks, the opportunity cost of restricted reinforcement during delays may increase delay discounting rates. The present within-subjects study used online crowdsourcing (Amazon Mechanical Turk, or MTurk) to assess the discounting of hypothetical delayed money (and cigarettes in smokers) under four hypothetical framing conditions differing in the availability of reinforcement during delays. At one extreme, participants were free to leave their computer without returning, and engage in any behavior during reward delays (modeling typical human tasks). At the opposite extreme, participants were required to stay at their computer and engage in little other behavior during reward delays (modeling typical nonhuman tasks). Discounting rates increased as an orderly function of opportunity cost. Results also indicated predominantly hyperbolic discounting, the “magnitude effect,” steeper discounting of cigarettes than money, and positive correlations between discounting rates of these commodities. This is the first study to test the effects of opportunity costs on discounting, and suggests that procedural differences may partially account for observed species differences in discounting. PMID:25388973

  15. Opportunity costs of reward delays and the discounting of hypothetical money and cigarettes.

    Science.gov (United States)

    Johnson, Patrick S; Herrmann, Evan S; Johnson, Matthew W

    2015-01-01

    Humans are reported to discount delayed rewards at lower rates than nonhumans. However, nonhumans are studied in tasks that restrict reinforcement during delays, whereas humans are typically studied in tasks that do not restrict reinforcement during delays. In nonhuman tasks, the opportunity cost of restricted reinforcement during delays may increase delay discounting rates. The present within-subjects study used online crowdsourcing (Amazon Mechanical Turk, or MTurk) to assess the discounting of hypothetical delayed money (and cigarettes in smokers) under four hypothetical framing conditions differing in the availability of reinforcement during delays. At one extreme, participants were free to leave their computer without returning, and engage in any behavior during reward delays (modeling typical human tasks). At the opposite extreme, participants were required to stay at their computer and engage in little other behavior during reward delays (modeling typical nonhuman tasks). Discounting rates increased as an orderly function of opportunity cost. Results also indicated predominantly hyperbolic discounting, the "magnitude effect," steeper discounting of cigarettes than money, and positive correlations between discounting rates of these commodities. This is the first study to test the effects of opportunity costs on discounting, and suggests that procedural differences may partially account for observed species differences in discounting. © Society for the Experimental Analysis of Behavior.

  16. Conceptualization of a hypothetical high-level nuclear waste repository site in unsaturated, fractured tuff

    Energy Technology Data Exchange (ETDEWEB)

    Parsons, A.M.; Olague, N.E.; Gallegos, D.P. [Sandia National Labs., Albuquerque, NM (USA)

    1991-01-01

    Under the sponsorship of the US Nuclear Regulatory Commission (NRC), Sandia National Laboratories (SNL) is developing a performance assessment methodology for the analysis of long-term disposal and isolation of high-level nuclear wastes (HLW) in alternative geologic media. As part of this exercise, SNL created a conceptualization of ground-water flow and radionuclide transport in the far field of a hypothetical HLW repository site located in unsaturated, fractured tuff formations. This study provides a foundation for the development of conceptual mathematical, and numerical models to be used in this performance assessment methodology. This conceptualization is site specific in terms of geometry, the regional ground-water flow system, stratigraphy, and structure in that these are based on information from Yucca Mountain located on the Nevada Test Site. However, in terms of processes in unsaturated, fractured, porous media, the model is generic. This report also provides a review and evaluation of previously proposed conceptual models of unsaturated and saturated flow and solute transport. This report provides a qualitative description of a hypothetical HLW repository site in fractured tuff. However, evaluation of the current knowledge of flow and transport at Yucca Mountain does not yield a single conceptual model. Instead, multiple conceptual models are possible given the existing information.

  17. The effects of restaurant menu calorie labeling on hypothetical meal choices of females with disordered eating.

    Science.gov (United States)

    Haynos, Ann F; Roberto, Christina A

    2017-03-01

    Concerns have been raised that obesity public policy measures may have harmful effects on individuals with eating disorders. However, little research has investigated this topic. We examined the impact of a popular obesity public policy, menu calorie labeling, on hypothetical food choices of women with disordered eating. Seven hundred sixteen adult females completed an online survey in which they were randomly assigned to receive a restaurant menu with or without calorie information listed. Participants selected foods representative of a meal they would choose to consume and answered questions on restaurant ordering and menu labeling. Participants completed the Eating Disorder Examination Questionnaire (Fairburn & Beglin, ) to assess global eating pathology. Diagnoses of anorexia nervosa (AN), bulimia nervosa (BN), and binge-eating disorder (BED) were also derived from this measure. Generalized linear modeling examined the impact of menu label condition, disordered eating, and the menu label by disordered eating interaction on hypothetical food selection and related variables. When disordered eating was examined continuously, menu labeling did not differentially affect food selections of those with elevated disordered eating (p = .45). However, when examined by eating disorder diagnosis, participants with AN or BN ordered significantly fewer (p menu label versus no label condition. Menu labeling may decrease the calories ordered among individuals with AN or BN and increase calories ordered among individuals with BED. © 2017 Wiley Periodicals, Inc.

  18. Patient assessments of a hypothetical medical error: effects of health outcome, disclosure, and staff responsiveness.

    Science.gov (United States)

    Cleopas, A; Villaveces, A; Charvet, A; Bovier, P A; Kolly, V; Perneger, T V

    2006-04-01

    To assess whether patients' perceptions of a hypothetical medical error are influenced by staff responsiveness, disclosure of error, and health consequences of the error. Hypothetical scenario describing a medication error submitted by mail. Three factors were manipulated at random: rapid v slow staff responsiveness to error; disclosure v non-disclosure of the error; and occurrence of serious v minor health consequences. Patients discharged from hospital. Assessment of care described in the scenario as bad or very bad, rating of care as unsafe, and intent to not recommend the hospital. Of 1274 participants who evaluated the scenario, 71.4% rated health care as bad or very bad, 60.2% rated healthcare conditions as unsafe, and 25.5% stated that they would not recommend the hospital. Rating health care as bad or very bad was associated with slow reaction to error (odds ratio (OR) 2.8, 95% CI 2.1 to 3.6), non-disclosure of error (OR 2.0, 95% CI 1.5 to 2.6), and serious health consequences (OR 3.4, 95% CI 2.6 to 4.5). Similar associations were observed for rating healthcare conditions as unsafe and the intent to not recommend the hospital. Younger patients were more sensitive to non-disclosure than older patients. Former patients view medical errors less favorably when hospital staff react slowly, when the error is not disclosed to the patient, and when the patient suffers serious health consequences.

  19. Ab initio total energy study of brucite, diaspore and hypothetical hydrous wadsleyite

    Science.gov (United States)

    Winkler, B.; Milman, V.; Hennion, B.; Payne, M. C.; Lee, M.-H.; Lin, J. S.

    1995-10-01

    Ab initio total energy calculations based on the local density approximation (LDA) and the generalised gradient approximation (GGA) of density functional theory have been performed for brucite, Mg(OH)2, diaspore, AlOOH and hypothetical hydrous wadsleyite, Mg7Si4O14(OH)2. The use of a general gradient approximation (GGA) is essential to obtain a good agreement (≈ 1%) of the calculated lattice parameters to diffraction data. The calculated fractional coordinates of brucite and diaspore are in good agreement (≈ 1.5%) with experimental data. The angle of the non-linear hydrogen bond in diaspore is reproduced well, and the calculated Raman active OH stretching frequency in brucite is in very good agreement with spectroscopic data. There are no significant differences between the calculated fractional coordinates and the second derivative of the energy when GGA is used instead of standard LDA. It is concluded that the description of the static and the dynamic behavior of the OH groups in these hydroxides is very good. It is therefore inferred that the parameter free model is predictive and it has been used to evaluate a hypothetical structure of hydrous wadsleyite. The model reproduces the unusual Si-O bond length of 1.7 Å, observed in β-Mg2SiO4. It predicts an O-H distance of 0.97 Å, which is significantly shorter than the distance obtained from earlier model calculations.

  20. Evaluating the impacts of farmers' behaviors on a hypothetical agricultural water market based on double auction

    Science.gov (United States)

    Du, Erhu; Cai, Ximing; Brozović, Nicholas; Minsker, Barbara

    2017-05-01

    Agricultural water markets are considered effective instruments to mitigate the impacts of water scarcity and to increase crop production. However, previous studies have limited understanding of how farmers' behaviors affect the performance of water markets. This study develops an agent-based model to explicitly incorporate farmers' behaviors, namely irrigation behavior (represented by farmers' sensitivity to soil water deficit λ) and bidding behavior (represented by farmers' rent seeking μ and learning rate β), in a hypothetical water market based on a double auction. The model is applied to the Guadalupe River Basin in Texas to simulate a hypothetical agricultural water market under various hydrological conditions. It is found that the joint impacts of the behavioral parameters on the water market are strong and complex. In particular, among the three behavioral parameters, λ affects the water market potential and its impacts on the performance of the water market are significant under most scenarios. The impacts of μ or β on the performance of the water market depend on the other two parameters. The water market could significantly increase crop production only when the following conditions are satisfied: (1) λ is small and (2) μ is small and/or β is large. The first condition requires efficient irrigation scheduling, and the second requires well-developed water market institutions that provide incentives to bid true valuation of water permits.

  1. Telephony Earth Station

    Science.gov (United States)

    Morris, Adrian J.; Kay, Stan

    The Telephony Earth Station (TES), a digital full-mesh SCPC (single channel per carrier) system designed for satellite voice and data transmission is described. As compared to companded FM, the advanced speech compression and forward error correction techniques used by TES better achieve the quality, power, and bandwidth ideal for each application. In addition, the TES offers a fully demand-assigned voice call setup, handles point-to-point data channels, supports a variety of signaling schemes, and does not require any separate pilot receivers at the station, while keeping costs low through innovative technology and packaging. The TES can be used for both C-band and Ku-band (domestic or international) applications, and is configurable either as an VSAT (very small aperture terminal) using an SSPA, or as a larger station depending on the capacity requirements. A centralized DAMA processor and network manager is implemented using a workstation.

  2. Hydrogen Fuelling Stations

    DEFF Research Database (Denmark)

    Rothuizen, Erasmus Damgaard

    This thesis concerns hydrogen fuelling stations from an overall system perspective. The study investigates thermodynamics and energy consumption of hydrogen fuelling stations for fuelling vehicles for personal transportation. For the study a library concerning the components in a hydrogen fuelling...... station has been developed in Dymola. The models include the fuelling protocol (J2601) for hydrogen vehicles made by Society of Automotive Engineers (SAE) and the thermodynamic property library CoolProp is used for retrieving state point. The components in the hydrogen fuelling library are building up....... A system consisting of one high pressure storage tank is used to investigate the thermodynamics of fuelling a hydrogen vehicle. The results show that the decisive parameter for how the fuelling proceeds is the pressure loss in the vehicle. The single tank fuelling system is compared to a cascade fuelling...

  3. Hydrogen vehicle fueling station

    Energy Technology Data Exchange (ETDEWEB)

    Daney, D.E.; Edeskuty, F.J.; Daugherty, M.A. [Los Alamos National Lab., NM (United States)] [and others

    1995-09-01

    Hydrogen fueling stations are an essential element in the practical application of hydrogen as a vehicle fuel, and a number of issues such as safety, efficiency, design, and operating procedures can only be accurately addressed by a practical demonstration. Regardless of whether the vehicle is powered by an internal combustion engine or fuel cell, or whether the vehicle has a liquid or gaseous fuel tank, the fueling station is a critical technology which is the link between the local storage facility and the vehicle. Because most merchant hydrogen delivered in the US today (and in the near future) is in liquid form due to the overall economics of production and delivery, we believe a practical refueling station should be designed to receive liquid. Systems studies confirm this assumption for stations fueling up to about 300 vehicles. Our fueling station, aimed at refueling fleet vehicles, will receive hydrogen as a liquid and dispense it as either liquid, high pressure gas, or low pressure gas. Thus, it can refuel any of the three types of tanks proposed for hydrogen-powered vehicles -- liquid, gaseous, or hydride. The paper discusses the fueling station design. Results of a numerical model of liquid hydrogen vehicle tank filling, with emphasis on no vent filling, are presented to illustrate the usefulness of the model as a design tool. Results of our vehicle performance model illustrate our thesis that it is too early to judge what the preferred method of on-board vehicle fuel storage will be in practice -- thus our decision to accommodate all three methods.

  4. The organized Space Station

    Science.gov (United States)

    Lew, Leong W.

    Space Station organization designers should consider the onboard stowage system to be an integral part of the environment structured for productive working conditions. In order to achieve this, it is essential to use an efficient inventory control system able to track approximately 50,000 items over a 90-day period, while maintaining peak crew performance. It is noted that a state-of-the-art bar-code inventory management system cannot satisfy all Space Station requirements, such as the location of a critical missing item.

  5. Space Station Water Quality

    Science.gov (United States)

    Willis, Charles E. (Editor)

    1987-01-01

    The manned Space Station will exist as an isolated system for periods of up to 90 days. During this period, safe drinking water and breathable air must be provided for an eight member crew. Because of the large mass involved, it is not practical to consider supplying the Space Station with water from Earth. Therefore, it is necessary to depend upon recycled water to meet both the human and nonhuman water needs on the station. Sources of water that will be recycled include hygiene water, urine, and cabin humidity condensate. A certain amount of fresh water can be produced by CO2 reduction process. Additional fresh water will be introduced into the total pool by way of food, because of the free water contained in food and the water liberated by metabolic oxidation of the food. A panel of scientists and engineers with extensive experience in the various aspects of wastewater reuse was assembled for a 2 day workshop at NASA-Johnson. The panel included individuals with expertise in toxicology, chemistry, microbiology, and sanitary engineering. A review of Space Station water reclamation systems was provided.

  6. Galileo Station Keeping Strategy

    Science.gov (United States)

    Perez-Cambriles, Antonio; Bejar-Romero, Juan Antonio; Aguilar-Taboada, Daniel; Perez-Lopez, Fernando; Navarro, Daniel

    2007-01-01

    This paper presents analyses done for the design and implementation of the Maneuver Planning software of the Galileo Flight Dynamics Facility. The station keeping requirements of the constellation have been analyzed in order to identify the key parameters to be taken into account in the design and implementation of the software.

  7. Kiowa Creek Switching Station

    Energy Technology Data Exchange (ETDEWEB)

    1990-03-01

    The Western Area Power Administration (Western) proposes to construct, operate, and maintain a new Kiowa Creek Switching Station near Orchard in Morgan County, Colorado. Kiowa Creek Switching Station would consist of a fenced area of approximately 300 by 300 feet and contain various electrical equipment typical for a switching station. As part of this new construction, approximately one mile of an existing 115-kilovolt (kV) transmission line will be removed and replaced with a double circuit overhead line. The project will also include a short (one-third mile) realignment of an existing line to permit connection with the new switching station. In accordance with the Council on Environmental Quality (CEQ) regulations for implementing the procedural provisions of the National Environmental Policy Act of 1969 (NEPA), 40 CFR Parts 1500--1508, the Department of Energy (DOE) has determined that an environmental impact statement (EIS) is not required for the proposed project. This determination is based on the information contained in this environmental assessment (EA) prepared by Western. The EA identifies and evaluates the environmental and socioeconomic effects of the proposed action, and concludes that the advance impacts on the human environment resulting from the proposed project would not be significant. 8 refs., 3 figs., 1 tab.

  8. Summit Station Skiway Review

    Science.gov (United States)

    2013-03-01

    operating procedures (SOPs) for future construction and maintenance efforts. DISCLAIMER: The contents of this report are not to be used for...Runway Construction .......................................................... 22 Appendix B: Rammsonde Instructions...13. Snow accumulation at Summit Station in the Bamboo Forest. .......................................... 13 Figure 14. Strength of Summit skiway

  9. Electrostatic pickup station

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    Electrostatic pickup station, with 4 electrodes, to measure beam position in the horizontal and vertical plane. This type is used in the transfer lines leaving the PS (TT2, TTL2, TT70). See also 8206063, where the electrode shapes are clearly visible.

  10. Designing a Weather Station

    Science.gov (United States)

    Roman, Harry T.

    2012-01-01

    The collection and analysis of weather data is crucial to the location of alternate energy systems like solar and wind. This article presents a design challenge that gives students a chance to design a weather station to collect data in advance of a large wind turbine installation. Data analysis is a crucial part of any science or engineering…

  11. Hypothetical Outcome Plots Outperform Error Bars and Violin Plots for Inferences about Reliability of Variable Ordering.

    Directory of Open Access Journals (Sweden)

    Jessica Hullman

    Full Text Available Many visual depictions of probability distributions, such as error bars, are difficult for users to accurately interpret. We present and study an alternative representation, Hypothetical Outcome Plots (HOPs, that animates a finite set of individual draws. In contrast to the statistical background required to interpret many static representations of distributions, HOPs require relatively little background knowledge to interpret. Instead, HOPs enables viewers to infer properties of the distribution using mental processes like counting and integration. We conducted an experiment comparing HOPs to error bars and violin plots. With HOPs, people made much more accurate judgments about plots of two and three quantities. Accuracy was similar with all three representations for most questions about distributions of a single quantity.

  12. Hypothetical Outcome Plots Outperform Error Bars and Violin Plots for Inferences about Reliability of Variable Ordering.

    Science.gov (United States)

    Hullman, Jessica; Resnick, Paul; Adar, Eytan

    2015-01-01

    Many visual depictions of probability distributions, such as error bars, are difficult for users to accurately interpret. We present and study an alternative representation, Hypothetical Outcome Plots (HOPs), that animates a finite set of individual draws. In contrast to the statistical background required to interpret many static representations of distributions, HOPs require relatively little background knowledge to interpret. Instead, HOPs enables viewers to infer properties of the distribution using mental processes like counting and integration. We conducted an experiment comparing HOPs to error bars and violin plots. With HOPs, people made much more accurate judgments about plots of two and three quantities. Accuracy was similar with all three representations for most questions about distributions of a single quantity.

  13. Comparison of hypothetical and experienced EQ-5D valuations: relative weights of the five dimensions

    DEFF Research Database (Denmark)

    Rand-Hendriksen, K.; Augestad, L. A.; Sønbø Kristiansen, Ivar

    2012-01-01

    -specific regression coefficients. We examined differences in the relative importance attributed to the EQ-5D dimensions between EH and HH valuations of EQ-5D states in the United States. Methods We used the regression model from the US EQ-5D valuation study on EH ratings from the 2000-2003 Medical Expenditure Panel...... Survey and on HH ratings from the US EQ-5D valuation study conducted in 2001. We then compared patterns in the relative magnitudes of coefficients that corresponded to the five dimensions. Results In the HH model, self-care and pain/discomfort were the most important dimensions, while usual activities......Purpose EQ-5D tariffs are typically based on general population valuations studies, but whether valuations of experienced health (EH) or hypothetical health (HH) are more appropriate is disputed. Previous comparisons of valuations of EH and HH have focused on absolute differences in dimension...

  14. Performance assessment for a hypothetical low-level waste disposal facility

    Energy Technology Data Exchange (ETDEWEB)

    Smith, C.S.; Rohe, M.J.; Ritter, P.D. [and others

    1997-01-01

    Disposing of low-level waste (LLW) is a concern for many states throughout the United States. A common disposal method is below-grade concrete vaults. Performance assessment analyses make predictions of contaminant release, transport, ingestion, inhalation, or other routes of exposure, and the resulting doses for various disposal methods such as the below-grade concrete vaults. Numerous assumptions are required to simplify the processes associated with the disposal facility to make predictions feasible. In general, these assumptions are made conservatively so as to underestimate the performance of the facility. The objective of this report is to describe the methodology used in conducting a performance assessment for a hypothetical waste facility located in the northeastern United States using real data as much as possible. This report consists of the following: (a) a description of the disposal facility and site, (b) methods used to analyze performance of the facility, (c) the results of the analysis, and (d) the conclusions of this study.

  15. Preliminary results of consequence assessment of a hypothetical severe accident using Thai meteorological data

    Science.gov (United States)

    Silva, K.; Lawawirojwong, S.; Promping, J.

    2017-06-01

    Consequence assessment of a hypothetical severe accident is one of the important elements of the risk assessment of a nuclear power plant. It is widely known that the meteorological conditions can significantly influence the outcomes of such assessment, since it determines the results of the calculation of the radionuclide environmental transport. This study aims to assess the impacts of the meteorological conditions to the results of the consequence assessment. The consequence assessment code, OSCAAR, of Japan Atomic Energy Agency (JAEA) is used for the assessment. The results of the consequence assessment using Thai meteorological data are compared with those using Japanese meteorological data. The Thai case has following characteristics. Low wind speed made the radionuclides concentrate at the center comparing to the Japanese case. The squalls induced the peaks in the ground concentration distribution. The evacuated land is larger than the Japanese case though the relocated land is smaller, which is attributed to the concentration of the radionuclides near the release point.

  16. NMR Structure of the hypothetical protein encoded by the YjbJ gene from Escherichia coli

    Energy Technology Data Exchange (ETDEWEB)

    Pineda-Lucena, Antonio; Liao, Jack; Wu, Bin; Yee, Adelinda; Cort, John R.; Kennedy, Michael A.; Edwards, Aled M.; Arrowsmith, Cheryl H.

    2002-06-01

    Here we describe the solution structure of YjbJ (gil418541) as part of a structural proteomics project on the feasibility of the high-throughput generation of samples from Escherichia coli for structural studies. YjbJ is a hypothetical protein from Escherichia coli protein of unknown function. It is conserved, showing significant sequence identity to four predicted prokaryotic proteins, also of unknown function (Figure 1A). These include gil16762921 from Salmonella enterica (S. typhi), gil17938413 from Agrobacterium tumefaciens, gil16265654 from Sinorizhobium meliloti, and gil15599932 from Pseudomona aeruginosa. The structure of YjbJ reveals a new variation of a common motif (four-helix bundle) that could not be predicted from the protein sequence. Although the biochemical function is unknown, the existence of patterns of conserved residues on the protein surface suggest that the fold and function of all these proteins could be similar.

  17. Radiation Dose Calculations for a Hypothetical Accident in Xianning Nuclear Power Plant

    Directory of Open Access Journals (Sweden)

    Bo Cao

    2016-01-01

    Full Text Available Atmospheric dispersion modeling and radiation dose calculations have been performed for a hypothetical AP1000 SGTR accident by HotSpot code 3.03. TEDE, the respiratory time-integrated air concentration, and the ground deposition are calculated for various atmospheric stability classes, Pasquill stability categories A–F with site-specific averaged meteorological conditions. The results indicate that the maximum plume centerline ground deposition value of 1.2E+2 kBq/m2 occurred at about 1.4 km and the maximum TEDE value of 1.41E-05 Sv occurred at 1.4 km from the reactor. It is still far below the annual regulatory limits of 1 mSv for the public as set in IAEA Safety Report Series number 115. The released radionuclides might be transported to long distances but will not have any harmful effect on the public.

  18. Signal coverage approach to the detection probability of hypothetical extraterrestrial emitters in the Milky Way

    Science.gov (United States)

    Grimaldi, Claudio

    2017-04-01

    The lack of evidence for the existence of extraterrestrial life, even the simplest forms of animal life, makes it is difficult to decide whether the search for extraterrestrial intelligence (SETI) is more a high-risk, high-payoff endeavor than a futile attempt. Here we insist that even if extraterrestrial civilizations do exist and communicate, the likelihood of detecting their signals crucially depends on whether the Earth lies within a region of the galaxy covered by such signals. By considering possible populations of independent emitters in the galaxy, we build a statistical model of the domain covered by hypothetical extraterrestrial signals to derive the detection probability that the Earth is within such a domain. We show that for general distributions of the signal longevity and directionality, the mean number of detectable emitters is less than one even for detection probabilities as large as 50%, regardless of the number of emitters in the galaxy.

  19. Signal coverage approach to the detection probability of hypothetical extraterrestrial emitters in the Milky Way.

    Science.gov (United States)

    Grimaldi, Claudio

    2017-04-12

    The lack of evidence for the existence of extraterrestrial life, even the simplest forms of animal life, makes it is difficult to decide whether the search for extraterrestrial intelligence (SETI) is more a high-risk, high-payoff endeavor than a futile attempt. Here we insist that even if extraterrestrial civilizations do exist and communicate, the likelihood of detecting their signals crucially depends on whether the Earth lies within a region of the galaxy covered by such signals. By considering possible populations of independent emitters in the galaxy, we build a statistical model of the domain covered by hypothetical extraterrestrial signals to derive the detection probability that the Earth is within such a domain. We show that for general distributions of the signal longevity and directionality, the mean number of detectable emitters is less than one even for detection probabilities as large as 50%, regardless of the number of emitters in the galaxy.

  20. Purification and characterization of a thermostable hypothetical xylanase from Aspergillus oryzae HML366.

    Science.gov (United States)

    He, Haiyan; Qin, Yongling; Li, Nan; Chen, Guiguang; Liang, Zhiqun

    2015-03-01

    In the current study, fermentation broth of Aspergillus oryzae HML366 in sugar cane bagasse was subjected to ultrafiltration and ion exchange chromatography, and two xylanases, XynH1 and XynH2, were purified. Time-of-flight mass spectrometry coupled with SDS-PAGE analysis revealed that XynH1 is identical to the hypothetical A. oryzae RIB40 protein XP_001826985.1, with a molecular weight of 33.671 kDa. Likewise, XynH2 was identified as xylanase XynF1 with a molecular weight of 35.402 kDa. Sequence analysis indicated that XynH1 belongs to glycosyl hydrolases family 10. The specific activity of XynH1 was measured at 476.9 U/mg. Optimal xylanase activity was observed at pH 6.0, and enzyme remained active within pH 4.0-10.0 and at a temperature below 70 °C. Mg(2+), Mn(2+), Ca(2+), and K(+) enhanced the XynH1 xylanase activity to 146, 122, 114, and 108%, respectively. XynH1 hydrolyzed Birchwood xylan and Larchwood xylan effectively. The K m and V max of XynH1 values determined were 1.16 mM and 336 μmol/min/mg with Birchwood xylan as the substrate. A. oryzae HML366 xylanase XynH1 showed superior heat and pH tolerance, therefore may have significant applications in paper and biofuel industries. These studies constitute the first investigation of the xylanase activities of the hypothetical protein XP_001826985.1 form A. oryzae.

  1. Molecular Characterization and Immune Protection of a New Conserved Hypothetical Protein of Eimeria tenella.

    Science.gov (United States)

    Zhai, Qi; Huang, Bing; Dong, Hui; Zhao, Qiping; Zhu, Shunhai; Liang, Siting; Li, Sha; Yang, Sihan; Han, Hongyu

    2016-01-01

    The genome sequences of Eimeria tenella have been sequenced, but >70% of these genes are currently categorized as having an unknown function or annotated as conserved hypothetical proteins, and few of them have been studied. In the present study, a conserved hypothetical protein gene of E. tenella, designated EtCHP559, was cloned using rapid amplification of cDNA 5'-ends (5'RACE) based on the expressed sequence tag (EST). The 1746-bp full-length cDNA of EtCHP559 contained a 1224-bp open reading frame (ORF) that encoded a 407-amino acid polypeptide with the predicted molecular weight of 46.04 kDa. Real-time quantitative PCR analysis revealed that EtCHP559 was expressed at higher levels in sporozoites than in the other developmental stages (unsporulated oocysts, sporulated oocysts and second generation merozoites). The ORF was inserted into pCold-TF to produce recombinant EtCHP559. Using western blotting, the recombinant protein was successfully recognized by rabbit serum against E. tenella sporozoites. Immunolocalization by using EtCHP559 antibody showed that EtCHP559 was mainly distributed on the parasite surface in free sporozoites and became concentrated in the anterior region after sporozoites were incubated in complete medium. The EtCHP559 became uniformly dispersed in immature and mature schizonts. Inhibition of EtCHP559 function using anti-rEtCHP559 polyclonal antibody reduced the ability of E. tenella sporozoites to invade host cells by >70%. Animal challenge experiments demonstrated that the recombinant EtCHP559 significantly increased the average body weight gain, reduced the oocyst outputs, alleviated cecal lesions of the infected chickens, and resulted in anticoccidial index >160 against E. tenella. These results suggest that EtCHP559 plays an important role in sporozoite invasion and could be an effective candidate for the development of a new vaccine against E. tenella.

  2. Molecular Characterization and Immune Protection of a New Conserved Hypothetical Protein of Eimeria tenella.

    Directory of Open Access Journals (Sweden)

    Qi Zhai

    Full Text Available The genome sequences of Eimeria tenella have been sequenced, but >70% of these genes are currently categorized as having an unknown function or annotated as conserved hypothetical proteins, and few of them have been studied. In the present study, a conserved hypothetical protein gene of E. tenella, designated EtCHP559, was cloned using rapid amplification of cDNA 5'-ends (5'RACE based on the expressed sequence tag (EST. The 1746-bp full-length cDNA of EtCHP559 contained a 1224-bp open reading frame (ORF that encoded a 407-amino acid polypeptide with the predicted molecular weight of 46.04 kDa. Real-time quantitative PCR analysis revealed that EtCHP559 was expressed at higher levels in sporozoites than in the other developmental stages (unsporulated oocysts, sporulated oocysts and second generation merozoites. The ORF was inserted into pCold-TF to produce recombinant EtCHP559. Using western blotting, the recombinant protein was successfully recognized by rabbit serum against E. tenella sporozoites. Immunolocalization by using EtCHP559 antibody showed that EtCHP559 was mainly distributed on the parasite surface in free sporozoites and became concentrated in the anterior region after sporozoites were incubated in complete medium. The EtCHP559 became uniformly dispersed in immature and mature schizonts. Inhibition of EtCHP559 function using anti-rEtCHP559 polyclonal antibody reduced the ability of E. tenella sporozoites to invade host cells by >70%. Animal challenge experiments demonstrated that the recombinant EtCHP559 significantly increased the average body weight gain, reduced the oocyst outputs, alleviated cecal lesions of the infected chickens, and resulted in anticoccidial index >160 against E. tenella. These results suggest that EtCHP559 plays an important role in sporozoite invasion and could be an effective candidate for the development of a new vaccine against E. tenella.

  3. Modeling a novel hypothetical use of postal collection boxes as automated external defibrillator access points.

    Science.gov (United States)

    Srinivasan, Sanjana; Salerno, Jessica; Hajari, Hadi; Weiss, Lenny S; Salcido, David D

    2017-11-01

    Optimizing placement of Automated External Defibrillators (AED) can increase survival after an out-of-hospital cardiac arrest (OHCA). Using postal collection boxes (PCB) as locations for AEDs could potentially enhance accessibility and streamline maintenance. In this study, we modeled the hypothetical effects of deploying AEDs at PCB locations. We hypothesized that PCB-AEDs would increase AED coverage overall and in residential areas, and reduce the distance from OHCA to an AED. AEDs in Pittsburgh, PA were identified by the University of Pittsburgh Resuscitation Logistics and Informatics Venture (n=747). PCB locations were obtained from the United States Postal Service (n=479). OHCA locations from 2009 to 2014 were obtained from the Pittsburgh site of the Resuscitation Outcomes Consortium. AED coverage assuming a ¼ mile radius around each AED was estimated for known AEDs, PCB-AEDs (hypothetical AED locations), and known AEDs augmented by PCB-AEDs, both overall and for residential and non-residential zones. Linear distance from each OHCA to the nearest AED was calculated and compared between the sets. The set of known AEDs augmented with PCB-AEDs covered more of the city overall (55% vs 30%), as well as greater proportions of residential (62% vs 27%) and non-residential areas (45% vs 30%). The median distance from OHCA to AED was significantly shorter when known AEDs were augmented with PCB-AEDs (0.12mi vs 0.32mi; p=0.001). Augmenting existing publicly accessible AEDs with AEDs deployed at PCBs can increase AED spatial coverage in both residential and non-residential areas, and reduce the distance from AED to OHCA. Copyright © 2017 Elsevier B.V. All rights reserved.

  4. Geologic simulation model for a hypothetical site in the Columbia Plateau. [AEGIS

    Energy Technology Data Exchange (ETDEWEB)

    Petrie, G.M.; Zellmer, J.T.; Lindberg, J.W.; Foley, M.G.

    1981-04-01

    This report describes the structure and operation of the Assessment of Effectiveness of Geologic Isolation Systems (AEGIS) Geologic Simulation Model, a computer simulation model of the geology and hydrology of an area of the Columbia Plateau, Washington. The model is used to study the long-term suitability of the Columbia Plateau Basalts for the storage of nuclear waste in a mined repository. It is also a starting point for analyses of such repositories in other geologic settings. The Geologic Simulation Model will aid in formulating design disruptive sequences (i.e. those to be used for more detailed hydrologic, transport, and dose analyses) from the spectrum of hypothetical geological and hydrological developments that could result in transport of radionuclides out of a repository. Quantitative and auditable execution of this task, however, is impossible without computer simulation. The computer simulation model aids the geoscientist by generating the wide spectrum of possible future evolutionary paths of the areal geology and hydrology, identifying those that may affect the repository integrity. This allows the geoscientist to focus on potentially disruptive processes, or series of events. Eleven separate submodels are used in the simulation portion of the model: Climate, Continental Glaciation, Deformation, Geomorphic Events, Hydrology, Magmatic Events, Meteorite Impact, Sea-Level Fluctuations, Shaft-Seal Failure, Sub-Basalt Basement Faulting, and Undetected Features. Because of the modular construction of the model, each submodel can easily be replaced with an updated or modified version as new information or developments in the state of the art become available. The model simulates the geologic and hydrologic systems of a hypothetical repository site and region for a million years following repository decommissioning. The Geologic Simulation Model operates in both single-run and Monte Carlo modes.

  5. Hydrogen Filling Station

    Energy Technology Data Exchange (ETDEWEB)

    Boehm, Robert F; Sabacky, Bruce; Anderson II, Everett B; Haberman, David; Al-Hassin, Mowafak; He, Xiaoming; Morriseau, Brian

    2010-02-24

    Hydrogen is an environmentally attractive transportation fuel that has the potential to displace fossil fuels. The Freedom CAR and Freedom FUEL initiatives emphasize the importance of hydrogen as a future transportation fuel. Presently, Las Vegas has one hydrogen fueling station powered by natural gas. However, the use of traditional sources of energy to produce hydrogen does not maximize the benefit. The hydrogen fueling station developed under this grant used electrolysis units and solar energy to produce hydrogen fuel. Water and electricity are furnished to the unit and the output is hydrogen and oxygen. Three vehicles were converted to utilize the hydrogen produced at the station. The vehicles were all equipped with different types of technologies. The vehicles were used in the day-to-day operation of the Las Vegas Valley Water District and monitoring was performed on efficiency, reliability and maintenance requirements. The research and demonstration utilized for the reconfiguration of these vehicles could lead to new technologies in vehicle development that could make hydrogen-fueled vehicles more cost effective, economical, efficient and more widely used. In order to advance the development of a hydrogen future in Southern Nevada, project partners recognized a need to bring various entities involved in hydrogen development and deployment together as a means of sharing knowledge and eliminating duplication of efforts. A road-mapping session was held in Las Vegas in June 2006. The Nevada State Energy Office, representatives from DOE, DOE contractors and LANL, NETL, NREL were present. Leadership from the National hydrogen Association Board of Directors also attended. As a result of this session, a roadmap for hydrogen development was created. This roadmap has the ability to become a tool for use by other road-mapping efforts in the hydrogen community. It could also become a standard template for other states or even countries to approach planning for a hydrogen

  6. Battery charging stations

    Energy Technology Data Exchange (ETDEWEB)

    Bergey, M.

    1997-12-01

    This paper discusses the concept of battery charging stations (BCSs), designed to service rural owners of battery power sources. Many such power sources now are transported to urban areas for recharging. A BCS provides the opportunity to locate these facilities closer to the user, is often powered by renewable sources, or hybrid systems, takes advantage of economies of scale, and has the potential to provide lower cost of service, better service, and better cost recovery than other rural electrification programs. Typical systems discussed can service 200 to 1200 people, and consist of stations powered by photovoltaics, wind/PV, wind/diesel, or diesel only. Examples of installed systems are presented, followed by cost figures, economic analysis, and typical system design and performance numbers.

  7. Weigh-in-Motion Stations

    Data.gov (United States)

    Department of Homeland Security — The data included in the GIS Traffic Stations Version database have been assimilated from station description files provided by FHWA for Weigh-in-Motion (WIM), and...

  8. Automatic Traffic Recorder (ATR) Stations

    Data.gov (United States)

    Department of Homeland Security — The data included in the GIS Traffic Stations Version database have been assimilated from station description files provided by FHWA for Weigh-in-Motion (WIM), and...

  9. Emergency Medical Service (EMS) Stations

    Data.gov (United States)

    Kansas Data Access and Support Center — EMS Locations in Kansas The EMS stations dataset consists of any location where emergency medical services (EMS) personnel are stationed or based out of, or where...

  10. Space Station fluid management logistics

    Science.gov (United States)

    Dominick, Sam M.

    1990-01-01

    Viewgraphs and discussion on space station fluid management logistics are presented. Topics covered include: fluid management logistics - issues for Space Station Freedom evolution; current fluid logistics approach; evolution of Space Station Freedom fluid resupply; launch vehicle evolution; ELV logistics system approach; logistics carrier configuration; expendable fluid/propellant carrier description; fluid carrier design concept; logistics carrier orbital operations; carrier operations at space station; summary/status of orbital fluid transfer techniques; Soviet progress tanker system; and Soviet propellant resupply system observations.

  11. An Efficient Method to Design Premature End-of-Life Trajectories: A Hypothetical Alternate Fate for Cassini

    Science.gov (United States)

    Vaquero, Mar; Senent, Juan

    2015-01-01

    What would happen if, hypothetically, the highly successful Cassini mission were to end prematurely due to lack of propellant or sudden subsystem failure? A solid plan to quickly produce a solution for any given scenario, regardless of where the spacecraft is along its reference path, must be in place to safely dispose of the spacecraft and meet all planetary protection requirements. As a contingency plan for this hypothetical situation, a method to design viable high-fidelity terminating trajectories based on a hybrid approach that exploits two-body and three-body flyby transfers combined with a numerical optimization scheme is detailed in this paper.

  12. Build Your Own Space Station

    Science.gov (United States)

    Bolinger, Allison

    2016-01-01

    This presentation will be used to educate elementary students on the purposes and components of the International Space Station and then allow them to build their own space stations with household objects and then present details on their space stations to the rest of the group.

  13. Air and radiation monitoring stations

    CERN Multimedia

    AUTHOR|(SzGeCERN)582709

    2015-01-01

    CERN has around 100 monitoring stations on and around its sites. New radiation measuring stations, capable of detecting even lower levels of radiation, were installed in 2014. Two members of HE-SEE group (Safety Engineering and Environment group) in front of one of the new monitoring stations.

  14. Southeast Regional Experiment Station

    Science.gov (United States)

    1994-08-01

    This is the final report of the Southeast Regional Experiment Station project. The Florida Solar Energy Center (FSEC), a research institute of the University of Central Florida (UCF), has operated the Southeast Regional Experiment Station (SE RES) for the US Department of Energy (DOE) since September 1982. Sandia National Laboratories, Albuquerque (SNLA) provides technical program direction for both the SE RES and the Southwest Regional Experiment Station (SW RES) located at the Southwest Technology Development Institute at Las Cruces, New Mexico. This cooperative effort serves a critical role in the national photovoltaic program by conducting system evaluations, design assistance and technology transfer to enhance the cost-effective utilization and development of photovoltaic technology. Initially, the research focus of the SE RES program centered on utility-connected PV systems and associated issues. In 1987, the SE RES began evaluating amorphous silicon (a-Si) thin-film PV modules for application in utility-interactive systems. Stand-alone PV systems began receiving increased emphasis at the SE RES in 1986. Research projects were initiated that involved evaluation of vaccine refrigeration, water pumping and other stand-alone power systems. The results of this work have led to design optimization techniques and procedures for the sizing and modeling of PV water pumping systems. Later recent research at the SE RES included test and evaluation of batteries and charge controllers for stand-alone PV system applications. The SE RES project provided the foundation on which FSEC achieved national recognition for its expertise in PV systems research and related technology transfer programs. These synergistic products of the SE RES illustrate the high visibility and contributions the FSEC PV program offers to the DOE.

  15. Submerged AUV Charging Station

    Science.gov (United States)

    Jones, Jack A.; Chao, Yi; Curtin, Thomas

    2014-01-01

    Autonomous Underwater Vehicles (AUVs) are becoming increasingly important for military surveillance and mine detection. Most AUVs are battery powered and have limited lifetimes of a few days to a few weeks. This greatly limits the distance that AUVs can travel underwater. Using a series of submerged AUV charging stations, AUVs could travel a limited distance to the next charging station, recharge its batteries, and continue to the next charging station, thus traveling great distances in a relatively short time, similar to the Old West “Pony Express.” One solution is to use temperature differences at various depths in the ocean to produce electricity, which is then stored in a submerged battery. It is preferred to have the upper buoy submerged a reasonable distance below the surface, so as not to be seen from above and not to be inadvertently destroyed by storms or ocean going vessels. In a previous invention, a phase change material (PCM) is melted (expanded) at warm temperatures, for example, 15 °C, and frozen (contracted) at cooler temperatures, for example, 8 °C. Tubes containing the PCM, which could be paraffin such as pentadecane, would be inserted into a container filled with hydraulic oil. When the PCM is melted (expanded), it pushes the oil out into a container that is pressurized to about 3,000 psi (approx equals 20.7 MPa). When a valve is opened, the high-pressure oil passes through a hydraulic motor, which turns a generator and charges a battery. The low-pressure oil is finally reabsorbed into the PCM canister when the PCM tubes are frozen (contracted). Some of the electricity produced could be used to control an external bladder or a motor to the tether line, such that depth cycling is continued for a very long period of time. Alternatively, after the electricity is generated by the hydraulic motor, the exiting low-pressure oil from the hydraulic motor could be vented directly to an external bladder on the AUV, such that filling of the bladder

  16. Korea Geodetic VLBI Station Sejong

    Science.gov (United States)

    Yi, S.; Moon, Y.; Kim, S.; Lee, J.; Joo, H. e.; Oh, H.

    2012-12-01

    The Sejong VLBI station has been constructed by the National Geographic Information Institute (NGII) in the Republic of Korea. It took approximately four years from 2008 to the end of 2011. In February 2012, we successfully carried out a fringe-test with the Kashima 11-m antenna of the National Institute of Information and Communications Technology (NICT) in Japan. In March, the Sejong station was accepted as an IVS network station by acceptance of the IVS Directing Board which was held at the 7th IVS General Meeting in Spain. This report summarizes activities of the Sejong station as a new IVS Network Station.

  17. Hypothetical biotechnology companies: A role-playing student centered activity for undergraduate science students.

    Science.gov (United States)

    Chuck, Jo-Anne

    2011-01-01

    Science students leaving undergraduate programs are entering the biotechnology industry where they are presented with issues which require integration of science content. Students find this difficult as through-out their studies, most content is limited to a single subdiscipline (e.g., biochemistry, immunology). In addition, students need knowledge of the ethical, economic, and legal frame work in which the industry operates. This article presents an approach to deliver these outcomes in a collaborative and active learning modality which promotes deep learning. In the model, groups of final year undergraduate students form hypothetical biotechnology companies and identify real issues of interest to industry, make integrative team decisions, use professional level technology, and develop appropriate communication skills. The final successful teaching paradigm was based on self reflection, observation, and student feedback to ensure appropriate attainment of content, group work skills and increased confidence in professional decision-making. It is these outcomes which will facilitate life long learning skills, a major outcome applicable for all tertiary education. Copyright © 2011 Wiley Periodicals, Inc.

  18. The Presence of Real Food Usurps Hypothetical Health Value Judgment in Overweight People.

    Science.gov (United States)

    Medic, Nenad; Ziauddeen, Hisham; Forwood, Suzanna E; Davies, Kirsty M; Ahern, Amy L; Jebb, Susan A; Marteau, Theresa M; Fletcher, Paul C

    2016-01-01

    To develop more ecologically valid models of the neurobiology of obesity, it is critical to determine how the neural processes involved in food-related decision-making translate into real-world eating behaviors. We examined the relationship between goal-directed valuations of food images in the MRI scanner and food consumption at a subsequent ad libitum buffet meal. We observed that 23 lean and 40 overweight human participants showed similar patterns of value-based neural responses to health and taste attributes of foods. In both groups, these value-based responses in the ventromedial PFC were predictive of subsequent consumption at the buffet. However, overweight participants consumed a greater proportion of unhealthy foods. This was not predicted by in-scanner choices or neural response. Moreover, in overweight participants alone, impulsivity scores predicted greater consumption of unhealthy foods. Overall, our findings suggest that, while the hypothetical valuation of the health of foods is predictive of eating behavior in both lean and overweight people, it is only the real-world food choices that clearly distinguish them.

  19. Sequence Analysis of Hypothetical Proteins from 26695 to Identify Potential Virulence Factors

    Directory of Open Access Journals (Sweden)

    Ahmad Abu Turab Naqvi

    2016-09-01

    Full Text Available Helicobacter pylori is a Gram-negative bacteria that is responsible for gastritis in human. Its spiral flagellated body helps in locomotion and colonization in the host environment. It is capable of living in the highly acidic environment of the stomach with the help of acid adaptive genes. The genome of H. pylori 26695 strain contains 1,555 coding genes that encode 1,445 proteins. Out of these, 340 proteins are characterized as hypothetical proteins (HP. This study involves extensive analysis of the HPs using an established pipeline which comprises various bioinformatics tools and databases to find out probable functions of the HPs and identification of virulence factors. After extensive analysis of all the 340 HPs, we found that 104 HPs are showing characteristic similarities with the proteins with known functions. Thus, on the basis of such similarities, we assigned probable functions to 104 HPs with high confidence and precision. All the predicted HPs contain representative members of diverse functional classes of proteins such as enzymes, transporters, binding proteins, regulatory proteins, proteins involved in cellular processes and other proteins with miscellaneous functions. Therefore, we classified 104 HPs into aforementioned functional groups. During the virulence factors analysis of the HPs, we found 11 HPs are showing significant virulence. The identification of virulence proteins with the help their predicted functions may pave the way for drug target estimation and development of effective drug to counter the activity of that protein.

  20. Spacecraft Mission Design for the Mitigation of the 2017 PDC Hypothetical Asteroid Threat

    Science.gov (United States)

    Barbee, Brent W.; Sarli, Bruno V.; Lyzhoft, Josh; Chodas, Paul W.; Englander, Jacob A.

    2017-01-01

    This paper presents a detailed mission design analysis results for the 2017 Planetary Defense Conference (PDC) Hypothetical Asteroid Impact Scenario, documented at https:cneos.jpl.nasa.govpdcspdc17. The mission design includes campaigns for both reconnaissance (flyby or rendezvous) of the asteroid (to characterize it and the nature of the threat it poses to Earth) and mitigation of the asteroid, via kinetic impactor deflection, nuclear explosive device (NED) deflection, or NED disruption. Relevant scenario parameters are varied to assess the sensitivity of the design outcome, such as asteroid bulk density, asteroid diameter, momentum enhancement factor, spacecraft launch vehicle, and mitigation system type. Different trajectory types are evaluated in the mission design process from purely ballistic to those involving optimal midcourse maneuvers, planetary gravity assists, and/or low-thrust solar electric propulsion. The trajectory optimization is targeted around peak deflection points that were found through a novel linear numerical technique method. The optimization process includes constrain parameters, such as Earth departure date, launch declination, spacecraft, asteroid relative velocity and solar phase angle, spacecraft dry mass, minimum/maximum spacecraft distances from Sun and Earth, and Earth-spacecraft communications line of sight. Results show that one of the best options for the 2017 PDC deflection is solar electric propelled rendezvous mission with a single spacecraft using NED for the deflection.

  1. Identification of functional candidates amongst hypothetical proteins of Treponema pallidum ssp. pallidum.

    Science.gov (United States)

    Naqvi, Ahmad Abu Turab; Shahbaaz, Mohd; Ahmad, Faizan; Hassan, Md Imtaiyaz

    2015-01-01

    Syphilis is a globally occurring venereal disease, and its infection is propagated through sexual contact. The causative agent of syphilis, Treponema pallidum ssp. pallidum, a Gram-negative sphirochaete, is an obligate human parasite. Genome of T. pallidum ssp. pallidum SS14 strain (RefSeq NC_010741.1) encodes 1,027 proteins, of which 444 proteins are known as hypothetical proteins (HPs), i.e., proteins of unknown functions. Here, we performed functional annotation of HPs of T. pallidum ssp. pallidum using various database, domain architecture predictors, protein function annotators and clustering tools. We have analyzed the sequences of 444 HPs of T. pallidum ssp. pallidum and subsequently predicted the function of 207 HPs with a high level of confidence. However, functions of 237 HPs are predicted with less accuracy. We found various enzymes, transporters, binding proteins in the annotated group of HPs that may be possible molecular targets, facilitating for the survival of pathogen. Our comprehensive analysis helps to understand the mechanism of pathogenesis to provide many novel potential therapeutic interventions.

  2. Estimation of environmental flow incorporating water quality and hypothetical climate change scenarios.

    Science.gov (United States)

    Walling, Bendangtola; Chaudhary, Shushobhit; Dhanya, C T; Kumar, Arun

    2017-05-01

    Environmental flows (Eflow, hereafter) are the flows to be maintained in the river for its healthy functioning and the sustenance and protection of aquatic ecosystems. Estimation of Eflow in any river stretch demands consideration of various factors such as flow regime, ecosystem, and health of river. However, most of the Eflow estimation studies have neglected the water quality factor. This study urges the need to consider water quality criterion in the estimation of Eflow and proposes a framework for estimating Eflow incorporating water quality variations under present and hypothetical future scenarios of climate change and pollution load. The proposed framework is applied on the polluted stretch of Yamuna River passing through Delhi, India. Required Eflow at various locations along the stretch are determined by considering possible variations in future water quantity and quality. Eflow values satisfying minimum quality requirements for different river water usage classes (classes A, B, C, and D as specified by the Central Pollution Control Board, India) are found to be between 700 and 800 m 3 /s. The estimated Eflow values may aid policymakers to derive upstream storage-release policies or effluent restrictions. Generalized nature of this framework will help its implementation on any river systems.

  3. Property of Kozai Dynamics of Inner Oort Cloud Objects with a Hypothetical Planet Beyond Neptune

    Science.gov (United States)

    Sie, Zong-Fu; Lin, Hsing-Wen; Ip, Wing-Huen

    2015-11-01

    The origin of a number of Trans-Neptunian objects (TNOs) with large perihelion and semi-major axis are difficult to explain by current models. In addition to Sedna, these include 2010 GB174 (Chen et al., 2013) and 2012 VP113 (Trujillo and Sheppard, 2014) which might represent members of the Inner Oort Cloud objects (IOCOs). One thing of particular interest has to do with the clustering of the argument of perihelion (ω) of the discovered IOCSs near 340o. Trujillo and Sheppard (2014) suggested that this effect could be caused by the Kozai mechanism induced by a distant planet. We have performed parametric studies of the orbital motion of hypothetical IOCOs under the influence of this distant planet. Our preliminary results indicate that this distant planet with a perihelion distance of about 150 AU, if exists, should have a mass larger than 2 Earth masses. The observed clustering in the argument of perihelion at around 340o can not be reproduced by our simulations. Instead, the distribution of ω of the test particles in the inner Oort cloud is characterized by concentration around 0 o or 180o and, on the other hand, 90o or 270o (for smaller perihelion and lower inclination).

  4. Astrophysical implications of hypothetical stable TeV-scale black holes

    CERN Document Server

    Giddings, Steven B

    2008-01-01

    We analyze macroscopic effects of TeV-scale black holes, such as could possibly be produced at the LHC, in what is regarded as an extremely hypothetical scenario in which they are stable and, if trapped inside Earth, begin to accrete matter. We examine a wide variety of TeV-scale gravity scenarios, basing the resulting accretion models on first-principles, basic, and well-tested physical laws. These scenarios fall into two classes, depending on whether accretion could have any macroscopic effect on the Earth at times shorter than the Sun's natural lifetime. We argue that cases with such effect at shorter times than the solar lifetime are ruled out, since in these scenarios black holes produced by cosmic rays impinging on much denser white dwarfs and neutron stars would then catalyze their decay on timescales incompatible with their known lifetimes. We also comment on relevant lifetimes for astronomical objects that capture primordial black holes. In short, this study finds no basis for concerns that TeV-scale...

  5. The Presence of Real Food Usurps Hypothetical Health Value Judgment in Overweight People123

    Science.gov (United States)

    Ziauddeen, Hisham; Davies, Kirsty M.; Jebb, Susan A.; Marteau, Theresa M.

    2016-01-01

    Abstract To develop more ecologically valid models of the neurobiology of obesity, it is critical to determine how the neural processes involved in food-related decision-making translate into real-world eating behaviors. We examined the relationship between goal-directed valuations of food images in the MRI scanner and food consumption at a subsequent ad libitum buffet meal. We observed that 23 lean and 40 overweight human participants showed similar patterns of value-based neural responses to health and taste attributes of foods. In both groups, these value-based responses in the ventromedial PFC were predictive of subsequent consumption at the buffet. However, overweight participants consumed a greater proportion of unhealthy foods. This was not predicted by in-scanner choices or neural response. Moreover, in overweight participants alone, impulsivity scores predicted greater consumption of unhealthy foods. Overall, our findings suggest that, while the hypothetical valuation of the health of foods is predictive of eating behavior in both lean and overweight people, it is only the real-world food choices that clearly distinguish them. PMID:27280152

  6. An Application of Graphical Approach to Construct Multiple Testing Procedure in a Hypothetical Phase III Design

    Directory of Open Access Journals (Sweden)

    Naitee eTing

    2014-01-01

    Full Text Available Many multiple testing procedures (MTP have been developed in recent years. Among these new procedures, the graphical approach is flexible and easy to communicate with non-statisticians. A hypothetical Phase III clinical trial design is introduced in this manuscript to demonstrate how graphical approach can be applied in clinical product development. In this design, an active comparator is used. It is thought that this test drug under development could potentially be superior to this comparator. For comparison of efficacy, the primary endpoint is well established and widely accepted by regulatory agencies. However, an important secondary endpoint based on Phase II findings looks very promising. The target dose may have a good opportunity to deliver superiority to the comparator. Furthermore, a lower dose is included in case the target dose may demonstrate potential safety concerns. This Phase III study is designed as a non-inferiority trial with two doses, and two endpoints. This manuscript will illustrate how graphical approach is applied to this design in handling multiple testing issues.

  7. Public acceptance of a hypothetical Ebola virus vaccine in Aceh, Indonesia: A hospital-based survey

    Directory of Open Access Journals (Sweden)

    Harapan Harapan

    2017-04-01

    Full Text Available Objective: To determine the acceptance towards a hypothetical Ebola virus vaccine (EVV and associated factors in a non-affected country, Indonesia. Methods: A hospital-based, cross-sectional study was conducted in four regencies of Aceh, Indonesia. A set of pre-tested questionnaires was used to obtain information on acceptance towards EVV and a range of explanatory variables. Associations between EVV acceptance and explanatory variables were tested using multi-steps logistic regression analysis and the Spearman's rank correlation. Results: Participants who had knowledge on Ebola virus disease (EVD were 45.3% (192/424 and none of the participants achieved 80% correct answers on the knowledge regarding to EVD. About 73% of participants expressed their willingness to receive the EVV. Education attainment, occupation, monthly income, have heard regarding to EVD previously, socioeconomic level, attitude towards vaccination practice and knowledge regarding to EVD were associated significantly with acceptance towards EVV in univariate analysis (P < 0.05. In the final multivariate model, socio-economic level, attitude towards vaccination practice and knowledge regarding to EVD were the independent explanatory variables for EVV acceptance. Conclusions: The knowledge of EVD was low, but this minimally affected the acceptance towards EVV. However, to facilitate optimal uptake of EVV, dissemination of vaccine-related information prior to its introduction is required.

  8. Economic impacts of a hypothetical H1N1 pandemic : a cross-sectional analysis.

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Braeton J.; Shaneyfelt, Calvin R.

    2010-06-01

    A NISAC study on the economic effects of a hypothetical H1N1 pandemic was done in order to assess the differential impacts at the state and industry levels given changes in absenteeism, mortality, and consumer spending rates. Part of the analysis was to determine if there were any direct relationships between pandemic impacts and gross domestic product (GDP) losses. Multiple regression analysis was used because it shows very clearly which predictors are significant in their impact on GDP. GDP impact data taken from the REMI PI+ (Regional Economic Models, Inc., Policy Insight +) model was used to serve as the response variable. NISAC economists selected the average absenteeism rate, mortality rate, and consumer spending categories as the predictor variables. Two outliers were found in the data: Nevada and Washington, DC. The analysis was done twice, with the outliers removed for the second analysis. The second set of regressions yielded a cleaner model, but for the purposes of this study, the analysts deemed it not as useful because particular interest was placed on determining the differential impacts to states. Hospitals and accommodation were found to be the most important predictors of percentage change in GDP among the consumer spending variables.

  9. "Hypothetical machines": the science fiction dreams of Cold War social science.

    Science.gov (United States)

    Lemov, Rebecca

    2010-06-01

    The introspectometer was a "hypothetical machine" Robert K. Merton introduced in the course of a 1956 how-to manual describing an actual research technique, the focused interview. This technique, in turn, formed the basis of wartime morale research and consumer behavior studies as well as perhaps the most ubiquitous social science tool, the focus group. This essay explores a new perspective on Cold War social science made possible by comparing two kinds of apparatuses: one real, the other imaginary. Even as Merton explored the nightmare potential of such machines, he suggested that the clear aim of social science was to build them or their functional equivalent: recording machines to access a person's experiential stream of reality, with the ability to turn this stream into real-time data. In this way, the introspectometer marks and symbolizes a broader entry during the Cold War of science-fiction-style aspirations into methodological prescriptions and procedural manuals. This essay considers the growth of the genre of methodological visions and revisions, painstakingly argued and absorbed, but punctuated by sci-fi aims to transform "the human" and build newly penetrating machines. It also considers the place of the nearly real-, and the artificial "near-substitute" as part of an experimental urge that animated these sciences.

  10. The labelling and reporting of euthanasia by Belgian physicians: a study of hypothetical cases.

    Science.gov (United States)

    Smets, Tinne; Cohen, Joachim; Bilsen, Johan; Van Wesemael, Yanna; Rurup, Mette L; Deliens, Luc

    2012-02-01

    Belgium legalized euthanasia in 2002. Physicians must report each euthanasia case to the Federal Control and Evaluation Committee. This study examines which end-of-life decisions (ELDs) Belgian physicians label 'euthanasia', which ELDs they think should be reported and the physician characteristics associated with correct labelling of euthanasia cases, the awareness that they should be reported and the reporting of them. Five hypothetical cases of ELDs: intensified pain alleviation, palliative/terminal sedation, euthanasia with neuromuscular relaxants, euthanasia with morphine and life-ending without patient request were presented in a cross-sectional survey of 914 physicians in Belgium in 2009. About 19% of physicians did not label a euthanasia case with neuromuscular relaxants 'euthanasia', 27% did not know that it should be reported. Most physicians labelled a euthanasia case with morphine 'intensification of pain and symptom treatment' (39%) or 'palliative/terminal sedation' (37%); 21% of physicians labelled this case 'euthanasia'. Cases describing other ELDs were sometimes also labelled 'euthanasia'. Factors associated with a higher likelihood of labelling a euthanasia case correctly were: living in Flanders, being informed about the euthanasia law and having a positive attitude towards societal control over euthanasia. Whether a physician correctly labelled the euthanasia cases strongly determined their reporting knowledge and intentions. There is no consensus among physicians about the labelling of euthanasia and other ELDs, and about which cases must be reported. Mislabelling of ELDs could impede societal control over euthanasia. The provision of better information to physicians appears to be necessary.

  11. Planning guidance for emergency response to a hypothetical nuclear attack on Riyadh, Saudi Arabia

    Science.gov (United States)

    Shubayr, Nasser Ali M.

    The threat of nuclear attack will remain imminent in an ever-advancing society. Saudi Arabia is not immune to this threat. This dissertation establishes planning guidance for response to a nuclear attack on Riyadh, the capital of Saudi Arabia, based on a hypothetical scenario of a nuclear detonation. A case scenario of a one-megaton thermonuclear bomb detonated at ground level over Riyadh is used to support the thesis. Previous nuclear tests and the Hiroshima and Nagasaki bombings have been used to present possible effects on Riyadh. US planning guidance and lessons learned from the Chernobyl and Fukushima nuclear plants accidents have been used to develop the emergency response guidance. The planning guidance outlines a rapid response to the nuclear detonation. Four damage zones have been identified; severe damage zone, moderate damage zone, light damage zone and dangerous fallout zone. Actions that are recommended, and those that should be avoided, have been determined for each zone. Shelter/ evacuation evaluation for blast-affected and fallout-affected areas is the basis for the recommendation that shelter in place is the best decision for the first hours to days after the attack. Guidelines for medical care response and population monitoring and decontamination are included to reduce the early and long-term effects of the attack. Recommendations to the Saudi Arabian authorities have been made to facilitate suitable preparedness and response for such an event.

  12. The hypothetical ancestral animal. the Urmetazoa: telomerase activity in sponges (Porifera

    Directory of Open Access Journals (Sweden)

    ISABEL M. MÜLLER

    2003-05-01

    Full Text Available Sponges (Porifera represent the lowest metazoan phylum, characterized by a pronounced plasticity in the determination of cell lineages, and they are the closest related taxon to the hypothetical ancestral animal, the Urmetazoa, from which the metazoan lineages diverged. In a first approach to elucidate the molecular mechanisms controlling the switch from the cell lineage with a putative indefinite growth capacity to senescent, somatic cells, the activity of the telomerase as an indicator for immortality has been determined. The studies were performed with the marine demosponges Suberites domuncula and Geodia cydonium, in vivo with tissue but also in vitro using the primmorph system. Primmorphs are formed from dissociated cells which have retained their proliferation potency. It was found that the activity of telomerase in tissue of both sponges is high. Based on this and additional findings it is assumed that the separation of the senescent sponge cell lineage from the immortal germ-/somatic cell lineage is triggered by the loss of contact to cell adhesion factors. First evidence is included which suggests that the final progress of the senescent, telomerase-negative cells to cell death is caused by apoptosis.

  13. Testing the feasibility of a hypothetical whaling-conservation permit market in Norway.

    Science.gov (United States)

    Huang, Biao; Abbott, Joshua K; Fenichel, Eli P; Muneepeerakul, Rachata; Perrings, Charles; Gerber, Leah R

    2017-08-01

    A cap-and-trade system for managing whale harvests represents a potentially useful approach to resolve the current gridlock in international whale management. The establishment of whale permit markets, open to both whalers and conservationists, could reveal the strength of conservation demand, about which little is known. This lack of knowledge makes it difficult to predict the outcome of a hypothetical whale permit market. We developed a bioeconomic model to evaluate the influence of economic uncertainty about demand for whale conservation or harvest. We used simulations over a wide range of parameterizations of whaling and conservation demands to examine the potential ecological consequences of the establishment of a whale permit market in Norwegian waters under bounded (but substantial) economic uncertainty. Uncertainty variables were slope of whaling and conservation demand, participation level of conservationists and their willingness to pay for whale conservation, and functional forms of demand, including linear, quadratic, and log-linear forms. A whale-conservation market had the potential to yield a wide range of conservation and harvest outcomes, the most likely outcomes were those in which conservationists bought all whale permits. © 2017 Society for Conservation Biology.

  14. How Long-Lived Are the Hypothetical Trojan Populations of Saturn, Uranus, and Neptune?

    Science.gov (United States)

    Nesvorný, D.; Dones, L.

    2002-12-01

    We investigate the possibility that fractions of the primordial populations at the triangular Lagrangian points of Saturn, Uranus, and Neptune have survived to the present and form (as yet unobserved) clusters of bodies coorbiting with these planets. Such leftovers would be analogs of the numerous objects (Trojans) leading and trailing the revolutions of Jupiter around the Sun. We focus on the dynamical stability of such populations over the age of the Solar System, assuming the current configuration of planets, and also discuss effects of the early radial migration of the outer planets. Our results suggest that, while Saturn's and Uranus' primordial Trojan populations should have been depleted by a factor of 100, Neptune may retain 50% of its original population of Trojans. A population of neptunian Trojans comparable to, or even larger than, Jupiter's Trojan population cannot be ruled out by existing observations. We compute the present-day sky densities of the hypothetical Trojans of the outer planets which can be used to guide observational surveys. Finally, we propose that the long-term instabilities that cause some jovian Trojans to escape the region of the Lagrange points at the present are due to three-body resonances.

  15. Bioinformatics and structural characterization of a hypothetical protein from Streptococcus mutans: implication of antibiotic resistance.

    Directory of Open Access Journals (Sweden)

    Jie Nan

    Full Text Available As an oral bacterial pathogen, Streptococcus mutans has been known as the aetiologic agent of human dental caries. Among a total of 1960 identified proteins within the genome of this organism, there are about 500 without any known functions. One of these proteins, SMU.440, has very few homologs in the current protein databases and it does not fall into any protein functional families. Phylogenetic studies showed that SMU.440 is related to a particular ecological niche and conserved specifically in some oral pathogens, due to lateral gene transfer. The co-occurrence of a MarR protein within the same operon among these oral pathogens suggests that SMU.440 may be associated with antibiotic resistance. The structure determination of SMU.440 revealed that it shares the same fold and a similar pocket as polyketide cyclases, which indicated that it is very likely to bind some polyketide-like molecules. From the interlinking structural and bioinformatics studies, we have concluded that SMU.440 could be involved in polyketide-like antibiotic resistance, providing a better understanding of this hypothetical protein. Besides, the combination of multiple methods in this study can be used as a general approach for functional studies of a protein with unknown function.

  16. Features of Hypothetical Plasma Phase Transition in Interiors of Saturn and Jupiter

    CERN Document Server

    Ukrainets, Artem

    2013-01-01

    Anomalous features for hypothetical Plasma Phase Transitions (PPT), which is expected to occur in mixed hydrogen-helium plasma in interior of Jupiter and Saturn, are under discussion. The characteristics of the Coulomb and density corrections (the so-called non-ideality corrections) are reconstructed for hydrogen-helium plasma in the vicinity of phase coexistence boundary of this PPT in version of Saumon and Chabrier, using tabular data for hydrogen-helium EOS of Saumon, Chabrier and VanHorn and some general thermodynamic relations. Two previously unknown characteristics of the studied PPT have been estimated based on these results: (i) -- the jump of the electrostatic potential across the phase boundary of PPT (Galvani potential), and (ii) -- the scale of non-congruency for this PPT (the differences in chemical composition of the coexisting hydrogen-helium phases), which could be expected in H2/He mixture at typical parameters of plasma in interior of Jupiter and Saturn. While the first effect -- the potenti...

  17. Draper Station Analysis Tool

    Science.gov (United States)

    Bedrossian, Nazareth; Jang, Jiann-Woei; McCants, Edward; Omohundro, Zachary; Ring, Tom; Templeton, Jeremy; Zoss, Jeremy; Wallace, Jonathan; Ziegler, Philip

    2011-01-01

    Draper Station Analysis Tool (DSAT) is a computer program, built on commercially available software, for simulating and analyzing complex dynamic systems. Heretofore used in designing and verifying guidance, navigation, and control systems of the International Space Station, DSAT has a modular architecture that lends itself to modification for application to spacecraft or terrestrial systems. DSAT consists of user-interface, data-structures, simulation-generation, analysis, plotting, documentation, and help components. DSAT automates the construction of simulations and the process of analysis. DSAT provides a graphical user interface (GUI), plus a Web-enabled interface, similar to the GUI, that enables a remotely located user to gain access to the full capabilities of DSAT via the Internet and Webbrowser software. Data structures are used to define the GUI, the Web-enabled interface, simulations, and analyses. Three data structures define the type of analysis to be performed: closed-loop simulation, frequency response, and/or stability margins. DSAT can be executed on almost any workstation, desktop, or laptop computer. DSAT provides better than an order of magnitude improvement in cost, schedule, and risk assessment for simulation based design and verification of complex dynamic systems.

  18. Putative function of hypothetical proteins expressed by Clostridium perfringens type A strains and their protective efficacy in mouse model.

    Science.gov (United States)

    Alam, Syed Imteyaz; Dwivedi, Pratistha

    2016-10-01

    The whole genome sequencing and annotation of Clostridium perfringens strains revealed several genes coding for proteins of unknown function with no significant similarities to genes in other organisms. Our previous studies clearly demonstrated that hypothetical proteins CPF_2500, CPF_1441, CPF_0876, CPF_0093, CPF_2002, CPF_2314, CPF_1179, CPF_1132, CPF_2853, CPF_0552, CPF_2032, CPF_0438, CPF_1440, CPF_2918, CPF_0656, and CPF_2364 are genuine proteins of C. perfringens expressed in high abundance. This study explored the putative role of these hypothetical proteins using bioinformatic tools and evaluated their potential as putative candidates for prophylaxis. Apart from a group of eight hypothetical proteins (HPs), a putative function was predicted for the rest of the hypothetical proteins using one or more of the algorithms used. The phylogenetic analysis did not suggest an evidence of a horizontal gene transfer event except for HP CPF_0876. HP CPF_2918 is an abundant extracellular protein, unique to C. perfringens species with maximum strain coverage and did not show any significant match in the database. CPF_2918 was cloned, recombinant protein was purified to near homogeneity, and probing with mouse anti-CPF_2918 serum revealed surface localization of the protein in C. perfringens ATCC13124 cultures. The purified recombinant CPF_2918 protein induced antibody production, a mixed Th1 and Th2 kind of response, and provided partial protection to immunized mice in direct C. perfringens challenge. Copyright © 2016 Elsevier B.V. All rights reserved.

  19. Environmental sustainability comparison of a hypothetical pneumatic waste collection system and a door-to-door system.

    Science.gov (United States)

    Punkkinen, Henna; Merta, Elina; Teerioja, Nea; Moliis, Katja; Kuvaja, Eveliina

    2012-10-01

    Waste collection is one of the life cycle phases that influence the environmental sustainability of waste management. Pneumatic waste collection systems represent a new way of arranging waste collection in densely populated urban areas. However, limited information is available on the environmental impacts of this system. In this study, we compare the environmental sustainability of conventional door-to-door waste collection with its hypothetical pneumatic alternative. Furthermore, we analyse whether the size of the hypothetical pneumatic system, or the number of waste fractions included, have an impact on the results. Environmental loads are calculated for a hypothetical pneumatic waste collection system modelled on an existing dense urban area in Helsinki, Finland, and the results are compared to those of the prevailing, container-based, door-to-door waste collection system. The evaluation method used is the life-cycle inventory (LCI). In this study, we report the atmospheric emissions of greenhouse gases (GHG), SO(2) and NO(x). The results indicate that replacing the prevailing system with stationary pneumatic waste collection in an existing urban infrastructure would increase total air emissions. Locally, in the waste collection area, emissions would nonetheless diminish, as collection traffic decreases. While the electricity consumption of the hypothetical pneumatic system and the origin of electricity have a significant bearing on the results, emissions due to manufacturing the system's components prove decisive. Copyright © 2012 Elsevier Ltd. All rights reserved.

  20. Perceptions of, and Assistance Provided to, a Hypothetical Rape Victim: Differences between Rape Disclosure Recipients and Nonrecipients

    Science.gov (United States)

    Paul, Lisa A.; Kehn, Andre; Gray, Matt J.; Salapska-Gelleri, Joanna

    2014-01-01

    Objective: Undergraduate rape disclosure recipients' and nonrecipients' sociodemographic and life experience variables, attitudes towards rape, and responses to a hypothetical rape disclosure were compared to determine differences between them. Participants: One hundred ninety-two undergraduates at 3 universities participated in this online survey…

  1. Global detection and characterization of hypothetical proteins in Shewanella oneidensis MR-1 using LC-MS based proteomics based proteomics

    Energy Technology Data Exchange (ETDEWEB)

    Elias, Dwayne A.; Monroe, Matthew E.; Marshall, Matthew J.; Romine, Margaret F.; Beliaev, Alex S.; Fredrickson, Jim K.; Anderson, Gordon A.; Smith, Richard D.; Lipton, Mary S.

    2005-08-01

    The availability of whole genome sequences has enabled the application of powerful tools for assaying global expression patterns in environmentally relevant bacteria such as Shewanella oneidensis MR-1. A large number of genes in prokaryote genomes, including MR-1, have been annotated as hypothetical indicating that no similar protein has yet been identified in other organisms. Using high-sensitivity mass spectrometry coupled with accurate mass and time (AMT) tag methodology, 1078 tryptic peptides were collectively detected in MR-1 cultures, 671 of which were unique to their parent protein. Using only these unique tryptic peptides and a minimum of 2 peptides per protein, we identified, with high confidence, the expression of 258 hypothetical proteins. These proteins ranged from 3.5 kDa to 139 kDa, with 47 being 100 amino acid residues or less. Using a combination of information including detection in cells grown under specific culture conditions, presence within a specific cell fraction, and predictive algorithms such as PSORT and PSORT-B, possible/plausible functions are proposed for some hypothetical proteins. Further, by applying this approach a number of proteins were found not only to be expressed, but only expressed under certain culturing conditions, thereby suggesting function while at the same time isolating several proteins to distinct locales of the cell. These results demonstrate the utility of the AMT tag methodology for comprehensive profiling of the microbial proteome while confirming the expression of a large number of hypothetical genes.

  2. Perceptions of Child Sexual Abuse in a Hypothetical Cybersexploitation Case: The Importance of Perpetrator Honesty, Outcome Type, and Respondent Gender

    Science.gov (United States)

    Davies, Michelle; Rogers, Paul; Hood, Paul A.

    2009-01-01

    This study investigated perceptions of child sexual abuse in a hypothetical cybersexploitation case. Men were predicted to be more negative toward the victim than were women. Victims were predicted to be more negatively judged when they consented to sex than when they did not and when they were lied to than when they were not. Two hundred and…

  3. Quantitative valuation placed by children and teenagers on participation in two hypothetical research scenarios.

    Science.gov (United States)

    Funnell, Dan; Fertleman, Caroline; Carrey, Liz; Brierley, Joe

    2012-11-01

    For paediatric medicine to advance, research must be conducted specifically with children. Concern about poor recruitment has led to debate about payments to child research participants. Although concerns about undue influence by such 'compensation' have been expressed, it is useful to determine whether children can relate the time and inconvenience associated with participation to the value of payment offered. This study explores children's ability to determine fair remuneration for research participation, and reviews payments to children participating in research. Forty children were interviewed before outpatient visits at two London Hospitals: Great Ormond Street Children's Hospital and the Whittington Hospital District General Hospital. Children were asked to value their involvement in two hypothetical research scenarios - the first an 'additional blood sample', the second also involving daily oral oil capsules taken for a fortnight before further venesection. Background knowledge about familiarity with money, and experience with hospitalisation was assessed. The mean valuation of involvement in the second scenario (£13.18) was higher than in the first (£2.84) (pvaluation persisted when children were categorised into groups 'aged 12+' and 'below 12'. Those undergoing a blood test on the day placed a higher valuation on participation in the second scenario (£10.43, £21.67, p=0.044). These children aged 8-16 demonstrated the capacity to discern a fair valuation for participation in medical research. The monetary sums are influenced by the time and inconvenience involved in the research, and by the extent of recent experience with hospital procedures. The authors review current ethical thinking regarding payments to child research participants and suggest that a fair wage model might be an ethically acceptable way to increase participation of children in research.

  4. Soil carbon sequestration, carbon markets, and conservation agriculture practices: A hypothetical examination in Mozambique

    Directory of Open Access Journals (Sweden)

    Timoteo E. Simone

    2017-09-01

    Full Text Available Payments for Environmental Services (PES are relatively novel mechanisms whereby the adoption of sustainable management practices by a stakeholder is rewarded by incentives linked to external markets. Adoption of PES for conservation agricultural practices (CAPS by smallholder farmers may provide opportunities to increase household income or cover the technology costs of adoption if the carbon sequestration benefits of CAPS are quantifiable, adoption rates are accelerated and maintained, a mechanism exists whereby carbon sequestration services can be compensated, and carbon offset exchange markets are viable. This research suggests a methodology to examine a PES market for carbon offsets generated by the adoption of CAPS by farmers in Mozambique. Assuming a cumulative adoption of 60% over a 20-year period, revenue from PES market participation to CA adopters was two times higher than revenue earned when disadoption occurred midway through the simulation. Lower adoption targets are associated with higher per household returns when fertilizer rates typical to the region are increased. Establishing and maintaining a sustainable PES system in the study region would require significant investment in time and resources. The lack of on-the-ground institutions or local support for such a program would also challenge successful implementation. Finally, the programs where participant success depends on external markets, such as the hypothetical one suggested here, are subject to the ebb and flow of foreign demand for carbon offsets. Addressing these three broad constraints to a PES/CAPS program in the region would require grass-roots driven policy initiatives with buy-in at multiple social, economic, and political levels.

  5. Neonatal nurses' response to a hypothetical premature birth situation: What if it was my baby?

    Science.gov (United States)

    Green, Janet; Darbyshire, Philip; Adams, Anne; Jackson, Debra

    2016-12-09

    Evolving technology and scientific advancement have increased the chances of survival of the extremely premature baby; however, such survival can be associated with some severe long-term morbidities. The research investigates the caregiving and ethical dilemmas faced by neonatal nurses when caring for extremely premature babies (defined as ≤24 weeks' gestation). This article explores the issues arising for neonatal nurses when they considered the philosophical question of 'what if it was me and my baby', or what they believed they would do in the hypothetical situation of going into premature labour and delivering an extremely premature baby. Data were collected via a questionnaire to Australian neonatal nurses and semi-structured interviews with 24 neonatal nurses in New South Wales, Australia. Relevant ethical approvals have been obtained by the researchers. A qualitative approach was used to analyse the data. The theme 'imagined futures' was generated which comprised three sub-themes: 'choice is important', 'not subjecting their own baby to treatment' and 'nurses and outcome predictions'. The results offer an important and unique understanding into the perceptions of nursing staff who care for extremely premature babies and their family, see them go home and witness their evolving outcomes. The results show that previous clinical and personal experiences led the nurses in the study to choose to have the belief that if in a similar situation, they would choose not to have their own baby resuscitated and subjected to the very treatment that they provide to other babies. The theme 'imagined futures' offers an overall understanding of how neonatal nurses imagine what the life of the extremely premature baby and his or her family will be like after discharge from neonatal intensive care. The nurses' past experience has led them to believe that they would not want this life for themselves and their baby, if they were to deliver at 24 weeks' gestation or less. © The

  6. A hypothetical model for predicting the toxicity of high aspect ratio nanoparticles (HARN)

    Science.gov (United States)

    Tran, C. L.; Tantra, R.; Donaldson, K.; Stone, V.; Hankin, S. M.; Ross, B.; Aitken, R. J.; Jones, A. D.

    2011-12-01

    The ability to predict nanoparticle (dimensional structures which are less than 100 nm in size) toxicity through the use of a suitable model is an important goal if nanoparticles are to be regulated in terms of exposures and toxicological effects. Recently, a model to predict toxicity of nanoparticles with high aspect ratio has been put forward by a consortium of scientists. The High aspect ratio nanoparticles (HARN) model is a platform that relates the physical dimensions of HARN (specifically length and diameter ratio) and biopersistence to their toxicity in biological environments. Potentially, this model is of great public health and economic importance, as it can be used as a tool to not only predict toxicological activity but can be used to classify the toxicity of various fibrous nanoparticles, without the need to carry out time-consuming and expensive toxicology studies. However, this model of toxicity is currently hypothetical in nature and is based solely on drawing similarities in its dimensional geometry with that of asbestos and synthetic vitreous fibres. The aim of this review is two-fold: (a) to present findings from past literature, on the physicochemical property and pathogenicity bioassay testing of HARN (b) to identify some of the challenges and future research steps crucial before the HARN model can be accepted as a predictive model. By presenting what has been done, we are able to identify scientific challenges and research directions that are needed for the HARN model to gain public acceptance. Our recommendations for future research includes the need to: (a) accurately link physicochemical data with corresponding pathogenicity assay data, through the use of suitable reference standards and standardised protocols, (b) develop better tools/techniques for physicochemical characterisation, (c) to develop better ways of monitoring HARN in the workplace, (d) to reliably measure dose exposure levels, in order to support future epidemiological

  7. Plutonium Worlds. Fast Breeders, Systems Analysis and Computer Simulation in the Age of Hypotheticality

    Directory of Open Access Journals (Sweden)

    Sebastian Vehlken

    2014-09-01

    Full Text Available This article examines the media history of one of the hallmark civil nuclear energy programs in Western Germany – the development of Liquid Metal Fast Breeder Reactor (LMFBR technology. Promoted as a kind of perpetuum mobile of the Atomic Age, the "German Manhattan Project" not only imported big science thinking. In its context, nuclear technology was also put forth as an avantgarde of scientific inquiry, dealing with the most complex and critical technological endeavors. In the face of the risks of nuclear technology, German physicist Wolf Häfele thus announced a novel epistemology of "hypotheticality". In a context where traditional experimental engineering strategies became inappropiate, he called for the application of advanced media technologies: Computer Simulations (CS and Systems Analysis (SA generated computerized spaces for the production of knowledge. In the course of the German Fast Breeder program, such methods had a twofold impact. One the one hand, Häfele emphazised – as the "father of the German Fast Breeder" – the utilization of CS for the actual planning and construction of the novel reactor type. On the other, namely as the director of the department of Energy Systems at the International Institute for Applied Systems Analysis (IIASA, Häfele advised SA-based projections of energy consumption. These computerized scenarios provided the rationale for the conception of Fast Breeder programs as viable and necessary alternative energy sources in the first place. By focusing on the role of the involved CS techniques, the paper thus investigates the intertwined systems thinking of nuclear facilities’s planning and construction and the design of large-scale energy consumption and production scenarios in the 1970s and 1980s, as well as their conceptual afterlives in our contemporary era of computer simulation.

  8. Pollutant Plume Dispersion over Hypothetical Urban Areas based on Wind Tunnel Measurements

    Science.gov (United States)

    Mo, Ziwei; Liu, Chun-Ho

    2017-04-01

    Gaussian plume model is commonly adopted for pollutant concentration prediction in the atmospheric boundary layer (ABL). However, it has a number of limitations being applied to pollutant dispersion over complex land-surface morphology. In this study, the friction factor (f), as a measure of aerodynamic resistance induced by rough surfaces in the engineering community, was proposed to parameterize the vertical dispersion coefficient (σz) in the Gaussian model. A series of wind tunnel experiments were carried out to verify the mathematical hypothesis and to characterize plume dispersion as a function of surface roughness as well. Hypothetical urban areas, which were assembled in the form of idealized street canyons of different aspect (building-height-to-street-width) ratios (AR = 1/2, 1/4, 1/8 and 1/12), were fabricated by aligning identical square aluminum bars at different separation apart in cross flows. Pollutant emitted from a ground-level line source into the turbulent boundary layer (TBL) was simulated using water vapour generated by ultrasonic atomizer. The humidity and the velocity (mean and fluctuating components) were measured, respectively, by humidity sensors and hot-wire anemometry (HWA) with X-wire probes in streamwise and vertical directions. Wind tunnel results showed that the pollutant concentration exhibits the conventional Gaussian distribution, suggesting the feasibility of using water vapour as a passive scalar in wind tunnel experiments. The friction factor increased with decreasing aspect ratios (widening the building separation). It was peaked at AR = 1/8 and decreased thereafter. Besides, a positive correlation between σz/xn (x is the distance from the pollutant source) and f1/4 (correlation coefficient r2 = 0.61) was observed, formulating the basic parameterization of plume dispersion over urban areas.

  9. Low frequency (Michoacan Earthquake and Hypothetical Rupture in the Guerrero Gap

    Science.gov (United States)

    Ramirez Guzman, L.; Contreras Ruíz Esparza, M.; Aguirre Gonzalez, J. J.; Alcántara Noasco, L.; Quiroz Ramírez, A.

    2012-12-01

    We present the analysis of simulations at low frequency (Michoacan earthquake is among the largest natural disasters that Mexico has faced in the last decades; more than 5000 people died and thousands of structures were damaged (Reinoso and Ordaz, 1999). Thus, estimates on the effects of similar or larger magnitude earthquakes on today's population and infrastructure are important. Moreover, Singh and Mortera (1991) suggest that earthquakes of magnitude 8.1 to 8.4 could take place in the so-called Guerrero Gap, an area adjacent to the region responsible for the 1985 earthquake. In order to improve previous estimations of the ground motion (e.g. Furumura and Singh, 2002) and lay the groundwork for a numerical simulation of a hypothetical Guerrero Gap scenario, we recast the 1985 Michoacan earthquake. We used the inversion by Mendoza and Hartzell (1989) and a 3D velocity model built on the basis of recent investigations in the area, which include a velocity structure of the Valley of Mexico constrained by geotechnical and reflection experiments, and noise tomography, receiver functions, and gravity-based regional models. Our synthetic seismograms were computed using the octree-based finite element tool-chain Hercules (Tu et al., 2006), and are valid up to a frequency of 1 Hz, considering realistic velocities in the Valley of Mexico ( >60 m/s in the very shallow subsurface). We evaluated the model's ability to reproduce the available records using the goodness-of-fit analysis proposed by Mayhew and Olsen (2010). Once the reliablilty of the model was established, we estimated the effects of a large magnitude earthquake in Central Mexico. We built a kinematic rupture for a Mw=8.4 earthquake with the method of Liu et al. (2006) for the Guerrero Gap and computed the ground motion. We summarized our results by presenting ground motion parameter maps and the potential population and infrastructure exposure to large Modified Mercalli Intensities (>VI).

  10. Innovative Railway Stations

    Science.gov (United States)

    Rzepnicka, Sylwia; Załuski, Daniel

    2017-10-01

    In relation to modern demographic trends, evolving technologies and environment-friendly solutions increases the potential of rail considered as sustainable form of public transport. Contemporary tendencies of designing railway stations in Europe are focused on lowering energy consumption and reducing carbon emission. The main goal of the designers is to create a friendly and intuitive space for its users and at the same time a building that uses renewable energy sources and minimizes negative impact on the environment by the increase of biologically active areas, reuse of rainwater and greywater, innovative heating and cooling solutions and reduction of energy losses. The optimisation of a life circle in railway architecture introduces new approach to passenger service. Examples mentioned in the content of this article help to synthesize changes in approach to the design within the context of sustainability.

  11. Photochemical Assessment Monitoring Stations (PAMS)

    Data.gov (United States)

    U.S. Environmental Protection Agency — Photochemical Assessment Monitoring Stations (PAMS). This file provides information on the numbers and distribution (latitude/longitude) of air monitoring sites...

  12. Station History Of The Seismic Station In Ahmadu Bello University ...

    African Journals Online (AJOL)

    The data were used to create the station history plots which display the travel times, the distance time curve and events location on a world seismicity map with Zaria as the center. KEY WORDS: History, Events, Station, Teleseismic, Travel time. Global Journal of Pure and Applied Sciences Vol.11(2) 2005: 309-315.

  13. Stanwell power station project

    Energy Technology Data Exchange (ETDEWEB)

    Mills, David R; J Dey, Christopher [University of Sidney, Sidney (Australia); Morrison, Graham L [University of New South Wales, Sidney (Australia)

    2000-07-01

    This paper describes the Compact Linear Fresnel Reflector (CLFR) being developed for installation at the Stanwell power station in Queensland Australia. Stanwell Corporation Limited (SCL). Solahart International, Solsearch Pty. Ltd. And the universities of Sidney and New South Wales are cooperating in the project, and this first plant being partly funded by the Australian Greenhouse Office. The solar plant will be attached to a 1440 MW(e) coal fired plant. The 17000 m{sup 2} array will be the largest array in Australia, producing a peak of 13 MW of thermal energy which will offset the use of coal in the generation of electricity. It will use direct steam generation and will feed either steam or hot water at 265 Celsius degrees directly into the power station preheating cycle. The CLFR system, first developed by the University of Sidney and Solsearch Pty. Ltd., is simple and offers small reflector size, low structural cost, fixed receiver geometry. Initial installed plant costs are approximately US$1000 per kWe, but this includes the effect of high up-front design costs and the cost should drop substantially in the second and subsequent plants. [Spanish] Proyecto de la Planta Electrica Stanwell este articulo describe el Reflector Lineal Compacto Fresnel (CLFR, siglas en ingles) que se esta desarrollando para la instalacion de la planta electrica Stanwell en Queensland, Australia. La Corporacion Stanwell Limited (SCL), Solahart International, Solsearch Pty. Ltd., las universidades de Sidney y de New South Wales estan cooperando en este proyecto, y esta primera planta esta parcialmente auspiciada por la Australian Greenhouse Office. La planta solar sera anexa a una planta de carbon de 1440 MW(e). Este arreglo de 17000 m{sup 2} sera el mayor en Australia y producira un maximo de 13 MW en energia termica la cual contrarrestara el uso del carbon en la generacion de electricidad. Utilizara generacion con vapor directo y alimentara ya sea vapor o agua caliente a 265 grados

  14. Radioactive dispersion analysis for hypothetical nuclear power plant (NPP) candidate site in Perak state, Malaysia

    Science.gov (United States)

    Shamsuddin, Shazmeen Daniar; Basri, Nor Afifah; Omar, Nurlyana; Koh, Meng-Hock; Ramli, Ahmad Termizi; Saridan Wan Hassan, Wan Muhamad

    2017-10-01

    Malaysia is planning to build a nuclear power plant (NPP) by 2030 to diversify the national electricity supply and resources. Selection of an NPP site must consider various factors, especially nuclear safety consideration to fulfil the nuclear safety objectives. Environmental Risk Assessment Analysis is a part of safety requirements by the International Atomic Energy Agency (IAEA) prior to the NPP commissioning process. Risk Assessments Analysis (RIA) is compulsory for the NPP site evaluation. One of RIA methods are Radioactive Dispersion Analysis using probabilistic risk analysis software. It is also important to perform studies to estimate the impact to the neighbouring population in the case of a nuclear accident at the power plant. In the present work, aimed to study the impact of a hypothetical nuclear accident by simulating the dispersion pattern of radionuclides originated from a candidate site at Manjung, Perak. The work has been performed using the HotSpot Health Physics codes. Two types of radionuclides have been considered namely 137Cs and 131I. In calculations, the initial concentration of radioactive materials of Fukushima Daiichi accident data are used which are 2.06 x 1016 Bq and 1.68 x 1017 Bq respectively for the two radionuclides. The result shows that the dispersion distance obtained from both software are not the same. It shows that 137Cs and 131I can be dispersed as far as 16 km and 80 km away from the site during radiological accident respectively, reaching major towns in Perak. Using HOTSPOT, the estimated total effective dose equivalent (TEDE) for 137Cs and 131I at major towns in Perak such as Lumut and Sitiawan are 1.2 mSv and 9.9 mSv. As for Taiping, Ipoh, Kampar, and Teluk Intan the estimated TEDE is around 0.2 mSv and 1.6 mSv respectively. In conclusion, the dispersion can reach as far as 80 km from the site. However, estimated annual effective dose is not more than 1 mSv limit, which is considered acceptable in the point of view of

  15. Side effects and accounting aspects of hypothetical large-scale Southern Ocean iron fertilization

    Directory of Open Access Journals (Sweden)

    A. Oschlies

    2010-12-01

    Full Text Available Recent suggestions to slow down the increase in atmospheric carbon dioxide have included ocean fertilization by addition of the micronutrient iron to Southern Ocean surface waters, where a number of natural and artificial iron fertilization experiments have shown that low ambient iron concentrations limit phytoplankton growth. Using a coupled carbon-climate model with the marine biology's response to iron addition calibrated against data from natural iron fertilization experiments, we examine biogeochemical side effects of a hypothetical large-scale Southern Ocean Iron Fertilization (OIF that need to be considered when attempting to account for possible OIF-induced carbon offsets. In agreement with earlier studies our model simulates an OIF-induced increase in local air-sea CO2 fluxes by about 73 GtC over a 100-year period, which amounts to about 48% of the OIF-induced increase in organic carbon export out of the fertilized area. Offsetting CO2 return fluxes outside the region and after stopping the fertilization at 1, 7, 10, 50, and 100 years are quantified for a typical accounting period of 100 years. For continuous Southern Ocean iron fertilization, the CO2 return flux outside the fertilized area cancels about 20% of the fertilization-induced CO2 air-sea flux within the fertilized area on a 100-yr timescale. This "leakage" effect has a radiative impact more than twice as large as the simulated enhancement of marine N2O emissions. Other side effects not yet discussed in terms of accounting schemes include a decrease in Southern Ocean oxygen levels and a simultaneous shrinking of tropical suboxic areas, and accelerated ocean acidification in the entire water column in the Southern Ocean at the expense of reduced globally-averaged surface-water acidification. A prudent approach to account for the OIF-induced carbon sequestration would account for global air-sea CO2 fluxes rather

  16. Consequences in Norway after a hypothetical accident at Sellafield - Predicted impacts on the environment

    Energy Technology Data Exchange (ETDEWEB)

    Thoerring, H.; Ytre-Eide, M.A.; Liland, A.

    2010-12-15

    This report describes the possible environmental consequences for Norway due to a hypothetical accident at the Sellafield complex in the UK. The scenario considered involves an explosion and fire at the B215 facility resulting in a 1 % release of the total HAL (Highly Active liquor) inventory of radioactive waste with a subsequent air transport and deposition in Norway. Air transport modelling is based on real meteorological data from October 2008 with wind direction towards Norway and heavy precipitation. This weather is considered to be quite representative as typical seasonal weather. Based on this weather scenario, the estimated fallout in Norway will be approx 17 P Bq of caesium-137 which is 7 times higher than the fallout from the Chernobyl accident. The modelled radioactive contamination is linked with data on transfer to the food chain and statistics on production and hunting to assess the consequences for foodstuffs. The investigation has been limited to the terrestrial environment, focussing on wild berries, fungi, and animals grazing unimproved pastures (i.e. various types of game, reindeer, sheep and goats). The predicted consequences are severe - especially in connection to sheep and goat production. Up to 80 % of the lambs in Norway could be exceeding the food intervention levels for radiocaesium the first years after the fallout, with 30-40 % likely to be above for many years. There will, consequently, be a need for extensive countermeasures in large areas for years or even decades involving several hundred thousand animals each year. Large consequences are also expected for reindeer husbandry - the first year in particular due to the time of fallout which is just prior to winter slaughter. The consequences will be most sever for reindeer herding in middle and southern parts of Norway, but problems may reach as far north as Finnmark where we find the majority of Norwegian reindeer production. The consequences for game will mostly depend on the

  17. Estimating hypothetical present-day insured losses for past intense hurricanes in the French Antilles

    Science.gov (United States)

    Thornton, James; Desarthe, Jérémy; Naulin, Jean-Philippe; Garnier, Emmanuel; Liu, Ye; Moncoulon, David

    2015-04-01

    On the islands of the French Antilles, the period for which systematic meteorological measurements and historic event loss data are available is short relative to the recurrence intervals of very intense, damaging hurricanes. Additionally, the value of property at risk changes through time. As such, the recent past can only provide limited insight into potential losses from extreme storms in coming years. Here we present some research that seeks to overcome, as far as is possible, the limitations of record length in assessing the possible impacts of near-future hurricanes on insured properties. First, using the archives of the French overseas departments (which included administrative and weather reports, inventories of damage to houses, crops and trees, as well as some meteorological observations after 1950) we reconstructed the spatial patterns of hazard intensity associated with three historical events. They are: i) the 1928 Hurricane (Guadeloupe), ii) Hurricane Betsy (1956, Guadeloupe) and iii) Hurricane David (1979, Martinique). These events were selected because all were damaging, and the information available on each is rich. Then, using a recently developed catastrophe model for hurricanes affecting Guadeloupe, Martinique, Saint-Barthélemy and Saint-Martin, we simulated the hypothetical losses to insured properties that the reconstructed events might cause if they were to reoccur today. The model simulated damage due to wind, rainfall-induced flooding and storm surge flooding. These 'what if' scenarios provided an initial indication of the potential present-day exposure of the insurance industry to intense hurricanes. However, we acknowledge that historical events are unlikely to repeat exactly. We therefore extended the study by producing a stochastic event catalogue containing a large number of synthetic but plausible hurricane events. Instrumental data were used as a basis for event generation, but importantly the statistical methods we applied permit

  18. Climate Risk Informed Decision Analysis: A Hypothetical Application to the Waas Region

    Science.gov (United States)

    Gilroy, Kristin; Mens, Marjolein; Haasnoot, Marjolijn; Jeuken, Ad

    2016-04-01

    More frequent and intense hydrologic events under climate change are expected to enhance water security and flood risk management challenges worldwide. Traditional planning approaches must be adapted to address climate change and develop solutions with an appropriate level of robustness and flexibility. The Climate Risk Informed Decision Analysis (CRIDA) method is a novel planning approach embodying a suite of complementary methods, including decision scaling and adaptation pathways. Decision scaling offers a bottom-up approach to assess risk and tailors the complexity of the analysis to the problem at hand and the available capacity. Through adaptation pathway,s an array of future strategies towards climate robustness are developed, ranging in flexibility and immediacy of investments. Flexible pathways include transfer points to other strategies to ensure that the system can be adapted if future conditions vary from those expected. CRIDA combines these two approaches in a stakeholder driven process which guides decision makers through the planning and decision process, taking into account how the confidence in the available science, the consequences in the system, and the capacity of institutions should influence strategy selection. In this presentation, we will explain the CRIDA method and compare it to existing planning processes, such as the US Army Corps of Engineers Principles and Guidelines as well as Integrated Water Resources Management Planning. Then, we will apply the approach to a hypothetical case study for the Waas Region, a large downstream river basin facing rapid development threatened by increased flood risks. Through the case study, we will demonstrate how a stakeholder driven process can be used to evaluate system robustness to climate change; develop adaptation pathways for multiple objectives and criteria; and illustrate how varying levels of confidence, consequences, and capacity would play a role in the decision making process, specifically

  19. Radioactive dispersion analysis for hypothetical nuclear power plant (NPP candidate site in Perak state, Malaysia

    Directory of Open Access Journals (Sweden)

    Shamsuddin Shazmeen Daniar

    2017-01-01

    Full Text Available Malaysia is planning to build a nuclear power plant (NPP by 2030 to diversify the national electricity supply and resources. Selection of an NPP site must consider various factors, especially nuclear safety consideration to fulfil the nuclear safety objectives. Environmental Risk Assessment Analysis is a part of safety requirements by the International Atomic Energy Agency (IAEA prior to the NPP commissioning process. Risk Assessments Analysis (RIA is compulsory for the NPP site evaluation. One of RIA methods are Radioactive Dispersion Analysis using probabilistic risk analysis software. It is also important to perform studies to estimate the impact to the neighbouring population in the case of a nuclear accident at the power plant. In the present work, aimed to study the impact of a hypothetical nuclear accident by simulating the dispersion pattern of radionuclides originated from a candidate site at Manjung, Perak. The work has been performed using the HotSpot Health Physics codes. Two types of radionuclides have been considered namely 137Cs and 131I. In calculations, the initial concentration of radioactive materials of Fukushima Daiichi accident data are used which are 2.06 x 1016 Bq and 1.68 x 1017 Bq respectively for the two radionuclides. The result shows that the dispersion distance obtained from both software are not the same. It shows that 137Cs and 131I can be dispersed as far as 16 km and 80 km away from the site during radiological accident respectively, reaching major towns in Perak. Using HOTSPOT, the estimated total effective dose equivalent (TEDE for 137Cs and 131I at major towns in Perak such as Lumut and Sitiawan are 1.2 mSv and 9.9 mSv. As for Taiping, Ipoh, Kampar, and Teluk Intan the estimated TEDE is around 0.2 mSv and 1.6 mSv respectively. In conclusion, the dispersion can reach as far as 80 km from the site. However, estimated annual effective dose is not more than 1 mSv limit, which is considered acceptable in the point

  20. Hypothetical high-surface-area carbons with exceptional hydrogen storage capacities: open carbon frameworks.

    Science.gov (United States)

    Kuchta, Bogdan; Firlej, Lucyna; Mohammadhosseini, Ali; Boulet, Pascal; Beckner, Matthew; Romanos, Jimmy; Pfeifer, Peter

    2012-09-12

    A class of high-surface-area carbon hypothetical structures has been investigated that goes beyond the traditional model of parallel graphene sheets hosting layers of physisorbed hydrogen in slit-shaped pores of variable width. The investigation focuses on structures with locally planar units (unbounded or bounded fragments of graphene sheets), and variable ratios of in-plane to edge atoms. Adsorption of molecular hydrogen on these structures was studied by performing grand canonical Monte Carlo simulations with appropriately chosen adsorbent-adsorbate interaction potentials. The interaction models were tested by comparing simulated adsorption isotherms with experimental isotherms on a high-performance activated carbon with well-defined pore structure (approximately bimodal pore-size distribution), and remarkable agreement between computed and experimental isotherms was obtained, both for gravimetric excess adsorption and for gravimetric storage capacity. From this analysis and the simulations performed on the new structures, a rich spectrum of relationships between structural characteristics of carbons and ensuing hydrogen adsorption (structure-function relationships) emerges: (i) Storage capacities higher than in slit-shaped pores can be obtained by fragmentation/truncation of graphene sheets, which creates surface areas exceeding of 2600 m(2)/g, the maximum surface area for infinite graphene sheets, carried mainly by edge sites; we call the resulting structures open carbon frameworks (OCF). (ii) For OCFs with a ratio of in-plane to edge sites ≈1 and surface areas 3800-6500 m(2)/g, we found record maximum excess adsorption of 75-85 g of H(2)/kg of C at 77 K and record storage capacity of 100-260 g of H(2)/kg of C at 77 K and 100 bar. (iii) The adsorption in structures having large specific surface area built from small polycyclic aromatic hydrocarbons cannot be further increased because their energy of adsorption is low. (iv) Additional increase of hydrogen

  1. Chronic Pain as a Hypothetical Construct: A Practical and Philosophical Consideration

    Science.gov (United States)

    Doleys, Daniel M.

    2017-01-01

    Pain has been defined by the International Association for the Study of Pain (IASP) as “an unpleasant sensory and emotional experience associated with actual or potential tissue damage, or described in terms of such damage.” Chronic pain is usually described as pain that has persisted for 3–6 months and/or beyond the expected time of healing. The numerical pain rating (NPR) is the customary metric and often considered as a proxy for the subjective experience of chronic pain. This definition of pain (chronic) has been of significant heuristic value. However, the definition and the models it has spawned tend to encourage the interpretation of pain as a measurable entity and implies that the patient’s experience of pain can be fully comprehended by someone other than the person in pain. Several major models of pain have been scrutinized and found to propagate the notion of pain as a ‘thing’ and fall prey to biomedical reductionism and Cartesian (mind-body) dualism. Furthermore, the NPR does not appear to capture the complexity of chronic pain and correlates poorly with other clinically meaningful outcomes. It, and other aspects of the current notion of chronic pain, appear to be an extension of our reliance on the philosophical principles of reductionism and materialism. These and other shortcomings identified in the IASP definition have resulted in an increased interest in a reexamination and possible updating of our view of pain (chronic) and its definition. The present paper describes an alternative view of pain, in particular chronic pain. It argues that chronic pain should be understood as a separate phenomenon from, rather than an extension of, acute pain and interpreted as a hypothetical construct (HC). HCs are contrasted to intervening variables (IV) and the use of HCs in science is illustrated. The acceptance of the principles of nonlinearity and emergence are seen as important characteristics. The practical implications and barriers of this

  2. Side effects and accounting aspects of hypothetical large-scale Southern Ocean iron fertilization

    Science.gov (United States)

    Oschlies, A.; Koeve, W.; Rickels, W.; Rehdanz, K.

    2010-12-01

    Recent suggestions to slow down the increase in atmospheric carbon dioxide have included ocean fertilization by addition of the micronutrient iron to Southern Ocean surface waters, where a number of natural and artificial iron fertilization experiments have shown that low ambient iron concentrations limit phytoplankton growth. Using a coupled carbon-climate model with the marine biology's response to iron addition calibrated against data from natural iron fertilization experiments, we examine biogeochemical side effects of a hypothetical large-scale Southern Ocean Iron Fertilization (OIF) that need to be considered when attempting to account for possible OIF-induced carbon offsets. In agreement with earlier studies our model simulates an OIF-induced increase in local air-sea CO2 fluxes by about 73 GtC over a 100-year period, which amounts to about 48% of the OIF-induced increase in organic carbon export out of the fertilized area. Offsetting CO2 return fluxes outside the region and after stopping the fertilization at 1, 7, 10, 50, and 100 years are quantified for a typical accounting period of 100 years. For continuous Southern Ocean iron fertilization, the CO2 return flux outside the fertilized area cancels about 20% of the fertilization-induced CO2 air-sea flux within the fertilized area on a 100-yr timescale. This "leakage" effect has a radiative impact more than twice as large as the simulated enhancement of marine N2O emissions. Other side effects not yet discussed in terms of accounting schemes include a decrease in Southern Ocean oxygen levels and a simultaneous shrinking of tropical suboxic areas, and accelerated ocean acidification in the entire water column in the Southern Ocean at the expense of reduced globally-averaged surface-water acidification. A prudent approach to account for the OIF-induced carbon sequestration would account for global air-sea CO2 fluxes rather than for local fluxes into the fertilized area only. However, according to our model

  3. Swedish encapsulation station review

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Sven Olof; Brunzell, P.; Heibel, R.; McCarthy, J.; Pennington, C.; Rusch, C.; Varley, G. [NAC International, Zuerich (Switzerland)

    1998-06-01

    In the Encapsulation Station (ES) Review performed by NAC International, a number of different areas have been studied. The main objectives with the review have been to: Perform an independent review of the cost estimates for the ES presented in SKB`s document `Plan 1996`. This has been made through comparisons between the ES and BNFL`s Waste Encapsulation Plant (WEP) at Sellafield as well as with the CLAB facility. Review the location of the ES (at the CLAB site or at the final repository) and its interaction with other parts of the Swedish system for spent fuel management. Review the logistics and plant capacity of the ES. Identify important safety aspects of the ES as a basis for future licensing activities. Based on NAC International`s experience of casks for transport and storage of spent fuel, review the basic design of the copper/steel canister and the transport cask. This review insides design, manufacturing, handling and licensing aspects. Perform an overall comparison between the ES project and the CLAB project with the objective to identify major project risks and discuss their mitigation 19 refs, 9 figs, 35 tabs

  4. In-silico prediction of dual function of DksA like hypothetical protein in V. cholerae O395 genome.

    Science.gov (United States)

    Dutta, Avirup; Katarkar, Atul; Chaudhuri, Keya

    2017-01-01

    Cholera, an acute infection of the small intestine, is caused by Vibrio cholerae. The present study identified a hypothetical protein in V. cholerae O395, which was predicted to be acquired through horizontal gene transfer the origin of which was found to be from a phage. Its expression was further confirmed by RT-PCR. Homology based 3D model of the hypothetical protein indicated DksA like homologue. Protein binding site of 3D-model revealed a deep cleft which may influence the dimer formation and interaction with ds-DNA molecule. Also, canonical function of direct interaction with RNA polymerase (RNAP) holoenzyme in complex with ppGpp suggests its dual role in the pathogenesis of cholera. Copyright © 2016. Published by Elsevier GmbH.

  5. Space Station technology testbed: 2010 deep space transport

    Science.gov (United States)

    Holt, Alan C.

    1993-12-01

    A space station in a crew-tended or permanently crewed configuration will provide major R&D opportunities for innovative, technology and materials development and advanced space systems testing. A space station should be designed with the basic infrastructure elements required to grow into a major systems technology testbed. This space-based technology testbed can and should be used to support the development of technologies required to expand our utilization of near-Earth space, the Moon and the Earth-to-Jupiter region of the Solar System. Space station support of advanced technology and materials development will result in new techniques for high priority scientific research and the knowledge and R&D base needed for the development of major, new commercial product thrusts. To illustrate the technology testbed potential of a space station and to point the way to a bold, innovative approach to advanced space systems' development, a hypothetical deep space transport development and test plan is described. Key deep space transport R&D activities are described would lead to the readiness certification of an advanced, reusable interplanetary transport capable of supporting eight crewmembers or more. With the support of a focused and highly motivated, multi-agency ground R&D program, a deep space transport of this type could be assembled and tested by 2010. Key R&D activities on a space station would include: (1) experimental research investigating the microgravity assisted, restructuring of micro-engineered, materials (to develop and verify the in-space and in-situ 'tuning' of materials for use in debris and radiation shielding and other protective systems), (2) exposure of microengineered materials to the space environment for passive and operational performance tests (to develop in-situ maintenance and repair techniques and to support the development, enhancement, and implementation of protective systems, data and bio-processing systems, and virtual reality and

  6. Analysis of the gas diffusion process during a hypothetical air ingress accident in a modular high temperature gas cooled reactor

    OpenAIRE

    Zhang, Z.; Gerwin, Helmut; Scherer, Winfried

    1993-01-01

    In order to simulate the diffusion process during a hypothetical air ingress accident in a modular high temperature gas cooled reactor, a one-dimensional coupled diffusion-convection model has been established. In this analysis it is shown first, that experiments performed at the Japan Atomic Energy Research Institute (JAERI) have been recalculated successfully, thus validating the new model. Applying this model to the NACOK facility, now under construction at the Institute for Safety Researc...

  7. Early Site Permit Demonstration Program, plant parameters envelopes: Comparison with ranges of values for four hypothetical sites. Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    1992-09-01

    The purpose of this volume is to report the results of the comparison of the ALWR plan parameters envelope with values of site characteristics developed for our hypothetical sites that generally represent conditions encountered within the United States. This effort is not intended to identify or address the suitability of any existing site, site area, or region in the United States. Also included in this volume is Appendix F, SERCH Summaries Regarding Siting.

  8. Pediatrician’s cough and cold medication prescription for hypothetical cases – A cross-sectional multi-centric study

    OpenAIRE

    Chandelia, Sudha; Dhankar, Mukesh; Salhan, Meetu

    2016-01-01

    Background: Concerns over inappropriate use of cough and cold medication (CCM) in children have been raised. In addition to being ineffective, these are now considered toxic for young children. Despite this fact studies from some regions have shown high use of these medications by physicians. However data on pediatricians and from India are negligible. Aim: To study the burden and patterns of cough and cold medications use by pediatricians for hypothetical cases. Methods: In this cross-sectio...

  9. How Simple Hypothetical-Choice Experiments Can Be Utilized to Learn Humans' Navigational Escape Decisions in Emergencies.

    Directory of Open Access Journals (Sweden)

    Milad Haghani

    Full Text Available How humans resolve non-trivial tradeoffs in their navigational choices between the social interactions (e.g., the presence and movements of others and the physical factors (e.g., spatial distances, route visibility when escaping from threats in crowded confined spaces? The answer to this question has major implications for the planning of evacuations and the safety of mass gatherings as well as the design of built environments. Due to the challenges of collecting behavioral data from naturally-occurring evacuation settings, laboratory-based virtual-evacuation experiments have been practiced in a number of studies. This class of experiments faces the traditional question of contextual bias and generalizability: How reliably can we infer humans' behavior from decisions made in hypothetical settings? Here, we address these questions by making a novel link between two different forms of empirical observations. We conduct hypothetical emergency exit-choice experiments framed as simple pictures, and then mimic those hypothetical scenarios in more realistic fashions through staging mock evacuation trials with actual crowds. Econometric choice models are estimated based on the observations made in both experimental contexts. The models are contrasted with each other from a number of perspectives including their predictions as well as the sign, magnitude, statistical significance, person-to-person variations (reflecting individuals' perception/preference differences and the scale (reflecting context-dependent decision randomness of their inferred parameters. Results reveal a surprising degree of resemblance between the models derived from the two contexts. Most strikingly, they produce fairly similar prediction probabilities whose differences average less than 10%. There is also unexpected consensus between the inferences derived from both experimental sources on many aspects of people's behavior notably in terms of the perception of social interactions

  10. 47 CFR 97.109 - Station control.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station control. 97.109 Section 97.109... SERVICE Station Operation Standards § 97.109 Station control. (a) Each amateur station must have at least one control point. (b) When a station is being locally controlled, the control operator must be at the...

  11. 47 CFR 80.519 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 80.519 Section 80.519... MARITIME SERVICES Private Coast Stations and Marine Utility Stations § 80.519 Station identification. (a.... In lieu of the identification of the station by voice, the official call sign may be transmitted by...

  12. 47 CFR 73.787 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Station identification. 73.787 Section 73.787... International Broadcast Stations § 73.787 Station identification. (a) A licensee of an international broadcast station shall make station identification announcement (call letters and location), at the beginning and...

  13. Technical Analysis of the Hydrogen Energy Station Concept, Phase I and Phase II

    Energy Technology Data Exchange (ETDEWEB)

    TIAX, LLC

    2005-05-04

    patterns would be most viable for an energy station, TIAX developed several criteria for selecting a representative set of technology configurations. TIAX applied these criteria to all possible technology configurations to determine an optimized set for further analysis, as shown in Table ES-1. This analysis also considered potential energy station operational scenarios and their impact upon hydrogen and power production. For example, an energy station with a 50-kWe reformer could generate enough hydrogen to serve up to 12 vehicles/day (at 5 kg/fill) or generate up to 1,200 kWh/day, as shown in Figure ES-1. Buildings that would be well suited for an energy station would utilize both the thermal and electrical output of the station. Optimizing the generation and utilization of thermal energy, hydrogen, and electricity requires a detailed look at the energy transfer within the energy station and the transfer between the station and nearby facilities. TIAX selected the Baseline configuration given in Table ES-1 for an initial analysis of the energy and mass transfer expected from an operating energy station. Phase II The purpose of this technical analysis was to analyze the development of a hydrogen-dispensing infrastructure for transportation applications through the installation of a 50-75 kW stationary fuel cell-based energy station at federal building sites. The various scenarios, costs, designs and impacts of such a station were quantified for a hypothetical cost-shared program that utilizes a natural gas reformer to provide hydrogen fuel for both the stack(s) and a limited number of fuel cell powered vehicles, with the possibility of using cogeneration to support the building heat load.

  14. Do children do what they say? Responses to hypothetical and real-life social problems in children with mild intellectual disabilities and behaviour problems.

    Science.gov (United States)

    van Nieuwenhuijzen, M; Bijman, E R; Lamberix, I C W; Wijnroks, L; de Castro, B Orobio; Vermeer, A; Matthys, W

    2005-06-01

    Most research on children's social problem-solving skills is based on responses to hypothetical vignettes. Just how these responses relate to actual behaviour in real-life social situations is, however, unclear, particularly for children with mild intellectual disabilities (MID). In the present study, the spontaneous and selected responses of 56 children with MID to hypothetical situations from the Social Problem-Solving Test for children with MID (SPT-MID) were compared to their actual behaviour in comparable staged standardized real-life conflict situations. Correlations to externalizing behaviour problems were assessed using the Teacher's Report Form (TRF). The results show children with MID and accompanying externalizing behaviour problems to behave more aggressively in the staged real-life conflicts and provide more spontaneous aggressive responses to the hypothetical vignettes than children with MID and no accompanying externalizing behaviour problems; they did not, however, select more aggressive responses from the hypothetical options provided. A moderate correlation was found between the aggressiveness of the spontaneous responses in the hypothetical situations and actual behaviour in the staged real-life situations. In addition, both the spontaneous aggressive responses under hypothetical circumstances and the actual aggressive behaviour under staged real-life circumstances were related to teacher-rated aggressive behaviour in the classroom. It is concluded that the hypothetical vignettes from the SPT-MID do provide information on both the actual behaviour and knowledge of social problem-solving skills of children with MID.

  15. VT Data - Electric Charging Stations

    Data.gov (United States)

    Vermont Center for Geographic Information — Locations of Electric Charging Stations provided by the NREL national laboratory of the U.S. Department of Energy, Office of Energy Efficiency and Renewable Energy....

  16. Interior Alaska Gravity Station Data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The gravity station data total 9416 records. This data base was received in March 1997. Principal gravity parameters include Free-air Anomalies which have been...

  17. WVU Hydrogen Fuel Dispensing Station

    Energy Technology Data Exchange (ETDEWEB)

    Davis, William [West Virginia University Research Corporation, Morgantown, WV (United States)

    2015-09-01

    The scope of this project was changed during the course of the project. Phase I of the project was to construct a site similar to the site at Central West Virginia Regional Airport in Charleston, WV to show that duplication of the site was a feasible method of conducting hydrogen stations. Phase II of the project was necessitated due to a lack of funding that was planned for the development of the station in Morgantown. The US Department of Energy determined that the station in Charleston would be dismantled and moved to Morgantown and reassembled at the Morgantown site. This necessitated storage of the components of the station for almost a year at the NAFTC Headquarters which caused a number of issues with the equipment that will be discussed in later portions of this report. This report will consist of PHASE I and PHASE II with discussions on each of the tasks scheduled for each phase of the project.

  18. Gravity Station Data for Spain

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The gravity station data total 28493 records. This data base was received in April 1997. Principal gravity parameters include Free-air Anomalies which have been...

  19. Conveying International Space Station Science

    Science.gov (United States)

    Goza, Sharon P.

    2017-01-01

    Over 1,000 experiments have been completed, and others are being conducted and planed on the International Space Station (ISS). In order to make the information on these experiments accessible, the IGOAL develops mobile applications to easily access this content and video products to convey high level concepts. This presentation will feature the Space Station Research Explorer as well as several publicly available video examples.

  20. Summit Station Skiway Cost Analysis

    Science.gov (United States)

    2016-07-01

    ER D C/ CR RE L TR -1 6- 9 Engineering for Polar Operations, Logistics , and Research (EPOLAR) Summit Station Skiway Cost Analysis Co ld...and Research (EPOLAR) ERDC/CRREL TR-16-9 July 2016 Summit Station Skiway Cost Analysis Terry D. Melendy Cold Regions Research and Engineering...snapshot at the current operating costs . We collected alternative skiway concepts, such as those at the NEEM camp, from the NEEM logistics and project

  1. Internationalization of the Space Station

    Science.gov (United States)

    Lottmann, R. V.

    1985-01-01

    Attention is given to the NASA Space Station system elements whose production is under consideration by potential foreign partners. The ESA's Columbus Program declaration encompasses studies of pressurized modules, unmanned payload carriers, and ground support facilities. Canada has expressed interest in construction and servicing facilities, solar arrays, and remote sensing facilities. Japanese studies concern a multipurpose experimental module concept. Each of these foreign investments would expand Space Station capabilities and lay the groundwork for long term partnerships.

  2. Space stations systems and utilization

    CERN Document Server

    Messerschmid, Ernst

    1999-01-01

    The design of space stations like the recently launched ISS is a highly complex and interdisciplinary task. This book describes component technologies, system integration, and the potential usage of space stations in general and of the ISS in particular. It so adresses students and engineers in space technology. Ernst Messerschmid holds the chair of space systems at the University of Stuttgart and was one of the first German astronauts.

  3. Tsukuba 32-m VLBI Station

    Science.gov (United States)

    Kawabata, Ryoji; Kurihara, Shinobu; Fukuzaki, Yoshihiro; Kuroda, Jiro; Tanabe, Tadashi; Mukai, Yasuko; Nishikawa, Takashi

    2013-01-01

    The Tsukuba 32-m VLBI station is operated by the Geospatial Information Authority of Japan. This report summarizes activities of the Tsukuba 32-m VLBI station in 2012. More than 200 sessions were observed with the Tsukuba 32-m and other GSI antennas in accordance with the IVS Master Schedule of 2012. We have started installing the observing facilities that will be fully compliant with VLBI2010 for the first time in Japan.

  4. Hey] What's Space Station Freedom?

    Science.gov (United States)

    Vonehrenfried, Dutch

    This video, 'Hey] What's Space Station Freedom?', has been produced as a classroom tool geared toward middle school children. There are three segments to this video. Segment One is a message to teachers presented by Dr. Jeannine Duane, New Jersey, 'Teacher in Space'. Segment Two is a brief Social Studies section and features a series of Presidential Announcements by President John F. Kennedy (May 1961), President Ronald Reagan (July 1982), and President George Bush (July 1989). These historical announcements are speeches concerning the present and future objectives of the United States' space programs. In the last segment, Charlie Walker, former Space Shuttle astronaut, teaches a group of middle school children, through models, computer animation, and actual footage, what Space Station Freedom is, who is involved in its construction, how it is to be built, what each of the modules on the station is for, and how long and in what sequence this construction will occur. There is a brief animation segment where, through the use of cartoons, the children fly up to Space Station Freedom as astronauts, perform several experiments and are given a tour of the station, and fly back to Earth. Space Station Freedom will take four years to build and will have three lab modules, one from ESA and another from Japan, and one habitation module for the astronauts to live in.

  5. Hey! What's Space Station Freedom?

    Science.gov (United States)

    Vonehrenfried, Dutch

    1992-01-01

    This video, 'Hey! What's Space Station Freedom?', has been produced as a classroom tool geared toward middle school children. There are three segments to this video. Segment One is a message to teachers presented by Dr. Jeannine Duane, New Jersey, 'Teacher in Space'. Segment Two is a brief Social Studies section and features a series of Presidential Announcements by President John F. Kennedy (May 1961), President Ronald Reagan (July 1982), and President George Bush (July 1989). These historical announcements are speeches concerning the present and future objectives of the United States' space programs. In the last segment, Charlie Walker, former Space Shuttle astronaut, teaches a group of middle school children, through models, computer animation, and actual footage, what Space Station Freedom is, who is involved in its construction, how it is to be built, what each of the modules on the station is for, and how long and in what sequence this construction will occur. There is a brief animation segment where, through the use of cartoons, the children fly up to Space Station Freedom as astronauts, perform several experiments and are given a tour of the station, and fly back to Earth. Space Station Freedom will take four years to build and will have three lab modules, one from ESA and another from Japan, and one habitation module for the astronauts to live in.

  6. Survivability of the hardened mobile launcher when attacked by a hypothetical rapidly retargetable ICBM system. Master's thesis

    Energy Technology Data Exchange (ETDEWEB)

    Gearhart, D.J.; Merrow, S.F.

    1986-03-01

    This thesis evaluates the survivability of the hardened mobile launcher system (HML) against a hypothetical enemy ICBM system. The hypothetical system has two key capabilities: it can obtain near real-time intelligence information regarding the HML's location, and it can be retargeted in flight (as necessary) according to the intelligence information. Thus, the hypothetical ICBM threat systems can attack individual HMLs directly rather than rely on a barrage attack against HML bases. Monte Carlo simulation is used to approach the problem. The model is an MBASIC computer program, written and runs on an Apple Macintosh computer. The model simulates the flight of the attacking ICBMs (there may be as few as one or as many as 14 warheads directed at each HML) and the random dispersal tactics of a single HML. The model determines the locations of the detonations and the location of the HML at time of detonation. Based on these locations, probability of kill due to peak-blast overpressure is calculated. A key parameter in the model is intelligence / retargeting cycle time -- the time required to obtain intelligence and retarget accordingly. This time is varied from 1-30 minutes. The model also allows variations in HML speed and hardness and threat system CEP. A subroutine for examining the effects of neutron fratricide on the attacking warheads is included (although the effects were found to be negligible). The thesis concludes that very small intelligence/retargeting cycle times are required for this to be an effective weapon system against the HML. Thus, with today's (or near future) technology, the HML can be considered a very survivable system.

  7. Source Term Analysis for the Nuclear Power Station Goesgen-Daeniken; Quelltermanalysen fuer das Kernkraftwerk Goesgen-Daeniken

    Energy Technology Data Exchange (ETDEWEB)

    Hosemann, J.P.; Megaritis, G.; Guentay, S.; Hirschmann, H.; Luebbesmeyer, D.; Lieber, K.; Jaeckel, B.; Birchley, J.; Duijvestijn, G

    2001-08-01

    Analyses are performed for three accident scenarios postulated to occur in the Goesgen Nuclear Power Plant, a 900 MWe Pressurised Water Reactor of Siemens design. The scenarios investigated comprise a Station Blackout and two separate cases of small break loss-of-coolant accident which lead, respectively, to high, intermediate and low pressure conditions in the reactor system. In each case the accident assumptions are highly pessimistic, so that the sequences span a large range of plant states and a damage phenomena. Thus the plant is evaluated for a diversity of potential safety challenges. A suite of analysis tools are used to examine the reactor coolant system response, the core heat-up, melting, fission product release from the reactor system, the transport and chemical behaviour of those fission products in the containment building, and the release of radioactivity (source term) to the environment. Comparison with reference values used by the licensing authority shows that the use of modern analysis tools and current knowledge can provide substantial reduction in the estimated source term. Of particular interest are insights gained from the analyses which indicate opportunities for operators to reduce or forestall the release. (author)

  8. 47 CFR 73.6016 - Digital Class A TV station protection of TV broadcast stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Digital Class A TV station protection of TV... Class A TV station protection of TV broadcast stations. Digital Class A TV stations must protect... existing Class A TV station or to change the facilities of a digital Class A TV station will not be...

  9. Enhanced Gravity Tractor Derived from the Asteroid Redirect Mission for Deflecting Hypothetical Asteroid 2017 PDC

    Science.gov (United States)

    Mazanek, Daniel D.; Reeves, David M.; Abell, Paul A.; Shen, Haijun; Qu, Min

    2017-01-01

    The Asteroid Redirect Mission (ARM) concept would robotically visit a hazardous-size near-Earth asteroid (NEA) with a rendezvous spacecraft, collect a multi-ton boulder and regolith samples from its surface, demonstrate an innovative planetary defense technique known as the Enhanced Gravity Tractor (EGT), and return the asteroidal material to a stable orbit around the Moon, allowing astronauts to explore the returned material in the mid-2020s. Launch of the robotic vehicle to rendezvous with the ARM reference target, NEA (341843) 2008 EV5, would occur in late 2021 [1,2]. The robotic segment of the ARM concept uses a 40 kW Solar Electric Propulsion (SEP) system with a specific impulse (Isp) of 2600 s, and would provide the first ever demonstration of the EGT technique on a hazardous-size asteroid and validate one method of collecting mass in-situ. The power, propellant, and thrust capability of the ARM robotic spacecraft can be scaled from a 40 kW system to 150 kW and 300 kW, which represent a likely future power level progression. The gravity tractor technique uses the gravitational attraction of a station-keeping spacecraft with the asteroid to provide a velocity change and gradually alter the trajectory of the asteroid. EGT utilizes a spacecraft with a high-efficiency propulsion system, such as Solar Electric Propulsion (SEP), along with mass collected in-situ to augment the mass of the spacecraft, thereby increasing the gravitational force between the objects [3]. As long as the spacecraft has sufficient thrust and propellant capability, the EGT force is only limited by the amount of in-situ mass collected and can be increased several orders of magnitude compared to the traditional gravity tractor technique in which only the spacecraft mass is used to generate the gravitational attraction force. This increase in available force greatly reduces the required deflection time. The collected material can be a single boulder, multiple boulders, regolith, or a

  10. Kola consequence analysis. Evaluation of doses from a hypothetical accident at Kola nuclear power plant; Kola konsekvensanalyse. Vurdering av dosemessige konsekvenser av en eventuell ulykke ved Kola kjernekraftverk

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, E.; Holo, E.N. [Statens Straalevern, Oesteraas (Norway); Saltbones, J. [Norske Meterologiske Inst., Oslo (Norway); Stokke, E. [Institutt for Energiteknikk, Kjeller (Norway)

    1999-08-01

    Levels of radionuclides in air and on ground as well as doses from direct irradiation and inhalation of radionuclides have been calculated for selected scenarios for a hypothetical accident at Kola nuclear power plant.

  11. Examination of some hypothetical SPS rectenna sites within the contiguous United States of America. Part I. Precipitation effects on hypothetical SPS sites in the USA. Part II. Point-to-point microwave and service mode communications systems near four hypothetical SPS rectenna sites in the continental United States

    Energy Technology Data Exchange (ETDEWEB)

    Dutton, E J; Warner, B D

    1981-05-01

    The report of Grant et al., (1980) describes the EMC (electromagnetic compatibility) problems for the candidate SPS rectenna site in the Mojave Desert of California. This study examines the precipitation effects at nine other hypothetical SPS rectenna sites and the licensed transmitter density at four proposed SPS rectenna sites. The results of the precipitation study indicate that the transmission loss will not vary by more than 3% from site-to-site for the nine sites considered. Results of the licensed transmitter study for four sites support the contention that a strong correlation exists between population density and operational communications systems within small area (150 Km x 150 Km).

  12. Potential consequences in Norway after a hypothetical accident at Leningrad nuclear power plant. Potential release, fallout and predicted impacts on the environment

    Energy Technology Data Exchange (ETDEWEB)

    Nalbandyan, A.; Ytre-Eide, M.A.; Thoerring, H.; Liland, A.; Bartnicki, J.; Balonov, M.

    2012-06-15

    The report describes different hypothetical accident scenarios at the Leningrad nuclear power plant for both RBMK and VVER-1200 reactors. The estimated release is combined with different meteorological scenarios to predict possible fallout of radioactive substances in Norway. For a hypothetical catastrophic accident at an RBMK reactor combined with a meteorological worst case scenario, the consequences in Norway could be considerable. Foodstuffs in many regions would be contaminated above the food intervention levels for radioactive cesium in Norway. (Author)

  13. An in silico Approach for Structural and Functional Annotation of Salmonella enterica serovar typhimurium Hypothetical Protein R_27

    Directory of Open Access Journals (Sweden)

    Arif Khan

    2016-03-01

    Full Text Available Typhoid fever is a major cause of illness in most developing countries, including Bangladesh. In quest of new potential drug against Typhoid fever, the current study was designed to elucidate structural and functional details of S. typhi hypothetical protein (HP R_27. HP R_27 has the primary amino acid sequences available only. The structural annotation was determined by ProtParam, SOPMA, and CELLO. The three-dimensional (3D structure of HP R_27 predicted through homology modeling by using Phyre2. The 3D structure then refined and verified by ModRefiner, PROCHECK, ERRAT, QMEAN. The functional annotation was also performed by InterProScan, SMART, Pfam, NCBI-CDD and found Phospholipase D-like and DNA repair activity. Multiple sequence alignment also supported the existence of PLD-like domain and DNA repair protein domain in the selected hypothetical protein sequences. Finally, the cavity of drug binding was also identified to assist further molecular docking study and potent inhibitor identification. This in silico approach can be further utilized in molecular drug design for other clinically significant pathogens.

  14. Beneficial effects of cellular autofluorescence following ionization radiation: hypothetical approaches for radiation protection and enhancing radiotherapy effectiveness.

    Science.gov (United States)

    Abdollahi, Hamid

    2015-03-01

    Ionization radiation (IR) is a main part of modern technologies with a double-edge sword manner. Finding the most feasible therapies to reduce adverse effects of IR and also enhancing radiotherapy effectiveness is a debating issue that has been challenged and studied for years. The main aim of the present hypothetical research was to theorize and suggest a new biological radiation protection approach and also increasing radiotherapy outcomes based on cellular autofluorescence following IR. In this hypothesis, we suggested that this cellular autofluorescence can activate some synthetic drugs called photo-activated agents that are injected in human body after radiation exposures scenarios. Photo activated agents can activate biological pathways such as DNA repair and immunostimulation pathways, bystander signals blocking, and so survive cells and tissues. In the other hand, light emitted by cellular response to radiation can be used as like as photodynamic therapy and therefore more cancer cells killing via apoptosis and necrosis. These ideas can be performed in future using more animal and in vivo/in vitro studies and clinical trials. In conclusion, cellular autofluorescence after radiation exposure can be used as a source for activation specific drugs for radiation protection and also radiation therapy effectiveness. These hypothetical therapeutic approaches can be served as personalized therapy based on individual radiosensitivity. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Identification of a novel nuclear localization signal sequence in Chlamydia trachomatis-secreted hypothetical protein CT311.

    Directory of Open Access Journals (Sweden)

    Lei Lei

    Full Text Available We previously reported that Chlamydia trachomatis hypothetical protein CT311 was secreted out of chlamydial inclusion and into host cell cytosol. We now found that CT311 further entered host cell nucleus at the late stage of infection and continued to accumulate in the nucleus of C. trachomatis-infected cells. When CT311 was expressed via a transgene in mammalian cells, CT311 protein was exclusively detected in the nucleus, suggesting that CT311 by itself is sufficient for nuclear targeting. However, preexisting nuclear CT311 did not affect subsequent chlamydial infection. Using deletion constructs, we mapped a nuclear localization signal sequence of CT311 to residues 21 to 63 ((21AVEGKPLSRAAQLRERRKDLHVSGKPSPRYALKKRALEAKKNK(63. This sequence was sufficient for targeting a heterologous protein into mammalian cell nucleus and it contains two independent clusters of basic residues ((34RERRK(38 and (53KKRALEAKKNK(63 respectively. Deletion or alanine substitution of the basic residues in either cluster led to loss of nuclear targeting activity, suggesting that both clusters are critical for the nuclear targeting function. These observations have demonstrated that the hypothetical protein CT311 possesses a novel nuclear localization signal sequence with dual modules of basic residues for targeting host cell nucleus during Chlamydia trachomatis infection.

  16. Hypothetical scenario exercises to improve planning and readiness for drinking water quality management during extreme weather events.

    Science.gov (United States)

    Deere, Daniel; Leusch, Frederic D L; Humpage, Andrew; Cunliffe, David; Khan, Stuart J

    2017-03-15

    Two hypothetical scenario exercises were designed and conducted to reflect the increasingly extreme weather-related challenges faced by water utilities as the global climate changes. The first event was based on an extreme flood scenario. The second scenario involved a combination of weather events, including a wild forest fire ('bushfire') followed by runoff due to significant rainfall. For each scenario, a panel of diverse personnel from water utilities and relevant agencies (e.g. health departments) formed a hypothetical water utility and associated regulatory body to manage water quality following the simulated extreme weather event. A larger audience participated by asking questions and contributing key insights. Participants were confronted with unanticipated developments as the simulated scenarios unfolded, introduced by a facilitator. Participants were presented with information that may have challenged their conventional experiences regarding operational procedures in order to identify limitations in current procedures, assumptions, and readily available information. The process worked toward the identification of a list of specific key lessons for each event. At the conclusion of each simulation a facilitated discussion was used to establish key lessons of value to water utilities in preparing them for similar future extreme events. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Personality and Behavior in Social Dilemmas: Testing the Situational Strength Hypothesis and the Role of Hypothetical Versus Real Incentives.

    Science.gov (United States)

    Lozano, José H

    2016-02-01

    Previous research aimed at testing the situational strength hypothesis suffers from serious limitations regarding the conceptualization of strength. In order to overcome these limitations, the present study attempts to test the situational strength hypothesis based on the operationalization of strength as reinforcement contingencies. One dispositional factor of proven effect on cooperative behavior, social value orientation (SVO), was used as a predictor of behavior in four social dilemmas with varying degree of situational strength. The moderating role of incentive condition (hypothetical vs. real) on the relationship between SVO and behavior was also tested. One hundred undergraduates were presented with the four social dilemmas and the Social Value Orientation Scale. One-half of the sample played the social dilemmas using real incentives, whereas the other half used hypothetical incentives. Results supported the situational strength hypothesis in that no behavioral variability and no effect of SVO on behavior were found in the strongest situation. However, situational strength did not moderate the effect of SVO on behavior in situations where behavior showed variability. No moderating effect was found for incentive condition either. The implications of these results for personality theory and assessment are discussed. © 2014 Wiley Periodicals, Inc.

  18. Overview of New Tools to Perform Safety Analysis: BWR Station Black Out Test Case

    Energy Technology Data Exchange (ETDEWEB)

    D. Mandelli; C. Smith; T. Riley; J. Nielsen; J. Schroeder; C. Rabiti; A. Alfonsi; Cogliati; R. Kinoshita; V. Pasucci; B. Wang; D. Maljovec

    2014-06-01

    Dynamic Probabilistic Risk Assessment (DPRA) methodologies couple system simulator codes (e.g., RELAP, MELCOR) with simulation controller codes (e.g., RAVEN, ADAPT). While system simulator codes accurately model system dynamics deterministically, simulation controller codes introduce both deterministic (e.g., system control logic, operating procedures) and stochastic (e.g., component failures, parameter uncertainties) elements into the simulation. Typically, a DPRA is performed by: 1) sampling values of a set of parameters from the uncertainty space of interest (using the simulation controller codes), and 2) simulating the system behavior for that specific set of parameter values (using the system simulator codes). For complex systems, one of the major challenges in using DPRA methodologies is to analyze the large amount of information (i.e., large number of scenarios ) generated, where clustering techniques are typically employed to allow users to better organize and interpret the data. In this paper, we focus on the analysis of a nuclear simulation dataset that is part of the Risk Informed Safety Margin Characterization (RISMC) Boiling Water Reactor (BWR) station blackout (SBO) case study. We apply a software tool that provides the domain experts with an interactive analysis and visualization environment for understanding the structures of such high-dimensional nuclear simulation datasets. Our tool encodes traditional and topology-based clustering techniques, where the latter partitions the data points into clusters based on their uniform gradient flow behavior. We demonstrate through our case study that both types of clustering techniques complement each other in bringing enhanced structural understanding of the data.

  19. 47 CFR 95.119 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... station identification is the call sign assigned to the GMRS station or system. (c) A unit number may be... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 95.119 Section 95.119... SERVICES General Mobile Radio Service (GMRS) § 95.119 Station identification. (a) Except as provided in...

  20. 47 CFR 73.1201 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Station identification. 73.1201 Section 73.1201... Rules Applicable to All Broadcast Stations § 73.1201 Station identification. (a) When regularly required. Broadcast station identification announcements shall be made: (1) At the beginning and ending of each time...

  1. 47 CFR 25.206 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station identification. 25.206 Section 25.206... Technical Standards § 25.206 Station identification. The requirement for transmission of station identification is waived for all radio stations licensed under this part with the exception of satellite uplinks...

  2. 47 CFR 95.1305 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 95.1305 Section 95.1305... SERVICES Multi-Use Radio Service (MURS) General Provisions § 95.1305 Station identification. A MURS station is not required to transmit a station identification announcement. ...

  3. 47 CFR 97.119 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 97.119 Section 97.119... SERVICE Station Operation Standards § 97.119 Station identification. (a) Each amateur station, except a... keyed by an automatic device used only for identification, the speed must not exceed 20 words per minute...

  4. 47 CFR 95.1127 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 95.1127 Section 95.1127... SERVICES Wireless Medical Telemetry Service (WMTS) General Provisions § 95.1127 Station identification. A WMTS station is not required to transmit a station identification announcement. ...

  5. 47 CFR 95.1205 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 95.1205 Section 95.1205... SERVICES Medical Device Radiocommunication Service (MedRadio) § 95.1205 Station identification. A station is not required to transmit a station identification announcement. ...

  6. 47 CFR 95.1005 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 95.1005 Section 95.1005... SERVICES Low Power Radio Service (LPRS) General Provisions § 95.1005 Station identification. An LPRS station is not required to transmit a station identification announcement. ...

  7. Autonomous Electrical Vehicles’ Charging Station

    Directory of Open Access Journals (Sweden)

    Józef Paska

    2016-09-01

    Full Text Available This paper presents a model of an autonomous electrical vehicles’ charging station. It consists of renewable energy sources: wind turbine system, photovoltaic cells, as well as an energy storage, load, and EV charging station. In order to optimise the operating conditions, power electronic converters were added to the system. The model was implemented in the Homer Energy programme. The first part of the paper presents the design assumptions and technological solutions. Further in the paper simulation results are discussed and analysed, and then problems observed in the simulation and possible solutions.

  8. Business earth stations for telecommunications

    Science.gov (United States)

    Morgan, Walter L.; Rouffet, Denis

    The current status of technology for small commercial satellite-communication earth stations is reviewed on the basis of an application study undertaken in the U.S. and Europe. Chapters are devoted to an overview of satellite communication networks, microterminal design and hardware implementation, microterminal applications, the advantages of microterminals, typical users, services provided, the U.S. market for small earth stations, network operators, and the economics of satellite and terrestrial communication services. Consideration is given to the operation of a microterminal network, standards and regulations, technological factors, space-segment requirements, and insurance aspects. Diagrams, graphs, tables of numerical data, and a glossary of terms are provided.

  9. DGPS ground station integrity monitoring

    Science.gov (United States)

    Skidmore, Trent A.; Vangraas, Frank

    1995-01-01

    This paper summarizes the development of a unique Differential Global Positioning System (DGPS) ground station integrity monitor which can offer improved availability over conventional code-differential monitoring systems. This monitoring technique, called code/carrier integrity monitoring (CCIM), uses the highly stable integrated Doppler measurement to smooth the relatively noisy code-phase measurements. The pseudorange correction is therefore comprised of the integrated Doppler measurement plus the CCIM offset. The design and operational results of a DGPS ground station integrity monitor are reported. A robust integrity monitor is realized which is optimized for applications such as the Special Category I (SCAT-I) defined in the RTCA Minimum Aviation System Performance Standards.

  10. Single-Station Sigma for the Iranian Strong Motion Stations

    Science.gov (United States)

    Zafarani, H.; Soghrat, M. R.

    2017-11-01

    In development of ground motion prediction equations (GMPEs), the residuals are assumed to have a log-normal distribution with a zero mean and a standard deviation, designated as sigma. Sigma has significant effect on evaluation of seismic hazard for designing important infrastructures such as nuclear power plants and dams. Both aleatory and epistemic uncertainties are involved in the sigma parameter. However, ground-motion observations over long time periods are not available at specific sites and the GMPEs have been derived using observed data from multiple sites for a small number of well-recorded earthquakes. Therefore, sigma is dominantly related to the statistics of the spatial variability of ground motion instead of temporal variability at a single point (ergodic assumption). The main purpose of this study is to reduce the variability of the residuals so as to handle it as epistemic uncertainty. In this regard, it is tried to partially apply the non-ergodic assumption by removing repeatable site effects from total variability of six GMPEs driven from the local, Europe-Middle East and worldwide data. For this purpose, we used 1837 acceleration time histories from 374 shallow earthquakes with moment magnitudes ranging from M w 4.0 to 7.3 recorded at 370 stations with at least two recordings per station. According to estimated single-station sigma for the Iranian strong motion stations, the ratio of event-corrected single-station standard deviation ( Φ ss) to within-event standard deviation ( Φ) is about 0.75. In other words, removing the ergodic assumption on site response resulted in 25% reduction of the within-event standard deviation that reduced the total standard deviation by about 15%.

  11. The Good, the Bad, and the Irrelevant: Neural Mechanisms of Learning Real and Hypothetical Rewards and Effort.

    Science.gov (United States)

    Scholl, Jacqueline; Kolling, Nils; Nelissen, Natalie; Wittmann, Marco K; Harmer, Catherine J; Rushworth, Matthew F S

    2015-08-12

    Natural environments are complex, and a single choice can lead to multiple outcomes. Agents should learn which outcomes are due to their choices and therefore relevant for future decisions and which are stochastic in ways common to all choices and therefore irrelevant for future decisions between options. We designed an experiment in which human participants learned the varying reward and effort magnitudes of two options and repeatedly chose between them. The reward associated with a choice was randomly real or hypothetical (i.e., participants only sometimes received the reward magnitude associated with the chosen option). The real/hypothetical nature of the reward on any one trial was, however, irrelevant for learning the longer-term values of the choices, and participants ought to have only focused on the informational content of the outcome and disregarded whether it was a real or hypothetical reward. However, we found that participants showed an irrational choice bias, preferring choices that had previously led, by chance, to a real reward in the last trial. Amygdala and ventromedial prefrontal activity was related to the way in which participants' choices were biased by real reward receipt. By contrast, activity in dorsal anterior cingulate cortex, frontal operculum/anterior insula, and especially lateral anterior prefrontal cortex was related to the degree to which participants resisted this bias and chose effectively in a manner guided by aspects of outcomes that had real and more sustained relationships with particular choices, suppressing irrelevant reward information for more optimal learning and decision making. In complex natural environments, a single choice can lead to multiple outcomes. Human agents should only learn from outcomes that are due to their choices, not from outcomes without such a relationship. We designed an experiment to measure learning about reward and effort magnitudes in an environment in which other features of the outcome were

  12. The Good, the Bad, and the Irrelevant: Neural Mechanisms of Learning Real and Hypothetical Rewards and Effort

    Science.gov (United States)

    Kolling, Nils; Nelissen, Natalie; Wittmann, Marco K.; Harmer, Catherine J.; Rushworth, Matthew F. S.

    2015-01-01

    Natural environments are complex, and a single choice can lead to multiple outcomes. Agents should learn which outcomes are due to their choices and therefore relevant for future decisions and which are stochastic in ways common to all choices and therefore irrelevant for future decisions between options. We designed an experiment in which human participants learned the varying reward and effort magnitudes of two options and repeatedly chose between them. The reward associated with a choice was randomly real or hypothetical (i.e., participants only sometimes received the reward magnitude associated with the chosen option). The real/hypothetical nature of the reward on any one trial was, however, irrelevant for learning the longer-term values of the choices, and participants ought to have only focused on the informational content of the outcome and disregarded whether it was a real or hypothetical reward. However, we found that participants showed an irrational choice bias, preferring choices that had previously led, by chance, to a real reward in the last trial. Amygdala and ventromedial prefrontal activity was related to the way in which participants' choices were biased by real reward receipt. By contrast, activity in dorsal anterior cingulate cortex, frontal operculum/anterior insula, and especially lateral anterior prefrontal cortex was related to the degree to which participants resisted this bias and chose effectively in a manner guided by aspects of outcomes that had real and more sustained relationships with particular choices, suppressing irrelevant reward information for more optimal learning and decision making. SIGNIFICANCE STATEMENT In complex natural environments, a single choice can lead to multiple outcomes. Human agents should only learn from outcomes that are due to their choices, not from outcomes without such a relationship. We designed an experiment to measure learning about reward and effort magnitudes in an environment in which other features

  13. The Medicina Station Status Report

    Science.gov (United States)

    Orfei, Alessandro; Orlati, Andrea; Maccaferri, Giuseppe

    2013-01-01

    General information about the Medicina Radio Astronomy Station, the 32-m antenna status, and the staff in charge of the VLBI observations is provided. In 2012, the data from geodetic VLBI observations were acquired using the Mark 5A recording system with good results. Updates of the hardware were performed and are briefly described.

  14. Mobile Lunar Laser Ranging Station

    Science.gov (United States)

    Intellect, 1977

    1977-01-01

    Harlan Smith, chairman of the University of Texas's Astronomy Department, discusses a mobile lunar laser ranging station which could help determine the exact rates of movement between continents and help geophysicists understand earthquakes. He also discusses its application for studying fundamental concepts of cosmology and physics. (Editor/RK)

  15. Space station molecular sieve development

    Science.gov (United States)

    Chang, C.; Rousseau, J.

    1986-01-01

    An essential function of a space environmental control system is the removal of carbon dioxide (CO2) from the atmosphere to control the partial pressure of this gas at levels lower than 3 mm Hg. The use of regenerable solid adsorbents for this purpose was demonstrated effectively during the Skylab mission. Earlier sorbent systems used zeolite molecular sieves. The carbon molecular sieve is a hydrophobic adsorbent with excellent potential for space station application. Although carbon molecular sieves were synthesized and investigated, these sieves were designed to simulate the sieving properties of 5A zeolite and for O2/N2 separation. This program was designed to develop hydrophobic carbon molecular sieves for CO2 removal from a space station crew environment. It is a first phase effort involved in sorbent material development and in demonstrating the utility of such a material for CO2 removal on space stations. The sieve must incorporate the following requirements: it must be hydrophobic; it must have high dynamic capacity for carbon dioxide at the low partial pressure of the space station atmosphere; and it must be chemiclly stable and will not generate contaminants.

  16. Delay distributions in railway stations

    NARCIS (Netherlands)

    Goverde, R.M.P.; Hansen, I.A.; Hooghiemstra, G.; Lopuhaa, H.P.

    2001-01-01

    The estimation of the precise arrival and departure times of trains at stations is done by means of a software tool that extracts the occupation and clearance times of each train per track section of the Dutch Railways‘ network. The software tool was applied to the whole automatically collected set

  17. Performance of Existing Hydrogen Stations

    Energy Technology Data Exchange (ETDEWEB)

    Sprik, Samuel [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kurtz, Jennifer M [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Ainscough, Christopher D [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Saur, Genevieve [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Peters, Michael C [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-12-01

    In this presentation, the National Renewable Energy Laboratory presented aggregated analysis results on the performance of existing hydrogen stations, including performance, operation, utilization, maintenance, safety, hydrogen quality, and cost. The U.S. Department of Energy funds technology validation work at NREL through its National Fuel Cell Technology Evaluation Center (NFCTEC).

  18. "Artificial intelligence" at streamgaging stations

    Science.gov (United States)

    R. B. Thomas

    1985-01-01

    Two types of problems are related to collecting hydrologic data at stream gaging stations. One includes the technical/logistical questions associated with measuring and transferring data for processing. Effort spent on these problems ranges from improving devices for sensing data to using electronic data loggers.

  19. Remote input/output station

    CERN Multimedia

    1972-01-01

    A general view of the remote input/output station installed in building 112 (ISR) and used for submitting jobs to the CDC 6500 and 6600. The card reader on the left and the line printer on the right are operated by programmers on a self-service basis.

  20. Total Stations : the Surveyor's Workhorse

    NARCIS (Netherlands)

    Lemmens, M.J.P.M.

    2016-01-01

    A total station is an angle measuring device, also known as a theodolite, integrated with an electronic distance measurement (EDM) unit. The integration provides the ability to measure horizontal and vertical angles as well as slope distances using the same device at the same time, which benefits

  1. 47 CFR 73.6018 - Digital Class A TV station protection of DTV stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Digital Class A TV station protection of DTV... TV station protection of DTV stations. Digital Class A TV stations must protect the DTV service that... application for digital operation of an existing Class A TV station or to change the facilities of a digital...

  2. Structural properties of hypothetical CeBa2Cu3O7 compound from LSDA+DMFT calculations

    Directory of Open Access Journals (Sweden)

    Łuszczek Maciej

    2016-09-01

    Full Text Available The hypothetical stoichiometric CeBa2Cu3O7 (Ce123 compound, which has not been synthesized as a single phase yet, was studied by the density functional theory (DFT. We utilized a method which merges the local spin density approximation (LSDA with the dynamical mean-field theory (DMFT to account for the electronic correlations. The LSDA+DMFT calculations were performed in the high-temperature range. The particular emphasis was put on the pressure-induced changes in the electronic band structure related to strongly correlated 4f states. The computational results indicate the occurrence of a large negative volumetric thermal expansion coefficient near T = 500 K and a trace of a low-volume isostructural metastable state at high temperatures.

  3. Hypothetical First Order abs(DELTA S) = 2 Transitions in the K sup 0 - (anti)K sup 0 System

    CERN Document Server

    Piskorski, J

    2003-01-01

    The influence of a hypothetical CP violating abs(DELTA S) = 2 interaction on the masses and lifetimes of neutral mesons K sup 0 and (anti)K sup 0 is investigated. It is shown, that the assumption of the existence of this superweak interaction does not significantly affect these parameters if phenomenological constraints based on recent experiments are imposed. To establish this result we use a computer simulation of a parameter corresponding to the difference between the diagonal elements of the effective Hamiltonian governing the time evolution in the K sup 0 - (anti)K sup 0 system. Instead of the widely used Lee, Oehme and Yang approximation which is insensitive to the abs(DELTA S) = 2 interaction we use a formalism based on the Krolikowski-Rzewuski equation. (author)

  4. Conserved hypothetical protein Rv1977 in Mycobacterium tuberculosis strains contains sequence polymorphisms and might be involved in ongoing immune evasion.

    Science.gov (United States)

    Jiang, Yi; Liu, Haican; Wang, Xuezhi; Li, Guilian; Qiu, Yan; Dou, Xiangfeng; Wan, Kanglin

    2015-01-01

    Host immune pressure and associated parasite immune evasion are key features of host-pathogen co-evolution. A previous study showed that human T cell epitopes of Mycobacterium tuberculosis are evolutionarily hyperconserved and thus it was deduced that M. tuberculosis lacks antigenic variation and immune evasion. Here, we selected 151 clinical Mycobacterium tuberculosis isolates from China, amplified gene encoding Rv1977 and compared the sequences. The results showed that Rv1977, a conserved hypothetical protein, is not conserved in M. tuberculosis strains and there are polymorphisms existed in the protein. Some mutations, especially one frameshift mutation, occurred in the antigen Rv1977, which is uncommon in M.tb strains and may lead to the protein function altering. Mutations and deletion in the gene all affect one of three T cell epitopes and the changed T cell epitope contained more than one variable position, which may suggest ongoing immune evasion.

  5. Measles outbreak in an asylum-seekers' shelter in Germany: comparison of the implemented with a hypothetical containment strategy.

    Science.gov (United States)

    Takla, A; Barth, A; Siedler, A; Stöcker, P; Wichmann, O; Deleré, Y

    2012-09-01

    In order to contain a measles outbreak in a German asylum-seekers' shelter, serological testing of all residents was performed, followed by selective vaccination of those with negative test results/not tested. In this paper we describe the outbreak epidemiologically and then compare the implemented strategy with a hypothetical mass vaccination of all individuals unvaccinated or with unknown vaccination status born after 1970 as recommended by the German Standing Committee on Vaccination in terms of potentially avoided cases, logistics, and costs. Three hundred (70%) residents participated in the serological testing, of which 39 (13%) were seronegative. In total, 144 individuals were eligible for vaccination, while a mass vaccination would have targeted 359 persons. However, serological testing was time- and personnel consuming and revealed several logistical problems. Its costs amounted to €90 000, double that of mass vaccination that additionally might have avoided three of the eight cases. Mass vaccination seems the preferred measure for measles outbreak control in such settings.

  6. Cues of High and Low Body Weight Negatively Influence Adults' Perceptions and Ratings in the Hypothetical Adoption Paradigm

    Directory of Open Access Journals (Sweden)

    Anthony A. Volk

    2006-01-01

    Full Text Available Infant and child facial cues influence perceptions and ratings in the Hypothetical Adoption Paradigm as well as actual parental care. A previous study demonstrated that infant and child facial cues of low body weight negatively influenced adults' ratings. The current study sought to replicate and expand on those results by presenting adults with normal faces as well as faces that were digitally altered to display high or low body weight. Cues of abnormal body weight significantly, and negatively, influenced adults’ ratings of adoption preference, health, and cuteness. Effect sizes were larger for cues of high body weight. Thus, infant and child facial cues of abnormal body weight may represent a relative risk factor to the quality of adult care obtained by children with abnormal body weight.

  7. Response to Hypothetical Social Scenarios in Individuals with Traumatic Brain Injury Who Present Inappropriate Social Behavior: A Preliminary Report

    Directory of Open Access Journals (Sweden)

    Michel Ouellette

    2013-01-01

    Full Text Available Background: Very little research thus far has examined the decision making that underlies inappropriate social behavior (ISB post-TBI (traumatic brain injury. Objectives: To verify the usefulness of a new instrument, the Social Responding Task, for investigating whether, in social decision making, individuals with TBI, who present inappropriate social behavior (ISB, have difficulty anticipating their own feelings of embarrassment and others’ angry reactions following an ISB. Methods: Seven subjects with TBI presenting with inappropriate social behavior (TBI-ISB, 10 presenting with appropriate social behavior (TBI-ASB, and 15 healthy controls were given 12 hypothetical scenarios three times, each time ending with a different behavioral response. Subjects were asked to gauge the likelihood of their displaying the behavior in that situation (part A and of it being followed by an angry reaction from the other or by feelings of embarrassment in themselves (part B. Results: TBI-ISB subjects scored higher than TBI-ASB and healthy controls on a scale of likelihood of displaying an ISB. Results regarding expectations of angry reactions from others and feelings of embarrassment after an ISB were similar among groups. Negative correlations between endorsement of an inappropriate behavior and anticipation of negative emotional consequences were significant for both TBI-ASB and control subjects, but not for TBI-ISB subjects. Conclusions: Results suggest that the TBI-ISB participants were likely to endorse an ISB despite being able to anticipate a negative emotional response in themselves or others, suggesting that there were other explanations for their poor behavior. A self-reported likely response to hypothetical social scenarios can be a useful approach for studying the neurocognitive processes behind the poor choices of individuals with TBI-ISB, but the task needs further validation studies. A comprehensive discussion follows on the underlying

  8. Inhibition of ovine in vitro fertilization by anti-Prt antibody: hypothetical model for Prt/ZP interaction.

    Science.gov (United States)

    Pimenta, Jorge; Sardinha, João; Marques, Carla C; Domingos, Ana; Baptista, Maria C; Barbas, João P; Martins, Ivo C; Mesquita, Patrícia; Pessa, Pedro; Soares, Rui; Viegas, Aldino; Cabrita, Eurico; Horta, E M António; Fontes, Carlos A; Prates, A M José; Pereira, M L N Rosa

    2013-03-26

    The impact of prion proteins in the rules that dictate biological reproduction is still poorly understood. Likewise, the role of prnt gene, encoding the prion-like protein testis specific (Prt), in ram reproductive physiology remains largely unknown. In this study, we assessed the effect of Prt in ovine fertilization by using an anti-Prt antibody (APPA) in fertilization medium incubated with spermatozoa and oocytes. Moreover, a computational model was constructed to infer how the results obtained could be related to a hypothetical role for Prt in sperm-zona pellucida (ZP) binding. Mature ovine oocytes were transferred to fertilization medium alone (control) or supplemented with APPA, or pre-immune serum (CSerum). Oocytes were inseminated with ovine spermatozoa and after 18 h, presumptive zygotes (n=142) were fixed to evaluate fertilization rates or transferred (n=374) for embryo culture until D6-7. Predicted ovine Prt tertiary structure was compared with data obtained by circular dichroism spectroscopy (CD) and a protein-protein computational docking model was estimated for a hypothetical Prt/ZP interaction. The fertilizing rate was lower (P=0.006) in APPA group (46.0+/-6.79%) when compared to control (78.5+/-7.47%) and CSerum (64.5+/-6.65%) groups. In addition, the cleavage rate was higher (PZP docking. Computational analyses predicted a favorable Prt-binding activity towards ZP domains. Our data indicates that the presence of APPA reduces the number of fertilized oocytes and of cleaved embryos. Moreover, the CD analysis data reinforces the predicted ovine Prt trend towards an alpha-helical structure. Predicted protein-protein docking suggests a possible interaction between Prt and ZP, thus supporting an important role for Prt in ovine fertilization.

  9. 3-D velocity structure model for long-period ground motion simulation of the hypothetical Nankai Earthquake

    Science.gov (United States)

    Kagawa, T.; Petukhin, A.; Koketsu, K.; Miyake, H.; Murotani, S.; Tsurugi, M.

    2010-12-01

    Three dimensional velocity structure model of southwest Japan is provided to simulate long-period ground motions due to the hypothetical subduction earthquakes. The model is constructed from numerous physical explorations conducted in land and offshore areas and observational study of natural earthquakes. Any available information is involved to explain crustal structure and sedimentary structure. Figure 1 shows an example of cross section with P wave velocities. The model has been revised through numbers of simulations of small to middle earthquakes as to have good agreement with observed arrival times, amplitudes, and also waveforms including surface waves. Figure 2 shows a comparison between Observed (dash line) and simulated (solid line) waveforms. Low velocity layers have added on seismological basement to reproduce observed records. The thickness of the layer has been adjusted through iterative analysis. The final result is found to have good agreement with the results from other physical explorations; e.g. gravity anomaly. We are planning to make long-period (about 2 to 10 sec or longer) simulations of ground motion due to the hypothetical Nankai Earthquake with the 3-D velocity structure model. As the first step, we will simulate the observed ground motions of the latest event occurred in 1946 to check the source model and newly developed velocity structure model. This project is partly supported by Integrated Research Project for Long-Period Ground Motion Hazard Maps by Ministry of Education, Culture, Sports, Science and Technology (MEXT). The ground motion data used in this study were provided by National Research Institute for Earth Science and Disaster Prevention Disaster (NIED). Figure 1 An example of cross section with P wave velocities Figure 2 Observed (dash line) and simulated (solid line) waveforms due to a small earthquake

  10. Does message framing predict willingness to participate in a hypothetical HIV vaccine trial: an application of Prospect Theory.

    Science.gov (United States)

    Evangeli, Michael; Kafaar, Zuhayr; Kagee, Ashraf; Swartz, Leslie; Bullemor-Day, Philippa

    2013-01-01

    It is vital that enough participants are willing to participate in clinical trials to test HIV vaccines adequately. It is, therefore, necessary to explore what affects peoples' willingness to participate (WTP) in such trials. Studies have only examined individual factors associated with WTP and not the effect of messages about trial participation on potential participants (e.g., whether losses or gains are emphasized, or whether the outcome is certain or uncertain). This study explores whether the effects of message framing on WTP in a hypothetical HIV vaccine trial are consistent with Prospect Theory. This theory suggests that people are fundamentally risk averse and that (1) under conditions of low risk and high certainty, gain-framed messages will be influential (2) under conditions of high risk and low certainty, loss-framed messages will be influential. This cross-sectional study recruited 283 HIV-negative students from a South African university who were given a questionnaire that contained matched certain gain-framed, certain loss-framed, uncertain gain-framed, and uncertain loss-framed statements based on common barriers and facilitators of WTP. Participants were asked to rate how likely each statement was to result in their participation in a hypothetical preventative HIV vaccine trial. Consistent with Prospect Theory predictions, for certain outcomes, gain-framed messages were more likely to result in WTP than loss-framed messages. Inconsistent with predictions, loss-framed message were not more likely to be related to WTP for uncertain outcomes than gain-framed messages. Older students were less likely to express their WTP across the different message frames. Recruitment for HIV vaccine trials should pay attention to how messages about the trial are presented to potential participants.

  11. Pediatrician’s cough and cold medication prescription for hypothetical cases – A cross-sectional multi-centric study

    Directory of Open Access Journals (Sweden)

    Sudha Chandelia

    2016-03-01

    Full Text Available Background: Concerns over inappropriate use of cough and cold medication (CCM in children have been raised. In addition to being ineffective, these are now considered toxic for young children. Despite this fact studies from some regions have shown high use of these medications by physicians. However data on pediatricians and from India are negligible. Aim: To study the burden and patterns of cough and cold medications use by pediatricians for hypothetical cases. Methods: In this cross-sectional study; 172 pediatricians of various hospitals of Delhi and Haryana were enrolled from February 15 to March 15, 2012. They were contacted personally by authors and asked to write their prescriptions for two hypothetical case scenarios [having cough and cold] of two different age groups; (1 less than 2 years and (2 2–5 years. We made two categories as recommendations exist for children less than 2 years while recommendations for the second category are underway. Results were summarized as percentages, counts and; presented in tables and figures. Chi square test was used to establish association between categorical variables of subgroups. Results: Response rate was 93%. The most used CCM was antihistaminics (82% and systemic sympathomimetics (48%. The use of CCM was significantly less in teaching hospitals as compared to non-teaching (77% vs. 95%; p-value – 0.025. However there was no statistical difference in the practice of post graduates and more senior pediatricians (p value-0.895. No difference in CCM use in two age groups {(82% (less than 2 years vs. 85% (2–5 years; p-value – 0.531} was observed. Conclusion: Overall use of CCM is still high irrespective of patient age, pediatrician’s seniority or hospital setting. Efforts should be made to create awareness among the pediatricians regarding cautious use of these medications.

  12. Work/control stations in Space Station weightlessness

    Science.gov (United States)

    Willits, Charles

    1990-01-01

    An ergonomic integration of controls, displays, and associated interfaces with an operator, whose body geometry and dynamics may be altered by the state of weightlessness, is noted to rank in importance with the optimal positioning of controls relative to the layout and architecture of 'body-ported' work/control stations applicable to the NASA Space Station Freedom. A long-term solution to this complex design problem is envisioned to encompass the following features: multiple imaging, virtual optics, screen displays controlled by a keyboard ergonomically designed for weightlessness, cursor control, a CCTV camera, and a hand-controller featuring 'no-grip' vernier/tactile positioning. This controller frees all fingers for multiple-switch actuations, while retaining index/register determination with the hand controller. A single architectural point attachment/restraint may be used which requires no residual muscle tension in either brief or prolonged operation.

  13. Space Station tethered elevator system

    Science.gov (United States)

    Haddock, Michael H.; Anderson, Loren A.; Hosterman, K.; Decresie, E.; Miranda, P.; Hamilton, R.

    1989-01-01

    The optimized conceptual engineering design of a space station tethered elevator is presented. The tethered elevator is an unmanned, mobile structure which operates on a ten-kilometer tether spanning the distance between Space Station Freedom and a platform. Its capabilities include providing access to residual gravity levels, remote servicing, and transportation to any point along a tether. The report discusses the potential uses, parameters, and evolution of the spacecraft design. Emphasis is placed on the elevator's structural configuration and three major subsystem designs. First, the design of elevator robotics used to aid in elevator operations and tethered experimentation is presented. Second, the design of drive mechanisms used to propel the vehicle is discussed. Third, the design of an onboard self-sufficient power generation and transmission system is addressed.

  14. The International Space Station Habitat

    Science.gov (United States)

    Watson, Patricia Mendoza; Engle, Mike

    2003-01-01

    The International Space Station (ISS) is an engineering project unlike any other. The vehicle is inhabited and operational as it is constructed. The habitability resources available to the crew are the sleep quarters, the galley, the waste and hygiene compartment, and exercise equipment. These items are mainly in the Russian Service Module and their placement is awkward for the crew to use and work around. ISS assembly will continue with the truss build and the addition of the International Partner Laboratories. Prior to the addition of the International Partner Laboratories. Node 2 will be added. The Node 2 module will provide additional stowage volume and room for more crew sleep quarters. The purpose of the ISS is to perform research and a major area of emphasis is on the effects of long duration space flight on humans, as result of this research the habitability requirements for the International Space Station crews will be determined.

  15. Fortaleza Station Report for 2012

    Science.gov (United States)

    Kaufmann, Pierre; Pereira de Lucena, A. Macilio; Sombra da Silva, Adeildo

    2013-01-01

    This is a brief report about the activities carried out at the Fortaleza geodetic VLBI station (ROEN: R´adio Observat´orio Espacial do Nordeste), located in Eus´ebio, CE, Brazil, during the period from January until December 2012. The observing activities were resumed in May after the major maintenance that comprised the azimuth bearing replacement. The total observational experiments consisted of 103 VLBI sessions and continuous GPS monitoring recordings.

  16. Package power stations for export

    Energy Technology Data Exchange (ETDEWEB)

    1985-01-01

    The cheap and efficient generation of power is an essential requirement for the success and prosperity of any community and is especially important to third world countries. It is therefore logical that the more technologically advanced nations should seek to produce power stations for the developing countries. Power plant can now be designed into a packaged form that may be readily exported and commissioned. This valuable and interesting collection of papers were originally presented at a seminar organised by the Power Industries Division of the Institution of Mechanical Engineers. Topics considered include the developing world market for packaged power stations using indigenous fuels; multi-fuel systems for power generation; packaging, modularisation, and containerisation of equipment for power boilers for export; compact coal-fired industrial plant; rural woodburning power stations; biomass gasification based power generation technology and potential; gas fed reciprocating engine development; packaged heavy duty gas turbines for power generation; and criteria for assessing the appropriateness of package power technologies in developing countries.

  17. Do cities deserve more railway stations? The choice of a departure railway station in a multiple-station region

    NARCIS (Netherlands)

    Givoni, M.; Rietveld, P.

    2014-01-01

    Promoting the use of rail is an important element in sustainable transport policy. One of the most important decisions to make in planning the railway network is on the number of stations to provide. Stations are the access points to rail services and while each additional station increases rail's

  18. Open System of Agile Ground Stations Project

    Data.gov (United States)

    National Aeronautics and Space Administration — There is an opportunity to build the HETE-2/TESS network of ground stations into an innovative and powerful Open System of Agile Stations, by developing a low-cost...

  19. HSIP Fire Stations in New Mexico

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Fire Stations in New Mexico Any location where fire fighters are stationed or based out of, or where equipment that such personnel use in carrying out their jobs is...

  20. Determinants of physician empathy during medical education: hypothetical conclusions from an exploratory qualitative survey of practicing physicians

    Science.gov (United States)

    2014-01-01

    Background Empathy is an outcome-relevant physician characteristic and thus a crucial component of high-quality communication in health care. However, the factors that promote and inhibit the development of empathy during medical education have not been extensively researched. Also, currently there is no explicit research on the perspective of practicing physicians on the subject. Therefore the aim of our study was to explore physicians’ views of the positive and negative influences on the development of empathy during their medical education, as well as in their everyday work as physicians. Method We administered a written Qualitative Short Survey to 63 physicians in seven specialties. They were able to respond anonymously. Our open-ended question was: “What educational content in the course of your studies and/or your specialist training had a positive or negative effect on your empathy?” We analyzed the data using thematic content analysis following Mayring’s approach. Results Forty-two physicians took part in our survey. All together, they mentioned 68 specific factors (37 positive, 29 negative, 2 neutral) from which six themes emerged: 1. In general, medical education does not promote the development of empathy. 2. Recognizing the psycho-social dimensions of care fosters empathy. 3. Interactions with patients in medical practice promote empathy. 4. Physicians’ active self-development through reflective practice helps the development of empathy. 5. Interactions with colleagues can both promote and inhibit empathy through their role modeling of empathic and non-empathic behavior. 6. Stress, time pressure, and adverse working conditions are detrimental to empathy development. Conclusions Our results provide an overview of what might influence the development of clinical empathy, as well as hypothetical conclusions about how to promote it. Reflective practice seems to be lacking in current medical curricula and could be incorporated. Raising physicians

  1. 78 FR 67309 - Earth Stations Aboard Aircraft

    Science.gov (United States)

    2013-11-12

    ... COMMISSION 47 CFR Part 25 Earth Stations Aboard Aircraft AGENCY: Federal Communications Commission. ACTION... collection associated with the Commission's Earth Station Aboard Aircraft, Report and Order (Order), which adopted licensing and service rules for Earth Stations Aboard Aircraft (ESAA) communicating with Fixed...

  2. 47 CFR 97.207 - Space station.

    Science.gov (United States)

    2010-10-01

    ... space station licensee has assessed and limited the amount of debris released in a planned manner during... space station becoming a source of debris by collisions with large debris or other operational space... 47 Telecommunication 5 2010-10-01 2010-10-01 false Space station. 97.207 Section 97.207...

  3. 30 CFR 57.12085 - Transformer stations.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Transformer stations. 57.12085 Section 57.12085 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR METAL AND NONMETAL MINE... Underground Only § 57.12085 Transformer stations. Transformer stations shall be enclosed to prevent persons...

  4. 47 CFR 95.835 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... SERVICES 218-219 MHz Service System Requirements § 95.835 Station identification. No RTU or CTS is required to transmit a station identification announcement. ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 95.835 Section 95.835...

  5. 47 CFR 90.735 - Station identification.

    Science.gov (United States)

    2010-10-01

    ....735 Station identification. (a) Except for nationwide systems authorized in the 220-222 MHz band, station identification is required pursuant to § 90.425 of this part. (b) Trunked systems shall employ an... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 90.735 Section 90.735...

  6. 47 CFR 90.647 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 90.647 Section 90.647..., 851-869 Mhz, 896-901 Mhz, and 935-940 Mhz Bands § 90.647 Station identification. (a) Conventional... at 30 minute intervals. Such station identification shall be made on the lowest frequency in the base...

  7. 47 CFR 87.107 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 87.107 Section 87.107... Operating Requirements and Procedures Operating Procedures § 87.107 Station identification. (a) Aircraft... an airport to another location in that airport may be identified by a station identification...

  8. 47 CFR 101.213 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 101.213 Section 101.213 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES FIXED MICROWAVE SERVICES Operational Requirements § 101.213 Station identification. Stations in these services are exempt...

  9. 47 CFR 22.313 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station identification. 22.313 Section 22.313... Operational and Technical Requirements Operational Requirements § 22.313 Station identification. The licensee... identified in accordance with the requirements of this section. (a) Station identification is not required...

  10. Space teleoperations technology for Space Station evolution

    Science.gov (United States)

    Reuter, Gerald J.

    1990-01-01

    Viewgraphs on space teleoperations technology for space station evolution are presented. Topics covered include: shuttle remote manipulator system; mobile servicing center functions; mobile servicing center technology; flight telerobotic servicer-telerobot; flight telerobotic servicer technology; technologies required for space station assembly; teleoperation applications; and technology needs for space station evolution.

  11. The avian hippocampus and the hypothetical maps used by navigating migratory birds (with some reflection on compasses and migratory restlessness).

    Science.gov (United States)

    Bingman, Verner P; MacDougall-Shackleton, Scott A

    2017-07-01

    The homology between the avian hippocampal formation (HF) and mammalian hippocampus nurtures the expectation that HF plays a fundamental role in navigation by migratory birds. Indeed, HF of migratory birds displays anatomical properties that differ from non-migratory species. Using a hypothetical framework of multiple maps of differing spatial resolution and range, homing pigeon data suggest that HF is important for navigating by landscape features near familiar breeding, over-wintering, and stop-over sites. By contrast, HF would be unimportant for an olfactory navigational map, which could be operational over unfamiliar space farther away from a goal location, nor is there any evidence for HF involvement in the sun or geomagnetic compass. The most intriguing question that remains open is what role HF may play in navigation when a migrant is thousands kms away from a familiar area, where homing pigeon data are uninformative and a geomagnetic map may be operational. Beyond navigation, successful migration depends on seasonal timing and often becoming nocturnally active. There is little evidence that HF plays a role in the timing of circannual and circadian cycles. Rather, circadian pacemakers including the pineal gland may control circadian timing of nocturnal restlessness and photoperiodic seasonal pacemakers likely control circannual expression.

  12. Mitigating the heroin crisis in Baltimore, MD, USA: a cost-benefit analysis of a hypothetical supervised injection facility.

    Science.gov (United States)

    Irwin, Amos; Jozaghi, Ehsan; Weir, Brian W; Allen, Sean T; Lindsay, Andrew; Sherman, Susan G

    2017-05-12

    In Baltimore, MD, as in many cities throughout the USA, overdose rates are on the rise due to both the increase of prescription opioid abuse and that of fentanyl and other synthetic opioids in the drug market. Supervised injection facilities (SIFs) are a widely implemented public health intervention throughout the world, with 97 existing in 11 countries worldwide. Research has documented the public health, social, and economic benefits of SIFs, yet none exist in the USA. The purpose of this study is to model the health and financial costs and benefits of a hypothetical SIF in Baltimore. We estimate the benefits by utilizing local health data and data on the impact of existing SIFs in models for six outcomes: prevented human immunodeficiency virus transmission, Hepatitis C virus transmission, skin and soft-tissue infection, overdose mortality, and overdose-related medical care and increased medication-assisted treatment for opioid dependence. We predict that for an annual cost of $1.8 million, a single SIF would generate $7.8 million in savings, preventing 3.7 HIV infections, 21 Hepatitis C infections, 374 days in the hospital for skin and soft-tissue infection, 5.9 overdose deaths, 108 overdose-related ambulance calls, 78 emergency room visits, and 27 hospitalizations, while bringing 121 additional people into treatment. We conclude that a SIF would be both extremely cost-effective and a significant public health and economic benefit to Baltimore City.

  13. Projecting the impact of hypothetical early life interventions on adiposity in children living in low-income households.

    Science.gov (United States)

    Nianogo, Roch A; Wang, May C; Wang, Aolin; Nobari, Tabashir Z; Crespi, Catherine M; Whaley, Shannon E; Arah, Onyebuchi A

    2017-10-01

    It is difficult to evaluate the effectiveness of interventions aimed at reducing early childhood obesity using randomized trials. Objective To illustrate how observational data can be analysed using causal inference methods to estimate the potential impact of behavioural 'interventions' on early childhood adiposity. Methods We used longitudinal data from 1054 children 1-5 years old enrolled in the Special Supplemental Nutrition Program for Women, Infants and Children and followed (WIC) from 2008 to 2010 for a mean duration of 23 months. The data came from a random sample of WIC families living in Los Angeles County in 2008. We used the parametric g-formula to estimate the impact of various hypothetical behavioural interventions. Results Adjusted mean weight-for-height Z score at the end of follow-up was 0.73 (95% CI 0.65, 0.81) under no intervention and 0.63 (95% CI 0.38, 0.87) for all interventions given jointly. Exclusive breastfeeding for 6 months or longer was the most effective intervention [population mean difference = -0.11 (95% CI -0.22, 0.01)]. Other interventions had little or no effect. Conclusions Compared with interventions promoting healthy eating and physical activity behaviours, breastfeeding was more effective in reducing obesity risk in children aged 1-5 years. When carefully applied, causal inference methods may offer viable alternatives to randomized trials in etiologic and evaluation research. © 2016 World Obesity Federation.

  14. Calculation of isodose curves from initial neutron radiation of a hypothetical nuclear explosion using Monte Carlo Method

    Energy Technology Data Exchange (ETDEWEB)

    Medeiros, Marcos P.C.; Rebello, Wilson F.; Andrade, Edson R., E-mail: rebello@ime.eb.br, E-mail: daltongirao@yahoo.com.br [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil). Secao de Engenharia Nuclear; Silva, Ademir X., E-mail: ademir@nuclear.ufrj.br [Corrdenacao dos Programas de Pos-Graduacao em Egenharia (COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear

    2015-07-01

    Nuclear explosions are usually described in terms of its total yield and associated shock wave, thermal radiation and nuclear radiation effects. The nuclear radiation produced in such events has several components, consisting mainly of alpha and beta particles, neutrinos, X-rays, neutrons and gamma rays. For practical purposes, the radiation from a nuclear explosion is divided into {sup i}nitial nuclear radiation{sup ,} referring to what is issued within one minute after the detonation, and 'residual nuclear radiation' covering everything else. The initial nuclear radiation can also be split between 'instantaneous or 'prompt' radiation, which involves neutrons and gamma rays from fission and from interactions between neutrons and nuclei of surrounding materials, and 'delayed' radiation, comprising emissions from the decay of fission products and from interactions of neutrons with nuclei of the air. This work aims at presenting isodose curves calculations at ground level by Monte Carlo simulation, allowing risk assessment and consequences modeling in radiation protection context. The isodose curves are related to neutrons produced by the prompt nuclear radiation from a hypothetical nuclear explosion with a total yield of 20 KT. Neutron fluency and emission spectrum were based on data available in the literature. Doses were calculated in the form of ambient dose equivalent due to neutrons H*(10){sub n}{sup -}. (author)

  15. Neurolaw: Differential brain activity for black and white faces predicts damage awards in hypothetical employment discrimination cases.

    Science.gov (United States)

    Korn, Harrison A; Johnson, Micah A; Chun, Marvin M

    2012-07-01

    Currently, potential jurors' racial biases are measured by explicit questioning--a poor measure because people often hide their views to adhere to social norms, and people have implicit views they are not consciously aware of. In this experiment, we investigated whether two alternative methods of measuring racial bias--a standard black/white, good/bad implicit association test (IAT) and neural activity, measured by fMRI, in response to seeing faces of black and white individuals--could predict how much money subjects would award Black victims in hypothetical employment discrimination cases. IAT scores failed to predict how much money subjects awarded victims. However, in right inferior parietal lobule (BA 40) and in right superior/middle frontal gyrus (BA 9/10)--which have both previously been implicated in measuring biases and implicit preferences--the difference in neural activity between when subjects viewed black faces paired with neutral adjectives and when subjects viewed white faces paired with neutral adjectives was positively correlated with the amount of money the subjects awarded victims. This suggests that brain activity measures racial bias with more practical validity, at least in this situation and with our sample size, than a common behavioral measure (the IAT).

  16. Mental health literacy among young people in a small US town: recognition of disorders and hypothetical helping responses.

    Science.gov (United States)

    Olsson, Dudley P; Kennedy, May G

    2010-11-01

    Mental health literacy may be a factor in early detection and prompt treatment for mental, emotional and behavioural disorders among young people. Building on previous research in Australia, this study assessed aspects of mental health literacy among adolescents in classrooms in a small town in the eastern USA. The students were provided brief, hypothetical, gender-matched scenarios about adolescents experiencing negative emotions and exhibiting related behaviours; some scenarios depicted diagnosable disorders. The respondents were asked to characterize each scenario as describing a mental health problem or other teen problem and indicate how they would respond to a peer who had such a problem. Overall levels of recognition of mental disorders were low (27.5% identified anxiety and 42.4% identified depression as 'a mental health problem or illness'). However, the respondents who recognized a disorder were three to four times more likely than those who did not to say they would take some helping action, such as telling an adult about the problem (depression: odds ratio 3.27; CI 1.43-7.46, anxiety: OR 4.43; CI 2.23-8.79). Few students (27.7%) remembered in-class discussions of mental health, a mandated health topic for schools in their area. There appears to be substantial room for improvement in mental health literacy among young people, and the development of interventions to enhance mental health literacy among students may be justified. © 2010 Blackwell Publishing Asia Pty Ltd.

  17. Improving environmental assessments by integrating Species Sensitivity Distributions into environmental modeling: examples with two hypothetical oil spills.

    Science.gov (United States)

    Bejarano, Adriana C; Mearns, Alan J

    2015-04-15

    A three dimensional (3D) trajectory model was used to simulate oil mass balance and environmental concentrations of two 795,000 L hypothetical oil spills modeled under physical and chemical dispersion scenarios. Species Sensitivity Distributions (SSD) for Total Hydrocarbon Concentrations (THCs) were developed, and Hazard Concentrations (HC) used as levels of concern. Potential consequences to entrained water column organisms were characterized by comparing model outputs with SSDs, and obtaining the proportion of species affected (PSA) and areas with oil concentrations exceeding HC5s (Area ⩾ HC5). Under the physically-dispersed oil scenario ⩽ 77% of the oil remains on the water surface and strands on shorelines, while with the chemically-dispersed oil scenario ⩽ 67% of the oil is entrained in the water column. For every 10% increase in chemical dispersion effectiveness, the average PSA and Area ⩾ HC5 increases (range: 0.01-0.06 and 0.50-2.9 km(2), respectively), while shoreline oiling decreases (⩽ 2919 L/km). Integrating SSDs into modeling may improve understanding of scales of potential impacts to water column organisms, while providing net environmental benefit comparison of oil spill response options. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Altruistic reasoning in adolescent-parent dyads considering participation in a hypothetical sexual health clinical trial for adolescents.

    Science.gov (United States)

    Chávez, Noé Rubén; Williams, Camille Y; Ipp, Lisa S; Catallozzi, Marina; Rosenthal, Susan L; Breitkopf, Carmen Radecki

    2016-04-01

    Altruism is a well-established reason underlying research participation. Less is known about altruism in adolescent-parent decision-making about clinical trials enrolling healthy adolescents. This qualitative investigation focused on identifying spontaneous statements of altruism within adolescent-parent (dyadic) discussions of participation in a hypothetical phase I clinical trial related to adolescent sexual health. Content analysis revealed several response patterns to each other's altruistic reasoning. Across 70 adolescent-parent dyads in which adolescents were 14-17 years of age and 91% of their parents were mothers, a majority (61%) of dyadic discussions included a statement reflecting altruism. Parents responded to adolescents' statements of altruism more frequently than adolescents responded to parents' statements. Responses included: expresses concern, reiterates altruistic reasoning, agrees with altruistic reasoning, and adds to/expands altruistic reasoning. Since an altruistic perspective was often balanced with concerns about risk or study procedures, researchers cannot assume that altruism will directly lead to study participation. Optimizing the informed consent process for early phase clinical trials involving healthy adolescents may include supporting parents to have conversations with their adolescents which will enhance their capacity to consider all aspects of trial participation.

  19. Revealing the functionality of hypothetical protein KPN00728 from Klebsiella pneumoniae MGH78578: molecular dynamics simulation approaches

    Science.gov (United States)

    2011-01-01

    Background Previously, the hypothetical protein, KPN00728 from Klebsiella pneumoniae MGH78578 was the Succinate dehydrogenase (SDH) chain C subunit via structural prediction and molecular docking simulation studies. However, due to limitation in docking simulation, an in-depth understanding of how SDH interaction occurs across the transmembrane of mitochondria could not be provided. Results In this present study, molecular dynamics (MD) simulation of KPN00728 and SDH chain D in a membrane was performed in order to gain a deeper insight into its molecular role as SDH. Structural stability was successfully obtained in the calculation for area per lipid, tail order parameter, thickness of lipid and secondary structural properties. Interestingly, water molecules were found to be highly possible in mediating the interaction between Ubiquinone (UQ) and SDH chain C via interaction with Ser27 and Arg31 residues as compared with earlier docking study. Polar residues such as Asp95 and Glu101 (KPN00728), Asp15 and Glu78 (SDH chain D) might have contributed in the creation of a polar environment which is essential for electron transport chain in Krebs cycle. Conclusions As a conclusion, a part from the structural stability comparability, the dynamic of the interacting residues and hydrogen bonding analysis had further proved that the interaction of KPN00728 as SDH is preserved and well agreed with our postulation earlier. PMID:22372825

  20. Real and hypothetical endowment effects when exchanging lottery tickets: Is regret a better explanation than loss aversion?☆

    Science.gov (United States)

    Kogler, Christoph; Kühberger, Anton; Gilhofer, Rainer

    2013-01-01

    The endowment effect is the finding that possession of an item adds to its value. We introduce a new procedure for testing this effect: participants are divided into two groups. Possession group participants inspect a numbered lottery ticket and know it is theirs, while inspection group participants only inspect a lottery ticket without being endowed with it. Subsequently participants choose between playing the lottery with this (possessed or inspected) ticket, or exchanging it for another one. Our procedure tests for the effect of endowment while controlling for the influence of transaction costs as well as for inspection effects and the influence of bargaining roles (buyer vs. seller), which often afflict experimentation with the endowment effect. In a real setting, tickets in possession were valued significantly higher than inspected tickets. Contrary to some findings in the literature participants also correctly predicted these valuation differences in a hypothetical situation, both for themselves as well as for others. Furthermore, our results suggest that regret rather than loss aversion may be the source of the endowment effect in an experimental setting using lottery tickets. Applying our procedure to a setting employing riskless objects in form of mugs revealed rather ambiguous results, thus emphasizing that the role of regret might be less prominent in non-lottery settings. PMID:23913998

  1. Real and hypothetical endowment effects when exchanging lottery tickets: Is regret a better explanation than loss aversion?

    Science.gov (United States)

    Kogler, Christoph; Kühberger, Anton; Gilhofer, Rainer

    2013-08-01

    The endowment effect is the finding that possession of an item adds to its value. We introduce a new procedure for testing this effect: participants are divided into two groups. Possession group participants inspect a numbered lottery ticket and know it is theirs, while inspection group participants only inspect a lottery ticket without being endowed with it. Subsequently participants choose between playing the lottery with this (possessed or inspected) ticket, or exchanging it for another one. Our procedure tests for the effect of endowment while controlling for the influence of transaction costs as well as for inspection effects and the influence of bargaining roles (buyer vs. seller), which often afflict experimentation with the endowment effect. In a real setting, tickets in possession were valued significantly higher than inspected tickets. Contrary to some findings in the literature participants also correctly predicted these valuation differences in a hypothetical situation, both for themselves as well as for others. Furthermore, our results suggest that regret rather than loss aversion may be the source of the endowment effect in an experimental setting using lottery tickets. Applying our procedure to a setting employing riskless objects in form of mugs revealed rather ambiguous results, thus emphasizing that the role of regret might be less prominent in non-lottery settings.

  2. N-glycans released from glycoproteins using a commercial kit and comprehensively analyzed with a hypothetical database

    Directory of Open Access Journals (Sweden)

    Xue Sun

    2017-04-01

    Full Text Available The glycosylation of proteins is responsible for their structural and functional roles in many cellular activities. This work describes a strategy that combines an efficient release, labeling and liquid chromatography-mass spectral analysis with the use of a comprehensive database to analyze N-glycans. The analytical method described relies on a recently commercialized kit in which quick deglycosylation is followed by rapid labeling and cleanup of labeled glycans. This greatly improves the separation, mass spectrometry (MS analysis and fluorescence detection of N-glycans. A hypothetical database, constructed using GlycResoft, provides all compositional possibilities of N-glycans based on the common sugar residues found in N-glycans. In the initial version this database contains >8,700 N-glycans, and is compatible with MS instrument software and expandable. N-glycans from four different well-studied glycoproteins were analyzed by this strategy. The results provided much more accurate and comprehensive data than had been previously reported. This strategy was then used to analyze the N-glycans present on the membrane glycoproteins of gastric carcinoma cells with different degrees of differentiation. Accurate and comprehensive N-glycan data from those cells was obtained efficiently and their differences compared corresponding to their differentiation states. Thus, the novel strategy developed greatly improves accuracy, efficiency and comprehensiveness of N-glycan analysis.

  3. Neutron proton crystallography station (PCS)

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, Zoe [Los Alamos National Laboratory; Kovalevsky, Andrey [Los Alamos National Laboratory; Johnson, Hannah [Los Alamos National Laboratory; Mustyakimov, Marat [Los Alamos National Laboratory

    2009-01-01

    The PCS (Protein Crystallography Station) at Los Alamos Neutron Science Center (LANSCE) is a unique facility in the USA that is designed and optimized for detecting and collecting neutron diffraction data from macromolecular crystals. PCS utilizes the 20 Hz spallation neutron source at LANSCE to enable time-of-flight measurements using 0.6-7.0 {angstrom} neutrons. This increases the neutron flux on the sample by using a wavelength range that is optimal for studying macromolecular crystal structures. The diagram below show a schematic of PCS and photos of the detector and instrument cave.

  4. Space Station Electrical Power System

    Science.gov (United States)

    Labus, Thomas L.; Cochran, Thomas H.

    1987-01-01

    The purpose of this paper is to describe the design of the Space Station Electrical Power System. This includes the Photovoltaic and Solar Dynamic Power Modules as well as the Power Management and Distribution System (PMAD). In addition, two programmatic options for developing the Electrical Power System will be presented. One approach is defined as the Enhanced Configuration and represents the results of the Phase B studies conducted by the NASA Lewis Research Center over the last two years. Another option, the Phased Program, represents a more measured approach to reaching about the same capability as the Enhanced Configuration.

  5. Arduino adventures escape from Gemini station

    CERN Document Server

    Kelly, James Floyd

    2013-01-01

    Arduino Adventures: Escape from Gemini Station provides a fun introduction to the Arduino microcontroller by putting you (the reader) into the action of a science fiction adventure story.  You'll find yourself following along as Cade and Elle explore Gemini Station-an orbiting museum dedicated to preserving and sharing technology throughout the centuries. Trouble ensues. The station is evacuated, including Cade and Elle's class that was visiting the station on a field trip. Cade and Elle don't make it aboard their shuttle and are trapped on the station along with a friendly artificial intellig

  6. Endorsement of Interpersonal Strategies for Dealing with Hypothetical Everyday Arthritis Problems as a Function of Marital Status, Gender, and Problem Severity

    Science.gov (United States)

    Strough, Jonell; McFall, Joseph P.; Schuller, Kelly L.

    2010-01-01

    We used hypothetical vignettes to examine whether older adults' endorsement of interpersonal strategies for dealing with health-related (arthritis) everyday problems varied as a function of marital status, gender, and the severity of the problem. Adults 60 years and older (N= 127, M= 71.40 years, SD = 7.21) rated interpersonal (i.e., discuss with…

  7. Attributions of Responsibility in a Child Sexual Abuse (CSA) Vignette among Respondents with CSA Histories: The Role of Abuse Similarity to a Hypothetical Victim

    Science.gov (United States)

    Harding, Hilary G.; Zinzow, Heidi M.; Burns, Erin E.; Jackson, Joan L.

    2010-01-01

    Previous research suggests that similarity to a victim may influence attributions of responsibility in hypothetical child sexual abuse scenarios. One aspect of similarity receiving mixed support in the literature is respondent child sexual abuse history. Using a sample of 1,345 college women, the present study examined child sexual abuse history,…

  8. Imagined Contact Improves Intentions towards a Hypothetical Peer with Asperger Syndrome but Not Attitudes towards Peers with Asperger Syndrome in General

    Science.gov (United States)

    Fleva, Eleni

    2015-01-01

    The aim of this study is twofold. First, to investigate whether the imagined contact method (an indirect method of contact) can improve behavioural intentions towards a hypothetical peer with Asperger syndrome (AS). Second, to test whether the effect of the method can be generalised on attitudes towards young people with AS in general.…

  9. Do children do what they say? Responses to hypothetical and real-life social problems in children with mild intellectual disabilities and behaviour problems

    NARCIS (Netherlands)

    van Nieuwenhuijzen, M; Bijman, ER; Lamberix, ICW; Wijnroks, L; de Castro, BO; Vermeer, A; Matthys, W

    Background Most research on children's social problem-solving skills is based on responses to hypothetical vignettes. Just how these responses relate to actual behaviour in real-life social situations is, however, unclear, particularly for children with mild intellectual disabilities (MID). Method

  10. Early cost-utility analysis of general and cerebrospinal fluid-specific Alzheimer's disease biomarkers for hypothetical disease-modifying treatment decision in mild cognitive impairment

    NARCIS (Netherlands)

    Handels, Ron L. H.; Joore, Manuela A.; Tran-Duy, An; Wimo, Anders; Wolfs, Claire A. G.; Verhey, Frans R. J.; Severens, Johan L.

    Introduction: The study aimed to determine the room for improvement of a perfect cerebrospinal fluid (CSF) biomarker and the societal incremental net monetary benefit of CSF in subjects with mild cognitive impairment (MCI) assuming a hypothetical disease-modifying Alzheimer's disease (AD) treatment.

  11. Space station operating system study

    Science.gov (United States)

    Horn, Albert E.; Harwell, Morris C.

    1988-01-01

    The current phase of the Space Station Operating System study is based on the analysis, evaluation, and comparison of the operating systems implemented on the computer systems and workstations in the software development laboratory. Primary emphasis has been placed on the DEC MicroVMS operating system as implemented on the MicroVax II computer, with comparative analysis of the SUN UNIX system on the SUN 3/260 workstation computer, and to a limited extent, the IBM PC/AT microcomputer running PC-DOS. Some benchmark development and testing was also done for the Motorola MC68010 (VM03 system) before the system was taken from the laboratory. These systems were studied with the objective of determining their capability to support Space Station software development requirements, specifically for multi-tasking and real-time applications. The methodology utilized consisted of development, execution, and analysis of benchmark programs and test software, and the experimentation and analysis of specific features of the system or compilers in the study.

  12. International Space Station technology demonstrations

    Science.gov (United States)

    Holt, Alan C.

    1998-01-01

    The International Space Station (ISS) has the capability to test and demonstrate, and otherwise assist in the development and validation, of a wide range of advanced technologies. Technology tests and demonstrations for advanced communication systems, closed-loop environmental control systems, advanced power storage and generation systems, advanced electric and electromagnetic propulsion systems, and others are being assessed for inclusion in an ISS Pre-Planned Program Improvement (P3I), Technology/Improvement Roadmap. The P3I roadmap is an integrated set of technology and improvement requirements for: (1) ISS subsystem upgrades and improvements (addressing maintenance, logistics, sustainability, and enhancement functions), (2) payload hardware technology infusion, (3) ISS/Exploration technology development and tests (dual use/benefits), and (4) Engineering Research and Technology payloads. As examples of the International Space Station's technology testbed capabilities, implementation approaches for three types of propulsion technology demonstrations and research are described: (1) electric and electromagnetic propulsion technologies and systems (NASA Lewis Research Center), (2) technologies and sub-systems for a variable specific impulse (Isp), magnetoplasma rocket (VASIMR), (Advanced Propulsion Lab, Sonny Carter Training Facility, Houston, Tx), and (3) candidates for innovative, deep space propulsion technology research and demonstrations (projections based on NASA Advanced Space Transportation Program, Propulsion Research and other R.&D activities.).

  13. Testing EDM of Total Stations

    Directory of Open Access Journals (Sweden)

    Cirbus Ján

    2001-03-01

    Full Text Available The paper is devoted to testing electrooptical distance measuring devices (EDM built in total stations, than can be used for various tasks in the contemporary geodetic works. A rich market offer and availability of these universal measuring systems with satisfying distance range, excellent accuracy and other parameters, make total stations as dominant terrestrial geodetic instruments.For succesfully applying these instruments, above all for relliable distance measurements, the stability of the modulation frequency is the most important pre-condition. In the article, therefore, there are given some methods to verify the modulation frequency stability. In addition, some ways for determining the EDM distance constant and periodical corrections of the phase measuring unit are introduced for 4 types of EDM : LEICA 1700L, TOPCON GTS6A, TOPCON GTS2, C.ZEISS ELTA50. It were also investigated their possibilities for precise distance survey. Values of the determined constants and periodical corrections are presented in Tab. 2.Based on the investigation results of the 4 EDM types and using the values m obtained for different distances S, equations of the a posteriori standard deviations in form : m = (a+b.S were derived too.

  14. International Space Station: Expedition 2000

    Science.gov (United States)

    2000-01-01

    Live footage of the International Space Station (ISS) presents an inside look at the groundwork and assembly of the ISS. Footage includes both animation and live shots of a Space Shuttle liftoff. Phil West, Engineer; Dr. Catherine Clark, Chief Scientist ISS; and Joe Edwards, Astronaut, narrate the video. The first topic of discussion is People and Communications. Good communication is a key component in our ISS endeavor. Dr. Catherine Clark uses two soup cans attached by a string to demonstrate communication. Bill Nye the Science Guy talks briefly about science aboard the ISS. Charlie Spencer, Manager of Space Station Simulators, talks about communication aboard the ISS. The second topic of discussion is Engineering. Bonnie Dunbar, Astronaut at Johnson Space Flight Center, gives a tour of the Japanese Experiment Module (JEM). She takes us inside Node 2 and the U.S. Lab Destiny. She also shows where protein crystal growth experiments are performed. Audio terminal units are used for communication in the JEM. A demonstration of solar arrays and how they are tested is shown. Alan Bell, Project Manager MRMDF (Mobile Remote Manipulator Development Facility), describes the robot arm that is used on the ISS and how it maneuvers the Space Station. The third topic of discussion is Science and Technology. Dr. Catherine Clark, using a balloon attached to a weight, drops the apparatus to the ground to demonstrate Microgravity. The bursting of the balloon is observed. Sherri Dunnette, Imaging Technologist, describes the various cameras that are used in space. The types of still cameras used are: 1) 35 mm, 2) medium format cameras, 3) large format cameras, 4) video cameras, and 5) the DV camera. Kumar Krishen, Chief Technologist ISS, explains inframetrics, infrared vision cameras and how they perform. The Short Arm Centrifuge is shown by Dr. Millard Reske, Senior Life Scientist, to subject astronauts to forces greater than 1-g. Reske is interested in the physiological effects of

  15. STRUVE arc and EUPOS® stations

    Science.gov (United States)

    Lasmane, Ieva; Kaminskis, Janis; Balodis, Janis; Haritonova, Diana

    2013-04-01

    The Struve Geodetic Arc was developed in Years 1816 to 1855, 200 years ago. Historic information on the points of the Struve Geodetic Arc are included in the UNESCO World Heritage list in 2005. Nevertheless, the sites of many points are still not identified nor included in the data bases nowadays. Originally STRUVE arc consisted of 258 main triangles with 265 triangulation points. Currently 34 of the original station points are identified and included in the in the UNESCO World Heritage list. identified original measurement points of the Meridian Arc are located in Sweden (7 points), Norway (15), Finland (83), Russia (1), Estonia (22), Latvia (16), Lithuania (18), Belorussia (28), Ukraine (59) and Moldova (27). In Year 2002 was initiated another large coverage project - European Position Determination System "EUPOS®". Currently there are about 400 continuously operating GNSS (Global Navigation Satellite Systems) stations covering EU countries Estonia, Latvia, Lithuania, Poland, Czech Republic, Slovakia, Hungary, Bulgaria, Romania and East European countries Ukraine and Moldavia. EUPOS® network is a ground based GNSS augmentation system widely used for geodesy, land surveying, geophysics and navigation. It gives the opportunity for fast and accurate position determination never available before. It is an honorable task to use the EUPOS® system for research of the Struve triangulation former sites. Projects with Struve arc can popularize geodesy, geo-information and its meaning in nowadays GIS and GNSS systems. Struve Arc and its points is unique cooperation cross-border object which deserve special attention because of their natural beauty and historical value for mankind. GNSS in geodesy discovers a powerful tool for the verification and validation of the height values of geodetic leveling benchmarks established historically almost 200 years ago. The differential GNSS and RTK methods appear very useful to identify vertical displacement of landscape by means of

  16. Estimates of immediate effects on world markets of a hypothetical disruption to Russia’s supply of six mineral commodities

    Science.gov (United States)

    Safirova, Elena; Barry, James J.; Hastorun, Sinan; Matos, Grecia R.; Perez, Alberto Alexander; Bedinger, George M.; Bray, E. Lee; Jasinski, Stephen M.; Kuck, Peter H.; Loferski, Patricia J.

    2017-05-18

    The potential immediate effects of a hypothetical shock to Russia’s supply of selected mineral commodities on the world market and on individual countries were determined and monetized (in 2014 U.S. dollars). The mineral commodities considered were aluminum (refined primary), nickel (refined primary), palladium (refined) and platinum (refined), potash, and titanium (mill products), and the regions and countries of primary interest were the United States, the European Union (EU–28), and China. The shock is assumed to have infinite duration, but only the immediate effects, those limited by a 1-year period, are considered.A methodology for computing and monetizing the potential impacts was developed. Then the data pertaining to all six mineral commodities were collected and the most likely effects were computed. Because of the uncertainties associated with some of the data, sensitivity analyses were conducted to confirm the validity of the results.Results indicate that the impact on the United States arising from a shock to Russia’s supply, in terms of the value of net exports, would range from a gain of \\$336 million for titanium mill products to a loss of \\$237 million for potash; thus, the overall effect of a supply shock is likely to be quite modest. The study also demonstrates that, taken alone, Russia’s share in the world production of a particular commodity is not necessarily indicative of the size of potential impacts resulting from a supply shock; other factors, such as prices, domestic production, and the structure of international commodity flows were found to be important as well.

  17. Hypothetical Rectal Microbicide Acceptability and Factors Influencing It among Men Who Have Sex with Men in Tianjin, China.

    Directory of Open Access Journals (Sweden)

    Guohong Zhang

    Full Text Available To measure potential acceptability of rectal microbicides and to explore factors likely to affect their acceptability among men who have sex with men (MSM.Cross-sectional and retrospective surveys were conducted in this study. A questionnaire and a scale were used to measure the acceptability score for physical and functional characteristics of hypothetical rectal microbicides. We also evaluated the involvement of other factors such as sexual behaviors, social context, etc.MSMs we interviewed showed a high acceptability to rectal microbicides, indicated by the mean acceptability score of 2.92 (SD, 0.54, scale of 1-4. The results also suggested that microbicides were preferred in a cream form that can moisten and lubricate the rectum, prevent HIV infection and go unnoticed by their partners. Multivariate analysis showed that the microbicides acceptability varied significantly by education level (β = 0.135; P = 0.028, having casual partners (β = 0.174; P = 0.007, frequency of lubricant use (β = 0.134; P = 0.031, history of HIV test (β = 0.129; P = 0.036, willingness to use lubricant (β = 0.126; P = 0.045, locus of control by partners regarding STI infection (β = 0.168; P = 0.009.A positive response to rectal microbicides among MSMs was found in our study, suggesting that rectal microbicides might have a potential market in MSMs and they might play an important role in HIV/STIs prevention as a supplement. Further studies may be considered to combine the acceptability study with clinical research together to understand the true feelings of MSMs when they use the products.

  18. Patients' attitudes towards generic substitution of oral atypical antipsychotics: a questionnaire-based survey in a hypothetical pharmacy setting.

    Science.gov (United States)

    Roman, Beatriz

    2009-08-01

    Generic atypical antipsychotics in tablet form differ in name, appearance and packaging from the innovator brand antipsychotics. These differences might cause anxiety, confusion and misperceptions in some ambulant patients with psychoses/schizophrenia, especially if the brand atypical antipsychotic is substituted in the pharmacy without the acknowledgement of the patient and treating psychiatrist. Furthermore, generic substitution of branded oral atypical antipsychotics in the pharmacy might cause nonadherence and potentially lead to suboptimal treatment outcomes if patients perceive the medicines to be clinically different. To determine the attitudes of patients with psychoses/schizophrenia towards generic substitution of oral atypical antipsychotics in a pharmacy setting. A total of 106 ambulant patients with psychoses/schizophrenia currently taking an oral atypical antipsychotic (risperidone [Risperdal], olanzapine [Zyprexa], quetiapine [Seroquel] or aripiprazole [Abilify]) were confronted with generic substitution in a hypothetical pharmacy setting.Two conditions were used: one granting patients a short explanation about the substitution, and one without explanation. Patients' attitudes towards the generic substitution were assessed using a combined quantitative and qualitative design. Of the respondents, 73% stated that they would be unlikely to take a generic antipsychotic if their pharmacist were to substitute it. Providing patients with a short explanation had a significantly positive effect on their intention to take a generic version; however, overall, the patients' intention to take the generic antipsychotic lay well below a neutral midpoint. Patients with psychoses/schizophrenia using atypical antipsychotics in tablet form perceive generic versions of their antipsychotics as being significantly different. This perceived difference lowers their intention of continuing to take the medication, thus possibly jeopardizing treatment outcome. Caution with the

  19. Local anesthetic failure associated with inflammation: verification of the acidosis mechanism and the hypothetic participation of inflammatory peroxynitrite

    Directory of Open Access Journals (Sweden)

    Takahiro Ueno

    2008-11-01

    .Keywords: inflammatory acidosis, local anesthetic failure, membrane lipid interaction, hypothetic mechanism, inflammatory peroxynitrite

  20. Feasibility Analysis and Simulation of Integrated Renewable Energy System for Power Generation: A Hypothetical Study of Rural Health Clinic

    Directory of Open Access Journals (Sweden)

    Vincent Anayochukwu Ani

    2015-01-01

    Full Text Available This paper presents the feasibility analysis and study of integrated renewable energy (IRE using solar photovoltaic (PV and wind turbine (WT system in a hypothetical study of rural health clinic in Borno State, Nigeria. Electrical power consumption and metrology data (such as solar radiation and wind speed were used for designing and analyzing the integrated renewable energy system. The health clinic facility energy consumption is 19 kWh/day with a 3.4 kW peak demand load. The metrological data was collected from National Aeronautics and Space Administration (NASA website and used to analyze the performance of electrical generation system using HOMER program. The simulation and optimization results show that the optimal integrated renewable energy system configuration consists of 5 kW PV array, BWC Excel-R 7.5 kW DC wind turbine, 24 unit Surrette 6CS25P battery cycle charging, and a 19 kW AC/DC converter and that the PV power can generate electricity at 9,138 kWh/year while the wind turbine system can generate electricity at 7,490 kWh/year, giving the total electrical generation of the system as 16,628 kWh/year. This would be suitable for deployment of 100% clean energy for uninterruptable power performance in the health clinic. The economics analysis result found that the integrated renewable system has total NPC of 137,139 US Dollar. The results of this research show that, with a low energy health facility, it is possible to meet the entire annual energy demand of a health clinic solely through a stand-alone integrated renewable PV/wind energy supply.

  1. Attributions of Blame in a Hypothetical Child Sexual Abuse Case: Roles of Behavior Problems and Frequency of Abuse.

    Science.gov (United States)

    Theimer, Kate; Hansen, David J

    2017-06-01

    Youth who are blamed for their sexual abuse may experience increased negative outcomes, such as amplified self-blame. Similarly, blaming nonoffending parents can impede their ability to support their child following disclosure. Understanding the factors that influence how people perceive victim, caregiver, and perpetrator responsibility is imperative for the protection and treatment of families who have experienced sexual abuse. Little research has explored victim and abuse characteristics that influence the perception of sexual abuse. As such, the purpose of this study was to examine the roles of behavior problems and frequency of abuse in the attribution of blame in a hypothetical sexual abuse case. In addition, the relationship between several respondent characteristics and assignment of responsibility were explored as secondary aims. The study used a two (behavior problems: three suspensions in one school semester vs. no mention of behavior problems) by two (one abuse occurrence vs. five abuse occurrences) between-subjects design. Seven hundred forty-two participants read one of the four child sexual abuse (CSA) vignettes and completed measures related to responsibility. ANOVAs revealed those who read a vignette where the youth experienced multiple abuse incidents rated the victim as more responsible regardless of whether or not the youth was described as having behavior problems. Results indicate that respondents may have attributed more blame to the victim due to the belief that she could have done something to stop the abuse after the first incident. The abuse frequency manipulation when combined with the behavior manipulation appeared to relate to how respondents perceived the victim's parents. Males and younger respondents attributed more blame to the victim; however, sexual abuse or assault history did not associate with victim responsibility ratings. Clinical and research implications were discussed.

  2. Respiratory support withdrawal in intensive care units: families, physicians and nurses views on two hypothetical clinical scenarios.

    Science.gov (United States)

    Fumis, Renata R L; Deheinzelin, Daniel

    2010-01-01

    Evidence suggests that dying patients' physical and emotional suffering is inadequately treated in intensive care units. Although there are recommendations regarding decisions to forgo life-sustaining therapy, deciding on withdrawal of life support is difficult, and it is also difficult to decide who should participate in this decision. We distributed a self-administered questionnaire in 13 adult intensive care units (ICUs) assessing the attitudes of physicians and nurses regarding end-of-life decisions. Family members from a medical-surgical ICU in a tertiary cancer hospital were also invited to participate. Questions were related to two hypothetical clinical scenarios, one with a competent patient and the other with an incompetent patient, asking whether the ventilator treatment should be withdrawn and about who should make this decision. Physicians (155) and nurses (204) of 12 ICUs agreed to take part in this study, along with 300 family members. The vast majority of families (78.6%), physicians (74.8%) and nurses (75%) want to discuss end-of-life decisions with competent patients. Most of the physicians and nurses desire family involvement in end-of-life decisions. Physicians are more likely to propose withdrawal of the ventilator with competent patients than with incompetent patients (74.8% × 60.7%, P = 0.028). When the patient was incompetent, physicians (34.8%) were significantly less prone than nurses (23.0%) and families (14.7%) to propose decisions regarding withdrawal of the ventilator support (P families recommended limiting life-support therapy with terminally ill patients and favored family participation. In decisions concerning an incompetent patient, physicians were more likely to maintain the therapy.

  3. Long term contaminant migration and impacts from uranium mill tailings. Comparison of computer models using a hypothetical dataset

    Energy Technology Data Exchange (ETDEWEB)

    Camus, H. [CEA Centre d' Etudes Nucleaires de Fontenay-aux-Roses (France). Inst. de Protection et de Surete Nucleaire] [and others

    1995-11-01

    The Uranium Mill Tailings Working Group of BIOMOVS II was initiated in Vienna in 1991 with the primary objective of comparing models which can be used to assess the long term impact of radioactive releases from uranium mill tailings, involving multiple pathways, multiple contaminants and multiple environmental receptors. A secondary objective was to examine how these models can be used to assess the fate of stable toxic elements. This is an interim report of the Working Group describing: development of a basic scenario describing a tailings system; application of models in deterministic calculations of contaminant concentrations in biosphere media, and related radiation doses, contaminant intakes and health risks; comparison of model results and review of the modelling. A hypothetical scenario has been developed for contaminant releases from a uranium mill tailings facility. The assumptions for the tailings facility and its environs have been chosen to facilitate the evaluation of potentially important processes incorporated into models. The site description is therefore idealised and does not represent any particular facility or type of facility. Atmospheric and groundwater release source terms have been chosen to facilitate comparison of models and should not be considered realistic. The time and effort taken over derivation of the scenario description and the associated preliminary modelling has been an important and valuable learning exercise. It also reflects the importance of gaining a clear picture of what is being modelled so that comparisons of model results are meaningful. Work within the exercise has contributed to new model development and to improvements and extensions to existing models. The scenario is a simplified description of a real facility and the releases which might occur. No allowance has been made for engineered features on the tailings disposal system which might reduce releases. The source terms have been chosen so as to test the models

  4. The US Space Station programme

    Science.gov (United States)

    Hodge, J. D.

    1985-01-01

    The Manned Space Station (MSS) involves NASA, and other countries, in the operation, maintenance and expansion of a permanent space facility. The extensive use of automation and robotics will advance those fields, and experimentation will be carried out in scientific and potentially commercial projects. The MSS will provide a base for astronomical observations, spacecraft assembly, refurbishment and repair, transportation intersection, staging for interplanetary exploration, and storage. Finally, MSS operations will be performed semi-autonomously from ground control. Phase B analysis is nearing completion, and precedes hardware development. Studies are being performed on generic advanced technologies which can reliably and flexibly be incorporated into the MSS, such as attitude control and stabilization, power, thermal, environmental and life support control, auxiliary propulsion, data management, etc. Guidelines are also being formulated regarding the areas of participation by other nations.

  5. Space Station Biological Research Project

    Science.gov (United States)

    Johnson, Catherine C.; Hargens, Alan R.; Wade, Charles E.

    1995-01-01

    NASA Ames Research Center is responsible for the development of the Space Station Biological Research Project (SSBRP) which will support non-human life sciences research on the International Space Station Alpha (ISSA). The SSBRP is designed to support both basic research to understand the effect of altered gravity fields on biological systems and applied research to investigate the effects of space flight on biological systems. The SSBRP will provide the necessary habitats to support avian and reptile eggs, cells and tissues, plants and rodents. In addition a habitat to support aquatic specimens will be provided by our international partners. Habitats will be mounted in ISSA compatible racks at u-g and will also be mounted on a 2.5 m diameter centrifuge except for the egg incubator which has an internal centrifuge. The 2.5 m centrifuge will provide artificial gravity levels over the range of 0.01 G to 2 G. The current schedule is to launch the first rack in 1999, the Life Sciences glovebox and a second rack early in 2001, a 4 habitat 2.5 in centrifuge later the same year in its own module, and to upgrade the centrifuge to 8 habitats in 2004. The rodent habitats will be derived from the Advanced Animal Habitat currently under development for the Shuttle program and will be capable of housing either rats or mice individually or in groups (6 rats/group and at least 12 mice/group). The egg incubator will be an upgraded Avian Development Facility also developed for the Shuttle program through a Small Business and Innovative Research grant. The Space Tissue Loss cell culture apparatus, developed by Walter Reed Army Institute of Research, is being considered for the cell and tissue culture habitat. The Life Sciences Glovebox is crucial to all life sciences experiments for specimen manipulation and performance of science procedures. It will provide two levels of containment between the work volume and the crew through the use of seals and negative pressure. The glovebox

  6. Station Program Note Pull Automation

    Science.gov (United States)

    Delgado, Ivan

    2016-01-01

    Upon commencement of my internship, I was in charge of maintaining the CoFR (Certificate of Flight Readiness) Tool. The tool acquires data from existing Excel workbooks on NASA's and Boeing's databases to create a new spreadsheet listing out all the potential safety concerns for upcoming flights and software transitions. Since the application was written in Visual Basic, I had to learn a new programming language and prepare to handle any malfunctions within the program. Shortly afterwards, I was given the assignment to automate the Station Program Note (SPN) Pull process. I developed an application, in Python, that generated a GUI (Graphical User Interface) that will be used by the International Space Station Safety & Mission Assurance team here at Johnson Space Center. The application will allow its users to download online files with the click of a button, import SPN's based on three different pulls, instantly manipulate and filter spreadsheets, and compare the three sources to determine which active SPN's (Station Program Notes) must be reviewed for any upcoming flights, missions, and/or software transitions. Initially, to perform the NASA SPN pull (one of three), I had created the program to allow the user to login to a secure webpage that stores data, input specific parameters, and retrieve the desired SPN's based on their inputs. However, to avoid any conflicts with sustainment, I altered it so that the user may login and download the NASA file independently. After the user has downloaded the file with the click of a button, I defined the program to check for any outdated or pre-existing files, for successful downloads, to acquire the spreadsheet, convert it from a text file to a comma separated file and finally into an Excel spreadsheet to be filtered and later scrutinized for specific SPN numbers. Once this file has been automatically manipulated to provide only the SPN numbers that are desired, they are stored in a global variable, shown on the GUI, and

  7. UK 2009-2010 repeat station report

    Directory of Open Access Journals (Sweden)

    Thomas J.G. Shanahan

    2013-03-01

    Full Text Available The British Geological Survey is responsible for conducting the UK geomagnetic repeat station programme. Measurements made at the UK repeat station sites are used in conjunction with the three UK magnetic observatories: Hartland, Eskdalemuir and Lerwick, to produce a regional model of the local field each year. The UK network of repeat stations comprises 41 stations which are occupied at approximately 3-4 year intervals. Practices for conducting repeat station measurements continue to evolve as advances are made in survey instrumentation and as the usage of the data continues to change. Here, a summary of the 2009 and 2010 UK repeat station surveys is presented, highlighting the measurement process and techniques, density of network, reduction process and recent results.

  8. Raising the AIQ of the Space Station

    Science.gov (United States)

    Lum, Henry; Heer, Ewald

    1987-01-01

    Expert systems and robotics technologies are to be significantly advanced during the Space Station program. Artificial intelligence systems (AI) on the Station will include 'scars', which will permit upgrading the AI capabilities as the Station evolves to autonomy. NASA-Ames is managing the development of the AI systems through a series of demonstrations, the first, controlling a single subsystem, to be performed in 1988. The capabilities being integrated into the first demonstration are described; however, machine learning and goal-driven natural language understanding will not reach a prototype stage until the mid-1990s. Steps which will be taken to endow the computer systems with the ability to move from heuristic reasoning to factual knowledge, i.e., learning from experience, are explored. It is noted that the development of Space Station expert systems depends on the development of experts in Station operations, which will not happen until the Station has been used extensively by crew members.

  9. Sediment Quality Characterization Naval Station San Diego

    Science.gov (United States)

    1999-01-01

    silversides (Menidia beryllina), the bioluminescent dinoflagellate (Gonyaulax polyhedra), the bioluminescent bacteria (Photo- I bacterium phosphoreum ), and...also observed in the diatom at Stations NSB-2, NSB-4, and NSB-5. None of the station sediments produced an IC50 in the bacteria Photobacterium ... phosphoreum (Microtox), 42 while IC 0,,, were observed in the dinoflagellate Gonyaulax polyhedra (QwikSed) at all six stations. Figures 15 through 17 are

  10. Space Station end effector strategy study

    Science.gov (United States)

    Katzberg, Stephen J.; Jensen, Robert L.; Willshire, Kelli F.; Satterthwaite, Robert E.

    1987-01-01

    The results of a study are presented for terminology definition, identification of functional requirements, technolgy assessment, and proposed end effector development strategies for the Space Station Program. The study is composed of a survey of available or under-developed end effector technology, identification of requirements from baselined Space Station documents, a comparative assessment of the match between technology and requirements, and recommended strategies for end effector development for the Space Station Program.

  11. METALLOGRAPHIC SAMPLE PREPARATION STATION-CONSTRUCTIVE CONCEPT

    Directory of Open Access Journals (Sweden)

    AVRAM Florin Timotei

    2016-11-01

    Full Text Available In this paper we propose to present the issues involved in the case of the constructive conception of a station for metallographic sample preparation. This station is destined for laboratory work. The metallographic station is composed of a robot ABB IRB1600, a metallographic microscope, a gripping device, a manipulator, a laboratory grinding and polishing machine. The robot will be used for manipulation of the sample preparation and the manipulator take the sample preparation for processing.

  12. Live From Space Station Outreach Payload Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The Live from Space Station? Outreach Payload (LFSSOP) is a technologically challenging, exciting opportunity for university students to conduct significant research...

  13. Worst case meteorological scenario for Norway in case of hypothetical accident related to recovery of the Russian submarine K-27

    Energy Technology Data Exchange (ETDEWEB)

    Bartnicki, J.; Klein, H. [Norwegian Meteorological Institute, Oslo (Norway); Centre for Environmental Radioactivity, Aas (Norway); Amundsen, I.; Hosseini, A. [Norwegian Radiation Protection Authority, Oesteraas (Norway); Centre for Environmental Radioactivity, Aas (Norway); Haakenstad, H. [Norwegian Meteorological Institute, Oslo (Norway); Lind, O.C.; Salbu, B. [Norwegian University of Life Sciences, Aas (Norway); Centre for Environmental Radioactivity, Aas (Norway)

    2014-07-01

    This study is a part of a comprehensive Norwegian project led by Norwegian Radiation Protection Authority assessing risks related to a potential salvaging and decommissioning of the Russian nuclear submarine, K-27. In September 1981, the K-27 submarine was scuttled at shallow waters in the outer part of Stepovogo Bay, situated at the north-eastern coast of Novaya Zemlya. One of the scenarios that are included in the assessment is the lifting of the submarine to the surface and the subsequent transport to the Murmansk area for decommissioning. Thus, the risk of a criticality accident as a consequence of lifting and transport event cannot be ignored. A hypothetical accident might pose a serious threat to Norwegian territories and has to be considered from different perspectives. Here, we focus on the worst case meteorological scenario for Norway, but the same approach can be applied for other Scandinavian countries and Russia. As a first step, a large database with meteorological data has been prepared for the period of thirty years (1980-2010). These meteorological data are available in the 1000 km x 1000 km domain which includes both the entire Norwegian territory and the region of Novaya Zemlya. The spatial resolution of the meteorological data is 11 km and temporal 3 hours. The vertical structure includes 40 layers. The most important meteorological elements are the 3-D velocity field, the surface precipitation field and the 3-D temperature field. The second step is the development of the source terms for potential accidents which can be used by the dispersion model SNAP (Severe Nuclear Accident Program). Three locations for potential accidents with subsequent releases of radioactivity to the environment are assumed: 1) at the present location of K-27, 2) transport on the route to Murmansk and 3) in the Murmansk region. In the third step, the SNAP model will be run with meteorological data starting every 6. hour of each day during the 30 years period. As a result

  14. 47 CFR 80.1119 - Receipt and acknowledgement of distress alerts by coast stations and coast earth stations.

    Science.gov (United States)

    2010-10-01

    ... by coast stations and coast earth stations. 80.1119 Section 80.1119 Telecommunication FEDERAL... § 80.1119 Receipt and acknowledgement of distress alerts by coast stations and coast earth stations. (a... for coast stations.) (b) Coast earth stations in receipt of distress alerts must ensure that they are...

  15. Next Generation Hydrogen Station Composite Data Products: Retail Stations, Data through Quarter 2 of 2017

    Energy Technology Data Exchange (ETDEWEB)

    Sprik, Samuel [National Renewable Energy Lab. (NREL), Golden, CO (United States); Kurtz, Jennifer M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ainscough, Christopher D. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Saur, Genevieve [National Renewable Energy Lab. (NREL), Golden, CO (United States); Peters, Michael C. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2017-12-05

    This publication includes 92 composite data products (CDPs) produced for next generation hydrogen stations, with data through the second quarter of 2017. These CDPs include data from retail stations only.

  16. Next Generation Hydrogen Station Composite Data Products: Retail Stations, Data through Quarter 4 of 2016

    Energy Technology Data Exchange (ETDEWEB)

    Sprik, Sam [National Renewable Energy Lab. (NREL), Golden, CO (United States); Kurtz, Jennifer [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ainscough, Chris [National Renewable Energy Lab. (NREL), Golden, CO (United States); Saur, Genevieve [National Renewable Energy Lab. (NREL), Golden, CO (United States); Peters, Michael [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2017-05-31

    This publication includes 86 composite data products (CDPs) produced for next generation hydrogen stations, with data through the fourth quarter of 2016. These CDPs include data from retail stations only.

  17. Next Generation Hydrogen Station Composite Data Products: Retail Stations, Data Through Quarter 3 of 2016

    Energy Technology Data Exchange (ETDEWEB)

    Sprik, Sam [National Renewable Energy Lab. (NREL), Golden, CO (United States); Kurtz, Jennifer [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ainscough, Chris [National Renewable Energy Lab. (NREL), Golden, CO (United States); Saur, Genevieve [National Renewable Energy Lab. (NREL), Golden, CO (United States); Peters, Michael [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jeffers, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2017-03-07

    This publication includes 80 composite data products (CDPs) produced in Spring 2016 for next generation hydrogen stations, with data through the third quarter of 2016. These CDPs include data from retail stations only.

  18. East Baton Rouge Fire Stations, UTM15 NAD83, LAGIC (2002) [ebr_fire_stations

    Data.gov (United States)

    Louisiana Geographic Information Center — This dataset consists of twenty-nine (29) geocoded points representing fire stations in East Baton Rouge parish, Louisiana. Thirty (30) fire station, disctrict, and...

  19. Space Station Freedom - What if...?

    Science.gov (United States)

    Grey, Jerry

    1992-10-01

    The use of novel structural designs and the Energia launch system of the Commonwealth of Independent States for the Space Station Freedom (SSF) program is evaluated by means of a concept analysis. The analysis assumes that: (1) Energia is used for all cargo and logistics resupply missions; (2) the shuttles are launched from the U.S.; and (3) an eight-person assured crew return vehicle is available. This launch/supply scenario reduces the deployment risk from 30 launches to a total of only eight launches reducing the cost by about 15 billion U.S. dollars. The scenario also significantly increases the expected habitable and storage volumes and decreases the deployment time by three years over previous scenarios. The specific payloads are given for Energia launches emphasizing a proposed design for the common module cluster that incorporates direct structural attachment to the truss at midspan. The design is shown to facilitate the accommodation of additional service hangars and to provide a more efficient program for spacecraft habitable space.

  20. Space station induced electromagnetic effects

    Science.gov (United States)

    Singh, N.

    1988-01-01

    Several mechanisms which can cause electric (E) and magnetic (B) field contaminations of the Space Station environment are identified. The level of E and B fields generated by some of them such as the motion of the vehicle across the ambient magnetic field B(0) and the 20-kHz leakage currents and charges can be controlled by proper design considerations. On the other hand, there are some mechanisms which are inherent to the interaction of large vehicles with the plasma and probably their contributions to E and B fields cannot be controlled; these include plasma waves in the wake and ram directions and the effects of the volume current generated by the ionization of neutrals. The interaction of high-voltage solar arrays with plasma is yet another rich source of E and B fields and it is probably uncontrollable. Wherever possible, quantitative estimates of E and B are given. A set of recommendations is included for further study in areas where indepth knowledge is seriously lacking.

  1. development development of base transceiver station selection

    African Journals Online (AJOL)

    eobe

    save cost and reduce the number of people who are at risk of radiation in BTSs located places as compared to each ... Keywords: Keywords: absolute radio frequency channel number; base transceiver station; collocation; radiation; spectral ..... [5] Singh R.K., “Assessment of Electromagnetic Radiation from Base Station ...

  2. Connection Facility Layout Model of Subway Stations

    Directory of Open Access Journals (Sweden)

    Liya Yao

    2015-01-01

    Full Text Available As the key node of public transportation system, subway station has many functions such as attracting and distributing passengers and guiding the transfer from various traffic modes to subway. However, the poor facility scale and layout around subway stations in practice usually cause the inconvenience of transfer and low transfer efficiency, which causes the declination of travel efficiency and even loose of subway passengers. Taking subway stations as the study objects, this paper has emphasis on the connection characters between various traffic modes and subway stations. Considering the attraction region, the total transfer time, transfer distance, and connection cost were selected to form the efficiency index of connection layout of subway stations. Data envelopment analysis (DEA model is applied in the quantization of traffic resource consumption and output. At last, connection facility layout model of subway stations was established with the aim of improving the transfer efficiency. Meaningful results were obtained from the connection layout model of subway stations, which guide the planning and designing of the transfer facilities around subway stations.

  3. STS-97 Onboard Photograph - International Space Station

    Science.gov (United States)

    2000-01-01

    This image of the International Space Station in orbit was taken from the Space Shuttle Endeavour prior to docking. Most of the Station's components are clearly visible in this photograph. They are the Node 1 or Unity Module docked with the Functional Cargo Block or Zarya (top) that is linked to the Zvezda Service Module. The Soyuz spacecraft is at the bottom.

  4. Background noise spectra of global seismic stations

    Energy Technology Data Exchange (ETDEWEB)

    Wada, M.M.; Claassen, J.P.

    1996-08-01

    Over an extended period of time station noise spectra were collected from various sources for use in estimating the detection and location performance of global networks of seismic stations. As the database of noise spectra enlarged and duplicate entries became available, an effort was mounted to more carefully select station noise spectra while discarding others. This report discusses the methodology and criteria by which the noise spectra were selected. It also identifies and illustrates the station noise spectra which survived the selection process and which currently contribute to the modeling efforts. The resulting catalog of noise statistics not only benefits those who model network performance but also those who wish to select stations on the basis of their noise level as may occur in designing networks or in selecting seismological data for analysis on the basis of station noise level. In view of the various ways by which station noise were estimated by the different contributors, it is advisable that future efforts which predict network performance have available station noise data and spectral estimation methods which are compatible with the statistics underlying seismic noise. This appropriately requires (1) averaging noise over seasonal and/or diurnal cycles, (2) averaging noise over time intervals comparable to those employed by actual detectors, and (3) using logarithmic measures of the noise.

  5. The white SR spectrum experimental station

    CERN Document Server

    Ancharov, A I; Tolochko, B P; Sukhorukov, A V; Baru, S E; Savinov, G A; Kosov, A V; Sheromov, M A; Sikka, S K; Momin, S N

    2000-01-01

    A new experimental station for working with white synchrotron radiation is described. Radiation from the bending magnet of the VEPP-4 storage ring is used. The station is destined for study of structures at high pressure by energy-dispersive and Laue diffraction methods.

  6. Welding/brazing for Space Station repair

    Science.gov (United States)

    Dickinson, David W.; Babel, H. W.; Conaway, H. R.; Hooper, W. H.

    1990-01-01

    Viewgraphs on welding/brazing for space station repair are presented. Topics covered include: fabrication and repair candidates; debris penetration of module panel; welded repair patch; mechanical assembly of utility fluid line; space station utility systems; Soviet aerospace fabrication - an overview; and processes under consideration.

  7. Solar radiation observation stations updated to 1979

    Energy Technology Data Exchange (ETDEWEB)

    Carter, E.A.; Cristina, J.R.; Williams, B.B.

    1979-04-01

    The type of sensing and recording equipment for 420 stations in the US are listed alphabetically by states. The stations are divided according to whether or not they are in the basic National Weather Service, NOAA, network. Reports of summarized solar radiation data are listed in an appendix. (MHR)

  8. 47 CFR 73.210 - Station classes.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Station classes. 73.210 Section 73.210 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES FM... forth in § 73.211. If a station has an ERP and an antenna HAAT such that it cannot be classified using...

  9. 49 CFR 236.814 - Station, control.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Station, control. 236.814 Section 236.814..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.814 Station, control. The place where the control machine of a traffic control system is located. ...

  10. Present trends in HVDC converter station design

    Energy Technology Data Exchange (ETDEWEB)

    Carlsson, Lennart; Asplund, Gunnar; Bjorklund, Hans; Flisberg, Gunnar [ABB Power Systems AB, Ludvika (Sweden)

    1994-12-31

    HVDC converter station technology has developed rapidly to satisfy increasing requirements during past 10 - 15 years, but there has not been any dramatic changes since thyristor valves were introduced in the mid 70s. This paper describes some recent and expected future developments, that will substantiality change and simplify future converter stations. (author) 4 refs., 7 figs.

  11. The Sewer Research Station in Frejlev

    DEFF Research Database (Denmark)

    Hvitved-Jacobsen, Thorkild; Schaarup-Jensen, Kjeld

    This report for the 1999 activities at the sewer research station in Frejlev. Only few - if any - sewer monitoring stations like the one in Frejlev exist. Without no doubt the field data produced - especially the time series - in the course of time will serve as a unigue basis for projects dealing...

  12. The Sewer Research Station in Frejlev

    DEFF Research Database (Denmark)

    Schaarup-Jensen, Kjeld; Hvitved-Jacobsen, T.

    This report for the 2000 activities at the sewer research station in Frejlev. Only few - if any - sewer monitoring stations like the one in Frejlev exist. Without no doubt the field data produced - especially the time series - in the course of time will serve as a unique basis for projects dealing...

  13. 47 CFR 80.1181 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 80.1181 Section 80.1181... MARITIME SERVICES Voluntary Radio Installations On-Board Communications § 80.1181 Station identification...; or (2) The communications are likely to be received aboard another vessel. (b) Identification, when...

  14. 47 CFR 95.1507 - Station Identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station Identification. 95.1507 Section 95.1507 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES PERSONAL RADIO... Identification. A DSRCS On-Board Unit is not required to transmit an FCC station identification announcement. ...

  15. Reduction of dark-band-like metal artifacts caused by dental implant bodies using hypothetical monoenergetic imaging after dual-energy computed tomography.

    Science.gov (United States)

    Tanaka, Ray; Hayashi, Takafumi; Ike, Makiko; Noto, Yoshiyuki; Goto, Tazuko K

    2013-06-01

    The aim of this study was to evaluate the usefulness of hypothetical monoenergetic images after dual-energy computed tomography (DECT) for assessment of the bone encircling dental implant bodies. Seventy-two axial images of implantation sites clipped out from image data scanned using DECT in dual-energy mode were used. Subjective assessment on reduction of dark-band-like artifacts (R-DBAs) and diagnosability of adjacent bone condition (D-ABC) in 3 sets of DECT images-a fused image set (DE120) and 2 sets of hypothetical monoenergetic images (ME100, ME190)-was performed and the results were statistically analyzed. With regards to R-DBAs and D-ABC, significant differences among DE120, ME100, and ME190 were observed. The ME100 and ME190 images revealed more artifact reduction and diagnosability than those of DE120. DECT imaging followed by hypothetical monoenergetic image construction can cause R-DBAs and increase D-ABC and may be potentially used for the evaluation of postoperative changes in the bone encircling implant bodies. Copyright © 2013 Elsevier Inc. All rights reserved.

  16. A Hypothetical Model to Predict the Potential Impact of Government and Management Support in Implementing Integrated Management of Childhood Illness Practices

    Directory of Open Access Journals (Sweden)

    Fannah Al Fannah Al Araimi

    2017-05-01

    Full Text Available Objectives: Despite broad adoption and implementation of Integrated Management of Childhood Illness (IMCI in more than 100 countries, childhood mortality and morbidity rates continue to prevail. This calls for further investigation to identify the factors that prevent actual application of IMCI-recommended clinical practices. This study tests a hypothetical structural model to investigate potential role of government and healthcare policymakers on improving implementation and application of IMCI-recommended practices in clinical setting. Methods: The study was carried out at Sur and Ibra Nursing Institutes in Oman, in June 2016. We used six pre-tested and validated constructs for developing a hypothetical structural model. The constructs were used as underlying variables to examine the probable influence of government and policymakers on actual application of IMCI-recommended practices. Data were collected through structured questionnaires, which designed to measure healthcare professionals’ perceptions. Each construct was pre-loaded with three sub-constructs. Cronbach’s alpha (CA was used to calculate the internal consistency and reliability. Results: Factor loadings for each item in the model were ≥ 0.700. CA values for all the studied constructs were > 0.600. The average variance extracted values for all the constructs were > 0.500. Conclusions: The findings support the hypothetical structural model and highlights governments could play a significant role in ensuring that IMCI strategy is not only implemented, but also its recommended practices are applied in clinical setting.

  17. Within-population diversity of koala Chlamydophila pecorum at ompA VD1-VD3 and the ORF663 hypothetical gene.

    Science.gov (United States)

    Higgins, D P; Beninati, T; Meek, M; Irish, J; Griffith, J E

    2012-05-04

    Infection of koalas by Chlamydophila pecorum is very common and causes significant morbidity, infertility and mortality. Fundamental to management of the disease is an understanding of the importance of multi-serotype infection or pathogen virulence in pathogenesis; these may need consideration in plans involving koala movement, vaccination, or disease risk assessment. Here we describe diversity of ompA VD1-3, and ORF663 hypothetical gene tandem repeat regions, in a single population of koalas with diverse disease outcomes. We PCR amplified and sequenced 72 partial ompA segments and amplified 25 tandem repeat segments (ORF663 hypothetical gene) from C. pecorum obtained from 62 koalas. Although several ompA genotypes were identified nationally, only one ompA genotype existed within the population studied, indicating that severe chlamydial disease occurs commonly in free-ranging koalas in the absence of infection by multiple MOMP serotypes of C. pecorum. In contrast, variation in tandem repeats within the ORF663 hypothetical gene was very high, approaching the entire range reported for pathogenic and non-pathogenic C. pecorum of European ruminants; providing an impetus for further investigation of this as a potential virulence trait. Copyright © 2011 Elsevier B.V. All rights reserved.

  18. Hydrogen Station Cost Estimates: Comparing Hydrogen Station Cost Calculator Results with other Recent Estimates

    Energy Technology Data Exchange (ETDEWEB)

    Melaina, M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Penev, M. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2013-09-01

    This report compares hydrogen station cost estimates conveyed by expert stakeholders through the Hydrogen Station Cost Calculation (HSCC) to a select number of other cost estimates. These other cost estimates include projections based upon cost models and costs associated with recently funded stations.

  19. Progressive autonomy. [for space station systems operation

    Science.gov (United States)

    Anderson, J. L.

    1984-01-01

    The present investigation is concerned with the evolution of a space station in terms of the progression of autonomy, as systems perspectives and architectural concepts permit. The distinction between automation and autonomy is considered along with the evolution of autonomy, and the evolution of automation in station operations. Attention is given to the startup of a complex technological system, aspects of station control, questions of crew operational support, factors regarding the habitability of a space station, system design philosophy for autonomy, evolvability, latent capability, stage commonality, and multiple modularity. It is concluded that an evolutionary space station operating over a period of 10-20 years with a great increase in capability over that time will require a design philosophy which is more flexible and open-ended than for previous space systems.

  20. Atmospheric Dispersion Modeling of 137Cs generated from Nuclear Spent Fuel under Hypothetic Accidental Condition in the BNPP Area

    Science.gov (United States)

    Lee, Jongkuk; Lee, Kwan-Hee; Yook, Daesik; Kim, Sung Il; Lee, Byung Soo

    2016-04-01

    This study presents the results of atmosphere dispersion modeling using CALPUFF code that are based on computational simulation to evaluate the environmental characteristics of the Barakah nuclear power plant (BNPP) in west area of UAE. According to meteorological data analysis (2012~2013), the winds from the north(7.68%) and west(9.05%) including NNW(41.63%), NW(28.55%), and WNW(6.31%) winds accounted for more than 90% of the wind directions. East(0.2%) and south(0.6%) direction wind, including ESE(0.31%), SE(0.38%), and SSE(0.38%) were rarely distributed during the simulation period. Seasonal effects were not showed. However, a discrepancy in the tendency between daytime and night-time was observed. Approximately 87% of the wind speed was distributed below 5.4m/s (17%, 47% and 23% between the speeds of 0.5-1.8m/s 1.8-3.3m/s and 3.3-5.4m/s, respectively) during the annual period. Seasonal wind speed distribution results presented very similar pattern of annual distribution. Wind speed distribution of day and night, on the other hand, had a discrepancy with annual modeling results than seasonal distribution in some sections. The results for high wind speed (more than 10.8m/s) showed that this wind blew from the west. This high wind speed is known locally as the 'Shamal', which occurs rarely, lasting one or two days with the strongest winds experienced in association with gust fronts and thunderstorms. Six variations of cesium-137 (137Cs) dispersion test were simulated under hypothetic severe accidental condition. The 137Cs dispersion was strongly influenced by the direction and speed of the main wind. From the test cases, east-south area of the BNPP site was mainly influenced by 137Cs dispersion. A virtual receptor was set and calculated for observation of the 137Cs movement and accumulation. Surface roughness tests were performed for the analysis of topographic conditions. According to the surface condition, there are various surface roughness length. Four types

  1. Aids for the Study of Electromagnetic Blackout

    Science.gov (United States)

    1975-02-25

    The energy of any radation incident upon or flowing through unit area, perpendicular to the radiation beam, in unit time. The intensity of thermal...lW))1.2 - rf t MeV fission- sec-1 (l . -+ 2-6 -~~=-~t -material fissionable by thermal neutrons Spcrm total fissionable material fly i.1e1L photons MeV1

  2. A Simple Space Station Rescue Vehicle

    Science.gov (United States)

    Petro, Andrew

    1995-01-01

    Early in the development of the Space Station it was determined that there is a need to have a vehicle which could be used in the event that the Space Station crew need to quickly depart and return to Earth when the Space Shuttle is not available. Unplanned return missions might occur because of a medical emergency, a major Space Station failure, or if there is a long-term interruption in the delivery of logistics to the Station. The rescue vehicle ms envisioned as a simple capsule-type spacecraft which would be maintained in a dormant state at the Station for several years and be quickly activated by the crew when needed. During the assembly phase for the International Space Station, unplanned return missions will be performed by the Russian Soyuz vehicle, which can return up to three people. When the Station assembly is complete there will be a need for rescue capability for up to six people. This need might be met by an additional Soyuz vehicle or by a new vehicle which might come from a variety of sources. This paper describes one candidate concept for a Space Station rescue vehicle. The proposed rescue vehicle design has the blunt-cone shape of the Apollo command module but with a larger diameter. The rescue vehicle would be delivered to the Station in the payload bay of the Space Shuttle. The spacecraft design can accommodate six to eight people for a one-day return mission. All of the systems for the mission including deorbit propulsion are contained within the conical spacecraft and so there is no separate service module. The use of the proven Apollo re-entry shape would greatly reduce the time and cost for development and testing. Other aspects of the design are also intended to minimize development cost and simplify operations. This paper will summarize the evolution of rescue vehicle concepts, the functional requirements for a rescue vehicle, and describe the proposed design.

  3. Magnetic Base Station Deceptions, a magnetovariational analysis along the Ligurian Sea coast, Italy

    Directory of Open Access Journals (Sweden)

    E. Bozzo

    2007-06-01

    Full Text Available Reliability of high resolution airborne and shipborne magnetic surveys depends on accurate removal of temporal variations from the recorded total magnetic field intensity data. At mid latitudes, one or a few base stations are typically located within or near the survey area and are used to monitor and remove time dependent variations. These are usually assumed to be of external origin and uniform throughout the survey area. Here we investigate the influence on the magnetic base station correction of the time varying magnetic field variations generated by internal telluric currents flowing in anomalous regional 2D/3D conductivity structures. The study is based on the statistical analysis of a data set collected by four magnetovariational stations installed in northwestern Italy. The variometer stations were evenly placed with a spacing of about 60 km along a profile roughly parallel to the coastline. They recorded the geomagnetic field from the beginning to the end of April 2005, with a sampling rate of 0.33 Hz. Cross-correlation and coherence analysis applied to a subset of 125 five hours long magnetic events indicates that, for periods longer than 400 s, there is an high correlation between the horizontal magnetic field components at the different stations. This indicates spatial uniformity of the source field and of the induced currents in the 1D Earth. Additionally, the pattern of the induction arrows, estimated from single site transfer functions, reveals a clear electromagnetic signature of the Sestri-Voltaggio line, interpreted as a major regional tectonic boundary. Induced telluric currents flowing through this 2D/3D electrical conductivity discontinuity affect mainly the vertical magnetic component at the closer locations. By comparing this component at near (32 km and far (70 km stations, we have found that the mean value of the power spectra ratio, due to the electromagnetic induced field, is about 1.8 in the frequency

  4. 47 CFR 80.1121 - Receipt and acknowledgement of distress alerts by ship stations and ship earth stations.

    Science.gov (United States)

    2010-10-01

    ... by ship stations and ship earth stations. 80.1121 Section 80.1121 Telecommunication FEDERAL... § 80.1121 Receipt and acknowledgement of distress alerts by ship stations and ship earth stations. (a) Ship or ship earth stations that receive a distress alert must, as soon as possible, inform the master...

  5. Non-Coop Station History Forms Digest

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Single 71-page document entitled 'Station history non-COOP Keying Rules & Forms Digest,' dated December 12, 2003. Contractors with NCDC Climate Database...

  6. Normal heights for GNSS reference station antennas

    Science.gov (United States)

    Balodis, J.; Morozova, K.; Reiniks, M.; Normand, M.

    2017-10-01

    The GNSS reference station ellipsoidal heights are of the mm precision quality due to their continuous operation and monitoring of their coordinates in the international terrestrial reference frame. The GNSS reference station data is mostly used for rover positioning. The reference stations are very important also as a fitting points for the geoid modelling developments. Unfortunately, the importance of the referencing of antenna heights to the national levelling network are sometimes neglected. Usually the antennas are fixed on the roof of high buildings in urban environment. It is quite difficult to make a high precision levelling procedures and sometimes the direct geodetic measurements of antenna normal heights are not performed. Actually, for the most of Latvian GNSS reference network antennas the normal heights are not tied to the national levelling network. The aim of this research is to use the collected data of GNSS/levelling points for the determination of the normal heights of continuously operating reference station antennas.

  7. Resident Station Contact Information for Application Developers

    Data.gov (United States)

    Social Security Administration — SSA provides a web service and downloadable file for SSA Resident Station locations, telephone numbers, and hours of operation. (Note: If you think an office might...

  8. Space station synergetic RAM-logistics analysis

    Science.gov (United States)

    Dejulio, Edmund T.; Leet, Joel H.

    1988-01-01

    NASA's Space Station Maintenance Planning and Analysis (MP&A) Study is a step in the overall Space Station Program to define optimum approaches for on-orbit maintenance planning and logistics support. The approach used in the MP&A study and the analysis process used are presented. Emphasis is on maintenance activities and processes that can be accomplished on orbit within the known design and support constraints of the Space Station. From these analyses, recommendations for maintainability/maintenance requirements are established. The ultimate goal of the study is to reduce on-orbit maintenance requirements to a practical and safe minimum, thereby conserving crew time for productive endeavors. The reliability, availability, and maintainability (RAM) and operations performance evaluation models used were assembled and developed as part of the MP&A study and are described. A representative space station system design is presented to illustrate the analysis process.

  9. Eufaula National Wildlife Refuge : Station Safety Plan

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Eufaula National Wildlife Refuge Safety Plan discusses policies for the safety of the station employees, volunteers, and public. This plan seeks to identify and...

  10. [Station Safety Plan: Louisa National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Louisa National Wildlife Refuge Safety plan discusses policies for the safety of the station employees, volunteers and public. This plan seeks to identify and...

  11. Decommissioning strategy for Trawsfynydd power station

    Energy Technology Data Exchange (ETDEWEB)

    Jones, H.M.; Ellis, A.T. [Nuclear Electric plc, Barnwood (United Kingdom)

    1995-12-31

    Following the decision to close Trawsfynydd power station, Nuclear Electric adapted its generic decommissioning plans to suit the particular local circumstances. This resulted in an early reduced height safestore strategy which is described in the paper. (Author).

  12. DMA Reference Base Station Network Data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The data (15,904 records documenting 9,090 worldwide gravity base stations) were gathered by various governmental organizations (and academia) using a variety of...

  13. NPS Focus Digital Library and Research Station

    Data.gov (United States)

    National Park Service, Department of the Interior — Scope: National. NPS Focus Digital Library and Research Station information system manages images and archives of images as well as documents described by linked...

  14. CDMP COOP Station History Indexing Guidelines

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Single 66-page document entitled 'Station history COOP Rework via WSSRD and stragglers NC4 & NC3: Keying Rules,' dated December 12, 2003. Contractors with NCDC's...

  15. Weather Station: Hawaii: Oahu: Coconut Island

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Hawaii Institute of Marine Biology (HIMB) automatic weather station (AWS) records hourly measurements of precipitation, air temperature, wind speed and...

  16. Space Station data management system architecture

    Science.gov (United States)

    Mallary, William E.; Whitelaw, Virginia A.

    1987-01-01

    Within the Space Station program, the Data Management System (DMS) functions in a dual role. First, it provides the hardware resources and software services which support the data processing, data communications, and data storage functions of the onboard subsystems and payloads. Second, it functions as an integrating entity which provides a common operating environment and human-machine interface for the operation and control of the orbiting Space Station systems and payloads by both the crew and the ground operators. This paper discusses the evolution and derivation of the requirements and issues which have had significant effect on the design of the Space Station DMS, describes the DMS components and services which support system and payload operations, and presents the current architectural view of the system as it exists in October 1986; one-and-a-half years into the Space Station Phase B Definition and Preliminary Design Study.

  17. Space Station Displays and Controls Technology Evolution

    Science.gov (United States)

    Blackburn, Greg C.

    1990-01-01

    Viewgraphs on space station displays and controls technology evolution are presented. Topics covered include: a historical perspective; major development objectives; current development activities; key technology areas; and technology evolution issues.

  18. Photovoltaic central-station power conditioner subsystems

    Science.gov (United States)

    Krauthamer, S.; Das, R.; Bahrami, K.; Bulawka, A.

    1984-01-01

    The potential of applying new advanced circuit topologies and semiconductors with improved switching characteristics to the design and development of central-station power conditioning subsystems is assessed. State-of-the-art large power conditioners suitable for photovoltaic central-station application are reviewed. Advanced topology power conditioning subsystems, when compared to available production hardware, promise improved performance, significant cost reduction, and lower cost-to-efficiency ratios.

  19. Description of Measurements on Biogas Stations

    Directory of Open Access Journals (Sweden)

    Ladislav Novosád

    2016-08-01

    Full Text Available This paper focuses mainly on performance analysis for three biogas stations situated within the territory of the Czech Republic. This paper contains basic details of the individual biogas stations as well as description of their types. It also refers to the general description of the measurement gauge involved, with specifications of its potential use. The final part of this paper deals with the analysis of course data obtained, with special regard to voltage, current, active power and reactive power data.

  20. Semigraphical model of railway stations operation

    OpenAIRE

    Верлан, Анатолий Иванович

    2014-01-01

    Semigraphical model of railway stations operation for technical and operational evaluation of their technology is presented in the paper. The paper is aimed at improving the model structure to simplify the mechanical engineer's interaction with a computer at the stage of a formal description of the model. In the simulation, railway station is considered as a complex system, in which maintenance of facilities by technical means and executors is carried out by performing manufacturing operation...