Ensikat, Hans-Jürgen; Geisler, Thorsten; Weigend, Maximilian
2016-05-01
Biomineralization provides living organisms with various materials for the formation of resilient structures. Calcium phosphate is the main component of teeth and bones in vertebrates, whereas especially silica serves for the protection against herbivores on many plant surfaces. Functional calcium phosphate structures are well-known from the animal kingdom, but had not so far been reported from higher plants. Here, we document the occurrence of calcium phosphate biomineralization in the South-American plant group Loasaceae (rock nettle family), which have stinging trichomes similar to those of the well-known stinging nettles (Urtica). Stinging hairs and the smaller, glochidiate trichomes contained nanocrystalline hydroxylated apatite, especially in their distal portions, replacing the silica found in analogous structures of other flowering plants. This could be demonstrated by chemical, spectroscopic, and diffraction analyses. Some species of Loasaceae contained both calcium phosphate and silica in addition to calcium carbonate. The intriguing discovery of structural hydroxylated apatite in plants invites further studies, e.g., on its systematic distribution across the family, the genetic and cellular control of plant biomineralization, the properties and ultrastructure of calcium phosphate. It may prove the starting point for the development of biomimetic calcium phosphate composites based on a cellulose matrix.
Endoscopic treatment of vesicoureteral reflux using calcium hydroxyl apatite in dogs
Directory of Open Access Journals (Sweden)
Tavakoli Azin
2011-01-01
Full Text Available Abstract Background Injection of biomaterial to suburetral region, using minimally invasive procedure, has become an interesting topic for urologists to treat vesicoureteral reflux. The objective of this study was to evaluate the feasibility of injecting newly introduced calcium hydroxyl apatite to suburetral region, for treating an experimentally induced vesicoureteral reflux in dogs. Findings Bilateral vesicoureteral refluxed (VUR mixed breed dogs (n = 12; 10-15 kg live weight, 3-6 months of age were selected for this study. The presence and grade of the reflux were determined using cystography. Accordingly, 6 dogs displayed grade 1 & 2 and the other 6 showed grade 3 & 4 bilateral VUR. Every single dog, with bilateral VUR, underwent endoscopic treatment and received an injection of calcium hydroxyl apatite (an Iranian made product into the left (treated side and an injection of the similar volume of normal saline in to the right (control side subureteric space. One week, 3 and 6 months after treatment, cystography was performed. On each occasion, 4 dogs were euthanized by gas inhalation and biopsy samples were collected for histopathological study from ureter, bladder, kidney, lung and spleen in order to investigate the biomaterial migration into different organs. Data were analyzed using Chi-squared test. In control sides, radiographs confirmed the same grade of VUR, found at the initiation of the study. VUR was resolved in 100% (6/6 of Grade 1 & 2 and 83.33% (5/6 of Grade 3 & 4 in treated side. Therefore, the total success rate of this study was 91.67% (11/12. Macroscopic examination of the vesicouretral region of the treated side revealed a firm and consistent biomaterial mass at the site of injection. Histological findings confirmed inflammation at treated side. In contrast, there was no tissue reaction on control side. There was no evidence for biomaterial migration in macroscopic and microscopic observations in this study. Conclusion In
Atomic substitutions in synthetic apatite; Insights from solid-state NMR spectroscopy
Vaughn, John S.
Apatite, Ca5(PO4)3X (where X = F, Cl, or OH), is a unique mineral group capable of atomic substitutions for cations and anions of varied size and charge. Accommodation of differing substituents requires some kind of structural adaptation, e.g. new atomic positions, vacancies, or coupled substitutions. These structural adaptations often give rise to important physicochemical properties relevant to a range of scientific disciplines. Examples include volatile trapping during apatite crystallization, substitution for large radionuclides for long-term storage of nuclear fission waste, substitution for fluoride to improve acid resistivity in dental enamel composed dominantly of hydroxylapatite, and the development of novel biomaterials with enhanced biocompatibility. Despite the importance and ubiquity of atomic substitutions in apatite materials, many of the mechanisms by which these reactions occur are poorly understood. Presence of substituents at dilute concentration and occupancy of disordered atomic positions hinder detection by bulk characterization methods such as X-ray diffraction (XRD) and infrared (IR) spectroscopy. Solid-state nuclear magnetic resonance (NMR) spectroscopy is an isotope-specific structural characterization technique that does not require ordered atomic arrangements, and is therefore well suited to investigate atomic substitutions and structural adaptations in apatite. In the present work, solid-state NMR is utilized to investigate structural adaptations in three different types of apatite materials; a series of near-binary F, Cl apatite, carbonate-hydroxylapatite compositions prepared under various synthesis conditions, and a heat-treated hydroxylapatite enriched in 17O. The results indicate that hydroxyl groups in low-H, near binary F,Cl apatite facilitate solid-solution between F and Cl via column reversals, which result in average hexagonal symmetry despite very dilute OH concentration ( 2 mol percent). In addition, 19F NMR spectra indicate
Böttcher, Michael E.; Schmiedinger, Iris; Wacker, Ulrike; Conrad, Anika C.; Grathoff, Georg; Schmidt, Burkhard; Bahlo, Rainer; Gehlken, Peer-L.; Fiebig, Jens
2016-04-01
Carbonate-bearing hydroxyl-apatite (CHAP) is of fundamental and applied interest to the (bio)geochemical, paleontological, medical and material science communities, since it forms the basic mineral phase in human and animal teeth and bones. In addition, it is found in non-biogenic phosphate deposits. The stable isotope and foreign element composition of biogenic CHAP is widely used to estimate the formation conditions. This requires careful experimental calibration under well-defined boundary conditions. Within the DFG project EXCALIBOR, synthesis of carbonate-bearing hydroxyapatite was conducted via the transformation of synthetic calcite powder in aqueous solution as a function of time, pH, and temperature using batch-type experiments. The aqueous solution was analyzed for the carbon isotope composition of dissolved inorganic carbonate (gas irmMS), the oxygen isotope composition of water (LCRDS), and the cationic composition. The solid was characterized by powder X-ray diffraction, micro Raman and FTIR spectroscopy, SEM-EDX, elemental analysis (EA, ICP-OES) and gas irmMS. Temperature was found to significantly impact the transformation rate of calcite to CHAP. Upon complete transformation, CHAP was found to contain up to 5% dwt carbonate, depending on the solution composition (e.g., pH), both incorporated on the A and B type position of the crystal lattice. The oxygen isotope fractionation between water and CHAP decreased with increasing temperature with a tentative slope shallower than those reported in the literature for apatite, calcite or aragonite. In addition, the presence of dissolved NH4+, K+ or Na+ in aqueous solution led to partial incorporation into the CHAP lattice. How these distortions of the crystal lattice may impact stable isotope discrimination is subject of future investigations.
Ammonia IRMS-TPD measurements and DFT calculation on acidic hydroxyl groups in CHA-type zeolites.
Suzuki, Katsuki; Sastre, German; Katada, Naonobu; Niwa, Miki
2007-12-07
Brønsted acidity of H-chabazite (CHA) zeolites (Si : Al(2) = 4.2) was investigated by means of ammonia infrared-mass spectrometry/temperature-programmed desorption (IRMS-TPD) methods and density functional calculations. Four IR bands were observed at 3644, 3616, 3575 and 3538 cm(-1), and they were ascribable to the acidic OH groups on four nonequivalent oxygen sites in the CHA structure. The absorption band at 3538 cm(-1) was attributed to the O(4)H in the 6-membered ring (MR), and ammonia adsorption energy (DeltaU) of this OH group was the lowest among the 4 kinds of OH groups. The other 3 bands were assigned to the acidic OH groups in 8MR. It was observed that the DeltaU in 8 and 6MR were 131 (+/-3) and 101 kJ mol(-1), respectively. On the other hand, the density functional theory (DFT) calculations within periodic boundary conditions yielded the adsorption energies on these OH groups in 8 and 6MR to be ca. 130 and 110 kJ mol(-1), respectively, in good agreement with the experimentally-observed values.
Story, Lachel; To, Yen M
2016-05-01
Health care and academic systems are increasingly collaborating with community health advisors (CHAs) to provide culturally relevant health interventions that promote sustained community transformation. Little attention has been placed on CHA training evaluation, including core competency attainment. This study identified common CHA core competencies, generated a theoretically based measure of those competencies, and explored psychometric properties of that measure. A concept synthesis revealed five CHA core competencies (leadership, translation, guidance, advocacy, and caring). The CHA Core Competency Retrospective Pretest/Posttest (CCCRP) resulted from that synthesis, which was administered using multiple approaches to individuals who previously received CHA training (N= 142). Exploratory factor analyses revealed a two-factor structure underlying the posttraining data, and Cronbach's alpha indicated high internal consistency. This study suggested some CHA core competencies might be more interrelated than previously thought, and two major competencies exist rather than five and supported the CCCRP's use to evaluate core competency attainment resulting from training. © The Author(s) 2014.
Restoran Cha Dao = Restaurant Cha Dao
2012-01-01
Tallinnas Suur-Patarei 2 asuva Hiina restorani Cha Dao sisekujundusest. Restorani mööbel, v.a toolid, projekteeriti eritellimusena. Sisearhitekt Dmitri Pisarenko (DM3 OÜ), loetletud tema töid. Arhitekt Meeli Truu
Directory of Open Access Journals (Sweden)
Christèle Combes
2016-04-01
Full Text Available Calcium phosphate apatites offer outstanding biological adaptability that can be attributed to their specific physico-chemical and structural properties. The aim of this review is to summarize and discuss the specific characteristics of calcium phosphate apatite biominerals in vertebrate hard tissues (bone, dentine and enamel. Firstly, the structural, elemental and chemical compositions of apatite biominerals will be summarized, followed by the presentation of the actual conception of the fine structure of synthetic and biological apatites, which is essentially based on the existence of a hydrated layer at the surface of the nanocrystals. The conditions of the formation of these biominerals and the hypothesis of the existence of apatite precursors will be discussed. Then, we will examine the evolution of apatite biominerals, especially during bone and enamel aging and also focus on the adaptability of apatite biominerals to the biological function of their related hard tissues. Finally, the diagenetic evolution of apatite fossils will be analyzed.
Diffusion of hydroxyl ions from calcium hydroxide and Aloe vera pastes.
Batista, Victor Eduardo de Souza; Olian, Douglas Dáquila; Mori, Graziela Garrido
2014-01-01
This study evaluated the diffusion through the dentinal tubules of hydroxyl ions from different calcium hydroxide (CH) pastes containing Aloe vera. Sixty single-rooted bovine teeth were used. The tooth crowns were removed, the root canals were instrumented and the specimens were assigned to 4 groups (n=15) according to the intracanal medication: Group CH/S - CH powder and saline paste; Group CH/P - CH powder and propylene glycol paste; Group CH/A - calcium hydroxide powder and Aloe vera gel paste; Group CH/A/P - CH powder, Aloe vera powder and propylene glycol paste. After placement of the root canal dressings, the teeth were sealed coronally and apically with a two-step epoxy adhesive. The teeth were placed in identified flasks containing deionized water and stored in an oven with 100% humidity at 37 °C. After 3 h, 24 h, 72 h, 7 days, 15 days and 30 days, the deionized water in the flasks was collected and its pH was measured by a pH meter. The obtained data were subjected to statistical analysis at a significance level of 5%. The results demonstrated that all pastes provided diffusion of hydroxyl ions through the dentinal tubules. The combination of Aloe vera and CH (group CH/A) provided a constant release of calcium ions. Group CH/A/P showed the highest pH at 24 and 72 h. In conclusion, the experimental pastes containing Aloe vera were able to enable the diffusion of hydroxyl ions through the dentinal tubules.
Menopause and big data: Word Adjacency Graph modeling of menopause-related ChaCha data.
Carpenter, Janet S; Groves, Doyle; Chen, Chen X; Otte, Julie L; Miller, Wendy R
2017-07-01
To detect and visualize salient queries about menopause using Big Data from ChaCha. We used Word Adjacency Graph (WAG) modeling to detect clusters and visualize the range of menopause-related topics and their mutual proximity. The subset of relevant queries was fully modeled. We split each query into token words (ie, meaningful words and phrases) and removed stopwords (ie, not meaningful functional words). The remaining words were considered in sequence to build summary tables of words and two and three-word phrases. Phrases occurring at least 10 times were used to build a network graph model that was iteratively refined by observing and removing clusters of unrelated content. We identified two menopause-related subsets of queries by searching for questions containing menopause and menopause-related terms (eg, climacteric, hot flashes, night sweats, hormone replacement). The first contained 263,363 queries from individuals aged 13 and older and the second contained 5,892 queries from women aged 40 to 62 years. In the first set, we identified 12 topic clusters: 6 relevant to menopause and 6 less relevant. In the second set, we identified 15 topic clusters: 11 relevant to menopause and 4 less relevant. Queries about hormones were pervasive within both WAG models. Many of the queries reflected low literacy levels and/or feelings of embarrassment. We modeled menopause-related queries posed by ChaCha users between 2009 and 2012. ChaCha data may be used on its own or in combination with other Big Data sources to identify patient-driven educational needs and create patient-centered interventions.
Study of the auto-irradiation effects in apatites structure materials
International Nuclear Information System (INIS)
Soulet, St.
2000-11-01
decreases rapidly with the increase of SiO 4 /PO 4 ratio; this is in agreement with the conclusions of the study with natural analogous. It decreases also when the fluor anion is replaced by an hydroxyl group. With the current knowledge, the annealing by alpha seems to be an unique property of the apatitic structure. In order to model the behavior of ceramics when they are doped with actinides, it has been established, with defects creation and recovery velocities, the differential equation of the disorder evolution in terms of the storage or disposal time. The resolution of this equation in the case of the phospho-calcic fluoro-apatite and the fluoro-apatite with one silicate allows to conclude that these two potential matrices will probably keep their crystal structure during the storage or the disposal. (O.M.)
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHA557 (Link to dictyBase) - - - Contig-U15635-1 - (Link to Or...iginal site) CHA557F 620 - - - - - - Show CHA557 Library CH (Link to library) Clone ID CHA557 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15635-1 Original site URL http://dictycdb.b...HSIEIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGTGTDLPLL KWLEKYTFPVESKFKD...EIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGT
Endogenous Lunar Volatiles: Insights into the Abundances of Volatiles in the Moon from Lunar Apatite
McCubbin, Francis
2016-01-01
At the time of publication of New Views of the Moon, it was thought that the Moon was bone dry with less than about 1 ppb H2O. However in 2007, initial reports at the 38th Lunar and Planetary Science Conference speculated that H-species were present in both apatites and pyroclastic volcanic lunar glasses. These early reports were later confirmed through peer-review, which motivated many subsequent studies on magmatic volatiles in and on the Moon within the last decade. Some of these studies have cast into question the post-Apollo view of lunar formation, the distribution and sources of volatiles in the Earth-Moon system, and the thermal and magmatic evolution of the Moon. The mineral apatite has been one of the pillars of this new field of study, and it will be the primary focus of this abstract. Although apatite has been used both to understand the abundances of volatiles in lunar systems as well as the isotopic compositions of those volatiles, the focus here will be on the abundances of F, Cl, and H2O. This work demonstrates the utility of apatite in advancing our understanding of lunar volatiles, hence apatite should be among the topics covered in the endogenous lunar volatile chapter in NVM II. Truncated ternary plot of apatite X-site occupancy (mol%) from highlands apatite and mare basalt apatite plotted on the relative volatile abundance diagram from. The solid black lines delineate fields of relative abundances of F, Cl, and H2O (on a weight basis) in the melt from which the apatite crystallized. The diagram was constructed using available apatite/melt partitioning data for fluorine, chlorine, and hydroxyl.
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHA851 (Link to dictyBase) - - - Contig-U16368-1 - (Link to Or...iginal site) CHA851F 614 - - - - - - Show CHA851 Library CH (Link to library) Clone ID CHA851 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dictycdb.b...TCCXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT...nly*skttgttttllnlcraiism*srwn dlysstkqlyqy*ipmlpis--- Frame C: VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT
Sunendar, Bambang; Fathina, Afiya; Harmaji, Andrie; Mardhian, Deby Fajar; Asri, Lia; Widodo, Haris Budi
2017-09-01
The prospective material for implant plate required sufficient mechanical properties to maintain fracture fixation and resist physiological stress until bone healing process finished. Various problem implant plate based on metal and polymer materials when used as fixation for bone defect case induced developmental of bioceramic for implant plate materials. Materials that now has been attract a lot of attention is carbonate apatite and strontium as doping which known to have good biocompability along with biointegrity and mechanical charateristics. Other materials that have been known to have good mechanical properties are metakaolin and use of chitosan as coupling agent. Metakaolin and carbonate apatite can be produced by sol-gel methode which simpler, economical and energy-saving procedure furthermore use of chitosan which is widely found in the nature of Indonesia can be used to encourage the utilization of natural resources. The aim fo this paper is to investigated effect of CHA-doped Sr 5 (%) mol addition to the mechanical strength of metakaolin dental implant geoploymer composite. In this paper metakaolin is used as geopolymerization precursors. The test results have shown that addition of filler of apatite carbonate doped 5% mol strontium can be said to increase the value of mechnical properties but high concentration of calcium in the nanocomposite also can complicate the equilibrium of the geopolymerization process and induce alkali aggregate reactivity (AAR). The sample group of nanocomposite of metakaolin and carbonate apatite-doped 5% mol strontium (2: 1% wt) with 2% chitosan as a coupling agent based on geopolymerization for implant plate application has the best mechanical properties among all sample groups but does not qualify as an implant plate on cortical bone but can be used for the application of the implant plate on the trabecular bone specifically and potentially as a bone initiator.
International Nuclear Information System (INIS)
Zheng, Yanyan; Xiong, Chengdong; Zhang, Shenglan; Li, Xiaoyu; Zhang, Lifang
2015-01-01
Poly(etheretherketone) (PEEK) is a rigid semi-crystalline polymer with outstanding mechanical properties, bone-like stiffness and suitable biocompatibility that has attracted much interest as a biomaterial for orthopedic and dental implants. However, the bio-inert surface of PEEK limits its biomedical applications when direct osteointegration between the implants and the host tissue is desired. In this work, –PO 4 H 2 , –COOH and –OH groups were introduced on the PEEK surface by further chemical treatments of the vinyl-terminated silanization layers formed on the hydroxylation-pretreated PEEK surface. Both the surface-functionalized and pristine specimens were characterized by X-ray photoelectron spectroscopy (XPS), attenuated total reflectance Fourier transform infrared (ATR-FTIR) spectroscopy and water contact angle measurements. When placed in 1.5 strength simulated body fluid (SBF) solution, apatite was observed to form uniformly on the functionalized PEEK surface and firmly attach to the substrate. The characterized results demonstrated that the coating was constituted by poorly crystallized bone-like apatite and the effect of surface functional groups on coating formation was also discussed in detail. In addition, in vitro biocompatibility of PEEK, in terms of pre-osteoblast cell (MC3T3-E1) attachment, spreading and proliferation, was remarkably enhanced by the bone-like apatite coating. Thus, this study provides a method to enhance the bioactivity of PEEK and expand its applications in orthopedic and dental implants. - Highlights: • –PO 4 H 2 , –COOH and –OH groups were successfully introduced onto PEEK surface via tailored silanization layer technique. • Bone-like apatite formed uniformly on surface-functionalized PEEK after immersion in SBF, and tightly adhered to the PEEK. • SEM, EDS, FTIR, XPS and XRD results showed that apatite layer is composed of low-crystalline bone-like apatite. • Bone-like apatite coating remarkably enhanced pre
McCubbin, F. M.; Ustunisik, G.; Vander Kaaden, K. E.
2016-01-01
The mineral apatite [Ca5(PO4)3(F,Cl,OH)] is present in a wide range of planetary materials. Due to the presence of volatiles within its crystal structure (X-site), many recent studies have attempted to use apatite to constrain the volatile contents of planetary magmas and mantle sources. In order to use the volatile contents of apatite to precisely determine the abundances of volatiles in coexisting silicate melt or fluids, thermodynamic models for the apatite solid solution and for the apatite components in multi-component silicate melts and fluids are required. Although some thermodynamic models for apatite have been developed, they are incomplete. Furthermore, no mixing model is available for all of the apatite components in silicate melts or fluids, especially for F and Cl components. Several experimental studies have investigated the apatite-melt and apatite-fluid partitioning behavior of F, Cl, and OH in terrestrial and planetary systems, which have determined that apatite-melt partitioning of volatiles are best described as exchange equilibria similar to Fe-Mg partitioning between olivine and silicate melt. However, McCubbin et al. recently reported that the exchange coefficients may vary in portions of apatite compositional space where F, Cl, and OH do not mix ideally in apatite. In particular, solution calorimetry data of apatite compositions along the F-Cl join exhibit substantial excess enthalpies of mixing. In the present study, we conducted apatite-melt partitioning experiments in evacuated, sealed silica-glass tubes at approximately 1 bar and 950-1050 degrees Centigrade on a synthetic Martian basalt composition equivalent to the basaltic shergottite Queen Alexandria Range (QUE) 94201. These experiments were conducted dry, at low pressure, to assess the effects of temperature and apatite composition on the partitioning behavior of F and Cl between apatite and basaltic melt along the F-Cl apatite binary join, where there is non-ideal mixing of F and Cl
MoCha: Molecular Characterization of Unknown Pathways.
Lobo, Daniel; Hammelman, Jennifer; Levin, Michael
2016-04-01
Automated methods for the reverse-engineering of complex regulatory networks are paving the way for the inference of mechanistic comprehensive models directly from experimental data. These novel methods can infer not only the relations and parameters of the known molecules defined in their input datasets, but also unknown components and pathways identified as necessary by the automated algorithms. Identifying the molecular nature of these unknown components is a crucial step for making testable predictions and experimentally validating the models, yet no specific and efficient tools exist to aid in this process. To this end, we present here MoCha (Molecular Characterization), a tool optimized for the search of unknown proteins and their pathways from a given set of known interacting proteins. MoCha uses the comprehensive dataset of protein-protein interactions provided by the STRING database, which currently includes more than a billion interactions from over 2,000 organisms. MoCha is highly optimized, performing typical searches within seconds. We demonstrate the use of MoCha with the characterization of unknown components from reverse-engineered models from the literature. MoCha is useful for working on network models by hand or as a downstream step of a model inference engine workflow and represents a valuable and efficient tool for the characterization of unknown pathways using known data from thousands of organisms. MoCha and its source code are freely available online under the GPLv3 license.
Energy Technology Data Exchange (ETDEWEB)
Zheng, Yanyan [Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu 610041 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Xiong, Chengdong; Zhang, Shenglan [Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu 610041 (China); Li, Xiaoyu [State Key Laboratory of Oral Diseases, West China Hospital of Stomatology, Sichuan University, Chengdu 610041 (China); Zhang, Lifang, E-mail: zhanglfcioc@163.com [Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu 610041 (China)
2015-10-01
Poly(etheretherketone) (PEEK) is a rigid semi-crystalline polymer with outstanding mechanical properties, bone-like stiffness and suitable biocompatibility that has attracted much interest as a biomaterial for orthopedic and dental implants. However, the bio-inert surface of PEEK limits its biomedical applications when direct osteointegration between the implants and the host tissue is desired. In this work, –PO{sub 4}H{sub 2}, –COOH and –OH groups were introduced on the PEEK surface by further chemical treatments of the vinyl-terminated silanization layers formed on the hydroxylation-pretreated PEEK surface. Both the surface-functionalized and pristine specimens were characterized by X-ray photoelectron spectroscopy (XPS), attenuated total reflectance Fourier transform infrared (ATR-FTIR) spectroscopy and water contact angle measurements. When placed in 1.5 strength simulated body fluid (SBF) solution, apatite was observed to form uniformly on the functionalized PEEK surface and firmly attach to the substrate. The characterized results demonstrated that the coating was constituted by poorly crystallized bone-like apatite and the effect of surface functional groups on coating formation was also discussed in detail. In addition, in vitro biocompatibility of PEEK, in terms of pre-osteoblast cell (MC3T3-E1) attachment, spreading and proliferation, was remarkably enhanced by the bone-like apatite coating. Thus, this study provides a method to enhance the bioactivity of PEEK and expand its applications in orthopedic and dental implants. - Highlights: • –PO{sub 4}H{sub 2}, –COOH and –OH groups were successfully introduced onto PEEK surface via tailored silanization layer technique. • Bone-like apatite formed uniformly on surface-functionalized PEEK after immersion in SBF, and tightly adhered to the PEEK. • SEM, EDS, FTIR, XPS and XRD results showed that apatite layer is composed of low-crystalline bone-like apatite. • Bone-like apatite coating
Omelon, S. J.; Stanley, S. Y.; Gorelikov, I.; Matsuura, N.
2011-12-01
The oxygen isotopic composition in bone mineral phosphate is known to reflect the local water composition, environmental humidity, and diet1. Once ingested, biochemical processes presumably equilibrate PO43- with "body water" by the many biochemical reactions involving PO43- 2. Blake et al. demonstrated that enzymatic release of PO43- from organophosphorus compounds, and microbial metabolism of dissolved orthophosphate, significantly exchange the oxygen in precipitated apatite within environmental water3,4, which otherwise does not exchange with water at low temperatures. One of the enzymes that can cleave phosphates from organic substrates is alkaline phosphastase5, the enzyme also associated with bone mineralization. The literature often states that the mineral in bone in hydroxylapatite, however the mineral in bone is carbonated apatite that also contains some fluoride6. Deprotonation of HPO32- occurs at pH 12, which is impossibly high for biological system, and the predominate carbonate species in solution at neutral pH is HCO3-. To produce an apatite mineral without a significant hydroxyl content, it is possible that apatite biomineralization occurs through a polyphosphate pathway, where the oxygen atom required to transform polyphosphate into individual phosphate ions is from carbonate: [PO3-]n + CO32- -> [PO3-]n-1 + PO43- + CO2. Alkaline phosphatase can depolymerise polyphosphate into orthophosphate5. If alkaline phosphatase cleaves an oxygen atom from a calcium-carbonate complex, then there is no requirement for removing a hydrogen atom from the HCO3- or HPO43- ions of body water to form bioapatite. A mix of 1 mL of 1 M calcium polyphosphate hydogel, or nano-particles of calcium polyphosphate, and amorphous calcium carbonate were reacted with alkaline phosphatase, and maintained at neutral to basic pH. After two weeks, carbonated apatite and other calcium phosphate minerals were identified by powder x-ray diffraction. Orthophosphate and unreacted
Iodine immobilization in apatites
International Nuclear Information System (INIS)
Audubert, F.; Lartigue, J.E.
2000-01-01
In the context of a scientific program on long-lived radionuclide conditioning, a matrix for iodine 129 immobilization has been studied. A lead vanado-phosphate apatite was prepared from the melt of lead vanado-phosphate Pb 3 (VO 4 ) 1.6 (PO 4 ) 0.4 and lead iodide PbI 2 in stoichiometric proportions by calcination at 700 deg. C during 3 hours. Natural sintering of this apatite is not possible because the product decomposition occurs at 400 deg. C. Reactive sintering is the solution. The principle depends on the coating of lead iodide with lead vanado-phosphate. Lead vanado-phosphate coating is used as iodo-apatite reactant and as dense covering to confine iodine during synthesis. So the best condition to immobilize iodine during iodo-apatite synthesis is a reactive sintering at 700 deg. C under 25 MPa. We obtained an iodo-apatite surrounded with dense lead vanadate. Leaching behaviour of the matrix synthesized by solid-solid reaction is under progress in order to determine chemical durability, basic mechanisms of the iodo-apatite alteration and kinetic rate law. Iodo-apatite dissolution rates were pH and temperature dependent. We obtained a rate of 2.5 10 -3 g.m -2 .d -1 at 90 deg. C in initially de-ionised water. (authors)
Apatite glass-ceramics: a review
Duminis, Tomas; Shahid, Saroash; Hill, Robert Graham
2016-12-01
This article is a review of the published literature on apatite glass-ceramics (GCs). Topics covered include crystallization mechanisms of the various families of the apatite GCs and an update on research and development on apatite GCs for applications in orthopedics, dentistry, optoelectronics and nuclear waste management. Most apatite GCs crystallize through a homogenous nucleation and crystallization mechanism, which is aided by a prior liquid-liquid phase separation. Careful control of the base glass composition and heat-treatment conditions, which determine the nature and morphology of the crystal phases in the GC can produce GC materials with exceptional thermal, mechanical, optical and biological properties. The GCs reviewed for orthopedic applications exhibit suitable mechanical properties and can chemically bond to bone and stimulate its regeneration. The most commercially successful apatite GCs are those developed for dental veneering. These materials exhibit excellent translucency and clinical esthetics, and mimic the natural tooth mineral. Due to the ease of solid solution of the apatite lattice, rare earth doped apatite GCs are discussed for potential applications in optoelectronics and nuclear waste management. One of the drawbacks of the commercial apatite GCs used in orthopedics is the lack of resorbability, therefore the review provides a direction for future research in the field.
Sirois, Fuschia M; Riess, Helene; Upchurch, Dawn M
2017-10-01
Disclosure of the use of complementary health approaches (CHA) is an important yet understudied health behavior with important implications for patient care. Yet research into disclosure of CHA has been atheoretical and neglected the role of health beliefs. Using a consumer commitment model of CHA use as a guiding conceptual framework, the current study tests the hypotheses that perceived positive CHA outcomes (utilitarian values) and positive CHA beliefs (symbolic values) are associated with disclosure of CHA to conventional care providers in a nationally representative US sample. From a sample of 33,594 with CHA use information from the 2012 National Health Interview Survey (NHIS), a subsample of 7348 who used CHA within the past 12 months was analyzed. The 2012 NHIS is a cross-sectional survey of the non-institutionalized US adult population, which includes the most recent nationally representative CHA use data. The 63.2% who disclosed CHA use were older, were less educated, and had visited a health care provider in the past year. Weighted logistic regression analyses controlling for demographic variables revealed that those who disclosed were more likely to report experiencing positive psychological (improved coping and well-being) and physical outcomes (better sleep, improved health) from CHA and hold positive CHA-related beliefs. CHA users who perceive physical and psychological benefits from CHA use and who hold positive attitudes towards CHA are more likely to disclose their CHA use. Findings support the relevance of a consumer commitment perspective for understanding CHA disclosure and suggest CHA disclosure as an important proactive health behavior that warrants further attention.
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHA362 (Link to dictyBase) - - - Contig-U15579-1 | Contig-U156... library) Clone ID CHA362 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U155...79-1 | Contig-U15687-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...XACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVT...GNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVP
International Nuclear Information System (INIS)
Kaur, Kulwinder; Singh, K.J.; Anand, Vikas; Bhatia, Gaurav; Kaur, Raminderjit; Kaur, Manpreet; Nim, Lovedeep; Arora, Daljit Singh
2017-01-01
Poly(1, 4-butyl succinate) extended 1, 6-diisocyanatohexane (PBSu-DCH) polymers and Polymethylmethacrylate (PMMA) scaffolds decorated with nano hydroxyl apatite have been prepared and characterized for regeneration of bone in cranio-maxillofacial region. Synthesized scaffolds revealed good response in bone regeneration and excellent cell viability in comparison to commercial available glass plate, which lead to better proliferation of MG-63 cell lines. Additionally, they demonstrate high porosity and excellent water retention ability. Moreover, controlled degradation (in pH = 7.4) and sustained drug release in pH (4.5 and 7.4) are advantages of these scaffolds to serve as delivery vehicles for therapeutic drugs. Samples also provide the protection against Escherichia coli and Methicillin Resistant Staphylococcus aureus microorganisms which can be helpful for quick recovery of the patient. In-vitro inflammatory response has been assessed via adsorption of human plasma/serum proteins on the surface of the scaffolds. Results suggest that prepared scaffolds have good bone regeneration ability and provide friendly environment for the cell growth with the additional advantage of protection of the surrounding tissues from microbial infection. With all these features, it is speculated that these scaffolds will have wide utility in the area of tissue engineering and regenerative medicine. - Highlights: • Porous scaffolds have been prepared by solvent casting technique. • Scaffolds have shown good antibacterial activity against gram positive and negative microorganisms. • Synthesized scaffolds may find applications in the area of regenerative medicine.
Energy Technology Data Exchange (ETDEWEB)
Kaur, Kulwinder [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Singh, K.J., E-mail: kanwarjitsingh@yahoo.com [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Anand, Vikas [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Bhatia, Gaurav; Kaur, Raminderjit [Department of Molecular Biology and Biochemistry, Guru Nanak Dev University, Amritsar 143005 (India); Kaur, Manpreet [Department of Human Genetics, Guru Nanak Dev University, Amritsar 143005 (India); Nim, Lovedeep; Arora, Daljit Singh [Department of Microbiology, Guru Nanak Dev University, Amritsar 143005 (India)
2017-02-01
Poly(1, 4-butyl succinate) extended 1, 6-diisocyanatohexane (PBSu-DCH) polymers and Polymethylmethacrylate (PMMA) scaffolds decorated with nano hydroxyl apatite have been prepared and characterized for regeneration of bone in cranio-maxillofacial region. Synthesized scaffolds revealed good response in bone regeneration and excellent cell viability in comparison to commercial available glass plate, which lead to better proliferation of MG-63 cell lines. Additionally, they demonstrate high porosity and excellent water retention ability. Moreover, controlled degradation (in pH = 7.4) and sustained drug release in pH (4.5 and 7.4) are advantages of these scaffolds to serve as delivery vehicles for therapeutic drugs. Samples also provide the protection against Escherichia coli and Methicillin Resistant Staphylococcus aureus microorganisms which can be helpful for quick recovery of the patient. In-vitro inflammatory response has been assessed via adsorption of human plasma/serum proteins on the surface of the scaffolds. Results suggest that prepared scaffolds have good bone regeneration ability and provide friendly environment for the cell growth with the additional advantage of protection of the surrounding tissues from microbial infection. With all these features, it is speculated that these scaffolds will have wide utility in the area of tissue engineering and regenerative medicine. - Highlights: • Porous scaffolds have been prepared by solvent casting technique. • Scaffolds have shown good antibacterial activity against gram positive and negative microorganisms. • Synthesized scaffolds may find applications in the area of regenerative medicine.
Correlation between CHA2DS2-VASc Score and Glaucoma Treatment and Prognosis.
Pikkel, Yoav Y; Krebs, Daniel; Igal, Vadim; Sharabi-Nov, Adi; Epstein, Irena; Pikkel, Joseph
2018-01-01
To find if CHA 2 DS 2 -VASc scale can accurately predict the treatment, prognosis, and outcome for primary open-angle glaucoma (POAG). A survey of 250,000 patient years was taken, using the records of the Ophthalmology Department at Ziv Medical Center. Data was collected regarding the retinal nerve fiber layer (RNFL), visual field (VF), line of treatment (LOT) of glaucoma, and all the data needed to accurately calculate CHA 2 DS 2 -VASc score for each patient. Sixty-seven patients were included in the statistical analysis. The mean age was 72.5 years. The mean CHA 2 DS 2 -VASc score was 3.27 + -1.7. Positive Pearson's correlation coefficients were found for LOT and CHA 2 DS 2 -VASc score, 0.35, and for RNFL grade and CHA2DS2-VASc score, 0.37. The correlation was negative for RNFL width and CHA2DS2-VASc score, -0.35. CHA 2 DS 2 -VASc score was shown to be correlated with glaucoma. This correlation was manifested positively by the LOT needed to stop glaucoma progression, with higher CHA 2 DS 2 -VASc scores correlated with more aggressive treatment. Since glaucoma is a disease with a progressing nature, it is important to treat patients aggressively on one hand, while offering the most benign treatment as possible on the other hand. Modification of the CHA 2 DS 2 -VASc score could achieve an even higher correlation.
VizieR Online Data Catalog: ChaMP X-ray point source catalog (Kim+, 2007)
Kim, M.; Kim, D.-W.; Wilkes, B. J.; Green, P. J.; Kim, E.; Anderson, C. S.; Barkhouse, W. A.; Evans, N. R.; Ivezic, Z.; Karovska, M.; Kashyap, V. L.; Lee, M. G.; Maksym, P.; Mossman, A. E.; Silverman, J. D.; Tananbaum, H. D.
2009-01-01
We present the Chandra Multiwavelength Project (ChaMP) X-ray point source catalog with ~6800 X-ray sources detected in 149 Chandra observations covering ~10deg2. The full ChaMP catalog sample is 7 times larger than the initial published ChaMP catalog. The exposure time of the fields in our sample ranges from 0.9 to 124ks, corresponding to a deepest X-ray flux limit of f0.5-8.0=9x10-16ergs/cm2/s. The ChaMP X-ray data have been uniformly reduced and analyzed with ChaMP-specific pipelines and then carefully validated by visual inspection. The ChaMP catalog includes X-ray photometric data in eight different energy bands as well as X-ray spectral hardness ratios and colors. To best utilize the ChaMP catalog, we also present the source reliability, detection probability, and positional uncertainty. (10 data files).
Priest, Chad; Knopf, Amelia; Groves, Doyle; Carpenter, Janet S; Furrey, Christopher; Krishnan, Anand; Miller, Wendy R; Otte, Julie L; Palakal, Mathew; Wiehe, Sarah; Wilson, Jeffrey
2016-03-09
The development of effective health care and public health interventions requires a comprehensive understanding of the perceptions, concerns, and stated needs of health care consumers and the public at large. Big datasets from social media and question-and-answer services provide insight into the public's health concerns and priorities without the financial, temporal, and spatial encumbrances of more traditional community-engagement methods and may prove a useful starting point for public-engagement health research (infodemiology). The objective of our study was to describe user characteristics and health-related queries of the ChaCha question-and-answer platform, and discuss how these data may be used to better understand the perceptions, concerns, and stated needs of health care consumers and the public at large. We conducted a retrospective automated textual analysis of anonymous user-generated queries submitted to ChaCha between January 2009 and November 2012. A total of 2.004 billion queries were read, of which 3.50% (70,083,796/2,004,243,249) were missing 1 or more data fields, leaving 1.934 billion complete lines of data for these analyses. Males and females submitted roughly equal numbers of health queries, but content differed by sex. Questions from females predominantly focused on pregnancy, menstruation, and vaginal health. Questions from males predominantly focused on body image, drug use, and sexuality. Adolescents aged 12-19 years submitted more queries than any other age group. Their queries were largely centered on sexual and reproductive health, and pregnancy in particular. The private nature of the ChaCha service provided a perfect environment for maximum frankness among users, especially among adolescents posing sensitive health questions. Adolescents' sexual health queries reveal knowledge gaps with serious, lifelong consequences. The nature of questions to the service provides opportunities for rapid understanding of health concerns and may
Zheng, Yanyan; Xiong, Chengdong; Zhang, Shenglan; Li, Xiaoyu; Zhang, Lifang
2015-10-01
Poly(etheretherketone) (PEEK) is a rigid semi-crystalline polymer with outstanding mechanical properties, bone-like stiffness and suitable biocompatibility that has attracted much interest as a biomaterial for orthopedic and dental implants. However, the bio-inert surface of PEEK limits its biomedical applications when direct osteointegration between the implants and the host tissue is desired. In this work, -PO4H2, -COOH and -OH groups were introduced on the PEEK surface by further chemical treatments of the vinyl-terminated silanization layers formed on the hydroxylation-pretreated PEEK surface. Both the surface-functionalized and pristine specimens were characterized by X-ray photoelectron spectroscopy (XPS), attenuated total reflectance Fourier transform infrared (ATR-FTIR) spectroscopy and water contact angle measurements. When placed in 1.5 strength simulated body fluid (SBF) solution, apatite was observed to form uniformly on the functionalized PEEK surface and firmly attach to the substrate. The characterized results demonstrated that the coating was constituted by poorly crystallized bone-like apatite and the effect of surface functional groups on coating formation was also discussed in detail. In addition, in vitro biocompatibility of PEEK, in terms of pre-osteoblast cell (MC3T3-E1) attachment, spreading and proliferation, was remarkably enhanced by the bone-like apatite coating. Thus, this study provides a method to enhance the bioactivity of PEEK and expand its applications in orthopedic and dental implants. Copyright © 2015 Elsevier B.V. All rights reserved.
The solution structure of ChaB, a putative membrane ion antiporter regulator from Escherichia coli
Directory of Open Access Journals (Sweden)
Iannuzzi Pietro
2004-08-01
Full Text Available Abstract Background ChaB is a putative regulator of ChaA, a Na+/H+ antiporter that also has Ca+/H+ activity in E. coli. ChaB contains a conserved 60-residue region of unknown function found in other bacteria, archaeabacteria and a series of baculoviral proteins. As part of a structural genomics project, the structure of ChaB was elucidated by NMR spectroscopy. Results The structure of ChaB is composed of 3 α-helices and a small sheet that pack tightly to form a fold that is found in the cyclin-box family of proteins. Conclusion ChaB is distinguished from its putative DNA binding sequence homologues by a highly charged flexible loop region that has weak affinity to Mg2+ and Ca2+ divalent metal ions.
HERSCHEL OBSERVATIONS OF THE T CHA TRANSITION DISK: CONSTRAINING THE OUTER DISK PROPERTIES
International Nuclear Information System (INIS)
Cieza, Lucas A.; Olofsson, Johan; Henning, Thomas; Harvey, Paul M.; Evans II, Neal J.; Pinte, Christophe; Augereau, Jean-Charles; Ménard, Francois; Merín, Bruno; Najita, Joan
2011-01-01
T Cha is a nearby (d ∼ 100 pc) transition disk known to have an optically thin gap separating optically thick inner and outer disk components. Huélamo et al. recently reported the presence of a low-mass object candidate within the gap of the T Cha disk, giving credence to the suspected planetary origin of this gap. Here we present the Herschel photometry (70, 160, 250, 350, and 500 μm) of T Cha from the 'Dust, Ice, and Gas in Time' Key Program, which bridges the wavelength range between existing Spitzer and millimeter data and provide important constraints on the outer disk properties of this extraordinary system. We model the entire optical to millimeter wavelength spectral energy distribution (SED) of T Cha (19 data points between 0.36 and 3300 μm without any major gaps in wavelength coverage). T Cha shows a steep spectral slope in the far-IR, which we find clearly favors models with outer disks containing little or no dust beyond ∼40 AU. The full SED can be modeled equally well with either an outer disk that is very compact (only a few AU wide) or a much larger one that has a very steep surface density profile. That is, T Cha's outer disk seems to be either very small or very tenuous. Both scenarios suggest a highly unusual outer disk and have important but different implications for the nature of T Cha. Spatially resolved images are needed to distinguish between the two scenarios.
HERSCHEL OBSERVATIONS OF THE T CHA TRANSITION DISK: CONSTRAINING THE OUTER DISK PROPERTIES
Energy Technology Data Exchange (ETDEWEB)
Cieza, Lucas A. [Institute for Astronomy, University of Hawaii at Manoa, Honolulu, HI 96822 (United States); Olofsson, Johan; Henning, Thomas [Max Planck Institut fuer Astronomie, Koenigstuhl 17, 69117 Heidelberg (Germany); Harvey, Paul M.; Evans II, Neal J. [Department of Astronomy, University of Texas at Austin, Austin, TX 78712 (United States); Pinte, Christophe; Augereau, Jean-Charles; Menard, Francois [UJF-Grenoble 1/CNRS-INSU, Institut de Planetologie et d' Astrophysique de Grenoble (IPAG) UMR 5274, Grenoble, F-38041 (France); Merin, Bruno [Herschel Science Centre, European Space Agency (ESAC), P.O. Box 78, 28691 Villanueva de la Canada, Madrid (Spain); Najita, Joan, E-mail: lcieza@ifa.hawaii.edu [National Optical Astronomy Observatory, 950 N. Cherry Avenue, Tucson, AZ 86719 (United States)
2011-11-10
T Cha is a nearby (d {approx} 100 pc) transition disk known to have an optically thin gap separating optically thick inner and outer disk components. Huelamo et al. recently reported the presence of a low-mass object candidate within the gap of the T Cha disk, giving credence to the suspected planetary origin of this gap. Here we present the Herschel photometry (70, 160, 250, 350, and 500 {mu}m) of T Cha from the 'Dust, Ice, and Gas in Time' Key Program, which bridges the wavelength range between existing Spitzer and millimeter data and provide important constraints on the outer disk properties of this extraordinary system. We model the entire optical to millimeter wavelength spectral energy distribution (SED) of T Cha (19 data points between 0.36 and 3300 {mu}m without any major gaps in wavelength coverage). T Cha shows a steep spectral slope in the far-IR, which we find clearly favors models with outer disks containing little or no dust beyond {approx}40 AU. The full SED can be modeled equally well with either an outer disk that is very compact (only a few AU wide) or a much larger one that has a very steep surface density profile. That is, T Cha's outer disk seems to be either very small or very tenuous. Both scenarios suggest a highly unusual outer disk and have important but different implications for the nature of T Cha. Spatially resolved images are needed to distinguish between the two scenarios.
BIOMINERALOGICAL INVESTIGATION OF APATITE PIEZOELECTRICITY
Directory of Open Access Journals (Sweden)
M. Pawlikowski
2016-01-01
Full Text Available Investigation of apatite piezoelectricity was conducted in order to assess piezoelectric properties of bone. In the first stage, mineralogical analysis of different apatite crystals, regarding their purity and fitness for the experiments was performed. After the crystals had been chosen, 0.8 mm-thick plates were cut, perpendicular and parallel to the crystallographic Z axis. The plates were then polished and dusted with gold. Electrodes were attached to the opposite surfaces of the plates with conductive glue. So prepared plates were hooked up to the EEG machine used for measuring electrical activity in the brain. The plates were then gently tapped to observe and register currents generated in them. Acquired data was processed by subtracting from the resulting graphs those generated by a hand movement, without tapping the plate. Results indicate that apatite plates have weak piezoelectric properties. Observed phenomenon may be translated to bone apatite, which would explain, at least partially, piezoelectric properties of bone. Acquired results suggest that there is a relation between the mechanical workload of bones (bone apatite and theirelectrical properties. Considering the massive internal surface of bones, they may be treated as a kind of internal “antenna” reacting not only to mechanical stimuli, but to changes in electromagnetic field as well. Observed phenomena no doubt significantly influence the biological processes occurring in bones and the whole human body.
International Nuclear Information System (INIS)
Eichert, D.; Salome, M.; Banu, M.; Susini, J.; Rey, C.
2005-01-01
Several reports have mentioned the existence of non-apatitic environments of phosphate and carbonate ions in synthetic and biological poorly crystalline apatites. However there were no direct spectroscopic evidences for the existence of non-apatitic environment of calcium ions. X-ray Absorption Spectroscopy, at the K-edge of calcium, allows the discrimination between different calcium phosphates of biological interest despite great spectral similarities. A primary analysis of the spectra reveals the existence, in synthetic poorly crystalline apatites, of variable features related to the maturation stage of the sample and corresponding to the existence of non-apatitic environments of calcium ions. Although these features can also be found in several other calcium phosphate salts, and do not allow a clear identification of the ionic environments of calcium ions, they give a possibility to directly determine the maturity of poorly crystalline apatite from calcium X-ray Absorption Near Edge Structure spectra
HERSCHEL OBSERVATIONS OF THE T CHA TRANSITION DISK: CONSTRAINING THE OUTER DISK PROPERTIES
Cieza, Lucas A.; Olofsson, Johan; Harvey, Paul M.; Pinte, Christophe; Merin, Bruno; Augereau, Jean-Charles; Evans, Neal J., II; Najita, Joan; Henning, Thomas; Menard, Francois
2011-01-01
T Cha is a nearby (d = 100 pc) transition disk known to have an optically thin gap separating optically thick inner and outer disk components. Huelamo et al. (2011) recently reported the presence of a low-mass object candidate within the gap of the T Cha disk, giving credence to the suspected planetary origin of this gap. Here we present the Herschel photometry (70, 160, 250, 350, and 500 micron) of T Cha from the "Dust, Ice, and Gas in Time" (DIGIT) Key Program, which bridges the wavelength ...
RBS and RNRA studies on sorption of europium by apatite
Energy Technology Data Exchange (ETDEWEB)
Ohnuki, Toshihiko; Kozai, Naofumi; Isobe, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Murakami, Takashi; Yamamoto, Shunya; Aoki, Yasushi; Naramoto, Hiroshi
1997-03-01
The sorption mechanism of europium, alternative of trivalent TRU has been studied based on the depth profiles of elements obtained by Rutherford Backscattering Spectroscopy (RBS) and Resonant Nuclear Reaction Analysis (RNRA). The positive peak for Eu and the negative peak for Ca were observed in the subtracted RBS spectra of the apatites on which Eu was sorbed from that of the fresh apatite. This indicates that Eu was sorbed on apatite, while a fraction of Ca was released from apatite. The peak height for Eu in the RBS spectrum of the apatite obtained at 75degC was higher than that of the apatite at 40degC. The depth profile of hydrogen of the apatite on which Eu was sorbed was similar to that of the fresh apatite. The concentration of Eu in the solution decreased with increasing temperature. On the contrary, the concentration of Ca increased with increasing temperature. Thus, it is concluded that a fraction of Eu is exchanged for Ca in the structure of apatite. (author)
Energy Technology Data Exchange (ETDEWEB)
Soulet, St
2000-11-15
decreases rapidly with the increase of SiO{sub 4}/PO{sub 4} ratio; this is in agreement with the conclusions of the study with natural analogous. It decreases also when the fluor anion is replaced by an hydroxyl group. With the current knowledge, the annealing by alpha seems to be an unique property of the apatitic structure. In order to model the behavior of ceramics when they are doped with actinides, it has been established, with defects creation and recovery velocities, the differential equation of the disorder evolution in terms of the storage or disposal time. The resolution of this equation in the case of the phospho-calcic fluoro-apatite and the fluoro-apatite with one silicate allows to conclude that these two potential matrices will probably keep their crystal structure during the storage or the disposal. (O.M.)
Ault, A. K.; Reiners, P. W.; Thomson, S. N.; Miller, G. H.
2015-12-01
Coupled apatite (U-Th)/He and fission-track (AFT) thermochronology data from the same sample can be used to decipher complex low temperature thermal histories and evaluate compatibility between these two methods. Existing apatite He damage-diffusivity models parameterize radiation damage annealing as fission-track annealing and yield inverted apatite He and AFT dates for samples with prolonged residence in the He partial retention zone. Apatite chemistry also impacts radiation damage and fission-track annealing, temperature sensitivity, and dates in both systems. We present inverted apatite He and AFT dates from the Rae craton, Baffin Island, Canada, that cannot be explained by apatite chemistry or existing damage-diffusivity and fission track models. Apatite He dates from 34 individual analyses from 6 samples range from 237 ± 44 Ma to 511 ± 25 Ma and collectively define a positive date-eU relationship. AFT dates from these same samples are 238 ± 15 Ma to 350 ± 20 Ma. These dates and associated track length data are inversely correlated and define the left segment of a boomerang diagram. Three of the six samples with 20-90 ppm eU apatite grains yield apatite He and AFT dates inverted by 300 million years. These samples have average apatite Cl chemistry of ≤0.02 wt.%, with no correlation between Cl content and Dpar. Thermal history simulations using geologic constraints, an apatite He radiation damage accumulation and annealing model, apatite He dates with the range of eU values, and AFT date and track length data, do not yield any viable time-temperature paths. Apatite He and AFT data modeled separately predict thermal histories with Paleozoic-Mesozoic peaks reheating temperatures differing by ≥15 °C. By modifying the parameter controlling damage annealing (Rmr0) from the canonical 0.83 to 0.5-0.6, forward models reproduce the apatite He date-eU correlation and AFT dates with a common thermal history. Results imply apatite radiation damage anneals at
Heating the Primordial Soup: X-raying the Circumstellar Disk of T Cha
Principe, David; Huenemoerder, D.; Kastner, J. H.; Bessell, M. S.; Sacco, G.
2014-01-01
The classical T Tauri Star (cTTS) T Chamaeleontis (T Cha) presents a unique opportunity to probe pre-main sequence star-disk interactions and late-stage circumstellar disk evolution. T Cha is the only known example of a nearly edge-on, actively accreting star/disk system within ~110 pc, and furthermore may be orbited by a low-mass companion or massive planet that has cleared an inner hole in its disk. The star is characterized by strong variability in the optical 3 magnitudes in the V band) as well as large and variable extinction (AV in the range of 1-5). Like most cTTS, T Cha is also a luminous X-ray source. We present preliminary results of two observations (totaling 150 ks) of T Cha with Chandra’s HETGS. Our motivations are to (a) determine the intrinsic X-ray spectrum of T Cha, so as to establish whether its X-ray emission can be attributed to accretion shocks, coronal emission, or a combination; (b) investigate whether its X-ray flux exhibits modulation that may be related to the stellar rotational period 3.3 days); and (c) take advantage of the nearly-edge-on disk viewing geometry to model the spectrum of X-rays absorbed by the gaseous disk orbiting T Cha. These results will serve as much-needed input to models of magnetospheric accretion and irradiated, planet-forming disks. This research is supported via award number GO3-14022X to RIT issued by the Chandra X-ray Observatory Center, which is operated by the Smithsonian Astrophysical Observatory for and on behalf of NASA under contract NAS803060. Additional support is provided by National Science Foundation grant AST-1108950 to RIT.
CHaMP metrics - Columbia Habitat Monitoring Program
National Oceanic and Atmospheric Administration, Department of Commerce — The goal of CHaMP is to generate and implement a standard set of fish habitat monitoring (status and trend) methods in up to 26 watersheds across the Columbia River...
Chaînes logistiques et consommation d'énergie : cas du yaourt et du jean
Rizet , C.; Keita , Basile
2005-01-01
Contrat INRETS/ADEME n°: 0203034; Rapport de recherche; Pour analyser l'efficacité énergétique et les émissions de GES des chaînes logistiques, on compare différentes chaînes aboutissant aux mêmes consommateurs. Deux produits sont étudiés : le yaourt, caractéristique de la chaîne du froid et des flux tendus et le blue jean, intégré au marché mondial, tant pour sa matière première principale (le coton) que pour les différentes étapes de sa fabrication. Les chaînes étudiées pour le jean différe...
Favoriser le développement de chaînes de valeur agricoles ...
International Development Research Centre (IDRC) Digital Library (Canada)
Favoriser le développement de chaînes de valeur agricoles inclusives et durables grâce aux TIC ... Ce projet vise à mettre l'information et les connaissances au service du développement de chaînes de valeur agricoles grâce à l'utilisation stratégique des TIC. ... Tropical Agriculture Research and Higher Education Center.
Insight into Biological Apatite: Physiochemical Properties and Preparation Approaches
Directory of Open Access Journals (Sweden)
Quan Liu
2013-01-01
Full Text Available Biological apatite is an inorganic calcium phosphate salt in apatite form and nano size with a biological derivation. It is also the main inorganic component of biological hard tissues such as bones and teeth of vertebrates. Consequently, biological apatite has a wide application in dentistry and orthopedics by using as dental fillers and bone substitutes for bone reconstruction and regeneration. Given this, it is of great significance to obtain a comprehensive understanding of its physiochemical and biological properties. However, upon the previous studies, inconsistent and inadequate data of such basic properties as the morphology, crystal size, chemical compositions, and solubility of biological apatite were reported. This may be ascribed to the differences in the source of raw materials that biological apatite are made from, as well as the effect of the preparation approaches. Hence, this paper is to provide some insights rather than a thorough review of the physiochemical properties as well as the advantages and drawbacks of various preparation methods of biological apatite.
Heart failure: a weak link in CHA2 DS2 -VASc.
Friberg, Leif; Lund, Lars H
2018-02-15
In atrial fibrillation, stroke risk is assessed by the CHA 2 DS 2 -VASc score. Heart failure is included in CHA 2 DS 2 -VASc, but the rationale is uncertain. Our objective was to test if heart failure is a risk factor for stroke, independent of other risk factors in CHA 2 DS 2 -VASc. We studied 300 839 patients with atrial fibrillation in the Swedish Patient Register 2005-11. Three definitions of heart failure were used in order to assess the robustness of the results. In the main analysis, heart failure was defined by a hospital discharge diagnosis of heart failure as first or second diagnosis and a filled prescription of a diuretic within 3 months before index + 30 days. The second definition counted first or second discharge diagnoses failure diagnosis in open or hospital care before index + 30 days. Associations with outcomes were assessed with multivariable Cox analyses. Patients with heart failure were older (80.5 vs. 74.0 years, P failure and 3.1% without. Adjustment for the cofactors in CHA 2 DS 2 -VASc eradicated the difference in stroke risk between patients with and without heart failure (hazard ratio 1.01 with 95% confidence interval 0.96-1.05). The area under the receiver operating characteristic curve for CHA 2 DS 2 -VASc was not improved by points for heart failure. A clinical diagnosis of heart failure was not an independent risk factor for stroke in patients with atrial fibrillation, which may have implications for anticoagulation management. © 2018 The Authors. ESC Heart Failure published by John Wiley & Sons Ltd on behalf of the European Society of Cardiology.
The oxidation state of sulfur in apatite: A new oxybarometer?
Fiege, A.; Konecke, B.; Kim, Y.; Simon, A. C.; Becker, U.; Parat, F.
2016-12-01
Oxygen fugacity (fO2) of magmatic and hydrothermal systems influences, for instance, crystallization and degassing processes as well as metal solubilities in melts and fluids. Apatite is a ubiquitous mineral in magmatic and hydrothermal environments that can record and preserve volatile zonation. It can contain several thousand μg/g of the redox sensitive element sulfur (S), making S-in-apatite a potential fO2 sensor. Despite the polyvalent properties of S (e.g., S2-, S4+, S6+), the oxidation state and incorporation mechanisms of S in the apatite structure are poorly understood. In this study, the oxidation state of S-in-apatite as a function of fO2 is investigated using X-ray absorption near-edge structures (XANES) spectroscopy at the S K-edge. Apatites crystallized from lamproitic melts at 1000°C, 300 MPa and over a broad range of fO2 and sulfur fugacities (fS2) were measured. Peaks corresponding to S6+ ( 2482 eV), S4+ ( 2478 eV) and S2- ( 2470 eV) were identified in apatite. The integrated S6+/STotal (STotal = S6+ + S4+ + S2-) peak area ratios show a distinct positive correlation with fO2, increasing from 0.17 at FMQ+0 to 0.96 at FMQ+3. Ab-initio calculations were performed to further understand the energetics and geometry of incorporation of S6+, S4+ and S2- into the apatite (F-, Cl-, OH-) end-members. The results confirm that apatite can contain three different oxidations states of S (S6+, S4+, S2-) as a function of fO2. This makes apatite probably the first geologically relevant mineral to incorporate reduced (S2-), intermediate (S4+), and oxidized (S6+) S in variable proportions. We emphasize that the strong dependence of the S oxidation state in apatite as a function of fO2 is also coupled with changing S content of apatite and co-existing melt (i.e., with changing fS2), resulting in a complex correlation between [1] apatite-melt (or fluid) partitioning, [2] redox conditions and [3] the melt and/or fluid composition, making the application of previously
Polycrystalline apatite synthesized by hydrothermal replacement of calcium carbonates
Kasioptas, Argyrios; Geisler, Thorsten; Perdikouri, Christina; Trepmann, Claudia; Gussone, Nikolaus; Putnis, Andrew
2011-06-01
Aragonite and calcite single crystals can be readily transformed into polycrystalline hydroxyapatite pseudomorphs by hydrothermal treatment in a (NH 4) 2HPO 4 solution. Scanning electron microscopy of the reaction products showed that the transformation of aragonite to apatite is characterised by the formation of a sharp interface between the two phases and by the development of intracrystalline porosity in the hydroxyapatite phase. In addition, electron backscattered diffraction (EBSD) imaging showed that the c-axis of apatite is predominantly oriented perpendicular to the reaction front with no crystallographic relationship to the aragonite lattice. However, the Ca isotopic composition of the parent aragonite, measured by thermal ionization mass spectrometry was inherited by the apatite product. Hydrothermal experiments conducted with use of phosphate solutions prepared with water enriched in 18O (97%) further revealed that the 18O from the solution is incorporated in the product apatite, as measured by micro-Raman spectroscopy. Monitoring the distribution of 18O with Raman spectroscopy was possible because the incorporation of 18O in the PO 4 group of apatite generates four new Raman bands at 945.8, 932, 919.7 and 908.8 cm -1, in addition to the ν1(PO 4) symmetric stretching band of apatite located at 962 cm -1, which can be assigned to four 18O-bearing PO 4 species. The relative intensities of these bands reflect the 18O content in the PO 4 group of the apatite product. By using equilibrated and non-equilibrated solutions, with respect to the 18O distribution between aqueous phosphate and water, we could show that the concentration of 18O in the apatite product is linked to the degree of 18O equilibration in the solution. The textural and chemical observations are indicative of a coupled mechanism of aragonite dissolution and apatite precipitation taking place at a moving reaction interface.
Energy Technology Data Exchange (ETDEWEB)
Deng, Yi [Department of Oral and Maxillofacial Surgery, Laboratory of Interdisciplinary Studies, School and Hospital of Stomatology, Peking University, Beijing 100081 (China); Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Interdisciplinary Studies, Peking University, Beijing 100871 (China); Sun, Yuhua [Department of Oral and Maxillofacial Surgery, Laboratory of Interdisciplinary Studies, School and Hospital of Stomatology, Peking University, Beijing 100081 (China); Chen, Xiaofang [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Interdisciplinary Studies, Peking University, Beijing 100871 (China); Zhu, Peizhi, E-mail: pzzhu@umich.edu [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Interdisciplinary Studies, Peking University, Beijing 100871 (China); Department of Chemistry, University of Michigan, Ann Arbor, MI 48109-1055 (United States); Wei, Shicheng, E-mail: sc-wei@pku.edu.cn [Department of Oral and Maxillofacial Surgery, Laboratory of Interdisciplinary Studies, School and Hospital of Stomatology, Peking University, Beijing 100081 (China); Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Interdisciplinary Studies, Peking University, Beijing 100871 (China)
2013-07-01
Biomimetic synthesis of carbonated apatites with good biocompatibility is a promising strategy for the broadening application of apatites for bone tissue engineering. Most researchers were interested in collagen or gelatin-based templates for synthesis of apatite minerals. Inspired by recent findings about the important role of polysaccharides in bone biomineralization, here we reported that heparin, a mucopolysaccharide, was used to synthesize carbonated apatites in vitro. The results indicated that the Ca/P ratio, carbon content, crystallinity and morphology of the apatites varied depending on the heparin concentration and the initial pH value. The morphology of apatite changed from flake-shaped to needle-shaped, and the degree of crystallinity decreased with the increasing of heparin concentration. Biocompatibility of the apatites was tested by proliferation and alkaline phosphatase activity of MC3T3-E1 cells. The results suggested that carbonated apatites synthesized in the presence of heparin were more favorable to the proliferation and differentiation of MC3T3-E1 cells compared with traditional method. In summary, the heparin concentration and the initial pH value play a key role in the chemical constitution and morphology, as well as biological properties of apatites. These biocompatible nano-apatite crystals hold great potential to be applied as bioactive materials for bone tissue engineering. - Highlights: • Heparin was used as a template to synthesize needle-shaped nano-apatite. • Changing the pH value and concentration led to different properties of apatite. • Apatite prepared by heparin was more favorable to the osteogenic differentiation. • Possible synthesis mechanism of apatite templated by heparin was described.
Kauffman, C J
1990-06-01
Having weathered the Depression and war years, CHA in the late 1940s looked forward to a new era in Catholic healthcare. The third and fourth articles of Health Progress's six-part history of CHA described how Rev. Alphonse M. Schwitalla, SJ, led the association through one of the most difficult periods in U.S. history. This article follows CHA's development into a modern service organization under the leadership of Rev. John J. Flanagan, SJ. The series' final installment, which will appear in the July-August issue, describes how CHA has modernized its services and structure in the past two decades to help its members adjust to a turbulent environment.
Sadove, G.; Konecke, B.; Fiege, A.; Simon, A. C.
2017-12-01
Multiple competing hypotheses attempt to explain the genesis of iron oxide-apatite (IOA) ore deposits. Many studies have investigated the chemistry of apatite because the abundances of F and Cl can distinguish magmatic vs. hydrothermal processes. Recent experiments demonstrate that apatite incorporates S6+, S4+, and S2-, and that total sulfur (∑S) as well as the S6+/∑S ratio in apatite vary systematically as a function of oxygen fugacity [1], providing information about sulfur budget and redox. Here, we present results from X-ray absorption near-edge structure (XANES) spectroscopy at the S K-edge, electron microprobe analyses, cathodoluminescence (CL) imaging, and element mapping of apatite from the Philip's Mine IOA deposit, southern Adirondack Mountains, USA. The Philip's Mine apatite contains inclusions of pyrite and pyrrhotite, where the latter includes iron oxide and Ni-rich domains. The apatite also contains inclusions of monazite, and exhibits complex CL zonation coincident with variations in the abundances of REE and S. The presence of monazite fingerprints fluid-mediated dissolution-reprecipitation of originally REE-enriched apatite [2]. The S XANES spectra reveal varying proportions of structurally bound S6+ and S2-, as the S6+/∑S ratio ranges from sulfide-only to sulfate-only. Notably, sulfide-dominated domains contain higher S contents than sulfate-dominated regions. These observations are consistent with co-crystallization of apatite and monosulfide solid solution (MSS) at reducing conditions, followed by decomposition of MSS to pyrrhotite, pyrite and intermediate solid solution (ISS, which is not preserved; [3]). Metasomatism of that assemblage by an oxidized fluid resulted in formation of monazite in apatite and iron oxide domains in pyrrhotite. We conclude that the deposit formed by a H2S-Fe-rich volatile phase, possibly evolved from a rather primitive magmatic source, which is consistent with the low Ti content of magnetite. The deposit was
Can Polyphosphate Biochemistry Affect Biological Apatite Saturation?
Omelon, S. J.; Matsuura, N.; Gorelikov, I.; Wynnyckyj, C.; Grynpas, M. D.
2010-12-01
Phosphorus (P) is an important and limiting element for life. One strategy for storing ortho phosphates (Pi) is polymerization. Polymerized Pi's (polyphosphates: (PO3-)n: polyPs) serve as a Pi bank, as well as a catiion chelator, energy source, & regulator of responses to stresses in the stationary phase of culture growth and development1. PolyP biochemistry has been investigated in yeasts, bacteria & plants2. Bigeochemical cycling of P includes the condensation of Pi into pyro (P2O7-4), & polyPs, & the release of Pi from these compounds by the hydrolytic degradation of Pi from phosphomonoester bonds. Alkaline phosphatase (ALP) is one of the predominate enzymes for regenerating Pi in aquatic systems3, & it cleaves Pi from polyPs. ALP is also the enzyme associated with apatite biomineralization in vertebrates4. PolyP was proposed to be the ALP substrate in bone mineralization5. Where calcium ions are plentiful in many aquatic environments, there is no requirement for aquatic life to generate Ca-stores. However, terrestrial vertebrates benefit from a bioavailable Ca-store such as apatite. The Pi storage strategy of polymerizing PO4-3 into polyPs dovetails well with Ca-banking, as polyPs sequester Ca, forming a neutral calcium polyphosphate (Ca-polyP: (Ca(PO3)2)n) complex. This neutral complex represents a high total [Ca+2] & [PO4-3], without the threat of inadvertent apatite precipitation, as the free [Ca+2] & [PO4-3], and therefore apatite saturation, are zero. Recent identification of polyP in regions of bone resorption & calcifying cartilage5 suggests that vertebrates may use polyP chemistry to bank Ca+2 and PO4-3. In vitro experiments with nanoparticulate Ca-polyP & ALP were undertaken to determine if carbonated apatite could precipitate from 1M Ca-polyP in Pi-free “physiological fluid” (0.1 M NaCl, 2 mM Ca+2, 0.8 mM Mg+2, pH ~8.0 ±0.5, 37 °C), as this is estimated to generate the [Ca+2] & [PO4-3] required to form the apatite content of bone tissue
Immobilization of uranium in contaminated soil by natural apatite addition
International Nuclear Information System (INIS)
Mrdakovic Popic, Jelena; Stojanovic, Mirjana; Milosevic, Sinisa; Iles, Deana; Zildzovic, Snezana
2007-01-01
Available in abstract form only. Full text of publication follows: The goal of this study was to evaluate the effectiveness of Serbian natural mineral apatite as soil additive for reducing the migration of uranium from contaminated sediments. In laboratory study we investigated the sorption properties of domestic apatite upon different experimental conditions, such as pH, adsorbent mass, reaction period, concentration of P 2 O 5 in apatite, solid/liquid ratio. In second part of study, we did the quantification of uranium in soil samples, taken from uranium mine site 'Kalna', by sequential extraction method. The same procedure was, also, used for uranium determination in contaminated soil samples after apatite addition, in order to determine the changes in U distribution in soil fraction. The obtained results showed the significant level of immobilization (96.7%) upon certain conditions. Increase of %P 2 O 5 in apatite and process of mechano-chemical activation led to increase of immobilization capacity from 17.50% till 91.64%. The best results for uranium binding were obtained at pH 5.5 and reaction period 60 days (98.04%) The sequential extraction showed the presence of uranium (48.2%) in potentially available soil fractions, but with the apatite addition uranium content in these fractions decreased (30.64%), what is considering environmental aspect significant fact. In situ immobilization of radionuclide using inexpensive sequestering agents, such as apatite, is very adequate for big contaminated areas of soil with low level of contamination. This investigation study on natural apatite from deposit 'Lisina' Serbia was the first one of this type in our country. Key words: apatite, uranium, immobilization, soil, contamination. (authors)
Nucleosome structure of the yeast CHA1 promoter
DEFF Research Database (Denmark)
Moreira, José Manuel Alfonso; Holmberg, S
1998-01-01
conditions. Five yeast TBP mutants defective in different steps in activated transcription abolished CHA1 expression, but failed to affect induction-dependent chromatin rearrangement of the promoter region. Progressive truncations of the RNA polymerase II C-terminal domain caused a progressive reduction...
Preparation of mica/apatite glass-ceramics biomaterials
International Nuclear Information System (INIS)
Liu Yong; Sheng Xiaoxian; Dan Xiaohong; Xiang Qijun
2006-01-01
Glass-ceramics have become more and more important biomaterials. In this work mica glass/apatite composites with various compositions were prepared by casting and subsequent heat treatments. The effects of composition, phase constitution and crystallinity on mechanical properties, including elastic modulus and transverse rupture strength (TRS), were investigated by using X-ray diffraction analyses (XRD), scanning electron microscopy (SEM) and mechanical tests. Results show that addition of apatite composition in mica glass accelerates the crystallization process and induces the formation of fluoroapatite phase, and the nucleation of apatite crystals occurs before that of mica crystals. The fuoroapatite in this work is needle-like, which is almost the same to that in human bone. The transverse rupture strength increases with the content of fluoroapatite and the crystallinity increasing, except that at a low apatite content the mechanical properties are lower than those of mica glass under the same processing conditions. The transverse rupture strength and elastic modulus obtained in this work fall in the range of those of human bone. SBF immersion test demonstrates good bioactivity of this biomaterial
Apatite mineralization in elasmobranch skeletons via a polyphosphate intermediate
Omelon, Sidney; Lacroix, Nicolas; Lildhar, Levannia; Variola, Fabio; Dean, Mason
2014-05-01
All vertebrate skeletons are stiffened with apatite, a calcium phosphate mineral. Control of apatite mineralization is essential to the growth and repair of the biology of these skeletons, ensuring that apatite is deposited in the correct tissue location at the desired time. The mechanism of this biochemical control remains debated, but must involve increasing the localized apatite saturation state. It was theorized in 1923 that alkaline phosphatase (ALP) activity provides this control mechanism by increasing the inorganic phosphate (Pi) concentration via dephosphorylation of phosphorylated molecules. The ALP substrate for biological apatite is not known. We propose that polyphosphates (polyPs) produced by mitochondria may be the substrate for biological apatite formation by ALP activity. PolyPs (PO3-)n, also known as condensed phosphates, represent a concentrated, bioavailable Pi-storage strategy. Mitochondria import Pi and synthesize phosphate polymers through an unknown biochemical mechanism. When chelated with calcium and/or other cations, the effective P-concentration of these neutrally charged, amorphous, polyP species can be very high (~ 0.5 M), without inducing phosphate mineral crystallization. This P-concentration in the low Pi-concentration biological environment offers a method of concentrating P well above an apatite supersaturation required for nucleation. Bone is the most studied mineralized skeletal tissue. However, locating and analyzing active mineralizing areas is challenging. We studied calcified cartilage skeletons of elasmobranch fishes (sharks, stingrays and relatives) to analyse the phosphate chemistry in this continually mineralizing skeleton. Although the majority of the elasmobranch skeleton is unmineralized cartilage, it is wrapped in an outer layer of mineralized tissue comprised of small tiles called tesserae. These calcified tesserae continually grow through the formation of new mineral on their borders. Co-localization of ALP and
Van Doorn, S.; Debray, T. P. A.; Kaasenbrood, F.; Hoes, A. W.; Rutten, F. H.; Moons, K. G. M.; Geersing, G. J.
2017-01-01
Essentials The widely recommended CHA2DS2-VASc shows conflicting results in contemporary validation studies. We performed a systematic review and meta-analysis of 19 studies validating CHA2DS2-VASc. There was high heterogeneity in stroke risks for different CHA2DS2-VASc scores. This was not
Bioceramics of apatites: an option for bone regeneration
International Nuclear Information System (INIS)
Arxer, Eliana Alves; Almeida Filho, Edson de; Guastaldi, Antonio Carlos
2011-01-01
The bioceramics of calcium phosphate called apatite, are widely used as material for bone replacement and regeneration, due to its similarity to the mineral component of bones and teeth. The apatites are biocompatible, bioactive and integrate with living tissue by the same active process of physiological bone remodeling. These bioceramics may be used in medical, dental and orthopedic applications. In this research, it was used the wet method for the synthesis of the powder and biomimetic method for coating the surface. The Solubility study was performed in the layer deposited, apatite, for possible application as a platform for inorganic drug delivery. The bioceramics were characterized by MEV, DRX, and EDS. The curves of solubility of apatite in coatings showed that the OCP phase had a higher rate of release in the short term (4 days) while the HA phase showed a gradual release throughout the experiment (16 days). (author)
Intraclonal genome diversity of Pseudomonas aeruginosa clones CHA and TB
2013-01-01
Background Adaptation of Pseudomonas aeruginosa to different living conditions is accompanied by microevolution resulting in genomic diversity between strains of the same clonal lineage. In order to detect the impact of colonized habitats on P. aeruginosa microevolution we determined the genomic diversity between the highly virulent cystic fibrosis (CF) isolate CHA and two temporally and geographically unrelated clonal variants. The outcome was compared with the intraclonal genome diversity between three more closely related isolates of another clonal complex. Results The three clone CHA isolates differed in their core genome in several dozen strain specific nucleotide exchanges and small deletions from each other. Loss of function mutations and non-conservative amino acid replacements affected several habitat- and lifestyle-associated traits, for example, the key regulator GacS of the switch between acute and chronic disease phenotypes was disrupted in strain CHA. Intraclonal genome diversity manifested in an individual composition of the respective accessory genome whereby the highest number of accessory DNA elements was observed for isolate PT22 from a polluted aquatic habitat. Little intraclonal diversity was observed between three spatiotemporally related outbreak isolates of clone TB. Although phenotypically different, only a few individual SNPs and deletions were detected in the clone TB isolates. Their accessory genome mainly differed in prophage-like DNA elements taken up by one of the strains. Conclusions The higher geographical and temporal distance of the clone CHA isolates was associated with an increased intraclonal genome diversity compared to the more closely related clone TB isolates derived from a common source demonstrating the impact of habitat adaptation on the microevolution of P. aeruginosa. However, even short-term habitat differentiation can cause major phenotypic diversification driven by single genomic variation events and uptake of phage
Study on apatite compounds; Apataitokei kagobutsu ni kansuru kenkyu
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-11-28
To clarify the material properties of apatite compounds, the synthesis method, and the evaluation of physical properties of material and elementary technology were investigated. For the study on synthesis and crystal growth, a method of precipitating calcium phosphate on the surface of metal was investigated by means of relatively mild electrolytic method using liquid phase system. A new molding method of Ca defective apatite was established. Composite similar to vital bone was prepared by means of a new low-temperature sintering. For the study on chemical properties, from the model experiments, it was found that the self-organizing phenomenon, which is observed in the composite of apatite and collagen, happened between the organic single molecular film and crystal of apatite. For the study on evaluation of physical properties and elementary technology, the surface and interface of ceramics such as apatite were investigated by means of spectroscopy, the electronic state was analyzed by the quantum chemical calculation, and the crystalline structure was analyzed using X-ray equipment. 270 refs., 102 figs., 10 tabs.
Montefusco, David J; Newcomb, Benjamin; Gandy, Jason L; Brice, Sarah E; Matmati, Nabil; Cowart, L Ashley; Hannun, Yusuf A
2012-03-16
Targets of bioactive sphingolipids in Saccharomyces cerevisiae were previously identified using microarray experiments focused on sphingolipid-dependent responses to heat stress. One of these heat-induced genes is the serine deamidase/dehydratase Cha1 known to be regulated by increased serine availability. This study investigated the hypothesis that sphingolipids may mediate the induction of Cha1 in response to serine availability. The results showed that inhibition of de novo synthesis of sphingolipids, pharmacologically or genetically, prevented the induction of Cha1 in response to increased serine availability. Additional studies implicated the sphingoid bases phytosphingosine and dihydrosphingosine as the likely mediators of Cha1 up-regulation. The yeast protein kinases Pkh1 and Pkh2, known sphingoid base effectors, were found to mediate CHA1 up-regulation via the transcription factor Cha4. Because the results disclosed a role for sphingolipids in negative feedback regulation of serine metabolism, we investigated the effects of disrupting this mechanism on sphingolipid levels and on cell growth. Intriguingly, exposure of the cha1Δ strain to high serine resulted in hyperaccumulation of endogenous serine and in turn a significant accumulation of sphingoid bases and ceramides. Under these conditions, the cha1Δ strain displayed a significant growth defect that was sphingolipid-dependent. Together, this work reveals a feedforward/feedback loop whereby the sphingoid bases serve as sensors of serine availability and mediate up-regulation of Cha1 in response to serine availability, which in turn regulates sphingolipid levels by limiting serine accumulation.
Xue, Caibao; Chen, Yingzhi; Huang, Yongzhuo; Zhu, Peizhi
2015-08-01
Highly crystalline carbonated hydroxyapatite (CHA) nanorods with different carbonate contents were synthesized by a novel hydrothermal method. The crystallinity and chemical structure of synthesized nanorods were studied by Fourier transform infrared spectroscopy (FTIR), X-ray photo-electronic spectroscopy (XPS), X-ray diffraction (XRD), Raman spectroscopy, and transmission electron microscopy (TEM). The biocompatibility of synthesized CHA nanorods was evaluated by cell viability and alkaline phosphatase (ALP) activity of MG-63 cell line. The biocompatibility evaluation results show that these CHA nanorods are biologically active apatites and potentially promising bone-substitute biomaterials for orthopedic application.
UV photofunctionalization promotes nano-biomimetic apatite deposition on titanium
Directory of Open Access Journals (Sweden)
Saita M
2016-01-01
Full Text Available Makiko Saita,1 Takayuki Ikeda,1,2 Masahiro Yamada,1,3 Katsuhiko Kimoto,4 Masaichi Chang-Il Lee,5 Takahiro Ogawa1 1Division of Advanced Prosthodontics, Weintraub Center for Reconstructive Biotechnology, UCLA School of Dentistry, Los Angeles, CA, USA; 2Department of Complete Denture Prosthodontics, Nihon University School of Dentistry, Yokosuka, Japan; 3Division of Molecular and Regenerative Prosthodontics, Tohoku University Graduate School of Dentistry, Sendai, Miyagi, Japan; 4Department of Prosthodontics and Oral Rehabilitation, 5Yokosuka-Shonan Disaster Health Emergency Research Center and ESR Laboratories, Kanagawa Dental University Graduate School of Dentistry, Yokosuka, Japan Background: Although biomimetic apatite coating is a promising way to provide titanium with osteoconductivity, the efficiency and quality of deposition is often poor. Most titanium implants have microscale surface morphology, and an addition of nanoscale features while preserving the micromorphology may provide further biological benefit. Here, we examined the effect of ultraviolet (UV light treatment of titanium, or photofunctionalization, on the efficacy of biomimetic apatite deposition on titanium and its biological capability.Methods and results: Micro-roughed titanium disks were prepared by acid-etching with sulfuric acid. Micro-roughened disks with or without photofunctionalization (20-minute exposure to UV light were immersed in simulated body fluid (SBF for 1 or 5 days. Photofunctionalized titanium disks were superhydrophilic and did not form surface air bubbles when immersed in SBF, whereas non-photofunctionalized disks were hydrophobic and largely covered with air bubbles during immersion. An apatite-related signal was observed by X-ray diffraction on photofunctionalized titanium after 1 day of SBF immersion, which was equivalent to the one observed after 5 days of immersion of control titanium. Scanning electron microscopy revealed nodular apatite deposition
Determination of palaeotemperatures of apatite with the fission-track method
International Nuclear Information System (INIS)
Bertagnolli, E.; Maerk, E.; Bertel, E.; Pahl, M.; Maerk, T.D.
1981-01-01
As a consequence of thermal fading of fission tracks in minerals, the fission-track dating method can be used to obtain a sensitive geothermometer for unfolding thermal events in the history of rocks, especially if it is possible to determine the temperature associated with a measured fission-track age, i.e., yielding a temperature age. Based on the concept of a minimum fission-track length the differential annealing equation has been solved for apatite, taking into account the fact that the annealing coefficient depends also on the degree of fission-track reduction. This allows us to calculate an improved age-temperature relationship for apatite, which gives for a measured corrected fission-track age the corresponding temperature, assuming either linear or exponential time-dependence of the temperature. The present results for apatite are compared with previous calculations in apatite and sphene. As expected, a fission-track age of apatite dates a younger (lower temperature) point in the thermal-cooling history than a fission-track age of sphene. (author)
Apatite-mediated actin dynamics in resorbing osteoclasts.
Saltel, Frédéric; Destaing, Olivier; Bard, Frédéric; Eichert, Diane; Jurdic, Pierre
2004-12-01
The actin cytoskeleton is essential for osteoclasts main function, bone resorption. Two different organizations of actin have been described in osteoclasts, the podosomes belt corresponding to numerous F-actin columns arranged at the cell periphery, and the sealing zone defined as a unique large band of actin. To compare the role of these two different actin organizations, we imaged osteoclasts on various substrata: glass, dentin, and apatite. Using primary osteoclasts expressing GFP-actin, we found that podosome belts and sealing zones, both very dynamic actin structures, were present in mature osteoclasts; podosome belts were observed only in spread osteoclasts adhering onto glass, whereas sealing zone were seen in apico-basal polarized osteoclasts adherent on mineralized matrix. Dynamic observations of several resorption cycles of osteoclasts seeded on apatite revealed that 1) podosomes do not fuse together to form the sealing zone; 2) osteoclasts alternate successive stationary polarized resorption phases with a sealing zone and migration, nonresorption phases without any specific actin structure; and 3) apatite itself promotes sealing zone formation though c-src and Rho signaling. Finally, our work suggests that apatite-mediated sealing zone formation is dependent on both c-src and Rho whereas apico-basal polarization requires only Rho.
Mueller, Barbara
2016-04-01
Using bacteria of the strain Pseudomonas fluorescens wild type CHA0 and its genetic derivative strains CHA77, CHA89, CHA400, CHA631 and CHA661 (which differ in one gene only) the changes in chemical, mineralogical and rheological properties of the clay mineral vermiculite affected by microbial activity were studied in order to test whether the individually different production of metabolites by the genetically engineered strains may alter the clay mineral vermiculite in distinct ways. With the novel strategy of working with living wild type bacteria, their genetic derivatives and clay, the following properties of the mineral altered by the various strains of Pseudomonas fluorescens were determined: grain size, X-Ray diffraction pattern, intercrystalline swelling with glycerol, layer charge, CEC, BET surface and uptake of trace elements. Laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) was used to determine the changes in major, minor and trace elements of the clay vermiculite affected by microbial activity. Among all analyzed trace elements, Fe, Mn and Cu are the most interesting. Fe and Mn are taken up from the clay mineral by all bacterial strains whereas Cu is only removed from vermiculite by strains CHA0, CHA77, CHA400 and CHA661. The latter mentioned strains all produce the antibiotics 2,4-diacetylphloroglucinol and monoacetylphloroglucinol which can complex Cu efficiently. Therefore the alteration of only one gene of the bacteria is causing significant effects on the clay mineral.
Directory of Open Access Journals (Sweden)
Mohammad Ali Rajabzadeh
2014-10-01
Full Text Available Introduction Iron-apatite ore deposits well known as Kiruna iron type formed in association with calc-alkaline volcanism from Proterozoic to Tertiary (Hitzman et al., 1992. Liquid immiscibility in an igneous system was proposed to explain the formation of the iron oxides accompanying apatite in mineralized zones (Förster and Jafarzadeh, 1994; Daliran, 1999. The mode of ore formation however, is a matter in debate. Bafq region in Central Iran is one of the greatest iron mining regions in Iran with 750 million tons of reservoir. The majority of the iron deposits contains apatite as minor mineral and underwent metamorphism-alteration in varying degrees. The mode of formation and geological setting of Esfordi iron-apatite deposit in this region with an average of 13.9 wt% apatite are discussed using geochemical and mineralogical data along with field description. Materials and methods Fifty-three samples of mineralized zones and host rocks collected from 7 cross sections were studied by conventional microscopic methods. Seven representative samples were determined by XRD at Department of Physics, Shiraz University. Fifteen and six samples were also analyzed for major and trace elements using XRF at Binaloud Co. Iran, and ICP-MS at Labwest Minerals Analysis, Australia, respectively. Microprobe analyses were carried out on apatite in Geo Forschungs Zentrum Telegrafenberg at Potsdam University, Germany. Results Field observation shows that igneous host rocks in Esfordi were intensively altered by hydrothermal fluids. The ores are surrounded by wide altered halos. Petrographic investigation indicated that the most important alterations are of potassic, carbonatitic and silicification types. Magnetite and apatite occur as major minerals, accompanied by minor hematite and goethite in the mineralized zones. Rare Earth Element (REE minerals are present as minor phases in the ores. Three apatite mineralization types (vein, massive, and disseminated were
Tooth apatite as a bone substitute: an experimental study and clinical applications
International Nuclear Information System (INIS)
Eun-Seok Kim; Pill-Hoon Choung
1999-01-01
The purpose of this study is to evaluate the usefulness of calcined teeth powder as biological apatite. The animal experiment was performed in 36 rabbits aging 6 weeks and weighing 1.6 kg. In experimental group, tooth apatite powder was implanted to 10 mm bony defects in diameter made on the cranial bone of the rabbits. As control groups, synthetic porous hydroxyapatite and resorbable type calcium carbonate were implanted to the defects of same size. Each group was sacrificed in 1, 2, 4, 6, 8, 12 weeks after the surgery. Specimens were prepared for decalcified samples and observed by a light microscope. And we also performed quantitative analysis of new bone formation through image analysis using computer. In clinical applications, we used tooth apatite alone or mixed with decalcified freeze-dried bone for reconstruction of bony defects in 15 patients undergone enucleation of cyst or ameloblastoma. The obtained results were as follows; 1) The powder of the calcined teeth was called as 'tooth apatite' and it seemed to have biocompatibility in rabbits and human. 2) In group of tooth apatite, after 4 weeks of operation, new bone directly bonded to the particles was observed. And in 12 weeks of it, new bone occupied most of the bony defects. In 6 weeks, resorption of the tooth apatite particles was observed. Thus the tooth apatite was regarded as one of resorbable apatite. 3) The group of tooth apatite showed new bone formation similar to the group of porous hydroxyapatite, but they were inferior to the group of resorbable calcium carbonate. 4) In clinical application, tooth apatite had biocompatibility and new bone formation was observed without any complication except for 1 case. So we think it is a useful bone substitute with osteoconductivity
Effect of radiation damage on the infrared properties of apatite
International Nuclear Information System (INIS)
Anis Faridah Md Nori; Yusof Mohd Amin; Rosli Mahat; Burhanuddin Kamaluddin
1991-01-01
Apatites are known to contain radioactive elements such as uranium and thorium at a few ppm in concentration. These elements decay and produce fission tracks inside the crystals. The presence of such tracks have been known to affect the thermoluminescence (TL) properties of apatites. These fission tracks can be removed by annealing the crystals in air. In this paper we present the result of a preliminary study on the effect of radiation damage on the infrared transmission of apatites
Pyrophosphate-Inhibition of Apatite Formation Studied by In Situ X-Ray Diffraction
Directory of Open Access Journals (Sweden)
Casper Jon Steenberg Ibsen
2018-02-01
Full Text Available The pathways to crystals are still under debate, especially for materials relevant to biomineralization, such as calcium phosphate apatite known from bone and teeth. Pyrophosphate is widely used in biology to control apatite formation since it is a potent inhibitor of apatite crystallization. The impacts of pyrophosphate on apatite formation and crystallization kinetics are, however, not fully understood. Therefore, we studied apatite crystallization in water by synchrotron in situ X-ray diffraction. Crystallization was conducted from calcium chloride (0.2 M and sodium phosphate (0.12 M at pH 12 where hydrogen phosphate is the dominant phosphate species and at 60 °C to allow the synchrotron measurements to be conducted in a timely fashion. Following the formation of an initial amorphous phase, needle shaped crystals formed that had an octacalcium phosphate-like composition, but were too small to display the full 3D periodic structure of octacalcium phosphate. At later growth stages the crystals became apatitic, as revealed by changes in the lattice constant and calcium content. Pyrophosphate strongly inhibited nucleation of apatite and increased the onset of crystallization from minute to hour time scales. Pyrophosphate also reduced the rate of growth. Furthermore, when the pyrophosphate concentration exceeded ~1% of the calcium concentration, the resultant crystals had reduced size anisotropy suggesting that pyrophosphate interacts in a site-specific manner with the formation of apatite crystals.
Osada, Toshihiro; Tanaka, Yuki; Yamada, Akira; Sasaki, Eiji; Utsugi, Teruhiro
2018-03-07
About one-third of the Japanese population suffers from Japanese cedar pollinosis, which is frequently accompanied by Japanese cypress pollinosis. Recently, a novel major Japanese cypress pollen allergen, Cha o 3, was discovered. However, whether a Cha o 3 homolog is present in Japanese cedar pollen remains to be determined. Western blot analysis was performed using Cha o 3-specific antiserum. In addition, cloning of the gene encoding Cry j 4 was conducted using total cDNA from the male flower of Japanese cedar trees. Allergen potency and cross-reactivity were investigated using a T-cell proliferation assay, basophil activation test, and ImmunoCAP inhibition assay. A low amount of Cha o 3 homolog protein was detected in Japanese cedar pollen extract. The deduced amino acid sequence of Cry j 4 showed 84% identity to that of Cha o 3. Cross-reactivity between Cry j 4 and Cha o 3 was observed at the T cell and IgE levels. Cry j 4 was discovered as a counterpart allergen of Cha o 3 in Japanese cedar pollen, with a relationship similar to that between Cry j 1-Cha o 1 and Cry j 2-Cha o 2. Our findings also suggest that allergen-specific immunotherapy (ASIT) using Japanese cedar pollen extract does not induce adequate immune tolerance to Cha o 3 due to the low amount of Cry j 4 in Japanese cedar pollen. Therefore, ASIT using Cha o 3 or cypress pollen extract coupled with Japanese cedar pollen extract is required in order to optimally control allergy symptoms during Japanese cypress pollen season. Copyright © 2018 Japanese Society of Allergology. Production and hosting by Elsevier B.V. All rights reserved.
Rare earth elements materials production from apatite ores
International Nuclear Information System (INIS)
Anufrieva, A V; Buynovskiy, A S; Makaseev, Y N; Mazov, I N; Nefedov, R A; Sachkov, V I; Valkov, A V; Andrienko, O S; Stepanova, O B
2016-01-01
The paper deals with the study of processing apatite ores with nitric acid and extraction of the rare earth elements. The rare earth elements can be successfully separated and recovered by extraction from the nitrate- phosphate solution, being an tributyl phosphate as extraction agent. The developed scheme of the processing apatite concentrate provides obtaining rare earth concentrates with high qualitative characteristics. (paper)
Siddiqui, I A; Shaukat, S S; Khan, A
2004-01-01
The aim was to determine the influence of some Aspergillus species on the production of nematicidal agent(s) in vitro and biocontrol of Meloidogyne javanica in tomato by Pseudomonas fluorescens strains CHA0 and CHA0/pME3424. Six species of Aspergillus, isolated from the rhizosphere of certain crops, produced a variety of secondary metabolites in vitro. Culture filtrate (CF) obtained from Ps. fluorescens strain CHA0 and its2,4-diacetylphloroglucinol overproducing mutant CHA0/pME3424 grown in King's B liquid medium caused significant mortality of M. javanica juveniles in vitro. Bacterial growth medium amended with CF of A. niger enhanced nematicidal and beta-galactosidase activities of fluorescent pseudomonads while A. quadrilineatus repressed such activities. Methanol or ethyl acetate extracts of the CF of A. niger markedly optimized bacterial efficacy to cause nematode deaths while hexane extract of the fungus had no influence on the nematicidal activity of the bacterial strains. A. niger applied alone or in conjunction with the bacterial inoculants inhibited root-knot nematode galling in tomato. On the other hand, A. quadrilineatus used alone or together with CHA0 did not inhibit nematode galling but when used in combination with strain CHA0/pME3424 did reduce galling intensity. Aspergillus niger enhances the production of nematicidal compounds by Ps. fluorescensin vitro and improves biocontrol potential of the bacterial inoculants in tomato while A. quadrilineatus reduces bacterial performance to suppress root-knot nematodes. Rhizosphere harbours a variety of micro-organisms including bacteria, fungi and viruses. Aspergillus species are ubiquitous in most agricultural soils and generally produce a variety of secondary metabolites. Such metabolites synthesized by Aspergillus species may influence the production of nematicidal agents and subsequent biocontrol performance of the bacterial inoculants against plant-parasitic nematodes. This fact needs to be taken into
Energy Technology Data Exchange (ETDEWEB)
Iafisco, Michele, E-mail: michele.iafisco@istec.cnr.it; Ruffini, Andrea; Adamiano, Alessio; Sprio, Simone; Tampieri, Anna
2014-02-01
The present work investigates the preparation of biomimetic nanocrystalline apatites co-substituted with Mg, CO{sub 3} and Sr to be used as starting materials for the development of nanostructured bio-devices for regeneration of osteoporotic bone. Biological-like amounts of Mg and CO{sub 3} ions were inserted in the apatite structure to mimic the composition of bone apatite, whereas the addition of increasing quantities of Sr ions, from 0 up to 12 wt.%, as anti-osteoporotic agent, was evaluated. The chemical–physical features, the morphology, the degradation rates, the ion release kinetics as well as the in vitro bioactivity of the as-prepared apatites were fully evaluated. The results indicated that the incorporation of 12 wt.% of Sr can be viewed as a threshold for the structural stability of Mg–CO{sub 3}-apatite. Indeed, incorporation of lower quantity of Sr did not induce considerable variations in the chemical structure of Mg–CO{sub 3}-apatite, while when the Sr doping extent reached 12 wt.%, a dramatically destabilizing effect was detected on the crystal structure thus yielding alteration of the symmetry and distortion of the PO{sub 4}. As a consequence, this apatite exhibited the fastest degradation kinetic and the highest amount of Sr ions released when tested in physiological conditions. In this respect, the surface crystallization of new calcium phosphate phase when immersed in physiological-like solution occurred by different mechanisms and extents due to the different structural chemistry of the variously doped apatites. Nevertheless, all the apatites synthesized in this work exhibited in vitro bioactivity demonstrating their potential use to develop biomedical devices with anti-osteoporotic functionality. - Highlights: • Biomimetic nanocrystalline apatites co-substituted with Mg, CO{sub 3} and Sr were prepared. • Biological-like amounts of Mg and CO{sub 3} were inserted to mimic the composition of bone apatite. • The addition of increasing
International Nuclear Information System (INIS)
Iafisco, Michele; Ruffini, Andrea; Adamiano, Alessio; Sprio, Simone; Tampieri, Anna
2014-01-01
The present work investigates the preparation of biomimetic nanocrystalline apatites co-substituted with Mg, CO 3 and Sr to be used as starting materials for the development of nanostructured bio-devices for regeneration of osteoporotic bone. Biological-like amounts of Mg and CO 3 ions were inserted in the apatite structure to mimic the composition of bone apatite, whereas the addition of increasing quantities of Sr ions, from 0 up to 12 wt.%, as anti-osteoporotic agent, was evaluated. The chemical–physical features, the morphology, the degradation rates, the ion release kinetics as well as the in vitro bioactivity of the as-prepared apatites were fully evaluated. The results indicated that the incorporation of 12 wt.% of Sr can be viewed as a threshold for the structural stability of Mg–CO 3 -apatite. Indeed, incorporation of lower quantity of Sr did not induce considerable variations in the chemical structure of Mg–CO 3 -apatite, while when the Sr doping extent reached 12 wt.%, a dramatically destabilizing effect was detected on the crystal structure thus yielding alteration of the symmetry and distortion of the PO 4 . As a consequence, this apatite exhibited the fastest degradation kinetic and the highest amount of Sr ions released when tested in physiological conditions. In this respect, the surface crystallization of new calcium phosphate phase when immersed in physiological-like solution occurred by different mechanisms and extents due to the different structural chemistry of the variously doped apatites. Nevertheless, all the apatites synthesized in this work exhibited in vitro bioactivity demonstrating their potential use to develop biomedical devices with anti-osteoporotic functionality. - Highlights: • Biomimetic nanocrystalline apatites co-substituted with Mg, CO 3 and Sr were prepared. • Biological-like amounts of Mg and CO 3 were inserted to mimic the composition of bone apatite. • The addition of increasing quantities of Sr (from 0 to 12
DEFF Research Database (Denmark)
Godiksen, Anita; Stappen, Frederick N.; Vennestrøm, Peter N. R.
2014-01-01
Cu-CHA combines high activity for the selective catalytic reduction (SCR) reaction with better hydrothermal stability and selectivity compared to other copper-substituted zeolites. At the same time Cu-CHA offers an opportunity for unraveling the coordination environment of the copper centers since...... the zeolite framework is very simple with only one crystallographically independent tetrahedral site (T-site). In this study the results of an X-band electron paramagnetic resonance (EPR) investigation of ion-exchanged Cu-CHA zeolite with a Si/Al ratio of 14 ± 1 is presented. Different dehydration treatments...... of the EPR silent monomeric Cu2+ in copper-substituted zeolites is suggested to be copper species with an approximate trigonal coordination sphere appearing during the dehydration. After complete dehydration at 250 °C the majority of the EPR silent Cu2+ is suggested to exist as Cu2+–OH– coordinated to two...
Jeong, Namjo; Cha, Misun; Park, Yun Chang; Lee, Kyung Mee; Lee, Jae Hyup; Park, Byong Chon; Lee, Junghoon
2013-07-23
Vertically aligned one-dimensional hybrid structures, which are composed of apatite and graphitic structures, can be beneficial for orthopedic applications. However, they are difficult to generate using the current method. Here, we report the first synthesis of a single-crystal apatite nanowire encapsulated in graphitic shells by a one-step chemical vapor deposition. Incipient nucleation of apatite and its subsequent transformation to an oriented crystal are directed by derived gaseous phosphorine. Longitudinal growth of the oriented apatite crystal is achieved by a vapor-solid growth mechanism, whereas lateral growth is suppressed by the graphitic layers formed through arrangement of the derived aromatic hydrocarbon molecules. We show that this unusual combination of the apatite crystal and the graphitic shells can lead to an excellent osteogenic differentiation and bony fusion through a programmed smart behavior. For instance, the graphitic shells are degraded after the initial cell growth promoted by the graphitic nanostructures, and the cells continue proliferation on the bare apatite nanowires. Furthermore, a bending experiment indicates that such core-shell nanowires exhibited a superior bending stiffness compared to single-crystal apatite nanowires without graphitic shells. The results suggest a new strategy and direction for bone grafting materials with a highly controllable morphology and material conditions that can best stimulate bone cell differentiation and growth.
Understanding the evolution of S- and I-type granitic plutons through analysis of apatite.
Hess, B. L.; Fiege, A.; Tailby, N.
2017-12-01
The major and trace element composition of apatites from the Lachlan fold belt (LFB) S- and I-type granitoids (Australia) and the Central French Massif (CFM) S-type leucogranites (France) were analyzed to investigate their compositional and redox variation. Apatite is a common accessory mineral in magmatic systems that can incorporate a variety of trace elements, including the polyvalent elements sulfur (S), iron (Fe), and manganese (Mn). It was recently discovered that apatite can incorporate three oxidation states of S (S6+, S4+, S2-) into its structure as a function of oxygen fugacity [1]. However, the oxidation states of Mn and Fe in apatite are essentially unknown (2+ and/or 3+). In this study, we collected many electron probe line transects across apatites in several different host phases from a variety of S- and I-type plutons. The F-H-Cl contents of the S- and I-type LFB samples were similar ( 2.9 wt% F, 0.4 wt% Cl, 0.5 wt% OH). The CFM S-types contained virtually no Cl and ranged from near-endmember OH-apatite to near-endmember F-apatite. The apatites of all studied the S- and I-type plutons are characterized by similar ranges of Fe content (X-ray absorption near-edge structure (XANES) spectroscopy. The spectra show variability in S oxidation states ranging from mostly sulfate down to nearly equal S6+/S2- ratios, indicating redox variations during apatite formation. The S-type Mn + Fe content plots in a 1:1 ratio against calcium (Ca) in atoms per formula unit, while the I-type apatites have too low Mn and Fe to show a clear trend. Thus, divalent Mn and Fe probably replace Ca2+ in the S-types' apatite structure, while the incorporation of trivalent Mn or Fe in apatite is rather unlikely. We suggest that Mn and Fe contents in apatite may become a useful tracer of melt evolution once the distributions coefficients are experimentally calibrated. [1] Konecke et al. (2017), Am Mineral
Calcium phosphate nuclear materials: apatitic ceramics for separated wastes
International Nuclear Information System (INIS)
Carpena, J.; Lacout, J.L.
2005-01-01
Is it feasible to elaborate conditioning materials for separated high activity nuclear wastes, as actinides or fission products? Specific materials have been elaborated so that the waste is incorporated within the crystalline structure of the most stable calcium phosphate, i.e. apatite. This mineral is able to sustain high irradiation doses assuming a well chosen chemical composition. Mainly two different ways of synthesis have been developed to produce hard apatite ceramics that can be used to condition nuclear wastes. Here we present a data synthesis regarding the elaboration of these apatite nuclear materials that includes experiments on crystallo-chemistry, chemical analysis, leaching and irradiation tests performed for the past fifteen years. (authors)
Lead Speciation and Bioavailability in Apatite-Amended Sediments
Directory of Open Access Journals (Sweden)
Kirk G. Scheckel
2011-01-01
Full Text Available The in situ sequestration of lead (Pb in sediment with a phosphate amendment was investigated by Pb speciation and bioavailability. Sediment Pb in preamendment samples was identified as galena (PbS with trace amounts of absorbed Pb. Sediment exposed to atmospheric conditions underwent conversion to hydrocerussite and anglesite. Sediments mixed with apatite exhibited limited conversion to pyromorphite, the hypothesized end product. Conversion of PbS to pyromorphite is inhibited under reducing conditions, and pyromorphite formation appears limited to reaction with pore water Pb and PbS oxidation products. Porewater Pb values were decreased by 94% or more when sediment was amended with apatite. The acute toxicity of the sediment Pb was evaluated with Hyalella azteca and bioaccumulation of Pb with Lumbriculus variegatus. The growth of H. azteca may be mildly inhibited in contaminated sediment, with apatite-amended sediments exhibiting on average a higher growth weight by approximately 20%. The bioaccumulation of Pb in L. variegatus tissue decreased with increased phosphate loading in contaminated sediment. The study indicates limited effectiveness of apatite in sequestering Pb if present as PbS under reducing conditions, but sequestration of porewater Pb and stabilization of near-surface sediment may be a feasible and alternative approach to decreasing potential toxicity of Pb.
Energy Technology Data Exchange (ETDEWEB)
Visan, A. [National Institute for Lasers, Plasma, and Radiation Physics, 409 Atomistilor Street, RO-77125, MG-36, Magurele-Ilfov (Romania); Grossin, D. [CIRIMAT – Carnot Institute, University of Toulouse, ENSIACET, 4 Allée Emile Monso, 31030 Toulouse Cedex 4 (France); Stefan, N.; Duta, L.; Miroiu, F.M. [National Institute for Lasers, Plasma, and Radiation Physics, 409 Atomistilor Street, RO-77125, MG-36, Magurele-Ilfov (Romania); Stan, G.E. [National Institute of Materials Physics, RO-077125, Magurele-Ilfov (Romania); Sopronyi, M.; Luculescu, C. [National Institute for Lasers, Plasma, and Radiation Physics, 409 Atomistilor Street, RO-77125, MG-36, Magurele-Ilfov (Romania); Freche, M.; Marsan, O.; Charvilat, C. [CIRIMAT – Carnot Institute, University of Toulouse, ENSIACET, 4 Allée Emile Monso, 31030 Toulouse Cedex 4 (France); Ciuca, S. [Politehnica University of Bucharest, Faculty of Materials Science and Engineering, Bucharest (Romania); Mihailescu, I.N., E-mail: ion.mihailescu@inflpr.ro [National Institute for Lasers, Plasma, and Radiation Physics, 409 Atomistilor Street, RO-77125, MG-36, Magurele-Ilfov (Romania)
2014-02-15
Highlights: • We report the deposition by MAPLE of biomimetic apatite coatings on Ti substrates. • This is the first report of MAPLE deposition of hydrated biomimetic apatite films. • Biomimetic apatite powder was synthesized by double decomposition process. • Non-apatitic environments, of high surface reactivity, are preserved post-deposition. • We got the MAPLE complete transfer as thin film of a hydrated, delicate material. -- Abstract: We report the deposition by Matrix Assisted Pulsed Laser Evaporation (MAPLE) technique of biomimetic nanocrystalline apatite coatings on titanium substrates, with potential application in tissue engineering. The targets were prepared from metastable, nanometric, poorly crystalline apatite powders, analogous to mineral bone, synthesized through a biomimetic approach by double decomposition process. For the deposition of thin films, a KrF* excimer laser source was used (λ = 248 nm, τ{sub FWHM} ≤ 25 ns). The analyses revealed the existence, in synthesized powders, of labile non-apatitic mineral ions, associated with the formation of a hydrated layer at the surface of the nanocrystals. The thin film analyses showed that the structural and chemical nature of the nanocrystalline apatite was prevalently preserved. The perpetuation of the non-apatitic environments was also observed. The study indicated that MAPLE is a suitable technique for the congruent transfer of a delicate material, such as the biomimetic hydrated nanohydroxyapatite.
International Nuclear Information System (INIS)
Visan, A.; Grossin, D.; Stefan, N.; Duta, L.; Miroiu, F.M.; Stan, G.E.; Sopronyi, M.; Luculescu, C.; Freche, M.; Marsan, O.; Charvilat, C.; Ciuca, S.; Mihailescu, I.N.
2014-01-01
Highlights: • We report the deposition by MAPLE of biomimetic apatite coatings on Ti substrates. • This is the first report of MAPLE deposition of hydrated biomimetic apatite films. • Biomimetic apatite powder was synthesized by double decomposition process. • Non-apatitic environments, of high surface reactivity, are preserved post-deposition. • We got the MAPLE complete transfer as thin film of a hydrated, delicate material. -- Abstract: We report the deposition by Matrix Assisted Pulsed Laser Evaporation (MAPLE) technique of biomimetic nanocrystalline apatite coatings on titanium substrates, with potential application in tissue engineering. The targets were prepared from metastable, nanometric, poorly crystalline apatite powders, analogous to mineral bone, synthesized through a biomimetic approach by double decomposition process. For the deposition of thin films, a KrF* excimer laser source was used (λ = 248 nm, τ FWHM ≤ 25 ns). The analyses revealed the existence, in synthesized powders, of labile non-apatitic mineral ions, associated with the formation of a hydrated layer at the surface of the nanocrystals. The thin film analyses showed that the structural and chemical nature of the nanocrystalline apatite was prevalently preserved. The perpetuation of the non-apatitic environments was also observed. The study indicated that MAPLE is a suitable technique for the congruent transfer of a delicate material, such as the biomimetic hydrated nanohydroxyapatite
Certain distribution characteristics of uranium and thorium in apatite-carbonate ores
Energy Technology Data Exchange (ETDEWEB)
Kharitonova, R Sh; Faizullin, R N; Kozlov, E N; Berman, I B
1979-01-01
A study of the total radioactivity, uranium content, thorium content, U/Th ratio, and the spatial distribution of uranium by the f-radiographic method has demonstrated that the apatite ores of the deposit contain elevated concentrations of radioactive elements that are essentially of thorium origin. The main concentration of uranium and thorium is in the cinnemon-brown apatite. Elevated uranium concentrations are also found in hematite and accessory minerals (monacite, zirconium, titanite). Dolomite, quartz, martite, and second generation apatite were found to be weakly radioactive. The uranium and thorium concentration is correlated to the concentration of phosphorus and other petrogenic elements. An analysis of uranium, thorium, and Th/U distribution indicates that the concentration of radioactive elements is not caused by their primary content in carbonate rock but by the outside introduction of these elements together with phosphorus. The cited analyses confirm the chemogenic-sedimentary origin of the dolomite substrate and the metamorphogenic hydrothermal genesis of apatite mineralization. The data on radioactivity may be used as a reliable exploratory criterion for apatite potential. 3 references, 3 figures.
Amelogenin as a promoter of nucleation and crystal growth of apatite
Uskoković, Vuk; Li, Wu; Habelitz, Stefan
2011-02-01
Human dental enamel forms over a period of 2-4 years by substituting the enamel matrix, a protein gel mostly composed of a single protein, amelogenin with fibrous apatite nanocrystals. Self-assembly of amelogenin and the products of its selective proteolytic digestion are presumed to direct the growth of apatite fibers and their organization into bundles that eventually comprise the mature enamel, the hardest tissue in the mammalian body. This work aimed to establish the physicochemical and biochemical conditions for the growth of apatite crystals under the control of a recombinant amelogenin matrix (rH174) in combination with a programmable titration system. The growth of apatite substrates was initiated in the presence of self-assembling amelogenin particles. A series of constant titration rate experiments was performed that allowed for a gradual increase of the calcium and/or phosphate concentrations in the protein suspensions. We observed a significant amount of apatite crystals formed on the substrates following the titration of rH174 sols that comprised the initial supersaturation ratio equal to zero. The protein layers adsorbed onto the substrate apatite crystals were shown to act as promoters of nucleation and growth of calcium phosphates subsequently formed on the substrate surface. Nucleation lag time experiments have showed that rH174 tends to accelerate precipitation from metastable calcium phosphate solutions in proportion to its concentration. Despite their mainly hydrophobic nature, amelogenin nanospheres, the size and surface charge properties of which were analyzed using dynamic light scattering, acted as a nucleating agent for the crystallization of apatite. The biomimetic experimental setting applied in this study proves as convenient for gaining insight into the fundamental nature of the process of amelogenesis.
Kurtul, Alparslan; Yarlioglues, Mikail; Duran, Mustafa
2017-03-15
The CHA2DS2-VASC score, used for embolic risk stratification in atrial fibrillation (AF), has been reported recently to predict adverse clinical outcomes in patients with acute coronary syndrome (ACS), regardless of having AF. We investigated the correlation between the CHA2DS2-VASC score and contrast-induced nephropathy (CIN) in patients with ACS who underwent urgent percutaneous coronary intervention (PCI). A total of 1,408 patients were enrolled in the study. The CHA2DS2-VASC score was calculated for each patient. Based on the receiver operating characteristic analysis, the study population was divided into 2 groups: CHA2DS2-VASC score ≤3 group (n = 944) and CHA2DS2-VASC score ≥4 group (n = 464). Patients were then reallocated to 2 groups according to the presence or absence of CIN. CIN was defined as a rise in serum creatinine >0.5 mg/dl or >25% increase in baseline within 72 hours after PCI. Overall, 159 cases (11.3%) of CIN were diagnosed. Receiver operating characteristic curve analysis revealed good diagnostic value of CHA2DS2-VASC score in predicting CIN (area under the curve 0.769, 95% confidence interval 0.733 to 0.805; p high score had a higher frequency of CIN (23.9% vs 5.1%; p <0.001), and multivariate analysis identified the CHA2DS2-VASC score of ≥4 as an independent predictor of CIN. In conclusion, CHA2DS2-VASC score can be used as a new, simple, and reliable tool to predict CIN in patients with ACS who underwent urgent PCI. Copyright © 2016 Elsevier Inc. All rights reserved.
Genesis of iron-apatite ores in Posht-e-Badam Block (Central Iran) using REE geochemistry
Mokhtari, Mir Ali Asghar; Zadeh, Ghader Hossein; Emami, Mohamad Hashem
2013-06-01
Rare earth elements in apatites of different ore types show characteristic patterns which are related to different modes of formation of the ores. Most of the apatite-bearing iron ores are associated with alkaline magmas with LREE/HREE fractionation varying from moderate to steep. Iron-apatite deposits in Posht-e-Badam Block (Central Iran) have a high concentration of REE (more than 1000 ppm up to 2.5%), and show a strong LREE/HREE ratio with a pronounced negative Eu anomaly. This REE pattern is typical of magmatic apatite and quiet distinct from sedimentary apatites (phosphorites) which have a low REE contents and Ce negative anomalies. On the other hand, they are comparable to the REE patterns of apatites in Kiruna-type iron ores in different parts of the world. The REE patterns of apatites, iron-apatite ores and iron ores are similar and only have different REE contents. This similarity indicates a genetic relation for these rocks. Most of the iron-apatite deposits in Central Iran have similar REE patterns too, which in turn show a genetic relation for all of these deposits. This similarity indicates a similar origin and processes in their genesis. There are some small intrusions around some of the iron-apatite deposits that are petrographically identified as syenite and gabbro. These intrusions also have REE patterns similar to that of iron-apatite ores. This demonstrates a genetic relation between these intrusions and iron-apatite ores. The REE patterns of apatites in different deposits of Posht-e-Badam Block iron-apatite ores show an affinity to alkaline to sub-alkaline magmas and rifting environment. The alkaline host rocks of Central Iran iron-apatite ores are clearly related to an extensional setting where rifting was important (SSE-NNW fault lines). A probable source for this large scale ore forming processes is relatively low partial melting of mantle rocks. The ores have originated by magmatic differentiation as a late phase in the volcanic cycle
Hydrophobic agglomeration of apatite fines induced by sodium oleate in aqueous solutions
Directory of Open Access Journals (Sweden)
Bingqiao Yang
2018-06-01
Full Text Available In this work, the hydrophobic agglomeration of apatite fines induced by sodium oleate in aqueous solutions has been investigated through the measurement of agglomeration degree and fractal dimension. The results showed that the agglomeration degree of apatite fines and agglomerates morphology was strongly depended on sodium oleate concentration, pH, stirring speed and time. Better agglomeration degree and more regular agglomerates were achieved at sodium oleate concentration of 5 × 10−5 mol/L under neutral condition. The critical stirring speed for agglomerates rupture was 1000 rev/min, above which, prolonged stirring time would cause breakage and restructure of the agglomerates after a certain stirring time, resulting in lower agglomeration degree and more regular agglomerates. The agglomeration degree of apatite fines could be greatly enhanced with the addition of emulsified kerosene, but only if the apatite surface was hydrophobic enough. Keywords: Hydrophobic agglomeration, Apatite fines, Agglomeration degree, Fractal dimension, Sodium oleate
Geochemistry and genesis of apatite bearing Fe oxide Dizdaj deposit, SE Zanjan
Directory of Open Access Journals (Sweden)
Ghasem Nabatian
2009-09-01
Full Text Available Sorkheh-Dizaj apatite-iron oxide deposit is located 32 km southeast of Zanjan. The area is situated within the Tarom subzone of Western Alborz-Azarbaijan structural zone. The oldest units at the Sorkheh-Dizaj area are Eocene trachyte, trachyandesite, olivine basalt and volcanoclastic brecciate tuff and lapilli tuff which intruded by a quartz-monzonite, monzonite and granite subvolcanic pluton of Upper Eocene- Early Oligocene age. Subvolcanic plutonic rocks in the area show characteristics of the I-type granites. Magmatism of the area is of synorogenic to postorogenic related to magmatic arc environments. Mineralization at the area is divided into three main zones (A, B and C that all of which are located in the host subvolcanic pluton. These three zones are similar in terms of host rock, mineralogy, alteration, structure, texture and metal content. Mineralization in the volcanic rocks occurs as veins similar to those in three main zones, but less abundant. Geometry of the ore bodies is of vein type and their textures are stockwork, massive, banded, brecciate and vein-veinlet. The most important minerals at Sorkheh-Dizaj deposit are magnetite (low Ti and apatite that associated with them minor sulfide minerals such as chalcopyrite, bornite and pyrite. Minerals such as ilmenite, spinel (titanium magnetite, galena and sphalerite occur in low contents. The supergene minerals like chalcocite, malachite, azurite, covellite, hematite and goethite have been formed due to weathering and supergene processes. The main alterations at the deposit are K-feldspar metasomatism, actinolitization, argillic, sericitization, silicification, tourmalinization, and chlorite-epidotic. Rare earth elements (REE studies demonstrate that the deposit is more enriched in LREE than in HREE. The REE patterns in the apatite, magnetite and host rocks are similar suggesting a magmatic relationship. The REE contents of the apatites are higher than those of the host rocks and
Magnetite-apatite mineralization in Khanlogh iron deposit, northwest of Neyshaboor, NE Iran
Najafzadeh Tehrani, Parvin; Asghar Calagari, Ali; Velasco Roldan, Francisco; Simmonds, Vartan; Siahcheshm, Kamal
2016-04-01
Khanlogh iron deposit lies on Sabzehvar-Ghoochan Cenozoic magmatic belt in northwest of Neyshaboor, NE Iran. The lithologic units in this area include a series of sub-volcanic intrusive rocks like diorite porphyry, quartz-diorite porphyry, and micro-granodiorite of Oligocene age. Mineralization in this area occurred as veins, dissemination, and open space filling in brecciated zones within the host sub-volcanic intrusive bodies. Three distinct types of mineral associations can be distinguished, (1) diopside-magnetite, (2) magnetite-apatite, and (3) apatite-calcite. Microscopic examinations along with SEM and EPMA studies demonstrated that magnetite is the most common ore mineral occurring as solitary crystals. The euhedral magnetite crystals are accompanied by lamellar destabilized ilmenite and granular fluorapatite in magnetite-apatite ores. The results of EPMA revealed that the lamellar ilmenite, relative to host magnetite crystal, is notably enriched in MgO and MnO (average of 3.3 and 2.6 wt%, respectively; n=5), whereas magnetite is slighter enriched in Ti (TiO2 around 1.8 wt%) being average of MgO, MnO and V2O3 of 0.6wt%, 0.2wt%, and 0.6 wt% (respectively; n=20). Minerals such as chlorapatite, calcite, and chalcedony are also present in the magnetite-apatite ores. The samples from apatite-calcite ores contain coarse crystals of apatite and rhomboedral calcite. The plot of the EPMA data of Khanlogh iron ore samples on diagram of TiO2-V2O5 (Hou et al, 2011) illustrated that the data points lies between the well-known Kiruna and El Laco (Chile) iron deposits. The magnetite crystals in the sub-volcanic host rocks were possibly formed by immiscible iron oxide fluids during magmatic stage. However, the magnetite and apatite existing in the veins and breccia zones may have developed by high temperature hydrothermal fluids. Studies done by Purtov and Kotelnikova (1993) proved that the proportion of Ti in magnetite is related to fluoride complex in the hydrothermal
Formation of an ascorbate-apatite composite layer on titanium
Energy Technology Data Exchange (ETDEWEB)
Ito, Atsuo [National Institute of Advanced Industrial Science and Technology (AIST), Institute for Human Science and Biomedical Engineering, Central 6, Higashi 1-1-1, Tsukuba, Ibaraki 305-8566 (Japan); Sogo, Yu [National Institute of Advanced Industrial Science and Technology (AIST), Institute for Human Science and Biomedical Engineering, Central 6, Higashi 1-1-1, Tsukuba, Ibaraki 305-8566 (Japan); Ebihara, Yuko [School of Science and Technology, Waseda University, 3-4-1 Okubo, Sinjuku-ku, Tokyo 169-8050 (Japan); Onoguchi, Masahiro [School of Science and Technology, Waseda University, 3-4-1 Okubo, Sinjuku-ku, Tokyo 169-8050 (Japan); Oyane, Ayako [National Institute of Advanced Industrial Science and Technology (AIST), Nanotechnology Research Institute, Central 4, Higashi 1-1-1, Tsukuba, Ibaraki 305-8562 (Japan); Ichinose, Noboru [School of Science and Technology, Waseda University, 3-4-1 Okubo, Sinjuku-ku, Tokyo 169-8050 (Japan)
2007-09-15
An ascorbate-apatite composite layer was successfully formed on NaOH- and heat-treated titanium by coprecipitating L-ascorbic acid phosphate and low-crystalline apatite in a supersaturated calcium phosphate solution at 37 {sup 0}C for 48 h. The supersaturated calcium phosphate solutions used have chemical compositions attainable by mixing infusion fluids officially approved for clinical use. The amount of immobilized L-ascorbic acid phosphate ranged from 1.0 to 2.3 {mu}g mm{sup -2}, which is most likely to be sufficient for the in vitro osteogenic differentiation of mesenchymal stem cells on titanium. Since ascorbate is important for the collagen synthesis and subsequent osteogenesis of mesenchymal stem cells, titanium coated with the ascorbate-apatite composite layer would be useful as a scaffold in bone tissue engineering and as a bone substitute.
Formation of an ascorbate-apatite composite layer on titanium
International Nuclear Information System (INIS)
Ito, Atsuo; Sogo, Yu; Ebihara, Yuko; Onoguchi, Masahiro; Oyane, Ayako; Ichinose, Noboru
2007-01-01
An ascorbate-apatite composite layer was successfully formed on NaOH- and heat-treated titanium by coprecipitating L-ascorbic acid phosphate and low-crystalline apatite in a supersaturated calcium phosphate solution at 37 0 C for 48 h. The supersaturated calcium phosphate solutions used have chemical compositions attainable by mixing infusion fluids officially approved for clinical use. The amount of immobilized L-ascorbic acid phosphate ranged from 1.0 to 2.3 μg mm -2 , which is most likely to be sufficient for the in vitro osteogenic differentiation of mesenchymal stem cells on titanium. Since ascorbate is important for the collagen synthesis and subsequent osteogenesis of mesenchymal stem cells, titanium coated with the ascorbate-apatite composite layer would be useful as a scaffold in bone tissue engineering and as a bone substitute
Neymark, Leonid; Holm-Denoma, Christopher S.; Pietruszka, Aaron; Aleinikoff, John N.; Fanning, C. Mark; Pillers, Renee M.; Moscati, Richard J.
2016-01-01
The Pea Ridge iron oxide-apatite (IOA) deposit is one of the major rhyolite-hosted magnetite deposits of the St. Francois Mountains terrane, which is located within the Mesoproterozoic (1.5–1.3 Ga) Granite-Rhyolite province in the U.S. Midcontinent. Precise and accurate determination of the timing and duration of oreforming processes in this deposit is crucial for understanding its origin and placing it within a deposit-scale and regional geologic context. Apatite and monazite, well-established U-Pb mineral geochronometers, are abundant in the Pea Ridge orebody. However, the potential presence of multiple generations of dateable minerals, processes of dissolution-reprecipitation, and occurrence of micrometer-sized intergrowths and inclusions complicate measurements and interpretations of the geochronological results. Here, we employ a combination of several techniques, including ID-TIMS and high spatial resolution geochronology of apatite and monazite using LA-SC-ICPMS and SHRIMP, and Pb isotope geochemistry of pyrite and magnetite to obtain the first direct age constraints on the formation and alteration history of the Pea Ridge IOA deposit. The oldest apatite TIMS 207Pb*/206Pb* dates are 1471 ± 1 and 1468 ± 1 Ma, slightly younger than (but within error of) the ~1474 to ~1473 Ma U-Pb zircon ages of the host rhyolites. Dating of apatite and monazite inclusions within apatite provides evidence for at least one younger metasomatic event at ~1.44 Ga, and possibly multiple superimposed metasomatic events between 1.47 and 1.44 Ga. Lead isotop analyses of pyrite show extremely radiogenic 206Pb/204Pb ratios up to ~80 unsupported by in situ U decay. This excess radiogenic Pb in pyrite may have been derived from the spatially associated apatite as apatite recrystallized several tens of million years after its formation. The low initial 206Pb/204Pb ratio of ~16.5 and 207Pb/204Pb ratio of ~15.4 for individual magnetite grains indicate closed U-Pb system behavior in
[Synthesis and characterization of CO-3(2-) doping nano-hydroxyapatite].
Liao, Jian-Guo; Li, Yan-Qun; Duan, Xing-Ze; Liu, Qiong
2014-11-01
CO3(2-) doping is an effective method to increase the biological activity of nano-hydroxyapatite (n-HA). In the present study, calcium nitrate and trisodium phosphate were chosen as raw materials, with a certain amount of Na2CO3 as a source of CO-3(2-) ions, to synthesize nano-carbonate hydroxyapatite (n-CHA) slurry by solution precipitation method. The structure and micro-morphology of n-CHA were characterized by transmission electron microscope (TEM), X-ray diffraction (XRD), Fourier transform-infrared spectroscopy (FTIR) and Raman spectroscopy (RS). The results revealed that the synthetic n-HA crystals are acicular in nanometer scale and have a crystal size of 20-30 nm in diameter and 60-80 nm in length, which are similar to natural bone apatite. And the crystallinity of n-CHA crystals decreases to the increment of CO3(2-). Samples with more CO3(2) have composition and structure more similar to the bone apatite. The value of lattice parameters a decreases, value of c increases, and c/a value increases with the increase in the amount of CO3(2-), in accordance with crystal cell parameters change rule of type B replacement. In the AB mixed type (substitution OH- and PO4(3-)) CHA, IR characteristic peak of CO3(2-) out-of-plane bending vibration appears at 872 cm(-1), meanwhile, the asymmetry flexible vibration band is split into band at 1 454 cm(-1) and band at 1 420 cm(-1), while weak CO3(2)-peak appears at 1 540 cm(-1). CO3(2-) Raman peak of symmetric stretching vibration appears at 1 122 cm(-1). CO3(2-) B-type (substitution PO4(3-)) peak appeared at 1 071 cm(-1). Through the calculation of integral area ratio of PO4(3-)/ CO3(2-), OH-/CO3(2-), and PO4(3-)/OH-, low quantity CO3(2-) is B-type and high quantity CO3(2-) is A-type (substitution OH-). The results show that the synthesized apatite crystals are AB hybrid substitued nano-carbonate hydroxyapatite, however B-type replacement is the main substitute mode. Due to similarity inthe shape, size, crystal structure
Study on removal effect and mechanism of uranium by hydroxyapatite and natural apatite
International Nuclear Information System (INIS)
Zhang Xiaofeng; Chen Diyun; Tu Guoqing; Huang Xiaozhui
2014-01-01
By the static experiments, the effects of reaction time, pH value, initial concentration of uranium, dosage of apatite on adsorption of hydroxyapatite and natural apatite for uranium were studied respectively. The adsorption process was analyzed by thermodynamics and kinetics, and the adsorption mechanism was analyzed by infrared spectroscopy, X-ray diffraction and scanning electron microscope. The results of hydroxyapatite show that the removal capacity of uranium increases with the initial concentration of uranium, and the adsorption rate of hydroxyapatite on UO_2"2"+ reaches 85%, when the pH value is 4 to 5 and dosage of hydroxyapatite is 0.75 g. The results of natural apatite show that the removal capacity of uranium increases with the initial concentration of uranium, and the adsorption rate of natural apatite on UO_2"2"+ is up to 80%, when the pH value is 3 and dosage of hydroxyapatite is l.0 g. Similarly, at 120 minutes both of the removal reactions by hydroxyapatite and natural apatite substantially reach equilibrium. Moreover, both of the reactions by hydroxyapatite and natural apatite are in line with quasi secondary dynamics equation, and follow the Langmuir adsorption isotherm. Infrared spectra indicate that the removal of hydroxyapatite for uranium depends on the complexation of phosphate, which is almost the same as that of natural apatite. X-ray diffraction analysis shows that hydroxyapatite has the composition and structure of pure material, whereas the natural apatite is mainly composed of Ca_5H_2(PO_4)_3F and Ca_8H_2(PO_4)_6H_2O. In addition, scanning electron microscope demonstrates that hydroxyapatite has the appearance of spherical with a hole and the hole has a cavity containing a large amount of floc, while the surface becomes smooth and pores are closed after removal of uranium, which is due to the adsorption of UO_2"2"+ leading a link between molecules on hydroxyapatite surface. But for natural apatite, it depicts the angular mineral shape
Sub-µm structure and volatile distribution of shocked lunar apatite
Cernok, A.; White, L. F.; Darling, J.; Dunlop, J.; Fougerouse, D.; William, R. D. A.; Reddy, S.; Saxey, D. W.; Zhao, X.; Franchi, I.; Anand, M.
2017-12-01
Apatite is a key mineral broadly used for studying volatiles in planetary materials. Most studies in this recent frontier of planetary exploration focus on volatile content and respective isotopic composition in apatite. However, there is an imperative to contextualize geochemical data with impact-induced features, given that most planetary materials experienced at least some shock deformation. This study aims at understanding the effect of high-level shock deformation on volatile distribution in apatite from lunar highlands samples. Combining Electron Backscatter Diffraction (EBSD), NanoSIMS and Atom Probe Microscopy (APM) analyses we are gaining an insight into the µm- and nm-scale structural variation in apatite from a shocked, maskelynite- and impact-melt-bearing norite. EBSD revealed degraded crystallinity, high density of low angle grain boundaries and domains of sub-µm granular features that appear amorphous at this length scales ( 80 x 40 nm). Texture component maps show up to 25° misorientation within a single grain - evidence of severe crystal-plastic deformation, but with no obvious evidence of recrystallization. APM revealed complex microstructure of the apparently amorphous domains defined by well developed, straight to slightly curved grain boundaries meeting at 120° triple junctions. This equilibrium texture is probably accommodated by annealing and recrystallization of apatite due to the post-shock heating. Crystallites range in size from 50 to 100 nm. Grain boundaries are defined by segregation of Mg, Si and Fe impurities, which possibly originate from surrounding phases. Cl and F show homogenous distribution over the length scale of the APM analysis (1 to 500 nm). H2O content measurements of 250-600 ppm by NanoSIMS are consistent with the lower range of previously reported values for this rock, with no obvious correlation with the level of crystallinity. δD values are confirmed to be terrestrial-like and relatively constant. These preliminary
Rare Earth Element Behaviour in Apatite from the Olympic Dam Cu–U–Au–Ag Deposit, South Australia
Directory of Open Access Journals (Sweden)
Sasha Krneta
2017-08-01
Full Text Available Apatite is a common magmatic accessory in the intrusive rocks hosting the giant ~1590 Ma Olympic Dam (OD iron-oxide copper gold (IOCG ore system, South Australia. Moreover, hydrothermal apatite is a locally abundant mineral throughout the altered and mineralized rocks within and enclosing the deposit. Based on compositional data for zoned apatite, we evaluate whether changes in the morphology and the rare earth element and Y (REY chemistry of apatite can be used to constrain the fluid evolution from early to late hydrothermal stages at OD. The ~1.6 Ga Roxby Downs granite (RDG, host to the OD deposit, contains apatite as a magmatic accessory, locally in the high concentrations associated with mafic enclaves. Magmatic apatite commonly contains REY-poor cores and REY-enriched margins. The cores display a light rare earth element (LREE-enriched chondrite-normalized fractionation pattern with a strong negative Eu anomaly. In contrast, later hydrothermal apatite, confined to samples where magmatic apatite has been obliterated due to advanced hematite-sericite alteration, displays a conspicuous, convex, middle rare earth element (MREE-enriched pattern with a weak negative Eu anomaly. Such grains contain abundant inclusions of florencite and sericite. Within high-grade bornite ores from the deposit, apatite displays an extremely highly MREE-enriched chondrite-normalized fractionation trend with a positive Eu anomaly. Concentrations of U and Th in apatite mimic the behaviour of ∑REY and are richest in magmatic apatite hosted by RDG and the hydrothermal rims surrounding them. The shift from characteristic LREE-enriched magmatic and early hydrothermal apatite to later hydrothermal apatite displaying marked MREE-enriched trends (with lower U, Th, Pb and ∑REY concentrations reflects the magmatic to hydrothermal transition. Additionally, the strong positive Eu anomaly in the MREE-enriched trends of apatite in high-grade bornite ores are attributable to
Li, Rundong; Zhang, Ziheng; Li, Yanlong; Teng, Wenchao; Wang, Weiyun; Yang, Tianhua
2015-12-01
The recovery of phosphorus from incinerated sewage sludge ash (SSA) is assumed to be economical. Transformation from non-apatite inorganic phosphorus (NAIP) to apatite phosphorus (AP), which has a higher bioavailability and more extensive industrial applications, was studied at 750-950°C by sewage sludge incineration and model compound incineration with a calcium oxide (CaO) additive. Thermogravimetric differential scanning calorimetry analysis and X-ray diffraction measurements were used to analyze the reactions between NAIP with CaO and crystallized phases in SSA. High temperatures stimulated the volatilization of NAIP instead of AP. Sewage sludge incineration with CaO transformed NAIP into AP, and the percentage of AP from the total phosphorus reached 99% at 950°C. Aluminum phosphate reacted with CaO, forming Ca2P2O7 and Ca3(PO4)2 at 750-950°C. Reactions between iron phosphate and CaO occurred at lower temperatures, forming Ca(PO3)2 before reaching 850°C. Copyright © 2015 Elsevier Ltd. All rights reserved.
Acciarresi, Monica; Paciaroni, Maurizio; Agnelli, Giancarlo; Falocci, Nicola; Caso, Valeria; Becattini, Cecilia; Marcheselli, Simona; Rueckert, Christina; Pezzini, Alessandro; Morotti, Andrea; Costa, Paolo; Padovani, Alessandro; Csiba, Laszló; Szabó, Lilla; Sohn, Sung-Il; Tassinari, Tiziana; Abdul-Rahim, Azmil H; Michel, Patrik; Cordier, Maria; Vanacker, Peter; Remillard, Suzette; Alberti, Andrea; Venti, Michele; D'Amore, Cataldo; Scoditti, Umberto; Denti, Licia; Orlandi, Giovanni; Chiti, Alberto; Gialdini, Gino; Bovi, Paolo; Carletti, Monica; Rigatelli, Alberto; Putaala, Jukka; Tatlisumak, Turgut; Masotti, Luca; Lorenzini, Gianni; Tassi, Rossana; Guideri, Francesca; Martini, Giuseppe; Tsivgoulis, Georgios; Vadikolias, Kostantinos; Liantinioti, Chrissoula; Corea, Francesco; Del Sette, Massimo; Ageno, Walter; De Lodovici, Maria Luisa; Bono, Giorgio; Baldi, Antonio; D'Anna, Sebastiano; Sacco, Simona; Carolei, Antonio; Tiseo, Cindy; Imberti, Davide; Zabzuni, Dorjan; Doronin, Boris; Volodina, Vera; Consoli, Domenico; Galati, Franco; Pieroni, Alessio; Toni, Danilo; Monaco, Serena; Baronello, Mario Maimone; Barlinn, Kristian; Pallesen, Lars-Peder; Kepplinger, Jessica; Bodechtel, Ulf; Gerber, Johannes; Deleu, Dirk; Melikyan, Gayane; Ibrahim, Faisal; Akhtar, Naveed; Mosconi, Maria Giulia; Lees, Kennedy R
2017-06-01
The aim of this study was to investigate for a possible association between both prestroke CHA 2 DS 2 -VASc score and the severity of stroke at presentation, as well as disability and mortality at 90 days, in patients with acute stroke and atrial fibrillation (AF). This prospective study enrolled consecutive patients with acute ischemic stroke, AF, and assessment of prestroke CHA 2 DS 2 -VASc score. Severity of stroke was assessed on admission using the National Institutes of Health Stroke Scale (NIHSS) score (severe stroke: NIHSS ≥10). Disability and mortality at 90 days were assessed by the modified Rankin Scale (mRS <3 or ≥3). Multiple logistic regression was used to correlate prestroke CHA 2 DS 2 -VASc and severity of stroke, as well as disability and mortality at 90 days. Of the 1020 patients included in the analysis, 606 patients had an admission NIHSS score lower and 414 patients higher than 10. At 90 days, 510 patients had mRS ≥3. A linear correlation was found between the prestroke CHA 2 DS 2 -VASc score and severity of stroke (P = .001). On multivariate analysis, CHA 2 DS 2 -VASc score correlated with severity of stroke (P = .041) and adverse functional outcome (mRS ≥3) (P = .001). A logistic regression with the receiver operating characteristic graph procedure (C-statistics) evidenced an area under the curve of .60 (P = .0001) for severe stroke. Furthermore, a correlation was found between prestroke CHA 2 DS 2 -VASc score and lesion size. In patients with AF, in addition to the risk of stroke, a high CHA 2 DS 2 -VASc score was independently associated with both stroke severity at onset and disability and mortality at 90 days. Copyright © 2017 National Stroke Association. Published by Elsevier Inc. All rights reserved.
Chaînes d'exploits scénarios de hacking avancés et prévention
Whitaker, Andrew; Voth, Jack B
2009-01-01
Un pirate informatique s'appuie rarement sur une unique attaque, mais utilise plutôt des chaînes d'exploits, qui impliquent plusieurs méthodes et attaques coordonnées, pour atteindre sa cible et arriver à ses fins. Ces chaînes d'exploits sont généralement complexes et difficiles à prévenir. Or la plupart des ouvrages de sécurité ne les couvrent pas, ou sinon de manière superficielle. Cet ouvrage présente en profondeur les principales chaînes d'exploits qui sévissent actuellement. À travers des exemples basés sur des stratégies d'attaques réelles, utilisant les outils actuels les plus courants et visant des cibles importantes comme des données bancaires ou de sécurité sociale, vous découvrirez le spectre complet des attaques, des réseaux sans-fil à l'accès physique en passant par l'ingénierie sociale. Dans chaque scénario, les exploits sont décortiqués un à un en vue d'expliquer la chaîne qui va conduire à l'attaque finale. Les mesures de prévention à appliquer pour éviter...
Study of damage and helium diffusion in fluoro-apatites
International Nuclear Information System (INIS)
Miro, S.
2004-12-01
This work lies within the scope of the study of the radionuclides containment matrices. The choice of the fluoro-apatites as potential matrices of containment was suggested by the notable properties of these latter (thermal and chemical stability even under radioactive radiation). By irradiations with heavy ions and a helium implantation we simulated the effects related to the alpha radioactivity and to the spontaneous nuclear fission of the radionuclides. Thanks to the study of Durango fluoro-apatite single crystals and fluoro-apatite sintered ceramics, we evidenced that the damage fraction as well as the unit cell deformations increase with the electronic energy loss and with the substitution. These effects are followed at high fluences by a phenomenon of re-crystallization. The study of the helium diffusion points out that the thermal diffusion process improves with the substitution and strongly increases with heavy ions irradiation. (author)
Energy Technology Data Exchange (ETDEWEB)
Chowdhury, E.H., E-mail: md.ezharul.hoque@med.monash.edu.my [Jeffrey Cheah School of Medicine and Health Sciences, Monash University Sunway Campus, Jalan Lagoon Selatan, Bandar Sunway, Selangor Darul Ehsan (Malaysia)
2011-06-17
Highlights: {yields} Cytoplasmic stability of plasmid DNA is enhanced by fluoride incorporation into carbonate apatite carrier. {yields} Fluoridated carbonate apatite promotes a robust increase in transgene expression. {yields} Controlled dissolution of fluoridated carbonate apatite in endosomal acidic environment might buffer the endosomes and prevent degradation of the released DNA. -- Abstract: Intracellular delivery of a functional gene or a nucleic acid sequence to specifically knockdown a harmful gene is a potential approach to precisely treat a critical human disease. The intensive efforts in the last few decades led to the development of a number of viral and non-viral synthetic vectors. However, an ideal delivery tool in terms of the safety and efficacy has yet to be established. Recently, we have developed pH-sensing inorganic nanocrystals of carbonate apatite for efficient and cell-targeted delivery of gene and gene-silencing RNA. Here we show that addition of very low level of fluoride to the particle-forming medium facilitates a robust increase in transgene expression following post-incubation of the particles with HeLa cells. Confocal microscopic observation and Southern blotting prove the cytoplasmic existence of plasmid DNA delivered by likely formed fluoridated carbonate apatite particles while degradation of plasmid DNA presumably by cytoplasmic nucleases was noticed following delivery with apatite particles alone. The beneficial role of fluoride in enhancing carbonate apatite-mediated gene expression might be due to the buffering potential of generated fluoridated apatite in endosomal acidic environment, thereby increasing the half-life of delivered plasmid DNA.
International Nuclear Information System (INIS)
Chowdhury, E.H.
2011-01-01
Highlights: → Cytoplasmic stability of plasmid DNA is enhanced by fluoride incorporation into carbonate apatite carrier. → Fluoridated carbonate apatite promotes a robust increase in transgene expression. → Controlled dissolution of fluoridated carbonate apatite in endosomal acidic environment might buffer the endosomes and prevent degradation of the released DNA. -- Abstract: Intracellular delivery of a functional gene or a nucleic acid sequence to specifically knockdown a harmful gene is a potential approach to precisely treat a critical human disease. The intensive efforts in the last few decades led to the development of a number of viral and non-viral synthetic vectors. However, an ideal delivery tool in terms of the safety and efficacy has yet to be established. Recently, we have developed pH-sensing inorganic nanocrystals of carbonate apatite for efficient and cell-targeted delivery of gene and gene-silencing RNA. Here we show that addition of very low level of fluoride to the particle-forming medium facilitates a robust increase in transgene expression following post-incubation of the particles with HeLa cells. Confocal microscopic observation and Southern blotting prove the cytoplasmic existence of plasmid DNA delivered by likely formed fluoridated carbonate apatite particles while degradation of plasmid DNA presumably by cytoplasmic nucleases was noticed following delivery with apatite particles alone. The beneficial role of fluoride in enhancing carbonate apatite-mediated gene expression might be due to the buffering potential of generated fluoridated apatite in endosomal acidic environment, thereby increasing the half-life of delivered plasmid DNA.
Improvement of RVNRL film properties by adding fumed silica and hydroxy apatite
Directory of Open Access Journals (Sweden)
Adul Thiangchanya
2003-01-01
Full Text Available The effect of adding fumed silica and hydroxy apatite to Radiation Vulcanized Natural Rubber Latex (RVNRL for improving tear strength, aging properties, degradability and water-soluble protein content of rubber films has been investigated. The addition of fumed silica and hydroxy apatite in RVNRL improves tear strength and aging properties of rubber films, whereas tensile strength and degradability of rubber films were unchanged during storage at room temperature. The water-soluble protein content in rubber films was reduced by immobilization of the fumed silica and hydroxy apatite and enhanced by addition of ZnO. This may reduce allergy problems of natural rubber latex products caused by water-soluble protein. The MST of the RVNRL with fumed silica and hydroxy apatite indicated that the latex must be used within two months after mixing because of its stability.
Chakhmouradian, Anton R.; Reguir, Ekaterina P.; Zaitsev, Anatoly N.; Couëslan, Christopher; Xu, Cheng; Kynický, Jindřich; Mumin, A. Hamid; Yang, Panseok
2017-03-01
Apatite-group phosphates are nearly ubiquitous in carbonatites, but our understanding of these minerals is inadequate, particularly in the areas of element partitioning and petrogenetic interpretation of their compositional variation among spatially associated rocks and within individual crystals. In the present work, the mode of occurrence, and major- and trace-element chemistry of apatite (sensu lato) from calcite and dolomite carbonatites, their associated cumulate rocks (including phoscorites) and hydrothermal parageneses were studied using a set of 80 samples from 50 localities worldwide. The majority of this set represents material for which no analytical data are available in the literature. Electron-microprobe and laser-ablation mass-spectrometry data ( 600 and 400 analyses, respectively), accompanied by back-scattered-electron and cathodoluminescence images and Raman spectra, were used to identify the key compositional characteristics and zoning patterns of carbonatitic apatite. These data are placed in the context of phosphorus geochemistry in carbonatitic systems and carbonatite evolution, and compared to the models proposed by previous workers. The documented variations in apatite morphology and zoning represent a detailed record of a wide range of evolutionary processes, both magmatic and fluid-driven. The majority of igneous apatite from the examined rocks is Cl-poor fluorapatite or F-rich hydroxylapatite (≥ 0.3 apfu F) with 0.2-2.7 wt.% SrO, 0-4.5 wt.% LREE2O3, 0-0.8 wt.% Na2O, and low levels of other cations accommodated in the Ca site (up to 1000 ppm Mn, 2300 ppm Fe, 200 ppm Ba, 150 ppm Pb, 700 ppm Th and 150 ppm U), none of which show meaningful correlation with the host-rock type. Silicate, (SO4)2 - and (VO4)3 - anions, substituting for (PO4)3 -, tend to occur in greater abundance in crystals from calcite carbonatites (up to 4.2 wt.% SiO2, 1.5 wt.% SO3 and 660 ppm V). Although (CO3)2 - groups are very likely present in some samples, Raman micro
Thermodynamic Mixing Behavior Of F-OH Apatite Crystalline Solutions
Hovis, G. L.
2011-12-01
It is important to establish a thermodynamic data base for accessory minerals and mineral series that are useful in determining fluid composition during petrologic processes. As a starting point for apatite-system thermodynamics, Hovis and Harlov (2010, American Mineralogist 95, 946-952) reported enthalpies of mixing for a F-Cl apatite series. Harlov synthesized all such crystalline solutions at the GFZ-Potsdam using a slow-cooled molten-flux method. In order to expand thermodynamic characterization of the F-Cl-OH apatite system, a new study has been initiated along the F-OH apatite binary. Synthesis of this new series made use of National Institute of Standards and Technology (NIST) 2910a hydroxylapatite, a standard reference material made at NIST "by solution reaction of calcium hydroxide with phosphoric acid." Synthesis efforts at Lafayette College have been successful in producing fluorapatite through ion exchange between hydroxylapatite 2910a and fluorite. In these experiments, a thin layer of hydroxylapatite powder was placed on a polished CaF2 disc (obtained from a supplier of high-purity crystals for spectroscopy), pressed firmly against the disc, then annealed at 750 °C (1 bar) for three days. Longer annealing times did not produce further change in unit-cell dimensions of the resulting fluorapatite, but it is uncertain at this time whether this procedure produces a pure-F end member (chemical analyses to be performed in the near future). It is clear from the unit-cell dimensions, however, that the newly synthesized apatite contains a high percentage of fluorine, probably greater than 90 mol % F. Intermediate compositions for a F-OH apatite series were made by combining 2910a hydroxylapatite powder with the newly synthesized fluorapatite in various proportions, then conducting chemical homogenization experiments at 750 °C on each mixture. X-ray powder diffraction data indicated that these experiments were successful in producing chemically homogeneous
Magnetite-apatite-dolomitic rocks of Ust-Chulman (Aldan shield, Russia): Seligdar-type carbonatites?
Prokopyev, Ilya R.; Doroshkevich, Anna G.; Redina, Anna A.; Obukhov, Andrey V.
2018-04-01
The Ust-Chulman apatite ore body is situated within the Nimnyrskaya apatite zone at the Aldan shield in Russia. The latest data confirm the carbonatitic origin of the Seligdar apatite deposit (Prokopyev et al. in Ore Geol Rev 81:296-308, 2017). The results of our investigations demonstrate that the magnetite-apatite-dolomitic rocks of the Ust-Chulman are highly similar to Seligdar-type dolomitic carbonatites in terms of the mineralogy and the fluid regime of formation. The ilmenite and spinel mineral phases occur as solid solutions with magnetite, and support the magmatic origin of the Ust-Chulman ores. The chemical composition of REE- and SO3-bearing apatite crystals and, specifically, monazite-(Ce) mineralisation and the formation of Nb-rutile, late hydrothermal sulphate minerals (barite, anhydrite) and haematite are typical for carbonatite complexes. The fluid inclusions study revealed similarities to the evolutionary trend of the Seligdar carbonatites that included changes of the hydrothermal solutions from highly concentrated chloride to medium-low concentrated chloride-sulphate and oxidized carbonate-ferrous.
PNNL Apatite Investigation at 100-NR-2 Quality Assurance Project Plan
Energy Technology Data Exchange (ETDEWEB)
Fix, N. J.
2009-04-02
In 2004, the U.S. Department of Energy, Fluor Hanford, Inc., Pacific Northwest National Laboratory (PNNL), and the Washington Department of Ecology agreed that the long-term strategy for groundwater remediation at the 100-N Area would include apatite sequestration as the primary treatment, followed by a secondary treatment if necessary. Since then, the agencies have worked together to agree on which apatite sequestration technology has the greatest chance of reducing strontium-90 flux to the Columbia River. This Quality Assurance Project Plan provides the quality assurance requirements and processes that will be followed by staff working on the PNNL Apatite Investigation at 100-NR-2 Project. The plan is designed to be used exclusively by project staff.
IN SITU LEAD IMMOBILIZATION BY APATITE
Lead contamination is of environmental concern due to its effect on human health. The purpose of this study was to develop a technology to immobilize Pb in situ in contaminated soils and wastes using apatite. Hydroxyapatite [Ca10(PO4)6(O...
Apatite: A New Tool For Understanding The Temporal Variability Of Magmatic Volatile Contents
Stock, M. J.; Humphreys, M.; Smith, V.; Pyle, D. M.; Isaia, R.
2015-12-01
The apatite crystal structure is capable of incorporating H2O, F and Cl, as well as trace CO2 and sulphur. These can be related to parental magma compositions through application of a series of pressure and temperature-dependent exchange reactions (Piccoli and Candela, 1994), permitting apatite crystals to preserve a record of all major volatile species in the melt. Furthermore, due to the general incompatibility of P in other rock-forming minerals, apatite is ubiquitous in igneous systems and often begins crystallising early, such that apatite inclusions within phenocrysts record melt volatile contents throughout magmatic differentiation. In this work, we compare the compositions of apatite inclusions and microphenocrysts with pyroxene-hosted melt inclusions from the Astroni 1 eruption of Campi Flegrei, Italy. These data are coupled with magmatic differentiation models (Gualda et al., 2012), experimental volatile solubility data (Webster et al., 2014) and thermodynamic models of apatite compositional variations (Piccoli and Candela, 1994) to determine a time-series of magmatic volatile evolution in the build-up to eruption. We find that apatite halogen/OH ratios decreased through magmatic differentiation, while melt inclusion F and Cl concentrations increased. Melt inclusion H2O contents are constant at ~2.5 wt%. These data are best explained by volatile-undersaturated differentiation over most of the crystallisation history of the Astroni 1 melt, with melt inclusion H2O contents reset during ascent, due to rapid H diffusion through the phenocryst hosts (Woods et al., 2000). Given the rapid diffusivity of volatiles in apatite (Brenan, 1993), preservation of undersaturated compositions in microphenocrysts suggests that saturation was only achieved a few days to months before eruption and that it may have been the transition into a volatile-saturated state that ultimately triggered eruption. Piccoli and Candela, 1994. Am. J. of Sc., 294, 92-135. Gualda et al., 2012
Bio-inspired citrate functionalized apatite coating on rapid prototyped titanium scaffold
Energy Technology Data Exchange (ETDEWEB)
Yu, Peng [National engineering research center for tissue restoration and reconstruction, South China University of Technology, Guangzhou 510641 (China); Lu, Fang [School of Chinese Materia Medica, Guangzhou University of Chinese Medicine, Guangzhou 510006 (China); Zhu, Wenjun [Department of Prosthodontics, Guanghua School of Stomatology, Guang Dong Key Laboratory of Stomatology, Sun Yat-sen University, Guangzhou 510055 (China); Wang, Di [National engineering research center for tissue restoration and reconstruction, South China University of Technology, Guangzhou 510641 (China); Zhu, Xiaojing [Department of Prosthodontics, Guanghua School of Stomatology, Guang Dong Key Laboratory of Stomatology, Sun Yat-sen University, Guangzhou 510055 (China); Tan, Guoxin, E-mail: tanguoxin@126.com [Institute of Chemical Engineering and Light Industry, Guangdong University of Technology, Guangzhou 510006 (China); Wang, Xiaolan [National engineering research center for tissue restoration and reconstruction, South China University of Technology, Guangzhou 510641 (China); Zhang, Yu; Li, Lihua [General Hospital of Guangzhou Military Command of PLA, Guangzhou 510010 (China); Ning, Chengyun, E-mail: imcyning@scut.edu.cn [National engineering research center for tissue restoration and reconstruction, South China University of Technology, Guangzhou 510641 (China)
2014-09-15
Highlights: • Designed and reproducible porous titanium scaffolds were produced. • Hydrophilic nanoporous film was built on scaffold. • Apatite coating was deposited on scaffold under the modulation of citrate ions. • Citrate ions could affect CO{sub 3}{sup 2−} incorporation in apatite coatings. - Abstract: Scaffold functionalized with appropriate osteogenic coatings can significantly improve implant-bone response. In this study, with designed model and optimized manufacture parameters, reproducible and precise titanium scaffolds were produced. Reconstructed three-dimensional image and sectional structure of the scaffold were examined by micro-computed tomography and relative software. Alkali treatment was carried out on these manufactured porous scaffolds to produce nanoporous hydrophilic film. After 6 days deposition in simulated body fluid (SBF) containing sodium citrate (SC-SBF), plate-like amorphous calcium phosphate (ACP) coating was deposited on scaffold surface. Ultrasonication tests qualitatively indicated an enhanced adhesion force of apatite coatings deposited in SC-SBF compared to that deposited in SBF. And the effect of citrate ions on the CO{sub 3}{sup 2−} incorporation rate in apatite coating was quantitatively examined by bending vibration of CO{sub 3}{sup 2−} at ∼874 cm{sup −1}. Results indicated the highest carbonate content was obtained at the citrate ion concentration of 6 × 10{sup −5} mol/L in SC-SBF. These three-dimensional porous titanium-apatite hybrid scaffolds are expected to find application in bone tissue regeneration.
Naturally etched tracks in apatites and the correction of fission track dating
Tien, J L
1999-01-01
Naturally etched tracks have been found in apatites from the rapid cooled, high-level Kunon pluton in the Zhangzhou Igneous Complex, SE China. This is manifested by the fact that the apatite fission track (FT) age derived from conventional counting of spontaneous and induced tracks yields a result of 140.6+-6.5 Ma, which is much older than the ages determined using other methods on different minerals from the same rock. When tracks are observed after etching the polished inner sections of the apatite grains, the naturally etched tracks characterized by having hazy boundaries can be distinguished from the normal tracks with sharp boundaries. The age obtained by omitting these fading-resistant hazy tracks, 76.5+-4.0 Ma, indicates the time of the Kunon pluton cooling down to approx 100 deg. C. The corrected peak age (73.8 Ma) is consistent with the other apatite FT peak ages (79.2 to 70.2 Ma) of the nearly contemporaneous plutons in the same igneous complex.
The impact of bacteria of circulating water on apatite-nepheline ore flotation.
Evdokimova, G A; Gershenkop, A Sh; Fokina, N V
2012-01-01
A new phenomenon has been identified and studied-the impact of bacteria on the benefication process of non-sulphide ores using circulating water supply-a case study of apatite-nepheline ore. It is shown that bacteria deteriorate the floatability of apatite due to their interaction with active centres of calcium-containing minerals and intense flocculation, resulting in a decrease of the flotation process selectivity thus deteriorating the quality of concentrate. Based on the comparative analysis of primary sequences of 16S rRNA genes, there have been identified dominating bacteria species, recovered from the circulating water used at apatite-nepheline concentrating mills, and their phylogenetic position has been determined. All the bacteria were related to γ-Proteobacteria, including the Acinetobacter species, Pseudomonas alcaliphila, Ps. plecoglossicida, Stenotrophomonas rhizophila. A method of non-sulphide ores flotation has been developed with consideration of the bacterial factor. It consists in use of small concentrations of sodium hypochlorite, which inhibits the development of bacteria in the flotation of apatite-nepheline ores.
[Apatite-forming ability of pure titanium implant after micro-arc oxidation treatment].
Tian, Zhihui; Zhang, Yu; Wang, Lichao; Nan, Kaihui
2013-10-01
To investigate the apatite forming ability of pure titanium implant after micro-arc oxidation treatment in simulated body fluid (SBF) and obtain implants with calcium phosphate (Ca-P) layers. The implants were immersed in (SBF) after micro-arc oxidation treatment for different time lengths, and their apatite forming ability and the morphology and constituents of the Ca-P layers formed on the sample surface were analyzed using X-ray diffraction, scanning electron microscopy, X-ray photoelectron spectroscopy, and energy dispersive electron probe. After immersion in SBF, large quantities of Ca-P layers were induced on the surface of the samples. The Ca-P layers were composed of octacalcium phosphate and carbonated hydroxyapatite, and the crystals showed a plate-like morphology with an oriented growth. The implants with micro-arc oxidation treatment show good apatite forming ability on the surface with rich calcium and phosphorus elements. The formed layers are composed of bone-like apatite including octacalcium phosphate and carbonated hydroxyapatite.
International Nuclear Information System (INIS)
Raicevic, S.; Wright, J.V.; Veljkovic, V.; Conca, J.L.
2006-01-01
Addition of an amendment or reagent to soil/sediment is a technique that can decrease mobility and reduce bioavailability of uranium (U) and other heavy metals in the contaminated site. According to data from literature and results obtained in field studies, the general mineral class of apatites was selected as a most promising amendment for in situ immobilization/remediation of U. In this work we presented theoretical assessment of stability of U(VI) in four apatite systems (hydroxyapatite (HAP), North Carolina Apatite (NCA), Lisina Apatite (LA), and Apatite II) in order to determine an optimal apatite soil amendment which could be used for in situ remediation of uranium. In this analysis we used a theoretical criterion which is based on calculation of the ion-ion interaction potential, representing the main term of the cohesive energy of the matrix/pollutant system. The presented results of this analysis indicate (i) that the mechanism of immobilization of U by natural apatites depends on their chemical composition and (ii) that all analyzed apatites represent, from the point of view of stability, promising materials which could be used in field remediation of U-contaminated sites
Roden, M.; Patino Douce, A. E.; Chaumba, J. B.; Fleisher, C.; Yogodzinski, G. M.
2011-12-01
Apatite in ultramafic xenoliths from various tectonic enviroments including arc (Kamchatka), plume (Hawaii), and intraplate (Lunar Crater, Nunivak, Colorado Plateau) were analyzed by electron microprobe with the aim of characterizing the Cl and F contents, and from these measured compositions to infer the nature of fluids/melts that the apatites equilibrated with. The impetus for the study derived from the generalization of O'Reilly and Griffin (1) that mantle-derived metasomatic apatites tend to be Cl-rich and mantle-derived igneous apatites tend to be F-rich. Our work largely corroborates their generalization with Cl- and/or H2O-rich compositions characterizing the apatites from Nunivak and Kamchatka while apatites from igneous or Group II xenoliths tend to be Cl-poor and be either nearly pure fluorapatite or a mix of hydroxylapatite and fluorapatite. We attribute the Cl-rich nature of the Kamchatka apatites to formation from Cl-rich fluids generated from subducted lithosphere; however the Nunivak occurrence is far removed from subducted lithosphere and may reflect a deep seated source for Cl as also indicated by brine inclusions in diamonds, Cl-rich apatites in carbonate-bearing xenoliths and a Cl-rich signature in some plumes such as Iceland, Azores and Samoa. One curious aspect of mantle-derived apatite compositions is that xenoliths with evidence of carbonatitic metasomatism commonly have Cl-rich apatites while apatites from carbonatites are invariably Cl-poor - perhaps reflecting loss of Cl in fluids evolved from the carbonatitic magma. Apatites from Group II xenoliths at Hawaii are solid solutions between fluorapatite and hydroxylapatite and show no evidence for deep-seated Cl at Hawaii. Samples of the terrestrial mantle are almost uniformly characterized by mineral assemblages with a single Ca-rich phosphate phase but the mantles of Mars, Vesta and the Moon have two Ca-rich phosphates, apatite and volatile-poor merrillite - apatite compositions existing
Pang, Hui; Han, Bing; Fu, Qiang; Zong, Zhenkun
2017-07-05
The presence of acute myocardial infarction (AMI) confers a poor prognosis in atrial fibrillation (AF), associated with increased mortality dramatically. This study aimed to evaluate the predictive value of CHADS 2 and CHA 2 DS 2 -VASc scores for AMI in patients with AF. This retrospective study enrolled 5140 consecutive nonvalvular AF patients, 300 patients with AMI and 4840 patients without AMI. We identified the optimal cut-off values of the CHADS 2 and CHA 2 DS 2 -VASc scores each based on receiver operating characteristic curves to predict the risk of AMI. Both CHADS 2 score and CHA 2 DS 2 -VASc score were associated with an increased odds ratio of the prevalence of AMI in patients with AF, after adjustment for hyperlipidaemia, hyperuricemia, hyperthyroidism, hypothyroidism and obstructive sleep apnea. The present results showed that the area under the curve (AUC) for CHADS 2 score was 0.787 with a similar accuracy of the CHA 2 DS 2 -VASc score (AUC 0.750) in predicting "high-risk" AF patients who developed AMI. However, the predictive accuracy of the two clinical-based risk scores was fair. The CHA 2 DS 2 -VASc score has fair predictive value for identifying high-risk patients with AF and is not significantly superior to CHADS 2 in predicting patients who develop AMI.
The function of Sn(II)-apatite as a Tc immobilizing agent
Energy Technology Data Exchange (ETDEWEB)
Asmussen, R. Matthew, E-mail: matthew.asmussen@pnnl.gov [Energy and Environment Directorate, Pacific Northwest National Laboratory, 902 Battelle Blvd, Richland, WA, 99352 (United States); Neeway, James J.; Lawter, Amanda R.; Levitskaia, Tatiana G. [Energy and Environment Directorate, Pacific Northwest National Laboratory, 902 Battelle Blvd, Richland, WA, 99352 (United States); Lukens, Wayne W. [Chemical Sciences Division, Lawrence Berkeley National Laboratory, Berkeley, CA, 94720 (United States); Qafoku, Nikolla P. [Energy and Environment Directorate, Pacific Northwest National Laboratory, 902 Battelle Blvd, Richland, WA, 99352 (United States)
2016-11-15
At the U.S. Department of Energy Hanford Site, Tc-99 is a component of low-activity waste (LAW) fractions of the nuclear tank waste and removal of Tc from LAW streams would greatly benefit the site remediation process. In this study, we investigated the removal of Tc(VII), as pertechnetate, from deionized water (DIW) and a LAW simulant through batch sorption testing and solid phase characterization using tin (II) apatite (Sn-A) and SnCl{sub 2}. Sn-A showed higher levels of Tc removal from both DIW and LAW simulant. Scanning electron microscopy/energy dispersive X-ray spectroscopy (SEM/XEDS) and X-ray absorption spectroscopy (XAS) of reacted Sn-A in DIW showed that TcO4- is reduced to Tc(IV) on the Sn-A surface. The performance of Sn-A in the LAW simulant was lowered due to a combined effect of the high alkalinity, which lead to an increased dissolution of Sn from the Sn-A, and a preference for the reduction of Cr(VI). - Highlights: • Sn(II)-Apatite shows high proficiency in removing Tc(VII) from neutral solutions. • The removal of the Tc(VII) by Sn(II)-apatite is done via reduction to Tc(IV)O{sub 2} × H{sub 2}O. • In LAW Sn(II)-apatite is less efficient in removing Tc(VII). • Interference in LAW due to a preference for the reduction of Cr(VI) and the high pH. • Sn(II)-apatite can remove Tc(VII) from LAW effectively through increasing material added.
Energy Technology Data Exchange (ETDEWEB)
Pontier, C. [S.P.C.T.S., Faculte des Sciences, Limoges (France); G.E.F., Faculte de Pharmacie, Limoges (France); Viana, M.; Chulia, D. [G.E.F., Faculte de Pharmacie, Limoges (France); Champion, E.; Bernache-Assollant, D. [S.P.C.T.S., Faculte des Sciences, Limoges (France)
2002-07-01
Measurement of the cycles of compression and rupture helps to understand the phenomena occurring during compaction. Different parameters are deduced from the cycles, such as the packing of the material and energies used during compression. The ratio between the energy of rupture and the energy of compaction defines the efficacy of compaction of the materials. This technique is applied to ceramic materials using apatitic calcium phosphates with a Ca/P molar ratio of 1.5 (apatitic tricalcium phosphate and {beta}-tricalcium phosphate) and 1.667 (stoichiometric hydroxyapatite). The methodology uses a uniaxial instrumented press to plot the cycles of compaction and rupture. The results point out the good compaction and cohesion properties of apatitic tricalcium phosphate, compared to the other apatitic materials. (orig.)
Raič, Sara; Mogessie, Aberra; Krenn, Kurt; Hauzenberger, Christoph A.; Tropper, Peter
2016-04-01
The mineralized troctolitic Bathtub intrusion (Duluth Complex, NE-Minnesota) is known for its famous Cu-Ni-Sulfide±PGM Babbitt deposit, where platinum group minerals (PGMs) are either hosted by primary magmatic sulfides (base metal sulfides) or associated with hydrothermally altered portions. This secondary generation of PGMs is present in alteration patches and suggests the involvement of hydrothermal fluids in the mobilization of platinum-group elements (PGEs). Accessory fluorapatite in these samples reveals besides H2O- and CO2-rich primary fluid inclusions, textural and compositional variations that also record magmatic and metasomatic events. Based on detailed back-scattered electron imaging (BSE) and laser ablation-inductively coupled plasma-mass spectrometry (LA-ICPMS), a primary magmatic origin is reflected by homogeneous or zoned grains, where zoning patterns are either concentric or oscillatory, with respect to LREE. Late magmatic to hydrothermal processes are indicated by grains with bright LREE-enriched rims or conversion textures with REE-enriched patches in the interior of the apatite. A metasomatic formation of monazite from apatite is documented by the presence of monazite inclusions in apatite and newly grown monazite at altered apatite rims. They formed by the release of REEs from the apatite during a fluid-induced alteration, based on the coupled substitution Ca2+ + P5+ = REE3+ + Si4+ (Rønsbo 1989; Rønsbo 2008). Samples with monazite inclusions in apatite further display occurrences of PGMs associated with hydrothermal alteration patches (chlorite + amphibole). The presence of H2O- and CO2-rich fluid inclusions in apatite, the metasomatically induced monazite growth, as well as the occurrence of PGMs in hydrothermally alteration zones, also suggest the involvement of aqueous chloride complexes in a H2O dominated fluid in the transportation of LREE and redistribution of the second generation of PGEs. Rønsbo, J.G. (1989): Coupled substitutions
Directory of Open Access Journals (Sweden)
Ali Rostami
2014-04-01
Full Text Available The study area is located about 3 km southwest of the Hormoz Island in the Hormozgan province, in the Persian Gulf. The main rock units in the region consist of a highly altered acidic pluton cratophyre, which is responsible for apatite formation, diabasic dike, marl and altered basalt. Apatite is the only phosphate mineral in the Hormoz Island, which has accumulated REE in its crystal structure. The amount of Na2O and SiO2 oxides in apatite are high and the average content of the main elements Fe, Mg, Al, Ca are 7.5 ppm, 365 ppm, 2880 ppm and 27.8%, respectively. The Y, Mn, Rb contents increase and Sr decreases with increasing magmatic differentiation. It shows that a moderate magmatic differentiation occurred during the crystallization of apatite. The total REE content in the Hormoz apatite is high (1.22-2.25%. LREE/HREE ratio is also high. This means that Hormoz apatites are enriched in light rare earth elements. The REE normalized pattern shows a negative slope with a negative Eu anomaly. According to various diagrams based on apatite composition, it is deduced that the Hormoz apatites belong to mafic I-type granitoids with high oxidation state (Fe2O3/FeO>1.
Německý Mácha, Óda na radost a krize evropské vize
Czech Academy of Sciences Publication Activity Database
Pokorný, Martin Z.
2013-01-01
Roč. 31, 97-98 (2013), s. 244-251 ISSN 0862-7045 Institutional support: RVO:67985955 Keywords : K. H. Mácha * F. Schiller * A. Mozart * Enlightenment * romanticism Subject RIV: AA - Philosophy ; Religion
21 CFR 172.814 - Hydroxylated lecithin.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Hydroxylated lecithin. 172.814 Section 172.814 Food... Multipurpose Additives § 172.814 Hydroxylated lecithin. The food additive hydroxylated lecithin may be safely... obtained by the treatment of lecithin in one of the following ways, under controlled conditions whereby the...
Quantification of hydroxyl radical produced during phacoemulsification.
Gardner, Jonathan M; Aust, Steven D
2009-12-01
To quantitate hydroxyl radicals produced during phacoemulsification with various irrigating solutions and conditions used in cataract surgery. Chemistry and Biochemistry Department, Utah State University, Logan, Utah, USA. All experiments were performed using an Infiniti Vision System phacoemulsifier with irrigation and aspiration. Hydroxyl radicals were quantitated using electron spin resonance spectroscopy and a spectrophotometric assay for malondialdehyde, which is formed by the oxidation of deoxyribose by the hydroxyl radical. Hydroxyl radical production increased during longitudinal-stroking phacoemulsification as power levels were increased in a nonlinear, nonexponential fashion. The detection of hydroxyl radical was reduced in irrigating solutions containing organic molecules (eg, citrate, acetate, glutathione, dextrose) and further reduced in Navstel, an irrigating solution containing a viscosity-modifying agent, hydroxypropyl methylcellulose. Hydroxyl radicals produced in settings representative of those used in phacoemulsification cataract surgery were quantitated using the deoxyribose method. Hydroxyl radical production was dependent on the level of ultrasound power applied and the irrigating solution used. Oxidative stress on the eye during phacoemulsification may be minimized by using irrigating solutions that contain organic molecules, including the viscosity-modifying agent hydroxypropyl methylcellulose, that can compete for reaction with hydroxyl radicals.
Directory of Open Access Journals (Sweden)
Ayako Oyane
2013-09-01
Full Text Available A plasma- and precursor-assisted biomimetic process utilizing plasma and alternate dipping treatments was applied to a Leed-Keio artificial ligament to produce a thin coating of apatite in a supersaturated calcium phosphate solution. Following plasma surface modification, the specimen was alternately dipped in calcium and phosphate ion solutions three times (alternate dipping treatment to create a precoating containing amorphous calcium phosphate (ACP which is an apatite precursor. To grow an apatite layer on the ACP precoating, the ACP-precoated specimen was immersed for 24 h in a simulated body fluid with ion concentrations approximately equal to those in human blood plasma. The plasma surface modification was necessary to create an adequate apatite coating and to improve the coating adhesion depending on the plasma power density. The apatite coating prepared using the optimized conditions formed a thin-film that covered the entire surface of the artificial ligament. The resulting apatite-coated artificial ligament should exhibit improved osseointegration within the bone tunnel and possesses great potential for use in ligament reconstructions.
Prolyl hydroxylation in elastin is not random.
Schmelzer, Christian E H; Nagel, Marcus B M; Dziomba, Szymon; Merkher, Yulia; Sivan, Sarit S; Heinz, Andrea
2016-10-01
This study aimed to investigate the prolyl and lysine hydroxylation in elastin from different species and tissues. Enzymatic digests of elastin samples from human, cattle, pig and chicken were analyzed using mass spectrometry and bioinformatics tools. It was confirmed at the protein level that elastin does not contain hydroxylated lysine residues regardless of the species. In contrast, prolyl hydroxylation sites were identified in all elastin samples. Moreover, the analysis of the residues adjacent to prolines allowed the determination of the substrate site preferences of prolyl 4-hydroxylase. It was found that elastins from all analyzed species contain hydroxyproline and that at least 20%-24% of all proline residues were partially hydroxylated. Determination of the hydroxylation degrees of specific proline residues revealed that prolyl hydroxylation depends on both the species and the tissue, however, is independent of age. The fact that the highest hydroxylation degrees of proline residues were found for elastin from the intervertebral disc and knowledge of elastin arrangement in this tissue suggest that hydroxylation plays a biomechanical role. Interestingly, a proline-rich domain of tropoelastin (domain 24), which contains several repeats of bioactive motifs, does not show any hydroxyproline residues in the mammals studied. The results show that prolyl hydroxylation is not a coincidental feature and may contribute to the adaptation of the properties of elastin to meet the functional requirements of different tissues. The study for the first time shows that prolyl hydroxylation is highly regulated in elastin. Copyright © 2016 Elsevier B.V. All rights reserved.
Prolyl hydroxylation in elastin is not random
DEFF Research Database (Denmark)
Schmelzer, Christian E H; Nagel, Marcus B M; Dziomba, Szymon
2016-01-01
BACKGROUND: This study aimed to investigate the prolyl and lysine hydroxylation in elastin from different species and tissues. METHODS: Enzymatic digests of elastin samples from human, cattle, pig and chicken were analyzed using mass spectrometry and bioinformatics tools. RESULTS: It was confirmed...... at the protein level that elastin does not contain hydroxylated lysine residues regardless of the species. In contrast, prolyl hydroxylation sites were identified in all elastin samples. Moreover, the analysis of the residues adjacent to prolines allowed the determination of the substrate site preferences...... of prolyl 4-hydroxylase. It was found that elastins from all analyzed species contain hydroxyproline and that at least 20%-24% of all proline residues were partially hydroxylated. Determination of the hydroxylation degrees of specific proline residues revealed that prolyl hydroxylation depends on both...
Preparation and Characterization of Apatitic Biphasic Calcium Phosphate
International Nuclear Information System (INIS)
Thin Thin Nwe; Kyaw Naing; Khin Mar Tun; Nyunt Wynn
2005-09-01
The apatitic biphasic calcium phosphate (ABcp) consisting of hydroxyapatite (HA) and -tricalcium phosphate ( -Tcp) has been prepared by precipitation technique using slaked lime and orthophosphoric acid. The X-ray diffraction analysis of the product I (hydroxyapatite) revealed that ABcp was partially crystalline state. However, on heating at 800 C for 8 hrs, XRD pattern indicated a perfectly crystalline form of ABcp. This observation was supported by FT-IR measurement. The change in morphology regarding in the functional nature was infered by the shift in the FT-IR frequency. The optimization of the apatitic biphasic calcium phosphate was done by the variation of disodium hydrogen phosphate concentration, setting time, hardening time as well as compressive strength. The perpared cement may be used as an artificial substitution bone
International Nuclear Information System (INIS)
Kuczumow, A.; Nowak, J.; ChaLas, R.
2011-01-01
The aim of a recent paper was to recognize the chemical and structural changes in apatites, which form both the enamel and the dentin of the human tooth. The aim was achieved by scrutinizing the linear elemental profiles along the cross-sections of human molar teeth. Essentially, the task was accomplished with the application of the Electron Probe Microanalysis method and with some additional studies by Micro-Raman spectrometry. All the trends in linear profiles were strictly determined. In the enamel zone they were either increasing or decreasing curves of exponential character. The direction of the investigations was to start with the tooth surface and move towards the dentin-enamel junction (DEJ). The results of the elemental studies were more visible when the detected material was divided, in an arbitrary way, into the prevailing 'core' enamel (∼93.5% of the total mass) and the remaining 'overbuilt' enamel. The material in the 'core' enamel was fully stable, with clearly determined chemical and mechanical features. However, the case was totally different in the 'overbuilt enamel', with dynamic changes in the composition. In the 'overbuilt' layer Ca, P, Cl and F profiles present the decaying distribution curves, whereas Mg, Na, K and CO 3 2- present the growing ones. Close to the surface of the tooth the mixture of hydroxy-, chlor- and fluor-apatite is formed, which is much more resistant than the rest of the enamel. On passing towards the DEJ, the apatite is enriched with Na, Mg and CO 3 2- . In this location, three of six phosphate groups were substituted with carbonate groups. Simultaneously, Mg is associated with the hydroxyl groups around the hexad axis. In this way, the mechanisms of exchange reactions were established. The crystallographic structures were proposed for new phases located close to DEJ. In the dentin zone, the variability of elemental profiles looks different, with the most characteristic changes occurring in Mg and Na concentrations. Mg
Siddiqui, Imran Ali; Haas, Dieter; Heeb, Stephan
2005-01-01
In Pseudomonas fluorescens CHA0, mutation of the GacA-controlled aprA gene (encoding the major extracellular protease) or the gacA regulatory gene resulted in reduced biocontrol activity against the root-knot nematode Meloidogyne incognita during tomato and soybean infection. Culture supernatants of strain CHA0 inhibited egg hatching and induced mortality of M. incognita juveniles more strongly than did supernatants of aprA and gacA mutants, suggesting that AprA protease contributes to biocon...
El Rhilassi, A.; Mourabet, M.; El Boujaady, H.; Bennani-Ziatni, M.; Hamri, R. El; Taitai, A.
2012-10-01
Study focused on the interaction of adsorbate with poorly crystalline apatitic calcium phosphates analogous to bone mineral. Calcium phosphates prepared in water-ethanol medium at physiological temperature (37 °C) and neutral pH, their Ca/P ratio was between 1.33 and 1.67. Adsorbate used in this paper takes the mixture form of two essential amino acids L-lysine and DL-leucine which have respectively a character hydrophilic and hydrophobic. Adsorption and release are investigated experimentally; they are dependent on the phosphate type and on the nature of adsorbate L-lysine, DL-leucine and their mixture. Adsorption of mixture of amino acids on the apatitic calcium phosphates is influenced by the competition between the two amino acids: L-lysine and DL-leucine which exist in the medium reaction. The adsorption kinetics is very fast while the release kinetics is slow. The chemical composition of apatite has an influence on both adsorption and release. The interactions adsorbate-adsorbent are electrostatic type. Adsorption and release reactions of the amino acid mixture are explained by the existence of the hydrated surface layer of calcium phosphate apatite. The charged sbnd COOsbnd and sbnd NH3+ of adsorbates are the strongest groups that interact with the surface of apatites, the adsorption is mainly due to the electrostatic interaction between the groups sbnd COOsbnd of amino acids and calcium Ca2+ ions of the apatite. Comparative study of interactions between adsorbates (L-lysine, DL-leucine and their mixture) and apatitic calcium phosphates is carried out in vitro by using UV-vis and infrared spectroscopy IR techniques.
Characterization of damaging in apatitic materials irradiated with heavy ions and thermally annealed
International Nuclear Information System (INIS)
Tisserand, R.
2004-12-01
Some minerals belonging to the family of apatite are seen to be potential candidates for use as conditioning matrices or transmutation targets for high level nuclear waste management. Indeed, studies of natural nuclear reactors (Oklo) highlighted the strong ability of these minerals to anneal irradiation damage. In order to determine the global behaviour of these materials, we performed a fundamental study on the evolution of irradiation damage induced by various heavy ions in two apatites: a natural phospho-calcic fluor-apatite from Durango and a synthetic sintered mono-silicated fluor-apatite, called britholite. The damage in these materials was measured by using channelling R.B.S. and X-ray diffraction respectively and by determining an amorphization effective radius Re. The results revealed a similar behaviour for both apatites according to the electronic energy deposit at the entrance of the material. In addition, the effect of an isothermal annealing at 300 C was quantified on a mono-silicated britholite previously irradiated with Kr ions. We highlighted in this case the return of the lattice parameters to their initial values, followed by a partial and slow rebuilding of the crystalline lattice versus the annealing time. Finally, we followed the changes in the morphology of etch pits in the Durango fluor-apatite after acid dissolution as a function of the energy deposit by the ions. We showed that the influence of crystallography leads quickly to opening angles close to 30 degrees. The calculation of etching velocities within the irradiated material highlighted that there is a range of deposit energy where the velocity ratio increases strongly before becoming constant. (author)
Apukhtina, Olga B.; Kamenetsky, Vadim S.; Ehrig, Kathy; Kamenetsky, Maya B.; McPhie, Jocelyn; Maas, Roland; Meffre, Sebastien; Goemann, Karsten; Rodemann, Thomas; Cook, Nigel J.; Ciobanu, Cristiana L.
2016-01-01
An assemblage of magnetite and apatite is common worldwide in different ore deposit types, including disparate members of the iron-oxide copper-gold (IOCG) clan. The Kiruna-type iron oxide-apatite deposits, a subtype of the IOCG family, are recognized as economic targets as well. A wide range of competing genetic models exists for magnetite-apatite deposits, including magmatic, magmatic-hydrothermal, hydrothermal(-metasomatic), and sedimentary(-exhalative). The sources and mechanisms of transport and deposition of Fe and P remain highly debatable. This study reports petrographic and geochemical features of the magnetite-apatite-rich vein assemblages in the dolerite dykes of the Gairdner Dyke Swarm (~0.82 Ga) that intruded the Roxby Downs Granite (~0.59 Ga), the host of the supergiant Olympic Dam IOCG deposit. These symmetrical, only few mm narrow veins are prevalent in such dykes and comprise besides usually colloform magnetite and prismatic apatite also further minerals (e.g., calcite, quartz). The genetic relationships between the veins and host dolerite are implied based on alteration in the immediate vicinity (~4 mm) of the veins. In particular, Ti-magnetite-ilmenite is partially to completely transformed to titanite and magmatic apatite disappears. We conclude that the mafic dykes were a local source of Fe and P re-concentrated in the magnetite-apatite veins. Uranium-Pb ages for vein apatite and titanite associated with the vein in this case study suggest that alteration of the dolerite and healing of the fractures occurred shortly after dyke emplacement. We propose that in this particular case the origin of the magnetite-apatite assemblage is clearly related to hydrothermal alteration of the host mafic magmatic rocks.
Growth of apatite on chitosan-multiwall carbon nanotube composite membranes
Energy Technology Data Exchange (ETDEWEB)
Yang Jun; Yao Zhiwen [State Key Laboratory of Oral Diseases, West China College of Stomatology, Sichuan University, No 14, 3rd Section South People' s Road, Chengdu 610041 (China); Tang Changyu [Department of Polymer Science and Materials, Sichuan University (China); Darvell, B.W. [Dental Materials Science, Faculty of Dentistry, University of Hong Kong (Hong Kong); Zhang Hualin; Pan Lingzhan; Liu Jingsong [State Key Laboratory of Oral Diseases, West China College of Stomatology, Sichuan University, No 14, 3rd Section South People' s Road, Chengdu 610041 (China); Chen Zhiqing, E-mail: yangj0710@gmail.com [State Key Laboratory of Oral Diseases, West China College of Stomatology, Sichuan University, No 14, 3rd Section South People' s Road, Chengdu 610041 (China)
2009-07-30
Bioactive membranes for guided tissue regeneration would be of value for periodontal therapy. Chitosan-multiwall carbon nanotube (CS-MWNT) composites were treated to deposit nanoscopic apatite for MWNT proportions of 0-4 mass%. Fourier-transform infrared spectroscopy, scanning electron microscopy, energy-dispersive X-ray analysis, and X-ray diffraction were used for characterization. Apatite was formed on the CS-MWNT composites at low MWNT concentrations, but the dispersion of the MWNT affects the crystallite size and the Ca/P molar ratio of the composite. The smallest crystallite size was 9 nm at 1 mass% MWNT.
Composition dependent thermal annealing behaviour of ion tracks in apatite
Energy Technology Data Exchange (ETDEWEB)
Nadzri, A., E-mail: allina.nadzri@anu.edu.au [Department of Electronic Materials Engineering, Research School of Physics and Engineering, Australian National University, Canberra, ACT 2601 (Australia); Schauries, D.; Mota-Santiago, P.; Muradoglu, S. [Department of Electronic Materials Engineering, Research School of Physics and Engineering, Australian National University, Canberra, ACT 2601 (Australia); Trautmann, C. [GSI Helmholtz Centre for Heavy Ion Research, Planckstrasse 1, 64291 Darmstadt (Germany); Technische Universität Darmstadt, 64287 Darmstadt (Germany); Gleadow, A.J.W. [School of Earth Science, University of Melbourne, Melbourne, VIC 3010 (Australia); Hawley, A. [Australian Synchrotron, 800 Blackburn Road, Clayton, VIC 3168 (Australia); Kluth, P. [Department of Electronic Materials Engineering, Research School of Physics and Engineering, Australian National University, Canberra, ACT 2601 (Australia)
2016-07-15
Natural apatite samples with different F/Cl content from a variety of geological locations (Durango, Mexico; Mud Tank, Australia; and Snarum, Norway) were irradiated with swift heavy ions to simulate fission tracks. The annealing kinetics of the resulting ion tracks was investigated using synchrotron-based small-angle X-ray scattering (SAXS) combined with ex situ annealing. The activation energies for track recrystallization were extracted and consistent with previous studies using track-etching, tracks in the chlorine-rich Snarum apatite are more resistant to annealing than in the other compositions.
Fission-track dating of apatite from deep borehole ATK-1 at Atikokan, Ontario
International Nuclear Information System (INIS)
Naeser, C.W.; Crowley, K.D.
1990-01-01
Fission-track age and lengths have been determined on apatite separated from core recovered from the ATK-1 deep borehole at Atikokan, Ontario. The apatite ages decrease down the borehole, from 515 ± 72 Ma at the top to 376 ± 46 Ma at a depth of 993 m. The mean confined track length for fossil fission tracks in the apatite is 12.4 μm. Within the limits of the measurement the track lengths are the same for all the samples. The results of this study indicate that the rocks found currently at the surface have never been heated above ∼100C since Upper Cambrian time
Thermodynamic basis for evolution of apatite in calcified tissues (Invited)
Navrotsky, A.; Drouet, C.; Rollin-Martinet, S.; Champion, E.; Grossin, D.
2013-12-01
Bone remodeling and tooth enamel maturation are biological processes which alter the physico-chemical features of biominerals with time. However, although the ubiquity of bone remodeling is clear, why is well crystallized bone mineral systematically replaced by immature nanocrystalline inorganic material? In enamel, a clear evolution is also seen from the first mineral formed during the secretory stage to its mature well crystalline form, which then changes little in the adult tooth. This contribution provides the thermodynamic basis underlying these biological processes. We determined the energetics of biomimetic apatites corresponding to an increasing degree of maturation. Our data point out the progressive evolution of the enthalpy (ΔHf°) and free energy (ΔGf°) of formation toward more negative values upon maturation. Entropy contributions to ΔGf° values are small compared to enthalpy contributions. ΔHf° varies from -12058.9 × 12.2 to -12771.0 × 21.4 kJ/mol for maturation times increasing from 20 min to 3 weeks, approaching the value for stoichiometric hydroxyapatite, -13431.0 × 22.7 kJ/mol. Apatite thermodynamic stability increases as its composition moved toward stoichiometry. These findings imply diminishing aqueous solubility of calcium and phosphate ions as well as decreased surface reactivity. Such thermodynamically-driven maturation is favorable for enamel maturation since this biomineral must resist external aggressions such as contact with acids. In contrast, maintaining a metastable highly reactive and soluble form of apatite is essential to the effective participation of bone as a source of calcium and phosphate for homeostasis. Therefore our data strongly suggest that, far from being trivial, the intrinsic thermodynamic properties of apatite represent a critical driving force for continuous bone remodeling, in contrast to current views favoring a purely biologically driven cycle. These thermodynamic data may prove helpful in other domains
DEFF Research Database (Denmark)
Olesen, Jonas Bjerring; Torp-Pedersen, Christian; Hansen, Morten Lock
2012-01-01
associated with increasing CHA2DS2-VASc score was estimated in Cox regression models adjusted for year of inclusion and antiplatelet therapy. The value of adding the extra CHA2DS2-VASc risk factors to the CHADS2 score was evaluated by c-statistics, Net Reclassification Improvement (NRI) and Integrated......DS2-VASc score significantly improved the predictive value of the CHADS2 score alone and a CHA2DS2-VASc score=0 could clearly identify 'truly low risk' subjects. Use of the CHA2DS2-VASc score would significantly improve classification of AF patients at low and intermediate risk of stroke, compared......North American and European guidelines on atrial fibrillation (AF) are conflicting regarding the classification of patients at low/intermediate risk of stroke. We aimed to investigate if the CHA2DS2-VASc score improved risk stratification of AF patients with a CHADS2 score of 0-1. Using individual...
Huitrón, Carlos; Pérez, Rosalba; Gutiérrez, Luís; Lappe, Patricia; Petrosyan, Pavel; Villegas, Jesús; Aguilar, Cecilia; Rocha-Zavaleta, Leticia; Blancas, Abel
2013-01-01
Agave tequilana fructans are the source of fermentable sugars for the production of tequila. Fructans are processed by acid hydrolysis or by cooking in ovens at high temperature. Enzymatic hydrolysis is considered an alternative for the bioconversion of fructans. We previously described the isolation of Aspergillus niger CH-A-2010, an indigenous strain that produces extracellular inulinases. Here we evaluated the potential application of A. niger CH-A-2010 inulinases for the bioconversion of A. tequilana fructans, and its impact on the production of ethanol. Inulinases were analyzed by Western blotting and thin layer chromatography. Optimal pH and temperature conditions for inulinase activity were determined. The efficiency of A. niger CH-A-2010 inulinases was compared with commercial enzymes and with acid hydrolysis. The hydrolysates obtained were subsequently fermented by Saccharomyces cerevisiae to determine the efficiency of ethanol production. Results indicate that A. niger CH-A-2010 predominantly produces an exo-inulinase activity. Optimal inulinase activity occurred at pH 5.0 and 50 °C. Hydrolysis of raw agave juice by CH-A-2010 inulinases yielded 33.5 g/l reducing sugars, compared with 27.3 g/l by Fructozyme(®) (Novozymes Corp, Bagsværd, Denmark) and 29.4 g/l by acid hydrolysis. After fermentation of hydrolysates, we observed that the conversion efficiency of sugars into ethanol was 97.5 % of the theoretical ethanol yield for enzymatically degraded agave juice, compared to 83.8 % for acid-hydrolyzed juice. These observations indicate that fructans from raw Agave tequilana juice can be efficiently hydrolyzed by using A. niger CH-A-2010 inulinases, and that this procedure impacts positively on the production of ethanol.
Crystal growth of carbonate apatite using a CaCO3 flux.
Suetsugu, Y; Tanaka, J
1999-09-01
Single crystals of carbonate apatite were grown using a CaCO3 flux under an Ar gas pressure of 55 MPa. The crystals obtained were observed by scanning electron microscopy, optical microscopy and X-ray diffraction. Electron probe microanalyses and thermal analyses were performed. CO3 ions in planar triangle form replaced both OH sites and PO4 tetrahedral sites in the apatite structure: in particular, the OH sites were perfectly substituted by CO3 ions using this method.
Chaîne de blocs | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
7 déc. 2017 ... Des édutiants dans une salle de classe, Tambon Mae La, Myanmar. Zi Jian Lim. La technologie des chaînes de blocs pourrait appuyer et améliorer la gouvernance démocratique et les programmes de développement, mais le degré élevé de sophistication et les exigences complexes du point de vue de ...
Energy Technology Data Exchange (ETDEWEB)
DUNCAN JB; HAGERTY K; MOORE WP; RHODES RN; JOHNSON JM; MOORE RC
2012-06-01
This effort is part of the technetium management initiative and provides data for the handling and disposition of technetium. To that end, the objective of this effort was to challenge tin(II)apatite (Sn(II)apatite) against double-shell tank 241-AN-105 simulant spiked with pertechnetate (TcO{sub 4}{sup -}). The Sn(II)apatite used in this effort was synthesized on site using a recipe developed at and provided by Sandia National Laboratories; the synthesis provides a high quality product while requiring minimal laboratory effort. The Sn(II)apatite reduces pertechnetate from the mobile +7 oxidation state to the non-mobile +4 oxidation state. It also sequesters the technetium and does not allow for re-oxidization to the mo bile +7 state under acidic or oxygenated conditions within the tested period oftime (6 weeks). Previous work (RPP-RPT-39195, Assessment of Technetium Leachability in Cement-Stabilized Basin 43 Groundwater Brine) indicated that the Sn(II)apatite can achieve an ANSI leachability index in Cast Stone of 12.8. The technetium distribution coefficient for Sn(II)apatite exhibits a direct correlation with the pH of the contaminated media. Table A shows Sn(II)apatite distribution coefficients as a function of pH. The asterisked numbers indicate that the lower detection limit of the analytical instrument was used to calculate the distribution coefficient as the concentration of technetium left in solution was less than the detection limit. The loaded sample (200 mg of Sn(II)apatite loaded with O.311 mg of Tc-99) was subjected to different molarities of nitric acid to determine if the Sn(II)apatite would release the sequestered technetium. The acid was allowed to contact for 1 minute with gentle shaking ('1st wash'); the aqueous solution was then filtered, and the filtrate was analyzed for Tc-99. Table B shows the results ofthe nitric acid exposure. Another portion of acid was added, shaken for a minute, and filtered ('2nd wash'). The
The relationship between fission track length and track density in apatite
International Nuclear Information System (INIS)
Laslett, G.M.; Gleadow, A.J.W.; Duddy, I.R.
1984-01-01
Fission track dating is based upon an age equation derived from a random line segment model for fission tracks. This equation contains the implicit assumption of a proportional relationship between the true mean length of fission tracks and their track density in an isotropic medium. Previous experimental investigation of this relationship for both spontaneous and induced tracks in apatite during progressive annealment model in an obvious fashion. Corrected equations relating track length and density for apatite, an anisotropic mineral, show that the proportionality in this case is between track density and a length factor which is a generalization of the mean track length combining the actual length and crystallographic orientation of the track. This relationship has been experimentally confirmed for induced tracks in Durango apatite, taking into account bias in sampling of the track lengths, and the effect of the bulk etching velocity. (author)
Siddiqui, Imran Ali; Haas, Dieter; Heeb, Stephan
2005-01-01
In Pseudomonas fluorescens CHA0, mutation of the GacA-controlled aprA gene (encoding the major extracellular protease) or the gacA regulatory gene resulted in reduced biocontrol activity against the root-knot nematode Meloidogyne incognita during tomato and soybean infection. Culture supernatants of strain CHA0 inhibited egg hatching and induced mortality of M. incognita juveniles more strongly than did supernatants of aprA and gacA mutants, suggesting that AprA protease contributes to biocontrol. PMID:16151170
The Chaîne des Puys: how complicated can monogentic get?
Van Wyk de Vries, B.; Grosse, P.; Marquez, A.; Petronis, M. S.; Kervyn, M.; Delcamp, A.; Mossoux, S.; Troll, V. R.
2012-12-01
The Chaîne des Puys (Massif Centrale of France) is part of a prospective volcano-tectonic UNESCO World Heritage site including the Limagne Rift fault (http://www.chainedespuys-failledelimagne.com/). The strategy is to present the monogentic field that is as representative of other such fields, but which itself is uniquely special. Effectively, the Chaîne des Puys would become a sort of ambassador for monogentic volcanism, raising the profile of all other sites. Here, I want to go through some recent work on the chain, looking at morphology, morphometry, structure, lithology and petrology and show some of the intriguing complexities of this classic highly variable monogentic alignment. Also, I want to build on the historical development of ideas that can be traced back to characters such as Montlosier, Humphrey Davey, Faraday, Lyell, and Von Humbolt... and many more. I focus, first, on the central the Puy de Dôme. This classic trachyte dome has been known for some time to be the product of two eruptions, and recently we have found that it is related to a number of cryptodome intrusions that have created flanking bulges, fed at least two major explosive eruptions, and extensively modified the topography of the field. Strangely, Von Humbolt's concept of 'craters of elevation' rises up in a reanalysis of these structures. Secondly, I visit Lemptégy (www.auvergne-volcan.com/), that in 1857, Scrope called 'an insignificant cone grazed by sheep', but now quarried out and showing the internal structure expected for the Puy de Dôme bulges, as well as illustrating that a seemingly simple scoria cone plumbing can be infernally complicated. Thirdly, I consider the Beaunit, a bucolic village in a maar, where the process of crustal ingestion suggests an intimate relationship between eruptive dynamics and assimilation. With these three examples I show some of the complications and interactions of monogentic basaltic to trachytic volcanism typified by the Chaîne des Puys.
Theoretical basis of remediation of heavy metal contamination by apatite
International Nuclear Information System (INIS)
Raicevic, S.; Mandic, M.; Kaludjerovic, T.
2001-01-01
Recently we have demonstrated the connection between stability of the products of the in situ remediation processes and their values of the ion-ion interaction potential, representing the main term of the cohesive energy. Using this approach, the stability of the products of remediation of Pb and Cd by hydroxyapatite (HAP) was investigated. It has been demonstrated that incorporation of Pb ions from pyromorphite into HAP is followed by a decrease of the cohesive energy, indicating that in remediation of Pb, HAP serves as a source of components necessary for formation of a stabile Pb-apatite phase which is precipitated on the surface of the HAP particles. Contrary, incorporation of Cd from the Cd-apatite into HAP increases the cohesive energy of the system, suggesting that the precipitated Cd-apatite phase is later transformed into a more stabile HAP/Cd solid solution. The presented results of theoretical analysis are in good accordance with the reported experimental results. Based on the results of this analysis, the general criterion for estimation of stability of the products of the in situ remediation processes was proposed. (author)
Daitou, Fumikazu; Maruta, Michito; Kawachi, Giichiro; Tsuru, Kanji; Matsuya, Shigeki; Terada, Yoshihiro; Ishikawa, Kunio
2010-05-01
In this study, we investigated a novel method for fabrication of carbonate apatite block without ionic movement between precursor and solution by using precursor that includes all constituent ions of carbonate apatite. A powder mixture prepared from dicalcium phosphate anhydrous and calcite at appropriate Ca/P ratios (1.5, 1.67, and 1.8) was used as starting material. For preparation of specimens, the slurry made from the powder mixture and distilled water was packed in a split stainless steel mold and heat - treated, ranging from 60 degrees C to 100 degrees C up to 48 hours at 100% humidity. It appeared that carbonate apatite could be obtained above 70 degrees C and monophasic carbonate apatite could be obtained from the powder mixture at Ca/P ratio of 1.67. Carbonate content of the specimen was about 5-7%. Diametral tensile strength of the carbonate apatite blocks slightly decreased with increasing treatment temperature. The decrease in diametral tensile strength is thought to be related to the crystal size of the carbonate apatite formed.
International Nuclear Information System (INIS)
Oliva, Josep; De Pablo, Joan; Cortina, Jose-Luis; Cama, Jordi; Ayora, Carlos
2011-01-01
Highlights: → The efficiency of Apatite II TM increases as the acidity decreases, then the application of apatite-based materials for metal removal treatments should be restricted to slightly acid to neutral waters. → Because of the preferred process of using phosphate ions to form metal-phosphate precipitates, the mixture with other sources of alkalinity, such as limestone, is proposed to extend the duration of Apatite II TM . → Compared with other reactive materials such as limestone and caustic magnesia that exhibit a reduction of porosity Apatite II TM showed stable hydraulic performance. → The extrapolation of the column durabilities to a 1-m-thick passive treatment suggests that the Apatite II TM filling can be active between 5 and 10 years for an inflow pH exceeding 5. - Abstract: Apatite II TM , a biogenic hydroxyapatite, was evaluated as a reactive material for heavy metal (Cd, Cu, Co, Ni and Hg) removal in passive treatments. Apatite II TM reacts with acid water by releasing phosphates that increase the pH up to 6.5-7.5, complexing and inducing metals to precipitate as metal phosphates. The evolution of the solution concentration of calcium, phosphate and metals together with SEM-EDS and XRD examinations were used to identify the retention mechanisms. SEM observation shows low-crystalline precipitate layers composed of P, O and M. Only in the case of Hg and Co were small amounts of crystalline phases detected. Solubility data values were used to predict the measured column experiment values and to support the removal process based on the dissolution of hydroxyapatite, the formation of metal-phosphate species in solution and the precipitation of metal phosphate. Cd 5 (PO 4 ) 3 OH(s), Cu 2 (PO 4 )OH(s), Ni 3 (PO 4 ) 2 (s), Co 3 (PO 4 ) 2 8H 2 O(s) and Hg 3 (PO 4 ) 2 (s) are proposed as the possible mineral phases responsible for the removal processes. The results of the column experiments show that Apatite II TM is a suitable filling for permeable
La chaîne du froid en agroalimentaire
Rosset , Philippe; Beaufort , Annie; Cornu , Marie; Poumeyrol , Gérard
2002-01-01
Le recours au froid constitue une pratique courante pour assurer une conservation prolongée des aliments, de quelques jours à quelques semaines. Limitant notre propos aux denrées réfrigérées et au risque sanitaire d'origine microbiologique, après un rappel de la définition de la chaîne du froid et des modalités générales de mise en oeuvre, nous aborderons dans un premier temps les particularités technologiques de son application. Celle-ci sera étudiée tout d'abord selon le type d'aliments con...
Yao, Fang; LeGeros, John P; LeGeros, Racquel Z
2009-07-01
The mineral in bone is an impure hydroxyapatite, with carbonate as the chief minor substituent. Fluoride has been shown to stimulate osteoblastic activity and inhibit osteoclastic resorption in vitro. CO(3)- and F-substituted apatite (CFA) has been considered as potential bone graft material for orthopedic and dental applications. The objective of this study was to determine the effects of simultaneously incorporated CO(3) and F on the crystallographic physico-chemical properties of apatite. The results showed that increasing CO(3) and Na content in apatites with relatively constant F concentration caused a decrease in crystallite size and an increase in the extent of calcium release; increasing F content in apatites with relatively constant CO(3) concentration caused an increase in crystallite size and a decrease in the extent of Ca release. These findings suggest that CFAs as bone graft materials of desired solubility can be prepared by manipulating the relative concentrations of CO(3) and F incorporated in the apatite.
Period changes of cataclysmic variables below the period gap: V2051 Oph, OY Car and Z Cha
Pilarčík, L.; Wolf, M.; Zasche, P.; Vraštil, J.
2018-04-01
We present our results of a long-term monitoring of cataclysmic variable stars (CVs). About 40 new eclipses were measured for the three southern SU UMa-type eclipsing CVs: V2051 Oph, OY Car and Z Cha. Based on the current O - C diagrams we confirmed earlier findings that V2051 Oph and OY Car present cyclic changes of their orbital periods lasting 25 and 29 years, respectively. In case of Z Cha we propose the light-time effect caused probably by a presence of the third component orbiting the eclipsing CV with the period of 43.5 years. The minimal mass of this companion results about 15 MJup.
Preparation of an apatite-based matrix for the confinement of iodine 129
International Nuclear Information System (INIS)
Audubert, F.
1995-01-01
The aim of this thesis is the study of the conditioning of iodine 129 from the reprocessing of nuclear wastes. Because of its long half life (1.57 10 7 years), the conditioning of iodine 129 requires a matrix stable during several thousands of years. The study of natural minerals allows the selection of mineral phases having a good long term behaviour. In the first part the policy of nuclear wastes management, and in particular of iodine, is recalled. A naturalistic approach is used to define the best conditioning material and the remarkable properties of apatite in this way are described. In the second part, the preparation and physical-chemical characterization of iodo-apatites are described. A demonstration is made that iodine can penetrate inside vanadate or lead phospho-vanadate apatite-based compounds. The third part deals with the preparation of the conditioning material. The sintering reaction under pressure allows the preparation of composite ceramics including iodo-apatite. A multi-layer coating process is defined: coating of PbI 2 with a Pb 3 (VO 4 ) 1.6 (PO 4 ) 0.4 layer and a Ca 10 (PO 4 ) 6 F 2 layer. Sintering is performed at 700 deg. celsius under a 25 MPa pressure. (J.S.)
International Nuclear Information System (INIS)
Somrani, Saida; Banu, Mihai; Jemal, Mohamed; Rey, Christian
2005-01-01
The conversion of amorphous tricalcium phosphate with different hydration ratio into apatite in water at 25 deg. C has been studied by microcalorimetry and several physical-chemical methods. The hydrolytic transformation was dominated by two strong exothermic events. A fast, relatively weak, wetting process and a very slow but strong heat release assigned to a slow internal rehydration and the crystallization of the amorphous phase into an apatite. The exothermic phenomenon related to the rehydration exceeded the crystalline transformation enthalpy. Rehydration occurred before the conversion of the amorphous phase into apatite and determined the advancement of the hydrolytic reaction. The apatitic phases formed evolved slightly with time after their formation. The crystallinity increased whereas the amount of HPO 4 2- ion decreased. These data allow a better understanding of the behavior of biomaterials involving amorphous phases such as hydroxyapatite plasma-sprayed coatings
DNA Binding Hydroxyl Radical Probes.
Tang, Vicky J; Konigsfeld, Katie M; Aguilera, Joe A; Milligan, Jamie R
2012-01-01
The hydroxyl radical is the primary mediator of DNA damage by the indirect effect of ionizing radiation. It is a powerful oxidizing agent produced by the radiolysis of water and is responsible for a significant fraction of the DNA damage associated with ionizing radiation. There is therefore an interest in the development of sensitive assays for its detection. The hydroxylation of aromatic groups to produce fluorescent products has been used for this purpose. We have examined four different chromophores which produce fluorescent products when hydroxylated. Of these, the coumarin system suffers from the fewest disadvantages. We have therefore examined its behavior when linked to a cationic peptide ligand designed to bind strongly to DNA.
Girlanda, M; Perotto, S; Moenne-Loccoz, Y; Bergero, R; Lazzari, A; Defago, G; Bonfante, P; Luppi, A M
2001-04-01
Little is known about the effects of Pseudomonas biocontrol inoculants on nontarget rhizosphere fungi. This issue was addressed using the biocontrol agent Pseudomonas fluorescens CHA0-Rif, which produces the antimicrobial polyketides 2,4-diacetylphloroglucinol (Phl) and pyoluteorin (Plt) and protects cucumber from several fungal pathogens, including Pythium spp., as well as the genetically modified derivative CHA0-Rif(pME3424). Strain CHA0-Rif(pME3424) overproduces Phl and Plt and displays improved biocontrol efficacy compared with CHA0-Rif. Cucumber was grown repeatedly in the same soil, which was left uninoculated, was inoculated with CHA0-Rif or CHA0-Rif(pME3424), or was treated with the fungicide metalaxyl (Ridomil). Treatments were applied to soil at the start of each 32-day-long cucumber growth cycle, and their effects on the diversity of the rhizosphere populations of culturable fungi were assessed at the end of the first and fifth cycles. Over 11,000 colonies were studied and assigned to 105 fungal species (plus several sterile morphotypes). The most frequently isolated fungal species (mainly belonging to the genera Paecilomyces, Phialocephala, Fusarium, Gliocladium, Penicillium, Mortierella, Verticillium, Trichoderma, Staphylotrichum, Coniothyrium, Cylindrocarpon, Myrothecium, and Monocillium) were common in the four treatments, and no fungal species was totally suppressed or found exclusively following one particular treatment. However, in each of the two growth cycles studied, significant differences were found between treatments (e.g., between the control and the other treatments and/or between the two inoculation treatments) using discriminant analysis. Despite these differences in the composition and/or relative abundance of species in the fungal community, treatments had no effect on species diversity indices, and species abundance distributions fit the truncated lognormal function in most cases. In addition, the impact of treatments at the 32-day
Directory of Open Access Journals (Sweden)
Akdag S
2015-11-01
Full Text Available Serkan Akdag, Hakki Simsek, Musa Sahin, Aytac Akyol, Ramazan Duz, Naci Babat Department of Cardiology, Yuzuncu Yil University Medical Faculty, Van, Turkey Background: Epicardial adipose tissue (EAT, mean platelet volume (MPV, platelet-to- lymphocyte ratio (PLR, and neutrophil-to-lymphocyte ratio (NLR have been shown to be helpful in predicting adverse cardiovascular events. However, to date, in the literature, there have been no studies demonstrating the relationship between EAT, MPV, PLR, NLR, and thromboembolism risk in atrial fibrillation (AF. Therefore, we examined the relationship between EAT, MPV, PLR, NLR, and CHA2DS2-VASc score used for the evaluation of thromboembolism risk in patients with AF.Methods: The study included 96 consecutive patients with AF and 52 age- and sex-matched control subjects. We calculated CHA2DS2-VASc risk score for each patient and measured baseline EAT thickness, MPV, PLR, NLR, left atrial volume index, and left ventricular ejection fraction.Results: The group with high CHA2DS2-VASc score had higher EAT (7.2±1.5 vs 5.9±1.2 mm, P<0.001, MPV (9.1±1.1 vs 8.4±1.0 fL, P=0.004, PLR (152.3±28.4 vs 126.7±25.4, P=0.001, and NLR (4.0±1.6 vs 3.2±1.3, P<0.001 compared to group with low-intermediate CHA2DS2-VASc score. Moreover, CHA2DS2-VASc score was found to be positively correlated with EAT (r=0.623, P<0.001, MPV (r=0.350, P=0.004, PLR (r=0.398, P=0.001, and NLR (r=0.518, P<0.001.Conclusion: Our study results demonstrated that EAT thickness, MPV, PLR, and NLR were associated with the thromboembolic risk exhibited by CHA2DS2-VASc score in patients with nonvalvular AF. Keywords: atrial fibrillation, epicardial adipose tissue, platelet, neutrophil, mean platelet volume
Hydroxyl radical reactivity with diethylhydroxylamine
International Nuclear Information System (INIS)
Gorse, R.A. Jr.; Lii, R.R.; Saunders, B.B.
1977-01-01
Diethylhydroxylamine (DEHA) reacts with gas-phase hydroxyl radicals on every third collision, whereas the corresponding reaction in aqueous solution is considerably slower. The high gas-phase reactivity explains the predicted inhibitory effect of DEHA in atmospheric smog processes. Results from the studies in the aqueous phase are helpful in predicting the mechanism of the reaction of DEHA with hydroxyl radicals
Energy Technology Data Exchange (ETDEWEB)
Kuczumow, A., E-mail: kuczon@kul.lublin.pl [Department of Chemistry, Lublin Catholic University, 20-718 Lublin (Poland); Nowak, J. [Department of Chemistry, Lublin Catholic University, 20-718 Lublin (Poland); ChaLas, R. [Department of Conservative Medicine, Lublin Medical University, 20-081 Lublin (Poland)
2011-10-15
The aim of a recent paper was to recognize the chemical and structural changes in apatites, which form both the enamel and the dentin of the human tooth. The aim was achieved by scrutinizing the linear elemental profiles along the cross-sections of human molar teeth. Essentially, the task was accomplished with the application of the Electron Probe Microanalysis method and with some additional studies by Micro-Raman spectrometry. All the trends in linear profiles were strictly determined. In the enamel zone they were either increasing or decreasing curves of exponential character. The direction of the investigations was to start with the tooth surface and move towards the dentin-enamel junction (DEJ). The results of the elemental studies were more visible when the detected material was divided, in an arbitrary way, into the prevailing 'core' enamel ({approx}93.5% of the total mass) and the remaining 'overbuilt' enamel. The material in the 'core' enamel was fully stable, with clearly determined chemical and mechanical features. However, the case was totally different in the 'overbuilt enamel', with dynamic changes in the composition. In the 'overbuilt' layer Ca, P, Cl and F profiles present the decaying distribution curves, whereas Mg, Na, K and CO{sub 3}{sup 2-} present the growing ones. Close to the surface of the tooth the mixture of hydroxy-, chlor- and fluor-apatite is formed, which is much more resistant than the rest of the enamel. On passing towards the DEJ, the apatite is enriched with Na, Mg and CO{sub 3}{sup 2-}. In this location, three of six phosphate groups were substituted with carbonate groups. Simultaneously, Mg is associated with the hydroxyl groups around the hexad axis. In this way, the mechanisms of exchange reactions were established. The crystallographic structures were proposed for new phases located close to DEJ. In the dentin zone, the variability of elemental profiles looks different, with
International Nuclear Information System (INIS)
Ribet, I.; Petit, J.C.; CEA Cadarache, 13 - Saint-Paul-lez-Durance
1998-01-01
Apatites are investigated as possible high performance radioactive waste matrices for specific actinides. In this paper, we have quantified the influence of the chemical composition of apatites on their fission-track annealing behaviour. We aimed to evaluate the capability of apatites to self-anneal high densities of radiation damages produced during disposal. The thermal annealing kinetics, at 280 deg. C, of induced fission tracks has been determined for six different apatite compositions. We show that the chemical composition of apatites is a critical parameter with respect to their annealing behaviour. A mathematical treatment of the data, based upon the methodology of optimum design of experiments, allowed the quantification of the role of substitution for two major elements, of the apatite structure (Ca, P), for chlorine and for the two groups of minor elements, actinides (U+Th) and lanthanides (La+Ce+Y), which are relevant in the nuclear waste disposal context. A high actinide content enhances the annealing of fission-tracks in apatites, which is a very favourable feature of these minerals as radioactive waste matrices. This work also points to a new strategy for the best use of information provided by geological samples. In particular, the mathematical methodology proposed here allows, first, to evaluate the 'quality' of the information obtained and, second, to improve it by a proper choice of additional samples to investigate. (authors)
International Nuclear Information System (INIS)
Marshallsea, S.J.
1987-01-01
Vitrinite reflectance and apatite fission-track analysis (AFTA) are two techiques widely used to assess paleotemperatures of the order of 20-120 deg.C. in sedimentary basins. Whereas vitrinite reflectance is essentially a qualitative technique that gives an integrated measure of the entire thermal history, AFTA can reveal information on the variation of paleotemperatures through time because fission-tracks in apatite are continually produced throughout geological time. An apatite fission track study of the Upper Permian units of the Bowen Basin has offered the opportunity to compare the two paleotemperature indicators and place constraints on the timing of maximum paleotemperatures. The regional pattern of apatite fission-track ages closely coincides with the vitrinite reflectance indicating that maximum paleotemperatures have varied across the Basin with the central region of the Bowen Basin experiencing highest paleotemperatures. The reduction in apatite reflectance fission-track age with increasing reflectance represents the progressive annealing at temperatures around 60-120 deg. C. of those fission-tracks formed prior to the time of maximum temperatures. In those samples giving the youngest apatite fission-track ages all tacks were totally annealed at this time, and the fission-track age in these samples, in the range 90-120 Myr, indicate the time of cooling from the thermal maximum in the Early Cretaceous. 1 ref
Directory of Open Access Journals (Sweden)
Tania Saskianti
2018-04-01
Full Text Available Background: Alveolar bone defects in children still have a high incidence. Conventional bone graft technique that has been used as a defect therapy is still not effective, so new techniques with tissue engineering approach are needed. Bone Morphogenetic Protein 4 (BMP4 as one of the indicators of osteogenic differentiation has not been widely studied, especially in the transplantation with combination of Stem Cells from Human Exfoliated Deciduous (SHED and carbonate apatite. Aim and Objectives: This research aimed to determine the expression of BMP4 after SHED and carbonate apatite transplantation on Rattus norvegicus. Material and Methods: The combinations of SHED and carbonate apatite were transplanted on alveolar bone defects of 4 rats (Rattus norvegicus as the treatment groups and another 4 rats were transplanted with carbonate apatite as the control groups. After 21 days, staining with Hematoxylin Eosin (HE and Immunohistochemistry (IHC BMP4 was performed. Results: BMP4 expression in the treatment groups was significantly higher when compared to the control groups. Discussion: Carbonate apatite has low crystallization rate and high osteoconductivity that produce more osteoblasts and increased BMP4 expression. Conclusion: The transplantation of SHED and carbonate apatite increased BMP4 expression as an indicator of osteogenic differentiation in rats.
Economos, R. C.
2012-12-01
Apatite is a common igneous accessory mineral with a high saturation temperature which can therefore crystallize over a significant portion of magmatic compositional space. Sulfur presents an opportunity to identify zoning in apatites. Unlike other trace elements, sulfur is relatively immobile in the apatite crystal structure and can be present in typical concentrations up to 1500 - 2000 ppm (or 0.5 to 1 wt% SO3). Sulfur concentration zoning in igneous apatites from ore producing magmatic systems has been identified (Streck and Dilles, 1998), but the interpretation of the cause of this zoning remains an open question. δ34S isotopic ratios of whole apatites have been used to track isotopic evolution associated with changes in magma fO2 and eruptive degassing (Rye, 2005). The presented work combines sulfur concentration mapping in zoned apatite crystals with in-situ SIMS 34S and 32S isotope measurements. Apatites were extracted from granite to granodiorite samples from the Cadiz Valley Batholith in the central Mojave Desert. This batholith is related to the pulse of Cretaceous Cordilleran magmatism that generated large batholiths in the Sierra Nevada and the Penninsular Ranges. The Mojave segment of the Cretaceous arc is unique in their construction into a full thickness of continental crust which exerted a strong influence on magmatic compositions. Apatite grains were mounted parallel to C axes, ground until grains were approximately bisected, and analyzed by Electron Microprobe at UCLA, for CaO, P2O5, SO3 and SiO2. Grains were surveyed and those yielding anomalous SO3 contents were investigated by micron-scale concentration mapping. Typical SO3 concentrations of apatites from all samples were ~0.2 wt%, while 8 to 10% of apatite grains from two samples contained cores with concentrations ranging up to 0.5 wt%. The sulfur zoning in these samples is oscillatory, in some grains representing 5 to 6 repetitions of high and low concentrations. Based on these textures
Effects of Metal Ions on the Flotation of Apatite, Dolomite and Quartz
Directory of Open Access Journals (Sweden)
Yaoyang Ruan
2018-04-01
Full Text Available The effects of Ca2+, Mg2+, Al3+, and Fe3+ on the flotation behaviors of apatite, dolomite and quartz were investigated through a micro-flotation test, and the influence of calcium ions on the flotation of these minerals was further elucidated by solution chemistry study, zeta potential measurement, and X-ray photoelectron spectroscopy (XPS analyses. The results indicate that an appropriate amount of Ca2+ and Mg2+ can improve the floatability of apatite but had a negligible effect on the flotation performance of dolomite, whereas Al3+, Fe3+, and excessive amounts of Ca2+ decreased the recovery of apatite and dolomite. The studied metal cations can activate quartz at a particular pH. It can be inferred from solution chemistry and zeta potential measurement that the influence of metal ions on the flotation of different minerals should be attributed to the adsorption of various hydrolysis species on the mineral surfaces. XPS analyses reveal that calcium ions can enhance the adsorption of anionic collector on apatite and quartz surfaces, and there are no apparent changes to be observed on the surface of dolomite in the absence and presence of calcium ions at a concentration of 2.5 × 10−3 M, which was in good agreement with the micro-flotation results.
Szymanski, Filip M; Filipiak, Krzysztof J; Platek, Anna E; Hrynkiewicz-Szymanska, Anna; Karpinski, Grzegorz; Opolski, Grzegorz
2015-05-01
Assessment of stroke risk and implementation of appropriate antithrombotic therapy is an important issue in atrial fibrillation patients. Current risk scores do not take into consideration the comorbidities associated with elevated thromboembolic like obstructive sleep apnea (OSA). The aim of the study was to establish whether atrial fibrillation patients with coexisting OSA have higher stroke risk according to CHADS2 and CHA2DS2-VASc scores. Two hundred fifty-four consecutive patients hospitalized with a primary diagnosis of atrial fibrillation participated in the study. All patients underwent whole night polygraphy and were scored in both CHADS2 and CHA2DS2-VASc according to their medical records or de novo diagnosis. The study population was predominantly male (65.4%; mean age, 57.5 ± 10.0 years) with a high prevalence of hypertension (73.6%), dyslipidemia (63.4%), and obesity (42.9%). OSA was present in 47.6% of patients, who more often had history of stroke (p = 0.0007). Stroke risk profile assessed by both CHADS2 and CHA2DS2-VASc scores was higher in patients with OSA (1.2 ± 0.9 vs. 0.8 ± 0.6; p vs. 1.5 ± 1.1; p = 0.001) than without it. Differences in the stroke risk remained significant across different age strata, and the trend for point values in CHADS2 and CHA2DS2-VASc scores rose along with OSA severity according to the apnea-hypopnea index (AHI; p for trend stroke prediction models.
Developing biogeochemical tracers of apatite weathering by ectomycorrhizal fungi
Vadeboncoeur, M. A.; Bryce, J. G.; Hobbie, E. A.; Meana-Prado, M. F.; Blichert-Toft, J.
2012-12-01
Chronic acid deposition has depleted calcium (Ca) from many New England forest soils, and intensive harvesting may reduce phosphorus (P) available to future rotations. Thin glacial till soils contain trace amounts of apatite, a primary calcium phosphate mineral, which may be an important long-term source of both P and Ca to ecosystems. The extent to which ECM fungi enhance the weathering rate of primary minerals in soil which contain growth-limiting nutrients remains poorly quantified, in part due to biogeochemical tracers which are subsequently masked by within-plant fractionation. Rare earth elements (REEs) and Pb isotope ratios show some potential for revealing differences in soil apatite weathering rates across forest stands and silvicultural treatments. To test the utility of these tracers, we grew birch seedlings semi-hydroponically under controlled P-limited conditions, supplemented with mesh bags containing granite chips. Our experimental design included nonmycorrhizal (NM) as well as ectomycorrhizal cultures (Cortinarius or Leccinum). Resulting mycorrhizal roots and leachates of granite chips were analyzed for these tracers. REE concentrations in roots were greatly elevated in treatments with granite relative to those without granite, demonstrating uptake of apatite weathering products. Roots with different mycorrhizal fungi accumulated similar concentrations of REEs and were generally elevated compared to the NM cultures. Ammonium chloride leaches of granite chips grown in contact with mycorrhizal hyphae show elevated REE concentrations and significantly radiogenic Pb isotope signatures relative to bulk rock, also supporting enhanced apatite dissolution. Our results in culture are consistent with data from field-collected sporocarps from hardwood stands in the Bartlett Experimental Forest in New Hampshire, in which Cortinarius sporocarp Pb isotope ratios were more radiogenic than those of other ectomycorrhizal sporocarps. Taken together, the experimental
Clement, B; Schultze-Mosgau, M H; Richter, P H; Besch, A
1994-07-01
1. The first example of a P450-dependent N-hydroxylation of an aminoguanidine (amidinohydrazone) is reported for 2-amino-5-chlorobenzophenone amidinohydrazone 1 (G 256) as substrate. 2. The N-hydroxylated metabolite 2 (2-amino-5-chlorobenzophenone N-hydroxyamidinohydrazone NOH-G256) and a further metabolite of 1, the phenol 3, were identified by tlc and ms analysis. 3. The microsomal reduction of an N-hydroxyaminoguanidine (N-hydroxy-amidino-hydrazone) was also demonstrated for the transformation of 2 to 1. 4. Both the N-hydroxylation of the aminoguanidine and the retroreduction of the N-hydroxyaminoguanidine were characterized by quantitative hplc analysis. 5. The conversion of the aminoguanidine 1 to N-hydroxyaminoguanidine 2 may be considered as an analogue of the physiological N-hydroxylation of arginine to N-hydroxyarginine by NO synthases.
A likely planet-induced gap in the disc around T Cha
Hendler, Nathanial P.; Pinilla, Paola; Pascucci, Ilaria; Pohl, Adriana; Mulders, Gijs; Henning, Thomas; Dong, Ruobing; Clarke, Cathie; Owen, James; Hollenbach, David
2018-03-01
We present high-resolution (0.11 × 0.06 arcsec2) 3 mm ALMA observations of the highly inclined transition disc around the star T Cha. Our continuum image reveals multiple dust structures: an inner disc, a spatially resolved dust gap, and an outer ring. When fitting sky-brightness models to the real component of the 3 mm visibilities, we infer that the inner emission is compact (≤1 au in radius), the gap width is between 18 and 28 au, and the emission from the outer ring peaks at ˜36 au. We compare our ALMA image with previously published 1.6 μm VLT/SPHERE imagery. This comparison reveals that the location of the outer ring is wavelength dependent. More specifically, the peak emission of the 3 mm ring is at a larger radial distance than that of the 1.6 μm ring, suggesting that millimeter-sized grains in the outer disc are located farther away from the central star than micron-sized grains. We discuss different scenarios to explain our findings, including dead zones, star-driven photoevaporation, and planet-disc interactions. We find that the most likely origin of the dust gap is from an embedded planet, and estimate - for a single planet scenario - that T Cha's gap is carved by a 1.2MJup planet.
Fission track ages and uranium concentration of apatites of different rocks of South India
International Nuclear Information System (INIS)
Nand Lal; Nagpaul, K.K.; Nagpal, M.K.
1975-01-01
The uranium concentration and ages of apatite grains of various rocks of South India have been measured by fission track technique. The ages range from 100 m.y. to 730 m.y. whereas uranium concentrations vary from 0.5 to 23.8 atom/million atoms of the apatite mineral. The ages agree well with the Deccan volcanic and Ocean Cycle activities. (author)
Preparation of rare earth fluorides from apatite concentrate
International Nuclear Information System (INIS)
Mulyarchuk, I.F.; Voloshchenko, M.V.; Zen'kovich, E.G.; Sumenkova, V.V.; AN Ukrainskoj SSR, Kiev. Inst. Problem Lit'ya)
1980-01-01
The processes of preparation of the rare earths element sum from apatite concentrate of the Khibins, connected with preliminary extraction of rare earth phosphates from nitric acid extract using solvent extraction or direct precipitation from the extract by solution of potassium and ammonium fluorides. The sequence of the processes of the first variant is the following: solvent extraction of rare earths by tributylphosphate from clarified nitric acid extract of apatite with subsequent reextraction of rare earths with water and precipitation of rare earth phosphates from aqueous solution during neutralization by ammonia. In case of fluoride preparation from rare earth phosphate the main attention is paid to precipitation and filtration of fluorides. Technological scheme and cost price of industry for the production of 1800 t of rare earth trifluorides a year are calculated. When taking account of TBP losses according to its solubility the industry cost price is 1O times lower the modern cost of rare earth fluorides
Apatite-brannerite-pitchblende association in hydrothermal quartz veins
International Nuclear Information System (INIS)
Brodin, B.V.; Mel'nikova, A.M.; Osipov, B.S.; Pavlov, E.G.
1976-01-01
A study into the vein quartz mineralization confined to the tectonic zones of crush and silicification in sedimentary-igneous rocks of the lower Paleozoic has been made. The physicochemical characteristics of minerals were studied by way of optical and electron microscopy, chemical, laser-microspectral and X-ray structural analyses, microprobing and alpha-microradiography. 3 mineral associations have been discriminated, representative of the sequence of hydrothermal mineralization. An unusual parogenesis of pitchblende and brannerite with apatite, xenotime and more recent goethite has been revealed. The results are indicative of a medium-low-temperature hydrothermal process occurring at the final stages of formation of uraniferrous quartz veins. By composition and mineralization sequence, the latters are close to low- and medium-temperature uranium-quartz-chlorite-hydromica formations with apatite, coffinite, brannerite and pitchblende. The weak initial metamictization of goethite in veins 80 to 100 million years old is due to the radioactive effect of the submicroscopic radioactive mineral impurity on the crystalline lattice
Energy Technology Data Exchange (ETDEWEB)
Arxer, Eliana Alves; Almeida Filho, Edson de; Guastaldi, Antonio Carlos, E-mail: iarxer@iq.unesp.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Araraquara, SP (Brazil). Instituto de Quimica
2011-07-01
The bioceramics of calcium phosphate called apatite, are widely used as material for bone replacement and regeneration, due to its similarity to the mineral component of bones and teeth. The apatites are biocompatible, bioactive and integrate with living tissue by the same active process of physiological bone remodeling. These bioceramics may be used in medical, dental and orthopedic applications. In this research, it was used the wet method for the synthesis of the powder and biomimetic method for coating the surface. The Solubility study was performed in the layer deposited, apatite, for possible application as a platform for inorganic drug delivery. The bioceramics were characterized by MEV, DRX, and EDS. The curves of solubility of apatite in coatings showed that the OCP phase had a higher rate of release in the short term (4 days) while the HA phase showed a gradual release throughout the experiment (16 days). (author)
Acciarresi, Monica; Paciaroni, Maurizio; Agnelli, Giancarlo; Falocci, Nicola; Caso, Valeria; Becattini, Cecilia; Marcheselli, Simona; Rueckert, Christina; Pezzini, Alessandro; Morotti, Andrea; Costa, Paolo; Padovani, Alessandro; Csiba, László; Szabó, Lilla; Sohn, Sung-Il
2017-01-01
Background and Purpose:\\ud \\ud The aim of this study was to investigate for a possible association between both prestroke CHA2DS2-VASc score and the severity of stroke at presentation, as well as disability and mortality at 90 days, in patients with acute stroke and atrial fibrillation (AF).\\ud Methods:\\ud \\ud This prospective study enrolled consecutive patients with acute ischemic stroke, AF, and assessment of prestroke CHA2DS2-VASc score. Severity of stroke was assessed on admission using t...
Park, Gi Tae; Jo, Donghui; Ahn, Nak Ho; Cho, Jung; Hong, Suk Bong
2017-07-17
The structure-directing effects of a series of polymethylimidazolium cations with different numbers of methyl groups as organic structure-directing agents (OSDAs) in the synthesis of aluminophosphate (AlPO 4 )-based molecular sieves in both fluoride and hydroxide media are investigated. On the one hand, among the OSDAs studied here, the smallest 1,3-dimethylimidazolium and the largest 1,2,3,4,5-pentamethylimidazolium cations were found to direct the synthesis of a new variant of the triclinic chabazite (CHA)-type AlPO 4 material, designated AlPO 4 -34(t) V , and the one-dimensional small-pore silicoaluminophosphate (SAPO) molecular sieve STA-6 in hydroxide media, respectively. On the other hand, the intermediate-sized 1,2,3,4-tetramethylimidazolium cation gave SSZ-51, a two-dimensional large-pore SAPO material, in fluoride media. Synchrotron powder X-ray diffraction and Rietveld analyses reveal that as-made AlPO 4 -34(t) V contains penta-coordinated framework Al species connected by hydroxyl groups, as well as tetrahedral framework Al, which contrasts with the distortions arising from the two F - or OH - bridges between octahedral Al atoms in all already known AlPO 4 -34 materials. The presence of Al-OH-Al linkages in this triclinic AlPO 4 -34 molecular sieve has been further corroborated by thermal analysis, variable-temperature IR,27Al magic-angle spinning NMR, and dispersion-corrected density functional theory calculations.
Enhancement of the ALP activity of C3H10T1/2 cells by the combination of an oxysterol and apatite
International Nuclear Information System (INIS)
Son, Kyung Mi; Park, Hee Chul; Kim, Na Ryoung; Yang, Hyeong-Cheol; Lee, In-Seop
2010-01-01
Biomimetic apatite coating has been used to load osteogenic biomolecules onto the surface of titanium implants. Apatite on the surface of biomaterials is thought to function as a reservoir of biomolecules as well as enhancing osteoconductivity. In this study, 20α-hydroxycholesterol (20α-HC), an osteogenic oxysterol, was used to induce differentiation of a mouse embryo fibroblast cell line (C3H10T1/2) by loading the oxysterol on biomimetically coated apatite of titanium discs. We found that the phosphatase (alkaline phosphatase (ALP)) activity of 20α-HC was significantly higher with ascorbic acid than alone, suggesting a need for ascorbic acid as a co-factor. When 20α-HC was added into the apatite coating solution, the ALP activity of the C3H10T1/2 cells did not increase on the apatite surface, even in the presence of ascorbic acid. However, ALP activity increased dramatically when 20α-HC was loaded by volatilization of EtOH from the apatite coat after dipping discs in 20α-HC-dissolved EtOH. Interestingly, ascorbic acid was not needed for this increase in ALP activity, suggesting a synergistic effect of 20α-HC and apatite. The concentration of calcium ions, a major component of apatite, affected the osteogenic effect of 20α-HC, and the increase in ALP activity was attenuated by L-type calcium channel inhibitors, verapamil and nifedipine. These results demonstrate that calcium ions released from apatite are important in the synergistic effect of 20α-HC and apatite.
International Nuclear Information System (INIS)
Bostick, W.D.; Jarabek, R.J.; Conca, J.L.
1999-01-01
The apatite group of minerals is a family of calcium phosphate phases. Apatite is the principal component of bone tissue, and it also occurs naturally as mineral deposits in the geosphere. Bone char is calcined (coked) animal bone, containing activated carbon as well as calcium phosphate mineral phases. Apatite IItrademark is a more reactive form of apatite, supplied by UFA Ventures, Inc., at a cost of approximately 1/4 that of commercial bone char. Apatite is shown to be effective for the removal of select heavy metal impurities in groundwater. Previous investigations have demonstrated that apatite is an effective medium for the stabilization of soluble lead, cadmium, and zinc from mine waste leachate by the formation of highly insoluble precipitate phases. The performance of bone char and apatite II are compared with other candidate sorption media (including granular activated carbon and anion exchange resin) for the removal of soluble uranyl ion in synthetic DOE Site groundwater supplemented with varying levels of interfering nitrate ion. Apatite II has a greater affinity for U(VI), especially in the presence of nitrate ion, as evidenced by a larger value for the conditional distribution coefficient (Kd) in batch test experiments. Contact of uranyl nitrate solution with apatite II is shown to produce highly insoluble mineral phases of the autunite group (calcium uranyl phosphate hydrates). Apatite II is also demonstrated to be moderately effective for the removal of soluble radioactive isotopes of strontium, but not cesium, when these ions are supplemented into authentic DOE Site groundwater
Lead orthovanadate and some vanadium-lead compounds with the apatite structure
Energy Technology Data Exchange (ETDEWEB)
Baran, E J; Botto, I L; Aymonino, P J [La Plata Univ. Nacional (Argentina). Facultad de Ciencias Exactas
1976-06-01
The infrared and Raman spectra of Pb/sub 3/(VO/sub 4/)/sub 2/ are recorded and discussed with the aid of the 'site symmetry' rules. The i.r. spectra of the compounds Pb/sub 5/(VO/sub 4/)/sub 3/X (X=F, Cl, Br), Pb/sub 5/(VO/sub 4/)/sub 2/GeO/sub 4/, Pb/sub 5/(VO/sub 4/)/sub 2/SiO/sub 4/ (all with apatite structure) are also measured and briefly discussed. The X-ray, spectroscopic and analytical investigation of the lead vanadates precipitated from solutions, shows that in this cases mixed crystals of complicated nature, with the apatite structure, are obtained.
International Nuclear Information System (INIS)
Ezz El-Din, M.R.
2007-01-01
The aim of this study is to develop the cow bone derived apatite as a new sorbent for Sr 2+ and Pb 2+ ions from their aqueous waste solutions. In this respect, four different types of apatite (Ca 10 (PO 4 )6(OH) 2 ) were investigated. The first was natural cow bone apatite (raw bone). The second was cow bone derived apatite after treatment at 700 degree C. The third was synthetic apatite and the last was commercial apatite supplied from Bio Rad company, USA. Removal of Sr 2+ and Pb 2+ by the studied samples was investigated using batch experiments. The different parameters affecting sorption process such as contact time, metal ion concentration and hydrogen ion concentration of the aqueous phase were studied. Desorption of the investigated ions from the loaded samples was also studied. The results obtained showed that the raw cow bone was more effective than the other investigated HAP for adsorbing both Sr 2+ and Pb 2+ ions since the removal percentage of Sr 2+ and Pb 2+ by natural cow bone apatite were 85% and 98%, respectively, while the removal of Sr 2+ and Pb 2+ by the synthetic apatite were 71% and 62%, respectively. From the obtained data, it can be concluded that the natural (raw) cow bone apatite can be used as an ion exchanger for removal of some radioactive elements that may present in radioactive waste solutions as well as it could be considered as a new competitor of the other natural absorbents. Therefore, it is recommended that the natural cow bone apatite could be used for removal of both Sr 2+ and Pb 2+ from radioactive waste solutions as well as other wastewater
DNA Binding Hydroxyl Radical Probes
Tang, Vicky J; Konigsfeld, Katie M; Aguilera, Joe A; Milligan, Jamie R
2012-01-01
The hydroxyl radical is the primary mediator of DNA damage by the indirect effect of ionizing radiation. It is a powerful oxidizing agent produced by the radiolysis of water and is responsible for a significant fraction of the DNA damage associated with ionizing radiation. There is therefore an interest in the development of sensitive assays for its detection. The hydroxylation of aromatic groups to produce fluorescent products has been used for this purpose. We have examined four different c...
Directory of Open Access Journals (Sweden)
Maria Giovanna Gandolfi
2013-12-01
Full Text Available Aim: Calcium silicate-based materials are hydraulic self-setting materials with physico-chemical properties suitable for endodontic surgery and good biological/clinical outcomes. The study aim was to evaluate the bio-properties (biointeractivity and apatite-forming ability and selected physical properties (porosity, water sorption, solubility, and setting time of Biodentine, a tricalcium silicate material for endodontics and restorative dentistry, compared to that of ProRoot MTA (Mineral Trioxide Aggregate as gold standard material. Methods: Biodentine and ProRoot MTA pastes were prepared and analyzed for calcium release and alkalinizing activity (3 h–28 days, setting time, water sorption, porosity, solubility, surface microstructure and composition, and apatite-forming ability in simulated body fluid. Results: Biodentine showed higher calcium release, alkalinizing activity, and solubility but higher open and apparent porosity, water sorption, and a markedly shorter setting time. Calcium phosphate (CaP deposits were noted on material surfaces after short ageing times. A CaP coating composed of spherulites was detected after 28 days. The thickness, continuity, and Ca/P ratio of the coating differed markedly between the materials. Biodentine showed a coating composed by denser but smaller spherulites, while ProRoot MTA showed large but less dense aggregates of spherulitic deposits. Conclusions: Biodentine showed a pronounced ability to release calcium and extended alkalinizing activity interlinked with its noticeable porosity, water sorption, and solubility: open porosities provide a broad wet biointeractive surface for the release of the calcium and hydroxyl ions involved in the formation of a CaP mineral. Biodentine is a biointeractive tricalcium silicate material with interesting chemical-physical properties and represents a fast-setting alternative to the conventional calcium silicate MTA-like cements.
Pino, M; Stingelin, N; Tanner, K E
2008-11-01
The skirt of an artificial cornea must integrate the implant to the host sclera, a major failure of present devices. Thus, it is highly desirable to encourage the metabolic activity of the cornea by using more bioactive, flexible skirt materials. Here we describe attempts to increase the bioactivity of polyether ether ketone (PEEK), high-density polyethylene (HDPE) and ultra-high molecular weight polyethylene (UHMWPE) films. The effectiveness of different strength NaOH pre-treatments to initiate apatite deposition on PEEK, HDPE and UHMWPE is investigated. We find that exposure of PEEK, HDPE and UHMWPE films to NaOH solutions induces the formation of potential nuclei for apatite (calcium phosphate), from which the growth of an apatite coating is stimulated when subsequently immersing the polymer films in 1.5 strength Simulated Body Fluid (SBF). As immersion time in SBF increases, further nucleation and growth produces a thicker and more compact apatite coating that can be expected to be highly bioactive. Interestingly, the apatite growth is found to also be dependent on both the concentration of NaOH solution and the structure of the polymer surface.
Energy Technology Data Exchange (ETDEWEB)
Szecsody, James E.; Vermeul, Vincent R.; Fruchter, Jonathan S.; Williams, Mark D.; Rockhold, Mark L.; Qafoku, Nikolla; Phillips, Jerry L.
2010-07-01
The purpose of this study is to evaluate emplacement of phosphate into subsurface sediments in the Hanford Site 100-N Area by two different technologies: groundwater injection of a Ca-citrate-PO4 solution and water-jet injection of sodium phosphate and/or fish-bone apatite. In situ emplacement of phosphate and apatite adsorbs, then incorporates Sr-90 into the apatite structure by substitution for calcium. Overall, both technologies (groundwater injection of Ca-citrate-PO4) and water-jet injection of sodium phosphate/fish-bone apatite) delivered sufficient phosphate to subsur¬face sediments in the 100-N Area. Over years to decades, additional Sr-90 will incorporate into the apatite precipitate. Therefore, high pressure water jetting is a viable technology to emplace phosphate or apatite in shallow subsurface sediments difficult to emplace by Ca-citrate-PO4 groundwater injections, but further analysis is needed to quantify the relevant areal extent of phosphate deposition (in the 5- to 15-ft distance from injection points) and cause of the high deposition in finer grained sediments.
Bioactive coatings on Portland cement substrates: Surface precipitation of apatite-like crystals
International Nuclear Information System (INIS)
Gallego, Daniel; Higuita, Natalia; Garcia, Felipe; Ferrell, Nicholas; Hansford, Derek J.
2008-01-01
We report a method for depositing bioactive coatings onto cement materials for bone tissue engineering applications. White Portland cement substrates were hydrated under a 20% CO 2 atmosphere, allowing the formation of CaCO 3 . The substrates were incubated in a calcium phosphate solution for 1, 3, and 6 days (CPI, CPII, and CPIII respectively) at 37 deg. C to induce the formation of carbonated apatite. Cement controls were prepared and hydrated with and without CO 2 atmosphere (C+ and C- respectively). The presence of apatite-like crystals was verified by Scanning Electron Microscopy (SEM) and Energy Dispersive Spectroscopy (EDS). The substrate cytocompatibility was evaluated via SEM after 24 hour cell cultures. SEM revealed the presence Ca(OH) 2 on C-, and CaCO 3 on C+. Apatite-like crystals were detected only on CPIII, confirmed by phosphorus EDS peaks only for CPIII. Cells attached and proliferated similarly well on all the substrates except C-. These results prove the feasibility of obtaining biocompatible and bioactive coatings on Portland cement for bone tissue engineering applications
Antinociceptive activity of fruits extracts and "arrope" of Geoffroea decorticans (chañar).
Reynoso, M A; Vera, N; Aristimuño, M E; Daud, A; Sánchez Riera, A
2013-01-09
Geoffroea decorticans (chañar) fruits and their derivate product (arrope) have been traditionally used as food and a folk medicine for the treatment of a wide variety of diseases including bronchopulmonary disorders and to relieve dolorous process. In order to evaluate the pharmacology action of this plant, studies were performed of antinociceptive and antioxidant activities. The aqueous and ethanolic extracts and arrope of chañar were evaluated in various established pain models, including chemical nociception induced by subplantar formalin and intraperitoneal acetic acid and thermal nociception method, such as tail immersion test in rats. To examine the possible connection of the opioid receptor to the antinociceptive activity of extracts and arrope it was performed a combination test with naloxone, a non-selective opioid receptor antagonist. The aqueous extract and arrope (1000 mg/kg) caused an inhibition of the pain in formalin test in the first phase, similar to morphine and decrease in the second phase. In a combination test using naloxone, diminished analgesic activity of aqueous extract and arrope were observed, indicating that antinociceptive activity is connected with the opioid receptor. The aqueous extract and arrope, caused an inhibition of the writhing response induced by acetic acid. Central involvement in analgesic profile was confirmed by the tail immersion test, in which the aqueous extract and arrope showed a significant analgesic activity by increasing latency time. The aqueous extract showed higher antioxidant activity than the arrope, it may be due to the cooking process. This study has shown that the aqueous extract and arrope of Geoffroea decorticans (chañar) fruits, does possess significant antinociceptive effects. It is further concluded that aqueous extract with maximum inhibition of free radical is the most potent extract amount tested extracts. At the oral doses tested the aqueous extract and arrope were non-toxic. The present
International Nuclear Information System (INIS)
Ravenhurst, C.E.; Roden-Tice, M.K.; Miller, D.S.
2003-01-01
It is well known that the optically measured lengths of fission tracks in apatite crystals are a function of etching conditions, crystallographic orientation of the track, composition of the crystal, and the state of thermal annealing. In this study we standardize etching conditions and optimize track length measurability by etching until etch pits formed at the surface of each apatite crystal reached widths of about 0.74 μm. Etching times using 5M HNO 3 at 21 o C were 31 s for Otter Lake, Quebec, fluorapatite; 47 s for Durango, Mexico, apatite; 33 s for Portland, Connecticut, manganoanapatite; and 11 s for Bamle, Norway, chlorapatite. An etching experiment using two etchant strengths (5M and 1.6M HNO 3 ) revealed that, despite significant differences in etch pit shape, fission-track length anisotropy with respect to crystallographic orientation of the tracks is not a chemical etching effect. A series of 227 constant-temperature annealing experiments were carried out on nuclear reactor induced tracks in oriented slices of the apatites. After etching, crystallographic orientations of tracks were measured along with their lengths. The 200-300 track lengths measured for each slice were ellipse-fitted to give the major (c crystallographic direction) and minor (a crystallographic direction) semi-axes used to calculate equivalent isotropic lengths. The equivalent isotropic length is more useful than mean length for thermal history analysis because the variation caused by anisotropy has been removed. Using normalized etching procedures and equivalent isotropic length data, we found that the fluorapatite anneals most readily, followed by Durango apatite, manganoanapatite, and lastly chlorapatite. (author)
International Nuclear Information System (INIS)
Wei Jie; Wang Jiecheng; Liu Xiaochen; Ma Jian; Liu Changsheng; Fang Jing; Wei Shicheng
2011-01-01
Fluoride substituted apatite cement (fs-AC) was synthesized by using the cement powders of tetracalcium phosphate (TTCP) and sodium fluoride (NaF), and the cement powders were mixed with diluted phosphoric acid (H 3 PO 4 ) as cement liquid to form fs-AC paste. The fs-AC paste could be directly filled into the carious cavities to repair damaged dental enamel. The results indicated that the fs-AC paste was changed into fluorapatite crystals with the atom molar ratio for calcium to phosphorus of 1.66 and the F ion amount of 3 wt% after self-hardening for 2 days. The solubility of fs-AC in Tris-HCl solution (pH 6) was slightly lower than hydroxyapatite cement (HAC) that was similar to the apatite in enamel, indicating the fs-AC was much insensitive to the weakly acidic solution than the apatite in enamel. The fs-AC was tightly combined with the enamel surface because of the chemical reaction between the fs-AC and the apatite in enamel after the caries cavities was filled with fs-AC. The extracts of fs-AC caused no cytotoxicity on L929 cells, which satisfied the relevant criterion on dental biomaterials, revealing good cytocompatibility. The fs-AC had potential prospect for the reconstitution of carious lesion of dental enamel.
Energy Technology Data Exchange (ETDEWEB)
Oliva, Josep [Department of Mining Engineering and Natural Resou-rces, Universitat Politecnica de Catalunya, Bases de Manresa 61-73, 08242 Manresa, Catalonia (Spain); De Pablo, Joan [Department of Chemical Engineering, Universitat Politecnica de Catalunya, Diagonal 647, 08028 Barcelona, Catalonia (Spain); Cortina, Jose-Luis, E-mail: jose.luis.cortina@upc.edu [Department of Chemical Engineering, Universitat Politecnica de Catalunya, Diagonal 647, 08028 Barcelona, Catalonia (Spain); Water Technology Center, CETaqua, Paseo de los Tilos 3, 08034 Barcelona, Catalonia (Spain); Cama, Jordi; Ayora, Carlos [Institute of Environmental Assessment and Water Research, IDAEA, CSIC, Jordi Girona 18, 08034 Barcelona, Catalonia (Spain)
2011-10-30
Highlights: {yields} The efficiency of Apatite II{sup TM} increases as the acidity decreases, then the application of apatite-based materials for metal removal treatments should be restricted to slightly acid to neutral waters. {yields} Because of the preferred process of using phosphate ions to form metal-phosphate precipitates, the mixture with other sources of alkalinity, such as limestone, is proposed to extend the duration of Apatite II{sup TM}. {yields} Compared with other reactive materials such as limestone and caustic magnesia that exhibit a reduction of porosity Apatite II{sup TM} showed stable hydraulic performance. {yields} The extrapolation of the column durabilities to a 1-m-thick passive treatment suggests that the Apatite II{sup TM} filling can be active between 5 and 10 years for an inflow pH exceeding 5. - Abstract: Apatite II{sup TM}, a biogenic hydroxyapatite, was evaluated as a reactive material for heavy metal (Cd, Cu, Co, Ni and Hg) removal in passive treatments. Apatite II{sup TM} reacts with acid water by releasing phosphates that increase the pH up to 6.5-7.5, complexing and inducing metals to precipitate as metal phosphates. The evolution of the solution concentration of calcium, phosphate and metals together with SEM-EDS and XRD examinations were used to identify the retention mechanisms. SEM observation shows low-crystalline precipitate layers composed of P, O and M. Only in the case of Hg and Co were small amounts of crystalline phases detected. Solubility data values were used to predict the measured column experiment values and to support the removal process based on the dissolution of hydroxyapatite, the formation of metal-phosphate species in solution and the precipitation of metal phosphate. Cd{sub 5}(PO{sub 4}){sub 3}OH(s), Cu{sub 2}(PO{sub 4})OH(s), Ni{sub 3}(PO{sub 4}){sub 2}(s), Co{sub 3}(PO{sub 4}){sub 2}8H{sub 2}O(s) and Hg{sub 3}(PO{sub 4}){sub 2}(s) are proposed as the possible mineral phases responsible for the removal
Stock, Michael J.; Isaia, Roberto; Humphreys, Madeleine C. S.; Smith, Victoria C.; Pyle, David M.
2016-04-01
Apatite is capable of incorporating all major magmatic volatile species (H2O, CO2, S, Cl and F) into its crystal structure. Analysis of apatite volatile contents can be related to parental magma compositions through the application of pressure and temperature-dependent exchange reactions (Piccoli and Candela, 1994). Once included within phenocrysts, apatite inclusions are isolated from the melt and preserve a temporal record of magmatic volatile contents in the build-up to eruption. In this work, we measured the volatile compositions of apatite inclusions, apatite microphenocrysts and pyroxene-hosted melt inclusions from the Astroni 1 eruption of Campi Flegrei, Italy (Stock et al. 2016). These data are coupled with magmatic differentiation models (Gualda et al., 2012), experimental volatile solubility data (Webster et al., 2014) and thermodynamic models of apatite compositional variations (Piccoli and Candela, 1994) to decipher pre-eruptive magmatic processes. We find that apatite halogen/OH ratios decreased through magmatic differentiation, while melt inclusion F and Cl concentrations increased. Melt inclusion H2O contents are constant at ~2.5 wt%. These data are best explained by volatile-undersaturated differentiation over most of the crystallisation history of the Astroni 1 melt, with melt inclusion H2O contents reset at shallow levels during ascent. Given the high diffusivity of volatiles in apatite (Brenan, 1993), the preservation of volatile-undersaturated melt compositions in microphenocrysts suggests that saturation was only achieved 10 - 103 days before eruption. We suggest that late-stage transition into a volatile-saturated state caused an increase in magma chamber overpressure, which ultimately triggered the Astroni 1 eruption. This has major implications for monitoring of Campi Flegrei and other similar volcanic systems. Piccoli and Candela, 1994. Am. J. of Sc., 294, 92-135. Stock et al., 2016, Nat. Geosci. Gualda et al., 2012. J. Pet., 53, 875
Sarma, Bimal K.; Das, Apurba; Barman, Pintu; Pal, Arup R.
2016-04-01
This report presents findings on biomimetic growth of hydroxyapatite (HAp) nanocrystals on Ti and sputtered TiO2 substrates. The possibility of TiO2 nanostructure as candidate materials for future biomedical applications has been explored through the comparison of microstructural and mechanical properties of bone like apatite grown on Ti and nano-TiO2 surfaces. Raman spectroscopy and x-ray diffraction studies reveal formation of carbonate apatite with apparent domain size in the nanoscale range. A better interaction at the nano-TiO2/nano-HAp interface due to higher interfacial area could promote the growth of bone like apatite. The crystal phases, crystallinity, and surface morphology of nano-TiO2 are considered as parameters to understand the nucleation and growth of apatite with different mechanical properties at the nanoscale. The methodology of x-ray line profile analysis encompasses deconvolution of merged peaks by preserving broadening due to nanosized HAp aggregates. The Young’s modulus of bone like apatite exhibits crystallographic directional dependence which suggests the presence of elastic anisotropy in bone like apatite. The lattice contraction in the c-direction is associated with the degree of carbonate substitution in the apatite lattice. The role of residual stress is critical for the lattice distortion of HAp deposited at physiological conditions of temperature and pH of human blood plasma. The ion concentration is crucial for the uniformity, crystallinity, and mechanical behaviour of the apatite.
International Nuclear Information System (INIS)
Sarma, Bimal K; Das, Apurba; Barman, Pintu; Pal, Arup R
2016-01-01
This report presents findings on biomimetic growth of hydroxyapatite (HAp) nanocrystals on Ti and sputtered TiO 2 substrates. The possibility of TiO 2 nanostructure as candidate materials for future biomedical applications has been explored through the comparison of microstructural and mechanical properties of bone like apatite grown on Ti and nano-TiO 2 surfaces. Raman spectroscopy and x-ray diffraction studies reveal formation of carbonate apatite with apparent domain size in the nanoscale range. A better interaction at the nano-TiO 2 /nano-HAp interface due to higher interfacial area could promote the growth of bone like apatite. The crystal phases, crystallinity, and surface morphology of nano-TiO 2 are considered as parameters to understand the nucleation and growth of apatite with different mechanical properties at the nanoscale. The methodology of x-ray line profile analysis encompasses deconvolution of merged peaks by preserving broadening due to nanosized HAp aggregates. The Young’s modulus of bone like apatite exhibits crystallographic directional dependence which suggests the presence of elastic anisotropy in bone like apatite. The lattice contraction in the c-direction is associated with the degree of carbonate substitution in the apatite lattice. The role of residual stress is critical for the lattice distortion of HAp deposited at physiological conditions of temperature and pH of human blood plasma. The ion concentration is crucial for the uniformity, crystallinity, and mechanical behaviour of the apatite. (paper)
Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing
2012-01-01
This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193
Directory of Open Access Journals (Sweden)
Charlotte Atkinson
2017-10-01
Full Text Available Transoesophageal echocardiography (TOE is frequently performed prior to atrial fibrillation (AF ablation to exclude left atrial appendage (LAA thrombus. However, patients undergoing AF ablation are usually anticoagulated, thus making the presence of thrombus unlikely in most cases. This study aimed to determine whether the CHA2DS2VASc scoring system can be used to identify patients that do not require TOE prior to AF ablation. In this single-centre retrospective study, local institutional and primary care databases and electronic patient records were searched to identify patients that had undergone TOE prior to AF ablation. Patient demographics, CHA2DS2VASc score, TOE findings and anticoagulation status were collected for analysis. Over a 7-year period (2008–2014, 332 patients (age 57 ± 10 years; 74% male underwent TOE prior to proposed AF ablation. CHA2DS2VASc scores of 0, 1, 2 and >2 were found in 39, 34, 15 and 12% of patients, respectively. The prevalence of LAA thrombus was 0.6% (2 patients and these 2 patients had risk scores of 2 and 4. No patients with a score of 0 or 1 had LAA thrombus. Patients that are classed as low risk by the CHA2DS2VASc score do not require a pre-ablation TOE to screen for LAA thrombus provided they are adequately anticoagulated. This would lead to a significant reduction in health care expenditures by reducing unnecessary TOE requests and thereby improve patient experience.
Framework 'interstitial' oxygen in La10(GeO4)5-(GeO5)O2 apatite electrolyte
International Nuclear Information System (INIS)
Pramana, S.S.; White, T.J.
2007-01-01
Oxygen conduction at low temperatures in apatites make these materials potentially useful as electrolytes in solid-oxide fuel cells, but our understanding of the defect structures enabling ion migration is incomplete. While conduction along [001] channels is dominant, considerable inter-tunnel mobility has been recognized. Using neutron powder diffraction of stoichiometric 'La 10 (GeO 4 ) 6 O 3 ', it has been shown that this compound is more correctly described as an La 10 (GeO 4 ) 5- (GeO 5 )O 2 apatite, in which high concentrations of interstitial oxygen reside within the channel walls. It is suggested that these framework interstitial O atoms provide a reservoir of ions that can migrate into the conducting channels of apatite, via a mechanism of inter-tunnel oxygen diffusion that transiently converts GeO 4 tetrahedra to GeO 5 distorted trigonal bipyramids. This structural modification is consistent with known crystal chemistry and may occur generally in oxide apatites. (orig.)
Influence of Common Bean (Phaseolus vulgaris) Grown in Elevated CO2 on Apatite Dissolution
Olsen, A. A.; Morra, B.
2016-12-01
We ran a series of experiments to test the hypothesis that release of plant nutrients contained in apatite will be accelerated by the growth of Langstrath Stringless green bean in the presence of atmospheric CO2 meant to simulate possible future atmospheric conditions due a higher demand of nutrients and growth rate caused by elevated CO2. We hypothesize that elevated atmospheric CO2 will lead to both increased root growth and organic acid exudation. These two traits will lead to improved acquisition of P derived from apatite. Experiments were designed to investigate the effect of these changes on soil mineral weathering using plants grown under two conditions, ambient CO2 (400ppm) and elevated CO2 (1000ppm). Plants were grown in flow-through microcosms consisting of a mixture of quartz and apatite sands. Mini-greenhouses were utilized to control CO2 levels. Plant growth was sustained by a nutrient solution lacking in Ca and P. Calcium and P content of the leachate and plant tissue served as a proxy for apatite dissolution. Plants were harvested biweekly during the eight-week experiment and analyzed for Ca and P to calculate apatite dissolution kinetics. Preliminary results suggest that approximately four times more P and Ca are present in the leachate from experiments containing plants under both ambient and elevated CO2 levels than in abiotic experiments; however, the amounts of both P and Ca released in experiments conducted under both ambient and elevated CO2 levels are similar. Additionally, the amount of P in plant tissue grown under ambient and elevated CO2 conditions is similar. Plants grown in elevated CO2 had a greater root to shoot ratio. The planted microcosms were found to have a lower pH than abiotic controls most likely due to root respiration and exudation of organic acids.
Cd2+ and Zn2+ sorption on apatite in the presence of EDTA and humic substance
Directory of Open Access Journals (Sweden)
Viipsi K.
2013-04-01
Full Text Available The sorption of Cd2+ and Zn2+ on hydroxyapatite [HAP- Ca10(PO46(OH2] and fluorapatite [FAP- Ca10( PO46(F2] with different specific surface area and stoichiometry was investigated in batch experiments in the pH range 4 to 11 (25 ◦C; 0.1 M KNO3. The impact of different conditions was concerned: solution pH, the presence of complexing ligands (EDTA and humic substance and competing metal ions, as well as reaction kinetic and equilibrium conditions. To evaluate the reversibility of Cd2+ sorption onto HAP, desorption characteristics in water, Ca, EDTA, and HUM-solutions were determined. Additionally to solution analysis the surface composition of solid phases was analysed by X-Ray Photoelectron Spectroscopy XPS. The information from the chemical analyses was used to design an equilibration model that takes into account dissolution, surface potential, solution and surface complexation, as well as possible phase transformations. It was revealed that apatites effectively sorb Cd2+ and Zn2+ by ion exchange reactions on surface by formation of new surface phases. Using XPS the formation of a Me-enriched HAP surface was found, which was interpreted as the formation of a solid solution with the general formula: Ca8.4-xMex(HPO41.6(PO44.4(OH0.4. In a binary solution (Cd+Zn the competition of metals reduced individual sorbed amount compared with the single component solutions but the total adsorption maximum was approximately constant. The presence of EDTA reduces the metal sorption on apatite due to [CdEDTA]2- and [ZnEDTA]2- complexes and increases apatite solubility due to [CaEDTA]2- complex formation. The dissolved humic substance was bound on apatite in suspensions but the amount of Cd2+ bound was not changed. The results showed that the solution pH and the presence of complexing ligands have a significant effect on heavy metal sorption on apatite and must be considered if apatites are used as remediation agent. The proposed model can be used to predict
Radiation damage studies of mineral apatite, using fission tracks and thermoluminescence techniques
International Nuclear Information System (INIS)
Al-Khalifa, I.J.M.
1988-01-01
In a uranium (/thorium)-rich mineral sample which has not suffered a recent geological high-temperature excursion, the fossil fission track density (FFTD) will give a good indication of its natural radiation damage, provided that its U/Th ratio is known. From our studies of FFTD and thermoluminescence (TL) properties of several samples of apatite from different locations, and containing varying degrees of natural-radiation damage, an anti-correlation is observed between FFTD and TL sensitivity. It is also found that an anti-correlation exists between TL sensitivity and the amount of damage produced artificially by bombarding apatite crystals with different fluences of ∼30 MeV α-particles from a cyclotron. These results indicate that the presence of radiation damage in this mineral (viz., fluorapatite) can severely affect its TL sensitivity (i.e. TL output per unit test dose). The effect of crystal composition on the thermoluminescence and fission track annealing properties of mineral apatite is also reported. We have found that fission track annealing sensitivity and TL sensitivity are both significantly lower in samples of chlorapatite than in samples consisting predominantly of fluorapatite. (author)
Influence of agitation intensity on flotation rate of apatite particles
Directory of Open Access Journals (Sweden)
Francisco Gregianin Testa
Full Text Available Abstract The agitation intensity has a directly influence on flotation performance, lifting the particles and promoting the contact of bubbles and particles. In this paper, the energy input by the agitation on apatite flotation was investigated. The influence of pulp agitation in the flotation rate of particles with different sizes and two dosage levels was evaluated by batch testing. The flotation tests were conducted in an oscillating grid flotation cell (OGC, developed to promote a near isotropic turbulence environment. The cell is able to control the intensity of agitation and measure the energy transferred to the pulp phase. A sample of pure apatite was crushed (P80=310µm, characterized and floated with sodium oleate as collector. Four levels of energy dissipation, from 0.1 to 2 kWm-3, and two levels of collector dosage are used during the tests. The flotation kinetics by particle size were determined in function of the energy transferred. The results show a strong influence of the agitation intensity on the apatite flotation rate with both low and high dosage. For fine particles, when increasing the energy input, the flotation rate increase too, and this fact can be attributed to elevation of bubble-particle collisions. The kinetic result for the coarse particles demonstrated a reduction of the flotation rate whenever the energy input for this particle size was increased, whereby the turbulence caused by the agitation promotes the detachment of bubble-particle.
Energy Technology Data Exchange (ETDEWEB)
Wei Jie [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Inter-disciplinary Studies, Peking University, Beijing 100871 (China); Key Laboratory for Ultrafine Materials of Ministry of Education, East China University of Science and Technology, Shanghai 200237 (China); Wang Jiecheng; Liu Xiaochen [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Inter-disciplinary Studies, Peking University, Beijing 100871 (China); Ma Jian [Hospital of Stomatology, Tongji University, Shanghai 200072 (China); Liu Changsheng [Key Laboratory for Ultrafine Materials of Ministry of Education, East China University of Science and Technology, Shanghai 200237 (China); Fang Jing, E-mail: biomater2006@yahoo.com.cn [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Inter-disciplinary Studies, Peking University, Beijing 100871 (China); Wei Shicheng, E-mail: nic7505@263.net [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Inter-disciplinary Studies, Peking University, Beijing 100871 (China) and School and Hospital of Stomatology, Peking University, Beijing 100081 (China)
2011-06-15
Fluoride substituted apatite cement (fs-AC) was synthesized by using the cement powders of tetracalcium phosphate (TTCP) and sodium fluoride (NaF), and the cement powders were mixed with diluted phosphoric acid (H{sub 3}PO{sub 4}) as cement liquid to form fs-AC paste. The fs-AC paste could be directly filled into the carious cavities to repair damaged dental enamel. The results indicated that the fs-AC paste was changed into fluorapatite crystals with the atom molar ratio for calcium to phosphorus of 1.66 and the F ion amount of 3 wt% after self-hardening for 2 days. The solubility of fs-AC in Tris-HCl solution (pH 6) was slightly lower than hydroxyapatite cement (HAC) that was similar to the apatite in enamel, indicating the fs-AC was much insensitive to the weakly acidic solution than the apatite in enamel. The fs-AC was tightly combined with the enamel surface because of the chemical reaction between the fs-AC and the apatite in enamel after the caries cavities was filled with fs-AC. The extracts of fs-AC caused no cytotoxicity on L929 cells, which satisfied the relevant criterion on dental biomaterials, revealing good cytocompatibility. The fs-AC had potential prospect for the reconstitution of carious lesion of dental enamel.
Meslin, P.-Y.; Cicutto, L.; Forni, O.; Drouet, C.; Rapin, W.; Nachon, M.; Cousin, A.; Blank, J. G.; McCubbin, F. M.; Gasnault, O.;
2016-01-01
Determining the composition of apatites is important to understand the behavior of volatiles during planetary differentiation. Apatite is an ubiquitous magmatic mineral in the SNC meteorites. It is a significant reservoir of halogens in these meteorites and has been used to estimate the halogen budget of Mars. Apatites have been identified in sandstones and pebbles at Gale crater by ChemCam, a Laser-Induced Breakdown Spectroscometer (LIBS) instrument onboard the Curiosity rover. Their presence was inferred from correlations between calcium, fluorine (using the CaF molecular band centered near 603 nm, whose detection limit is much lower that atomic or ionic lines and, in some cases, phosphorus (whose detection limit is much larger). An initial quantification of fluorine, based on fluorite (CaF2)/basalt mixtures and obtained at the LANL laboratory, indicated that the excess of F/Ca (compared to the stoichiometry of pure fluorapatites) found on Mars in some cases could be explained by the presence of fluorite. Chlorine was not detected in these targets, at least above a detection limit of 0.6 wt% estimated from. Fluorapatite was later also detected by X-ray diffraction (with CheMin) at a level of approx.1wt% in the Windjana drill sample (Kimberley area), and several points analyzed by ChemCam in this area also revealed a correlation between Ca and F. The in situ detection of F-rich, Cl-poor apatites contrasts with the Cl-rich, F-poor compositions of apatites found in basaltic shergottites and in gabbroic clasts from the martian meteorite NWA 7034, which were also found to be more Cl-rich than apatites from basalts on Earth, the Moon, or Vesta. The in situ observations could call into question one of the few possible explanations brought forward to explain the SNC results, namely that Mars may be highly depleted in fluorine. The purpose of the present study is to refine the calibration of the F, Cl, OH and P signals measured by the ChemCam LIBS instrument, initiated
Characterization and potential application of pataua vegetable oil in apatite flotation
International Nuclear Information System (INIS)
Oliveira, P.S. de; Mansur, H.S.; Peres, A.E.C.
2016-01-01
The present research characterizes the Pataua palm (Oenocarpus bataua) oil regarding to its fatty acids profile and acidity index, and evaluates its use for apatite flotation. The Pataua oil evaluated is unsaturated e predominantly composed of cis-9-octadecenoic acid (oleic acid). The mineral sample characterization revealed a material composed by a fluoroapatite deficient in fluorine, a possibly result of isomorphic substitution, and with quartz and monazite inclusions. The analysis of the mineral after reagent conditioning, by Fourier Transform Infrared Spectroscopy (FTIR), pointed to the presence of characteristic bands of carbon chains and carboxylate group, suggesting the collector adsorption through the mechanisms of chemisorption and insoluble calcium salts precipitation. Thus, it is proposed the Pataua oil potential use in flotation systems aiming apatite recovery. (author)
Apatite fission track evidence on the uplifting of eastern Kunlun mountains
International Nuclear Information System (INIS)
Yuang Wanming; Dong Jinquan; Tang Yunhui; Wang Shicheng
2004-01-01
A series of samples were collected from about south-north section through Buqingshan and Dulan, eastern Kunlun mountains, China. The 41 apatite fission track ages (FTA) of these samples lie between 25.2 and 130.4 Ma, all of the apatite fission track ages are significantly younger than the host rocks. There are similar evolution trends for Middle-Kunlun zone and North-Kunlun zone, i.e. the FTA becomes less with slow increase of elevations and their uplifting rates are about 2.22 m/Ma. Differently, the FTA in South-Kunlun zone positively correlates to elevation, decreasing 11 m/Ma. It may be shown that South-Kunlun fault play a different and/or more important role on incontinent evolution than Middle-Kunlun fault. (author)
Energy Technology Data Exchange (ETDEWEB)
Szubert, M., E-mail: mm.szubert@gmail.com [Faculty of Chemical Technology, Poznan University of Technology, Poznan (Poland); Adamska, K. [Faculty of Chemical Technology, Poznan University of Technology, Poznan (Poland); Szybowicz, M. [Faculty of Technical Physics, Poznan University of Technology, Poznan (Poland); Jesionowski, T. [Faculty of Chemical Technology, Poznan University of Technology, Poznan (Poland); Buchwald, T. [Faculty of Technical Physics, Poznan University of Technology, Poznan (Poland); Voelkel, A. [Faculty of Chemical Technology, Poznan University of Technology, Poznan (Poland)
2014-01-01
The aim of this study was the surface modification of hydroxyapatite and β-tricalcium phosphate by poly(3-hydroxybutyrate) grafting and characterization of modificates. The bioactivity examination was carried out by the determination to grow an apatite layer on modified materials during incubation in simulated body fluid at 37 °C. The additional issue taken up in this paper was to investigate the influence of fluid replacement. The process of the surface modification of biomaterials was evaluated by means of infrared and Raman spectroscopy. Formation of the apatite layer was assessed by means of scanning electron microscopy and confirmed by energy dispersive, Raman and Fourier transformed infrared spectroscopy. During exposure in simulated body fluid, the variation of the zeta potential, pH measurement and relative weight was monitored. Examination of scanning electron microscopy micrographs suggests that modification of hydroxyapatite and β-tricalcium phosphate by poly(3-hydroxybutyrate) significantly increases apatite layer formation. Raman spectroscopy evaluation revealed that the formation of the apatite layer was more significant in the case of hydroxyapatite modificate, when compared to the β-tricalcium phosphate modificate. Both modificates were characterized by stable pH, close to the natural pH of human body fluids. Furthermore, we have shown that a weekly changed, simulated body fluid solution increases apatite layer formation. - Highlights: • Surface modification of HA and β-TCP was performed by PHB grafting. • The growth of apatite layer on materials was examined in simulated body fluid (SBF). • The bioactivity of obtained materials was proved. • The replacement of SBF solution plays an important role in the process of apatite formation.
International Nuclear Information System (INIS)
Szubert, M.; Adamska, K.; Szybowicz, M.; Jesionowski, T.; Buchwald, T.; Voelkel, A.
2014-01-01
The aim of this study was the surface modification of hydroxyapatite and β-tricalcium phosphate by poly(3-hydroxybutyrate) grafting and characterization of modificates. The bioactivity examination was carried out by the determination to grow an apatite layer on modified materials during incubation in simulated body fluid at 37 °C. The additional issue taken up in this paper was to investigate the influence of fluid replacement. The process of the surface modification of biomaterials was evaluated by means of infrared and Raman spectroscopy. Formation of the apatite layer was assessed by means of scanning electron microscopy and confirmed by energy dispersive, Raman and Fourier transformed infrared spectroscopy. During exposure in simulated body fluid, the variation of the zeta potential, pH measurement and relative weight was monitored. Examination of scanning electron microscopy micrographs suggests that modification of hydroxyapatite and β-tricalcium phosphate by poly(3-hydroxybutyrate) significantly increases apatite layer formation. Raman spectroscopy evaluation revealed that the formation of the apatite layer was more significant in the case of hydroxyapatite modificate, when compared to the β-tricalcium phosphate modificate. Both modificates were characterized by stable pH, close to the natural pH of human body fluids. Furthermore, we have shown that a weekly changed, simulated body fluid solution increases apatite layer formation. - Highlights: • Surface modification of HA and β-TCP was performed by PHB grafting. • The growth of apatite layer on materials was examined in simulated body fluid (SBF). • The bioactivity of obtained materials was proved. • The replacement of SBF solution plays an important role in the process of apatite formation
AHP 24: A Multi-ethnic Village in Northeast Tibet - History, Ritual, and Daily Life in Chu cha
Directory of Open Access Journals (Sweden)
Stobs stag lha སྟོབས་སྟག་ལྷ།
2013-09-01
Full Text Available Multi-ethnic Chu cha Village in Mchod rten thang Township, Dpa' ris Tibetan Autonomous County, Gansu Province, China is described in terms of location; population; clothing; language; religion; history; and personal, family, and community rituals. Photographs provide additional information.
Formation of apatite layers on modified canasite glass-ceramics in simulated body fluid.
Miller, C A; Kokubo, T; Reaney, I M; Hatton, P V; James, P F
2002-03-05
Canasite glass-ceramics were modified by either increasing the concentration of calcium in the glass, or by the addition of P2O5. Samples of these novel materials were placed in simulated body fluid (SBF), along with a control material (commercial canasite), for periods ranging from 12 h to 28 days. After immersion, surface analysis was performed using thin film X-ray diffraction, Fourier transform infrared reflection spectroscopy, and scanning electron microscopy equipped with energy dispersive X-ray detectors. The concentrations of sodium, potassium, calcium, silicon, and phosphorus in the SBF solution were measured using inductively coupled plasma emission spectroscopy. No apatite was detected on the surface of commercial canasite, even after 28 days of immersion in SBF. A crystalline apatite layer was formed on the surface of a P2O5-containing canasite after 5 days, and after 3 days for calcium-enriched canasite. Ion release data suggested that the mechanism for apatite deposition was different for P2O5 and non-P2O5-containing glass-ceramics. Copyright 2001 John Wiley & Sons, Inc.
Patel, Aarti A; Nelson, Winnie W; Schein, Jeff
2016-10-01
The purpose of this study is to report on the effect of using CHA 2 DS 2 VASc (congestive heart failure, hypertension, age ≥75 years [doubled], type 1 or type 2 diabetes mellitus, stroke or transient ischemic attack or thromboembolism [doubled], vascular disease [prior myocardial infarction, peripheral artery disease, or aortic plaque], age 65-75 years, sex category [female]) rather than CHADS 2 (congestive heart failure, hypertension, age ≥75 years, diabetes mellitus, and prior stroke) to determine candidacy for anticoagulant prophylaxis in insured patients with atrial fibrillation (AF). Six administrative claims databases that included medical and pharmacy claims for patients aged ≥18 years with a new or existing diagnosis of AF and patient outcomes assessed for 1 year after diagnosis were analyzed. Retrospective health plan data analyses were performed using a software tool (Anticoagulant Quality Improvement Analyzer). Study measures included stroke risk (identified by CHADS 2 and CHA 2 DS 2 VASc scores), bleeding risk (identified by the Anticoagulation and Risk Factors in Atrial Fibrillation score), and anticoagulant use. A total of 115,906 patients with AF (range of mean ages among the 6 databases, 56-79 years) met the inclusion criteria. All ranges reported represent the minimum and maximum values among the 6 databases. Using the CHA 2 DS 2 VASc compared with the CHADS 2 index to assess stroke risk resulted in a 23% to 32% increase in patients considered potential candidates for anticoagulant prophylaxis. This translated to a 38% to 114% increase in the number of ostensibly undertreated patients. Among patients with high stroke and low bleeding risk, 18% to 28% more patients were considered potential candidates for anticoagulation treatment using CHA 2 DS 2 VASc compared with CHADS 2 , or a 57% to 151% increase in the number of undertreated patients. Use of the CHA 2 DS 2 VASc score to determine the risk of stroke increased the number of AF patients for
On the reproducibility of apatite fission-track plateau-age dating
International Nuclear Information System (INIS)
Poupeau, G.; Baitelli, R.; Berbert, M.; Fonseca, A.
1985-01-01
Duplicate measurements as well as published data show that plateau-age measurements on apatites have a reproducibility - when made in optical microscopy - generally better than +- 5%, which may be accounted for by statistical errors on track density measurement. (Author) [pt
International Nuclear Information System (INIS)
Boyer, Laurent
1998-01-01
Apatite matrices have been developed for the conditioning of actinides from spent fuels of PWR reactors. Silicated apatites (britholites) containing actinides and lanthanides have been discovered in the natural environment. Synthetic analogues of these britholites can be obtained by solid-solid reaction at high temperature. The compounds of the solid solution of fluorinated britholites are synthesized by the double substitution of (Ca 2+ , PO 4 3- ) by (Ln 3+ , SiO 4 4- ). Trivalent lanthanides are chemical analogues of trivalent actinides. The synthesis was performed with La, Nd and Eu. This study allows to demonstrate that the chemical immobilization comes from the fixation of rare earths at the atomic scale, thanks to their participation to the mineral structure. In part 1, the criteria for the formulation of a matrix for the conditioning of separate radionuclides are given. The structure and the different methods of apatite preparation are shown. Part 2 treats of the study of the solid solution, of the elaboration of the Ca 9 Nd 1 (SiO 4 ) 5 F 2 ceramic and of its physico chemical characterization. The last part deals with the localization of rare earths in the apatite structure, determined by europium luminescence and X-ray diffraction on monocrystal. (J.S.) [fr
Enhanced apatite formation on Ti metal heated in PO2-controlled nitrogen atmosphere.
Hashimoto, Masami; Hayashi, Kazumi; Kitaoka, Satoshi
2013-10-01
The oxynitridation of biomedical titanium metal under a precisely regulated oxygen partial pressure (PO2) of 10(-14)Pa in nitrogen atmosphere at 973 K for 1 h strongly enhanced apatite formation compared with that on Ti heated in air. The factors governing the high apatite-forming ability are discussed from the viewpoint of the surface properties of Ti heated under a PO2 of 10(-14)Pa in nitrogen atmosphere determined from X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and zeta potential measurements. Nitrogen (N)-doped TiO2 (interstitial N) was formed on pure Ti heated under a PO2 of 10(-14)Pa in nitrogen atmosphere at 973 K. The XPS O1s main peak shifted toward a lower binding energy upon heating under a PO2 of 10(-14)Pa. This shift may be due to the formation of oxygen vacancies. This Ti surface had a positive zeta potential of approximately 20 mV. According to time-of-flight secondary ion mass spectroscopy results, PO4(3-) ions were predominantly adsorbed on Ti soaked in simulated body fluid (SBF) after heat treatment, followed by calcium ions. It was concluded that the apatite formation kinetics can be described using the Avrami-Erofeev equation with an Avrami index of n=2, which implies the instantaneous nucleation of apatite on the surface of Ti soaked in SBF after heat treatment at 973 K under a PO2 of 10(-14)Pa. Copyright © 2013 Elsevier B.V. All rights reserved.
Sotnikova, Irina; Vladykin, Nikolai
2015-04-01
Burpalinsky rare metal alkaline massif in the Northern Baikal folded zone in southern margin of Siberian Platform, is a of intrusion central type, created 287 Ma covering area of about 250 km2. It is composed of nepheline syenites and pulaskites grading to quartz syenites in the contacts. Veines and dykes are represented by shonkinites, sodalite syenite, leucocratic granophyres, alkali granites and numerous rare metal alkaline syenite pegmatites and two dykes of carbonatites. All rocks except for granites are cut by a large apatite-fluorite dyke rocks with mica and magnetite, which in turn is cut by alaskite granites dyke. The massif has been studied by A.M. Portnov, A.A. Ganzeev et al. (1992) Burpalinsky massif is highly enriched with trace elements, which are concentrated in pegmatite dykes. About 70 rare-metal minerals we found in massif. Zr-silicates: zircon, eudialyte, lovenite, Ti-lovenite, velerite, burpalite, seidozerite, Ca- seidozerite, Rosenbuschite, vlasovite, katapleite, Ca-katapleite, elpidite. Ti- minerals:- sphene, astrophyllite, ramsaite, Mn-neptunite bafertisite, chevkinite, Mn-ilmenite, pirofanite, Sr-perrerit, landauite, rutile, anatase, brookite; TR- minerals - loparite, metaloparite, britolite, rinkolite, melanocerite, bastnesite, parisite, ankilite, monazite, fluocerite, TR-apatite; Nb- minerals - pyrochlore, loparite. Other rare minerals leucophanite, hambergite, pyrochlore, betafite, torite, thorianite, tayniolite, brewsterite, cryolite and others. We have proposed a new scheme massif: shonkinites - nepheline syenites - alkaline syenite - quartz syenites - veined rocks: mariupolites, rare-metal pegmatites, apatite, fluorite rock alyaskite and alkaline granites and carbonatites (Sotnikova, 2009). Apatite-fluorite rocks are found in the central part of massif. This is a large vein body of 2 km length and a 20 m width cutting prevailing pulaskites. Previously, these rocks were regarded as hydrothermal low-temperature phase. New geological and
Study of retention properties of fluoro-apatite carbonate relative to Ni(II), Am(III) and Th(IV)
International Nuclear Information System (INIS)
Perrone, Jane
1999-01-01
Apatite minerals and particularly the carbonated species (francolites), are characterized by their chemical and geological stability and also by their capacity to retain durably a large number of elements. Therefore, they should be able to improve the retention properties of the engineered barriers of a deep geological nuclear waste repository. But there is a wide variety of francolites, so we focused our study on a synthetic carbonate fluoro-apatite of formula: Ca 10 (PO 4 ) 5 (CO 3 )(F,OH) 3 and on a natural apatite. We first studied their solubility which is an important criterion for the choice of the materials. A particular attention was also paid to the determination of their surface characteristics and to the study of the radionuclide/solution interactions. Sorption experiments have been performed for the three radionuclides and the influence of various parameters has been investigated. The modelling of the sorption isotherms with surface complexation models leads us to estimate the values of the constants associated to the equilibria under consideration. We have also demonstrated that the phosphate ions of the solution participate to the immobilization of americium as the AmPO 4 ,xH 2 O compound. Both apatites show high retention levels for the actinides: the sorption is quite total over all the pH range studied and the Kd values are close to 10 4 m 3 kg -1 . Consequently, the use of apatites could be considered as a specific solution for the immobilisation of heavy elements, specially actinides. Moreover, the results indicate that high amounts of carbonates and impurities do not alter the retention properties of francolites. This bears out the feasibility of the use of natural apatites as additives for the engineered barrier materials. (author)
Akisaka, Toshitaka; Yoshida, Atsushi
2015-05-01
Osteoclasts are highly polarized cells from both morphological and functional points of view. Using quick-freeze, rotary-replication methods combined with cell-shearing, we clarified the variability of cytoplasmic surface of the polarized membranes of osteoclasts seeded on apatite. As to the organization of actin filaments and clathrin sheets, we confirmed almost the same ventral membrane specializations of osteoclasts on apatite as seen on glass plates. The organized actin filaments and membrane-associated particles supported the ruffled border membranes. Inside the actin sealing zone, membrane specializations were not always occupied with the ruffled border but also with other types of membranes. Some osteoclasts formed an actin ring but lacked the ruffled border projections. We report a unique and distinctive membrane modification of apatite-attached osteoclasts, i.e., the presence of dense aggregates of membrane-associated particles and related structures not found in the osteoclasts seeded on glass plates. Actin filament polarity in the podosomes was determined by decoration with myosin S1. The actin filament polarity within podosome appears to be oriented predominantly with its barbed ends toward the core, whereas the interconnecting F-actin appears to be mixed oriented. Two different types of clathrin plaques displayed different distributions: clathrin-dependent endocytosis was observed in the ruffled border regions, whereas flat clathrin sheets were found in the leading edge of lamellipodia and near podosomes. The clathrin sheets adhered to the apatite surface tightly on the ventral membranes overlaying the resorption lacunae. All these membrane specializations as mentioned above may indicate the functional variability of osteoclasts seeded on apatite.
Solubility of apatite in H2O-NaCl and silicate-bearing solutions at 0.7-3.0 GPa, 800° C
Antignano, A.; Manning, C. E.
2004-12-01
Apatite is a major reservoir for the rare-earth elements (REE) in the earth's crust. However, little is known about its solubility in metamorphic fluids. We measured the solubility of apatite in H2O-NaCl and silicate bearing fluids at 800° C and 1.0-2.0 GPa using a piston-cylinder apparatus with NaCl-graphite furnaces. A single Durango fluor-apatite crystal was loaded into a 1.6 mm OD Pt inner capsule, which was crimped and then placed in a 3.5 OD Pt outer capsule with ultra pure H2O and NaCl or powdered albite. Solubility was determined by the weight loss of the apatite grain after 24 hrs. In the H2O-NaCl experiments, total dissolved solids (TDS) were initially below detection (0.4 millimolal) between XNaCl= 0 and XNaCl= 0.025. At XNaCl= 0.035, solubility was 3.3(0.2) millimolal (errors are 1s), and it increased to 57.5(0.4) millimolal at XNaCl= 0.526. Our results show that there is an enhancement in apatite solubility with increasing pressure in pure H2O. Solubility is initially below detection at bearing solutions. This probably explains textures in which monazite mantles apatite, which are common in granulite metamorphic terranes, such as the Kiirunavaara magnetite-apatite ore.
About the Genetic Mechanisms of Apatites: A Survey on the Methodological Approaches
Directory of Open Access Journals (Sweden)
Linda Pastero
2017-08-01
Full Text Available Apatites are properly considered as a strategic material owing to the broad range of their practical uses, primarily biomedical but chemical, pharmaceutical, environmental and geological as well. The apatite group of minerals has been the subject of a huge number of papers, mainly devoted to the mass crystallization of nanosized hydroxyapatite (or carboapatite as a scaffold for osteoinduction purposes. Many wet and dry methods of synthesis have been proposed. The products have been characterized using various techniques, from the transmission electron microscopy to many spectroscopic methods like IR and Raman. The experimental approach usually found in literature allows getting tailor made micro- and nano- crystals ready to be used in a wide variety of fields. Despite the wide interest in synthesis and characterization, little attention has been paid to the relationships between bulk structure and corresponding surfaces and to the role plaid by surfaces on the mechanisms involved during the early stages of growth of apatites. In order to improve the understanding of their structure and chemical variability, close attention will be focused on the structural complexity of hydroxyapatite (HAp, on the richness of its surfaces and their role in the interaction with the precursor phases, and in growth kinetics and morphology.
Hong, JaeSub; van den Berg, Maureen; Schlegel, Eric M.; Grindlay, Jonathan E.; Koenig, Xavier; Laycock, Silas; Zhao, Ping
2005-12-01
We describe the X-ray analysis procedure of the ongoing Chandra Multiwavelength Plane (ChaMPlane) Survey and report the initial results from the analysis of 15 selected anti-Galactic center observations (90degusing custom-developed analysis tools appropriate for Galactic sources but also of general use: optimum photometry in crowded fields using advanced techniques for overlapping sources, rigorous astrometry and 95% error circles for combining X-ray images or matching to optical/IR images, and application of quantile analysis for spectral analysis of faint sources. We apply these techniques to 15 anti-Galactic center observations (of 14 distinct fields), in which we have detected 921 X-ray point sources. We present logN-logS distributions and quantile analysis to show that in the hard band (2-8 keV) active galactic nuclei dominate the sources. Complete analysis of all ChaMPlane anti-Galactic center fields will be given in a subsequent paper, followed by papers on sources in the Galactic center and bulge regions.
U-Th-He dating of apatite: A potential thermochronometer
International Nuclear Information System (INIS)
Zeitler, P.K.; Herczeg, A.L.; McDougall, I.; Honda, M.
1987-01-01
The authors found a gem quality crystal of Durango fluorapatite to have a 4 He content consistent with complete retention of radiogenic helium since its formation at about 31 Ma. Isothermal heating and step-heating analysis reveal 4 He loss to occur systematically by volume diffusion at low temperatures. The linear, low-temperature portion of the diffusion data yields an activation energy of 38.5 ± 8.1 kcal/mol and a frequency factor of 1n (D 0 /a 2 ) = 16.4 ± 2.8 sec -1 , corresponding to a closure temperature of 105 degree C ± 30 degree C (cooling rate 10 degree C/m.y.). It appears that U-Th-He dating of apatite might represent a useful new thermochronometer with a range similar to that of fission-track dating of apatite. From these results, they infer that a number of the too-young U-Th-He dates reported in the literature on minerals such as zircon and magnetite may in fact represent valuable records of the low-temperature thermal history of their host rocks
Mo, Bin-Feng; Lu, Qiu-Fen; Lu, Shang-Biao; Xie, Yu-Quan; Feng, Xiang-Fei; Li, Yi-Gang
2017-08-20
The CHA2DS2-VASc score is used clinically for stroke risk stratification in patients with atrial fibrillation (AF). We sought to investigate whether the CHA2DS2-VASc score predicts stroke and death in Chinese patients with sick sinus syndrome (SSS) after pacemaker implantation and to evaluate whether the predictive power of the CHA2DS2-VASc score could be improved by combining it with left atrial diameter (LAD) and amino-terminal pro-brain natriuretic peptide (NT-proBNP). A total of 481 consecutive patients with SSS who underwent pacemaker implantation from January 2004 to December 2014 in our department were included. The CHA2DS2-VASc scores were retrospectively calculated according to the hospital medical records before pacemaker implantation. The outcome data (stroke and death) were collected by pacemaker follow-up visits and telephonic follow-up until December 31, 2015. During 2151 person-years of follow-up, 46 patients (9.6%) suffered stroke and 52 (10.8%) died. The CHA2DS2-VASc score showed a significant association with the development of stroke (hazard ratio [HR] 1.45, 95% confidence interval [CI] 1.20-1.75, Ppacemaker implantation. The addition of LAD and NT-proBNP to the CHA2DS2-VASc score improved its predictive power for stroke and death, respectively, in this patient cohort. Future prospective studies are warranted to validate the benefit of adding LAD and NT-proBNP to the CHA2DS2-VASc score for predicting stroke and death risk in non-AF populations.
Energy Technology Data Exchange (ETDEWEB)
Prywer, Jolanta, E-mail: jolanta.prywer@p.lodz.pl [Institute of Physics, Lodz University of Technology, ul. Wólczańska 219, 93-005 Łódź (Poland); Olszynski, Marcin [Institute of Physics, Lodz University of Technology, ul. Wólczańska 219, 93-005 Łódź (Poland); Mielniczek-Brzóska, Ewa [Institute of Chemistry, Environment Protection and Biotechnology, Jan Długosz University of Częstochowa, ul. Armii Krajowej 13/15, 42-200 Częstochowa (Poland)
2015-11-15
Effect of trisodium citrate on the precipitation of carbonate apatite is studied. The experimental series are performed in the solution of artificial urine. The investigations are related to infectious urinary stones formation as carbonate apatite is one of the main components of this kind of stones. To mimic a real infection in urinary tract the aqueous ammonia solution was added to the solution of artificial urine. The spectrophotometric results demonstrate that trisodium citrate increases induction time with respect to carbonate apatite formation and decreases the efficiency of carbonate apatite precipitation. The inhibitory effect of trisodium citrate on the precipitation of carbonate apatite is explained in base of chemical speciation analysis. Such an analysis demonstrates that the inhibitory effect is mainly related with the fact that trisodium citrate binds Ca{sup 2+} ions and causes the formation of CaCit{sup −} and Ca{sub 10}(PO{sub 4}){sub 6}CO{sub 3} complexes. Trisodium citrate binds Ca{sup 2+} ions in the range of pH from 6 to 9.5 for which carbonate apatite is favored to be formed. - Highlights: • Trisodium citrate (TC) increases induction time of carbonate apatite (CA) formation. • TC decreases the efficiency of CA precipitation. • The inhibitory effect of TC is explained in base of chemical speciation analysis. • The inhibitory effect is mainly related with the fact that TC binds Ca{sup 2+} ions. • TC binds Ca{sup 2+} ions in the range of pH from 6 to 9.5 for which CA is formed.
Comments About The New Rhetoric Theory Of Chaïm Perelman
Directory of Open Access Journals (Sweden)
Veronica Calado
2016-11-01
Full Text Available This essay pretends to demonstrate how the issue of the interpretation of legal norms was treated in the New Rhetoric of Chaïm Perelman. The theory emerged in the 1950´s criticizing juridical positivism and bringing back the possibility of reinsertion of valuational matters in the application of the law. With the scope of not compromising legal predictability, notions like equity and reasonability where hitched to the concept. Furthermore, the essay aimed, with the collation of literary works about the theme, to analyze the possibility of applying the New Rhetoric theory in the Brazilian Legal Order, The method utilized was the critic- deductive.
International Nuclear Information System (INIS)
Moens, P.D.W.; Callens, F.J.; Verbeeck, R.M.H.; Naessens, D.E.
1993-01-01
The effect of storage under ambient conditions on the Electron Paramagnetic Resonance (EPR) spectrum of X-irradiated sodium and carbonate containing synthetic apatites has been studied. A first series of samples was X-irradiated shortly after preparation and drying at 25 o C and investigated by means of EPR. The observed spectra were decomposed in terms of five theoretical curves representing an O - radical, two CO 3 - radicals (surface and bulk) and two CO 2 - radicals (surface and bulk). Afterwards, a second series of the same samples which was stored under ambient conditions for a long period, was also X-irradiated and examined with EPR. The same five radicals were found, but in different relative amounts. It appeared that the relative contributions of the two carbon containing surface radicals increased in comparison with the corresponding bulk radicals. This is explained by an adsorption of molecules from the atmosphere on the surface of the apatite powder. (author)
In vitro biomimetic deposition of apatite on alkaline and heat treated ...
Indian Academy of Sciences (India)
WINTEC
materials of choice for most dental and orthopedic appli- .... treatment on the surface of the substrate and the structure of the titanium substrate, gel layer and bone-like apatite coatings obtained were analysed by thin film X-ray dif-.
Bone apatite composition of necrotic trabecular bone in the femoral head of immature piglets.
Aruwajoye, Olumide O; Kim, Harry K W; Aswath, Pranesh B
2015-04-01
Ischemic osteonecrosis of the femoral head (IOFH) can lead to excessive resorption of the trabecular bone and collapse of the femoral head as a structure. A well-known mineral component to trabecular bone is hydroxyapatite, which can be present in many forms due to ionic substitution, thus altering chemical composition. Unfortunately, very little is known about the chemical changes to bone apatite following IOFH. We hypothesized that the apatite composition changes in necrotic bone possibly contribute to increased osteoclast resorption and structural collapse of the femoral head. The purpose of this study was to assess the macroscopic and local phosphate composition of actively resorbed necrotic trabecular bone to isolate differences between areas of increased osteoclast resorption and normal bone formation. A piglet model of IOFH was used. Scanning electron microscopy (SEM), histology, X-ray absorbance near edge structure (XANES), and Raman spectroscopy were performed on femoral heads to characterize normal and necrotic trabecular bone. Backscattered SEM, micro-computed tomography and histology showed deformity and active resorption of necrotic bone compared to normal. XANES and Raman spectroscopy obtained from actively resorbed necrotic bone and normal bone showed increased carbonate-to-phosphate content in the necrotic bone. The changes in the apatite composition due to carbonate substitution may play a role in the increased resorption of necrotic bone due to its increase in solubility. Indeed, a better understanding of the apatite composition of necrotic bone could shed light on osteoclast activity and potentially improve therapeutic treatments that target excessive resorption of bone.
Evaluation of apatite silicates as solid oxide fuel cell electrolytes
Energy Technology Data Exchange (ETDEWEB)
Marrero-Lopez, D. [Dpto. de Fisica Aplicada I, Laboratorio de Materiales y Superficies (Unidad Asociada al C.S.I.C.), Universidad de Malaga, 29071 Malaga (Spain); Dpto. de Quimica Inorganica, Universidad de La Laguna, 38200 La Laguna, Tenerife (Spain); Martin-Sedeno, M.C.; Aranda, M.A.G. [Dpto. de Quimica Inorganica, Universidad Malaga, 29071 Malaga (Spain); Pena-Martinez, J. [Dpto. de Quimica Inorganica, Universidad de La Laguna, 38200 La Laguna, Tenerife (Spain); Instituto de Energias Renovables, Parque Tecnologico, Universidad de Castilla La Mancha, 02006 Albacete (Spain); Ruiz-Morales, J.C.; Nunez, P. [Dpto. de Quimica Inorganica, Universidad de La Laguna, 38200 La Laguna, Tenerife (Spain); Ramos-Barrado, J.R. [Dpto. de Fisica Aplicada I, Laboratorio de Materiales y Superficies (Unidad Asociada al C.S.I.C.), Universidad de Malaga, 29071 Malaga (Spain)
2010-05-01
Apatite-type silicates have been considered as promising electrolytes for Solid Oxide Fuel Cells (SOFC); however studies on the potential use of these materials in SOFC devices have received relatively little attention. The lanthanum silicate with composition La{sub 10}Si{sub 5.5}Al{sub 0.5}O{sub 26.75} has been evaluated as electrolyte with the electrode materials commonly used in SOFC, i.e. manganite, ferrite and cobaltite as cathode materials and NiO-CGO composite, chromium-manganite and Sr{sub 2}MgMoO{sub 6} as anode materials. Chemical compatibility, area-specific resistance and fuel cell studies have been performed. X-ray powder diffraction (XRPD) analysis did not reveal any trace of reaction products between the apatite electrolyte and most of the aforementioned electrode materials. However, the area-specific polarisation resistance (ASR) of these electrodes in contact with apatite electrolyte increased significantly with the sintering temperature, indicating reactivity at the electrolyte/electrode interface. On the other hand, the ASR values are significantly improved using a ceria buffer layer between the electrolyte and electrode materials to prevent reactivity. Maximum power densities of 195 and 65 mWcm{sup -2} were obtained at 850 and 700 C, respectively in H{sub 2} fuel, using an 1 mm-thick electrolyte, a NiO-Ce{sub 0.8}Gd{sub 0.2}O{sub 1.9} composite as anode and La{sub 0.6}Sr{sub 0.4}Co{sub 0.8}Fe{sub 0.2}O{sub 3-{delta}} as cathode materials. This fuel cell was tested for 100 h in 5%H{sub 2}-Ar atmosphere showing stable performance. (author)
Monteleone, B. D.; van Soest, M. C.; Hodges, K. V.; Hervig, R.; Boyce, J. W.
2008-12-01
Conventional (U-Th)/He thermochronology utilizes single or multiple grain analyses of U- and Th-bearing minerals such as apatite and zircon and does not allow for assessment of spatial variation in concentration of He, U, or Th within individual crystals. As such, age calculation and interpretation require assumptions regarding 4He loss through alpha ejection, diffusive redistribution of 4He, and U and Th distribution as an initial condition for these processes. Although models have been developed to predict 4He diffusion parameters, correct for the effect of alpha ejection on calculated cooling ages, and account for the effect of U and Th zonation within apatite and zircon, measurements of 4He, U, and Th distribution have not been combined within a single crystal. We apply ArF excimer laser ablation, combined with noble gas mass spectrometry, to obtain depth profiles within apatite and zircon crystals in order to assess variations in 4He concentration with depth. Our initial results from pre-cut, pre-heated slabs of Durango apatite, each subjected to different T-t schedules, suggest a general agreement of 4He profiles with those predicted by theoretical diffusion models (Farley, 2000). Depth profiles through unpolished grains give reproducible alpha ejection profiles in Durango apatite that deviate from alpha ejection profiles predicted for ideal, homogenous crystals. SIMS depth profiling utilizes an O2 primary beam capable of sputtering tens of microns and measuring sub-micron resolution variation in [U], [Th], and [Sm]. Preliminary results suggest that sufficient [U] and [Th] zonation is present in Durango apatite to influence the form of the 4He alpha ejection profile. Future work will assess the influence of measured [U] and [Th] zonation on previously measured 4He depth profiles. Farley, K.A., 2000. Helium diffusion from apatite; general behavior as illustrated by Durango fluorapatite. J. Geophys. Res., B Solid Earth Planets 105 (2), 2903-2914.
Girard, Jean-Pierre; Savin, Samuel M.
1996-02-01
Thermal dehydroxylation and partial fluorination techniques were used to measure intracrystalline fractionation of oxygen isotopes between hydroxyl and non-hydroxyl sites in kaolinite. Several aliquots of a well characterized, fine-grained (rates, and target temperatures. Measured δ18O values of both the liberated water and the dehydroxylated residue are consistent over a wide range of temperatures (550 850°C) when dehydroxylation is performed in a single-step fashion at a rapid heating rate (>50°C/min.). Similar dehydroxylation experiments indicate that brucite dehydroxylation occurs without any significant isotopic fractionation of the oxygen isotopes. By extrapolation we postulate that no significant fractionation occurs during single-step thermal dehydroxylation of fine-grained kaolinite, provided that dehydroxylation is performed under well controlled conditions. In contrast, gibbsite dehydroxylation is accompanied by substantial isotopic fractionation. This is probably the result of the complex, multi-pathway dehydroxylation reaction of this mineral. Similarly, thermal dehydroxylation of coarsegrained (>1 μm) kaolinites and dickites of weathering and hydrothermal origin yield results that are dependent on the temperature of dehydroxylation. We suggest that this effect may be caused by isotopic exchange during diffusion of water molecules through coarse particles. Partial fluorination of fine-grained kaolinite in the presence of excess F2 at low temperatures (rate of reaction of hydroxyl oxygen than of non-hydroxyl oxygen, but examination of the isotopic data as well as XRD and IR analyses of the residues after partial fluorination indicates that the separation between the two types of oxygen is not complete. The results, therefore, do not yield a reliable δ18O value of the hydroxyl oxygen. The results of this study suggest that the thermal dehydroxylation technique may be appropriate for analysis of OH groups in fine-grained kaolinite. The partial
Directory of Open Access Journals (Sweden)
Hassan Heidarian
2018-02-01
Full Text Available The Chadormalu magnetite-apatite deposit in Bafq metallogenic province, Central Iran, is hosted in the late Precambrian-lower Cambrian volcano-sedimentary rocks with sodic, calcic, and potassic alterations characteristic of iron oxide copper-gold (IOCG and iron oxide-apatite (IOA ore systems. Apatite occurs as scattered irregular veinlets and disseminated grains, respectively, within and in the marginal parts of the main ore-body, as well as apatite-magnetite veins in altered wall rocks. Textural evidence (SEM-BSE images of these apatites shows primary bright, and secondary dark areas with inclusions of monazite/xenotime. The primary, monazite-free fluorapatite contains higher concentrations of Na, Si, S, and light rare earth elements (LREE. The apatite was altered by hydrothermal events that led to leaching of Na, Si, and REE + Y, and development of the dark apatite. The bright apatite yielded two U-Pb age populations, an older dominant age of 490 ± 21 Ma, similar to other iron deposits in the Bafq district and associated intrusions, and a younger age of 246 ± 17 Ma. The dark apatite yielded a U-Pb age of 437 ± 12 Ma. Our data suggest that hydrothermal magmatic fluids contributed to formation of the primary fluorapatite, and sodic and calcic alterations. The primary apatite reequilibrated with basinal brines in at least two regional extensions and basin developments in Silurian and Triassic in Central Iran.
Jiang, Xiao-Yan; Li, He; Ding, Xing; Wu, Kai; Guo, Jia; Liu, Ji-Qiang; Sun, Wei-Dong
2018-04-01
Apatite is ubiquitous in A-type granites, and can be used to elucidate the volatile contents of the silicate melt, which reflect its source characteristics. A-type granites have been recognized as a distinct group of granites. A1- and A2-type subgroups are produced under different extensional settings. However, the details of the mechanisms behind the distinctive geochemical characteristics of A1- and A2-type granites remain obscure. Belts of Cretaceous A1- and A2-type granites occur along the Lower Yangtze River Belt in eastern China. Here we investigated the major and trace element compositions of apatites from contemporary A1- and A2-type granites at different localities along the Lower Yangtze River Belt, in order to decipher their discrepant source processes. Apatites from A1- and A2-type granites show similar major and trace elements, but differ in their F and Cl concentrations. Apatites from A1-type granites in the eastern part of the Lower Yangtze River Belt have much lower F and higher Cl concentrations compared to A2-type granites in the western part. Moreover, from the east to the west, the F concentrations of apatites from A1-type granites increase, while the Cl concentrations decline. In a subducted plate, F is retained by amphibole, chlorite, serpentine and mica minerals through the amphibolite stage, and finally by phengite and lawsonite during the eclogite stage, whereas, Cl is controlled by amphibole, chlorite and serpentine. The high and varied Cl concentrations in A1 subgroup apatites, therefore, may be attributed to the breakdown of amphibole, chlorite and/or serpentine decomposition during partial melting of subducted oceanic crust releasing a large amount of Cl at shallower depth. In contrast, F is transported to deeper depths in the subducted oceanic crust, and released through breakdown of phengite and lawsonite, making an important contribution to the formation of A2-type granites. Apatites from A1- and A2-type granite samples show regular
Adsorption of Pb(II) present in aqueous solution on calcium, strontium and barium hydroxy apatites
International Nuclear Information System (INIS)
Vilchis G, J.
2013-01-01
Calcium, strontium and barium hydroxy apatites were successfully synthesized by chemical precipitation method, the obtained powders were characterized by the techniques of X-ray diffraction (XRD), scanning electron microscopy (Sem), semi-quantitative elemental analysis (EDS), infrared spectroscopy (IR), and N 2 physisorption studies, complementary to these analytical techniques, was determined the surface fractal dimension (Df), and the amount of surface active sites of the materials, in order to know application as ceramic for water remediation. The ability of Pb(II) ion adsorption present in aqueous solution on the hydroxy apatites synthesized by batch type experiments was studied as a function of contact time, concentration of the adsorbate and temperature. The maximum lead adsorption efficiencies obtained were 0.31, 0.32 and 0.26 mg/g for calcium, strontium and barium hydroxy apatites respectively, achieved an equilibrium time of 20 minutes in the three solid-liquid systems studied. Experimental data were adequately adjusted at the adsorption kinetic model pseudo-second order, for the three cases. Moreover, experimental data of the strontium and calcium hydroxy apatites were adjusted to the Langmuir adsorption isotherm, indicating that the adsorption was through a monolayer, whereas barium hydroxyapatite was adjusted to the Freundlich adsorption isotherm, indicating a multilayer adsorption. The thermodynamic parameters obtained during adsorption studies as a function of temperature showed physisorption, exothermic and spontaneous processes respectively. The results showed that the calcium hydroxyapatite, strontium and barium are an alternative for the Pb(II) ion adsorption present in wastewaters. (Author)
Vindhyal, Mohinder; Vindhyal, Shravani R; Haneke, Travis; Ndunda, Paul M; Eid, Freidy; Kallail, K James
2017-12-11
Introduction Atrial fibrillation (AF), the most common cardiac arrhythmia, affects approximately 2.3 million patients in the United States, costing around $26 billion. Atrial fibrillation is associated with a two- to seven-fold increased risk of stroke, one of the most serious complications. Chronic kidney disease affects approximately 13% of the US population and has been associated with higher rates of AF than the general population. In patients with chronic kidney disease (CKD), the risk of stroke increases as the glomerular filtration rate (GFR) decreases, especially in CKD stages three and four. Several risks stratification scores such as CHADS2 (congestive heart failure, hypertension, age, diabetes mellitus, stroke), CHA2DS2VASc (congestive heart failure, hypertension, age, diabetes mellitus, stroke, vascular disease, age, sex), and R2CHADS2 (renal failure, congestive heart failure, age, diabetes, stroke) scores are used for stroke risk assessment in patients with non-valvular atrial fibrillation (NVAF). This study investigates the association between renal functions and risk stratification scoring systems in patients with non-valvular AF presenting with stroke. Methods Using the convenience sampling method, 171 subjects were selected from the eligible population (n = 386). A Pearson product-moment correlation coefficient was calculated to determine the association between the GFR and each of the CHA2DS2VASc and R2CHADS2 scores. In addition, a Pearson product-moment correlation coefficient was calculated to determine the association between the CHA2DS2VASc and R2CHADS2 scores. Results The selected population represented 44.3% of the eligible subjects. Of these, 88% were Caucasian, 60% were female, and the mean age was 78 years. The mean CHA2DS2VASc score was six (range 2-9). The mean eGFR was 69.77 (range 6-108). Both the mode and the median CHA2DS2VASc score was four (range 2-8). A weak, but significant, negative correlation was found between renal
Self-hydroxylation of the splicing factor lysyl hydroxylase, JMJD6
DEFF Research Database (Denmark)
Mantri, M.; Webby, C.J.; Loik, N.D.
2012-01-01
The lysyl 5S-hydroxylase, JMJD6 acts on proteins involved in RNA splicing. We find that in the absence of substrate JMJD6 catalyses turnover of 2OG to succinate. H-NMR analyses demonstrate that consumption of 2OG is coupled to succinate formation. MS analyses reveal that JMJD6 undergoes self......-hydroxylation in the presence of Fe(ii) and 2OG resulting in production of 5S-hydroxylysine residues. JMJD6 in human cells is also found to be hydroxylated. Self-hydroxylation of JMJD6 may play a regulatory role in modulating the hydroxylation status of proteins involved in RNA splicing. This journal is...
Xu, Zhewu; Liang, Guobin; Jin, Lin; Wang, Zhenling; Xing, Chao; Jiange, Qing; Zhang, Zhiguang
2014-06-01
Phosphoproteins can induce and stabilize calcium carbonate (CaCO3) vaterite, which has desirable features for high reactivity. The purpose of this study was to synthesize bioactive CaCO3 microspheres for bone regeneration. Sodium caseinate (NaCas)-containing CaCO3 microspheres, with the crystal phase of vaterite, were synthesized by fast precipitation in an aqueous solution of CaCl2, Na2CO3, and 2 mg/mL of NaCas. The uniform microspheres exhibited rougher surfaces and lower negative charges than CaCO3 particles without NaCas addition. Fourier-transform infrared spectroscopy (FT-IR) of the microspheres showed characteristic peaks or bands corresponding to phosphate and hydroxyl groups. Thermogravimetric analysis (TGA) curves exhibited approximately 5% weight loss below 600 °C due to the decomposition of NaCas. Scanning electron microscope (SEM) images showed lath-like hydroxyapatite (HAp) on the surface after soaking in simulated body fluid (SBF) at 37 °C for 5 and 10 days. Energy dispersive X-ray spectrometry (EDS) revealed that the agglomerates were composed of Ca, C, O, P, Na, and Mg elements, and the Ca/P ratios ranged from 1.53 to 1.56. X-ray diffraction (XRD) patterns exhibited peaks characteristic of hydroxyapatite. The results of this study demonstrated that the addition of NaCas induced the formation of vaterite microspheres which possesses an enhanced apatite formation after soaking in SBF at 37 °C for 5 and 10 days. These NaCas-CaCO3 microspheres may be a potential biomaterial for bone regeneration.
Directory of Open Access Journals (Sweden)
Bin-Feng Mo
2017-01-01
Conclusions: CHA2DS2-VASc score is valuable for predicting stroke and death risk in patients with SSS after pacemaker implantation. The addition of LAD and NT-proBNP to the CHA2DS2-VASc score improved its predictive power for stroke and death, respectively, in this patient cohort. Future prospective studies are warranted to validate the benefit of adding LAD and NT-proBNP to the CHA2DS2-VASc score for predicting stroke and death risk in non-AF populations.
Szubert, M; Adamska, K; Szybowicz, M; Jesionowski, T; Buchwald, T; Voelkel, A
2014-01-01
The aim of this study was the surface modification of hydroxyapatite and β-tricalcium phosphate by poly(3-hydroxybutyrate) grafting and characterization of modificates. The bioactivity examination was carried out by the determination to grow an apatite layer on modified materials during incubation in simulated body fluid at 37°C. The additional issue taken up in this paper was to investigate the influence of fluid replacement. The process of the surface modification of biomaterials was evaluated by means of infrared and Raman spectroscopy. Formation of the apatite layer was assessed by means of scanning electron microscopy and confirmed by energy dispersive, Raman and Fourier transformed infrared spectroscopy. During exposure in simulated body fluid, the variation of the zeta potential, pH measurement and relative weight was monitored. Examination of scanning electron microscopy micrographs suggests that modification of hydroxyapatite and β-tricalcium phosphate by poly(3-hydroxybutyrate) significantly increases apatite layer formation. Raman spectroscopy evaluation revealed that the formation of the apatite layer was more significant in the case of hydroxyapatite modificate, when compared to the β-tricalcium phosphate modificate. Both modificates were characterized by stable pH, close to the natural pH of human body fluids. Furthermore, we have shown that a weekly changed, simulated body fluid solution increases apatite layer formation. © 2013.
Regioselective alkane hydroxylation with a mutant AlkB enzyme
Koch, Daniel J.; Arnold, Frances H.
2012-11-13
AlkB from Pseudomonas putida was engineered using in-vivo directed evolution to hydroxylate small chain alkanes. Mutant AlkB-BMO1 hydroxylates propane and butane at the terminal carbon at a rate greater than the wild-type to form 1-propanol and 1-butanol, respectively. Mutant AlkB-BMO2 similarly hydroxylates propane and butane at the terminal carbon at a rate greater than the wild-type to form 1-propanol and 1-butanol, respectively. These biocatalysts are highly active for small chain alkane substrates and their regioselectivity is retained in whole-cell biotransformations.
Sègla, Aimé Dafon
The essay examines Idààcha cosmological vision as a kind of incorporation of Yoruba cosmology. It shows a process where the two strands, that is to say, knowledge and belief can not be readily distinguished. The divinatory traditional calendar is indeed based on a scale of fixed number values whose definitions are drawn from the concepts early traditional people have of the universe. Thus, the signification of the terms that designate entities such as angle, circle, center of the circle, midnight, time zone, the number of days in a week, etc., in the Yoruba dialect Idààcha, mirrors cosmological standards. These words constitute a landscape of memory shedding light on early Yoruba culture and history. Hence, Idààcha being a significant western periphery of the Yoruba region, we examine why its divinatory calendar would preserve an older spatio-temporal logic, beyond Ifè and Oyo revisionism in Yoruba history. Finally, the article points out that the translation of spatial and geometrical relations into temporal terms and vice-versa may suggest a new indexical approach to the study of cosmology in relation to the human body. As the body is in the mind, we say in relation to the human mind.
Hydroxylation of the herbicide isoproturon by fungi isolated from agricultural soil.
Rønhede, Stig; Jensen, Bo; Rosendahl, Søren; Kragelund, Birthe B; Juhler, René K; Aamand, Jens
2005-12-01
Several asco-, basidio-, and zygomycetes isolated from an agricultural field were shown to be able to hydroxylate the phenylurea herbicide isoproturon [N-(4-isopropylphenyl)-N',N'-dimethylurea] to N-(4-(2-hydroxy-1-methylethyl)phenyl)-N',N'-dimethylurea and N-(4-(1-hydroxy-1-methylethyl)phenyl)-N',N'-dimethylurea. Bacterial metabolism of isoproturon has previously been shown to proceed by an initial demethylation to N-(4-isopropylphenyl)-N'-methylurea. In soils, however, hydroxylated metabolites have also been detected. In this study we identified fungi as organisms that potentially play a major role in the formation of these hydroxylated metabolites in soils treated with isoproturon. Isolates of Mortierella sp. strain Gr4, Phoma cf. eupyrena Gr61, and Alternaria sp. strain Gr174 hydroxylated isoproturon at the first position of the isopropyl side chain, yielding N-(4-(2-hydroxy-1-methylethyl)phenyl)-N',N'-dimethylurea, while Mucor sp. strain Gr22 hydroxylated the molecule at the second position, yielding N-(4-(1-hydroxy-1-methylethyl)phenyl)-N',N'-dimethylurea. Hydroxylation was the dominant mode of isoproturon transformation in these fungi, although some cultures also produced traces of the N-demethylated metabolite N-(4-isopropylphenyl)-N'-methylurea. A basidiomycete isolate produced a mixture of the two hydroxylated and N-demethylated metabolites at low concentrations. Clonostachys sp. strain Gr141 and putative Tetracladium sp. strain Gr57 did not hydroxylate isoproturon but N demethylated the compound to a minor extent. Mortierella sp. strain Gr4 also produced N-(4-(2-hydroxy-1-methylethyl)phenyl)-N'-methylurea, which is the product resulting from combined N demethylation and hydroxylation.
A gacS deletion in Pseudomonas aeruginosa cystic fibrosis isolate CHA shapes its virulence.
Directory of Open Access Journals (Sweden)
Khady Mayebine Sall
Full Text Available Pseudomonas aeruginosa, a human opportunistic pathogen, is capable of provoking acute and chronic infections that are associated with defined sets of virulence factors. During chronic infections, the bacterium accumulates mutations that silence some and activate other genes. Here we show that the cystic fibrosis isolate CHA exhibits a unique virulence phenotype featuring a mucoid morphology, an active Type III Secretion System (T3SS, hallmark of acute infections, and no Type VI Secretion System (H1-T6SS. This virulence profile is due to a 426 bp deletion in the 3' end of the gacS gene encoding an essential regulatory protein. The absence of GacS disturbs the Gac/Rsm pathway leading to depletion of the small regulatory RNAs RsmY/RsmZ and, in consequence, to expression of T3SS, while switching off the expression of H1-T6SS and Pel polysaccharides. The CHA isolate also exhibits full ability to swim and twitch, due to active flagellum and Type IVa pili. Thus, unlike the classical scheme of balance between virulence factors, clinical strains may adapt to a local niche by expressing both alginate exopolysaccharide, a hallmark of membrane stress that protects from antibiotic action, host defences and phagocytosis, and efficient T3S machinery that is considered as an aggressive virulence factor.
U-Pb Data On Apatites With Common Lead Correction : Exemples From The Scottish Caledonides
Jewison, E.; Deloule, E.; Villeneuve, J.; Bellahsen, N.; Labrousse, L.; Rosenberg, C.; Pik, R.; Chew, D.
2017-12-01
Apatite is a widely used mineral in low-temperature thermochronology (U-Th/He and AFT). The use of apatite in U-Pb geochronology has a great potential, given its closure temperature around 450°C, for orogen thermostructural evolution studies. However, since apatite can accumulate significant amount of initial Pb in its structure, its use can be hindered by the lack of 204 Pb estimations. To work around this, two options are commonly used : either use a ploting sytem that does not require corrected ratios, or use a proxy to estimate 204Pb and use it to correct the ratios. In this study we use a SIMS to mesure 204Pb in order to compare Tera-Wasserburg diagram and corrected ages to examine the cooling pattern in the northern Highlands of Scotland. The Highlands is an extensively studied caledonian collision wedge which results from the closure of the Iapétus Ocean during the Orodivician-Silurian. Two orogenic events are related to this closing, the grampian event (480-460Ma) and the scandian event (435-415 Ma) that culminated in the stacking of major ductile thrusts. The thermal history of thoses nappes are hence complex and the cooling pattern poorly constrained. Corrected apatite U-Pb ages provide new constrains on ductile wedge building and improve our understanding of mid to lower-crustal deformation and orogenic exhumation. Thoses corrected ages yield equivalent errors and mean ages from the classic method. Those data suggest a global cooling younger than previously thought and a sequence departing from a simple forward sequence. We thus present a refined thermal evolution and conceptualize a model of ductile wedge evolution.
Energy Technology Data Exchange (ETDEWEB)
Szecsody, Jim E.
2006-04-30
We propose to develop an infiltration strategy that defines the precipitation rate of an apatite-forming solution and Sr-90 sequestration processes under variably saturated (low water content) conditions. We will develop this understanding through small-scale column studies, intermediate-scale two-dimensional (2-D) experiments, and numerical modeling to quantify individual and coupled processes associated with apatite formation and Sr-90 transport during and after infiltration of the Ca-citrate-PO4 solution. Development of capabilities to simulate these coupled biogeochemical processes during both injection and infiltration will be used to determine the most cost-effective means to emplace an in situ apatite barrier with a longevity of 300 years to permanently sequester Sr-90 until it decays. Biogeochemical processes that will be investigated are citrate biodegradation and apatite precipitation rates at varying water contents as a function of water content. Coupled processes that will be investigated include the influence of apatite precipitation (which occupies pore space) on the hydraulic and transport properties of the porous media during infiltration.
Hydroxylated PBDEs induce developmental arrest in zebrafish
Energy Technology Data Exchange (ETDEWEB)
Usenko, Crystal Y., E-mail: Crystal_usenko@baylor.edu; Hopkins, David C.; Trumble, Stephen J., E-mail: Stephen_trumble@baylor.edu; Bruce, Erica D., E-mail: Erica_bruce@baylor.edu
2012-07-01
The ubiquitous spread of polybrominated diphenyl ethers (PBDEs) has led to concerns regarding the metabolites of these congeners, in particular hydroxylated PBDEs. There are limited studies regarding the biological interactions of these chemicals, yet there is some concern they may be more toxic than their parent compounds. In this study three hydroxylated PBDEs were assessed for toxicity in embryonic zebrafish: 3-OH-BDE 47, 5-OH-BDE 47, and 6-OH-BDE 47. All three congeners induced developmental arrest in a concentration-dependent manner; however, 6-OH-BDE 47 induced adverse effects at lower concentrations than the other congeners. Furthermore, all three induced cell death; however apoptosis was not observed. In short-term exposures (24–28 hours post fertilization), all hydroxylated PBDEs generated oxidative stress in the region corresponding to the cell death at 5 and 10 ppm. To further investigate the short-term effects that may be responsible for the developmental arrest observed in this study, gene regulation was assessed for embryos exposed to 0.625 ppm 6-OH-BDE 47 from 24 to 28 hpf. Genes involved in stress response, thyroid hormone regulation, and neurodevelopment were significantly upregulated compared to controls; however, genes related to oxidative stress were either unaffected or downregulated. This study suggests that hydroxylated PBDEs disrupt development, and may induce oxidative stress and potentially disrupt the cholinergic system and thyroid hormone homeostasis. -- Highlights: ► OH-PBDEs induce developmental arrest in a concentration-dependent manner. ► Hydroxyl group location influences biological interaction. ► OH-PBDEs induce oxidative stress. ► Thyroid hormone gene regulation was disrupted following exposure. ► To our knowledge, this is the first whole organism study of OH-PBDE toxicity.
Taddei, Paola; Tinti, Anna; Reggiani, Matteo; Monti, Patrizia; Fagnano, Concezio
2003-06-01
The bone integration of implants is a complex process which depends on chemical composition and surface morphology. To accelerate osteointegration, metal implants are coated with porous metal or apatites which have been reported to increase mineralisation, improving prosthesis fixation. To study the influence of composition and morphology on the in vivo bioactivity, titanium screws coated by Plasma Flame Spraying (PFS) with titanium or fluorinated apatite (K690) were implanted in sheep tibia and femur for 10 weeks and studied by micro-Raman and IR spectroscopy. The same techniques, together with thermogravimetry, were used for characterising the pre-coating K690 powder. Contrary to the manufacturer report, the K690 pre-coating revealed to be composed of a partially fluorinated apatite containing impurities of Ca(OH) 2 and CaCO 3. By effect of PFS, the impurities were decomposed and the crystallinity degree of the coating was found to decrease. The vibrational spectra recorded on the implanted screws revealed the presence of newly formed bone; for the K690-coated screws at least, a high level of osteointegration was evidenced.
Directory of Open Access Journals (Sweden)
Н. Г. Ризванова
2017-06-01
Full Text Available Results of isotope-geochemical studies by PbLS step-leaching method of cassiterite from greisens located in Logrosán granite massif (Central Iberian Zone, Spain and apatite from hydrothermal quartz-apatite vein on its exocontact indicate that in both cases a hydrothermal event is recorded in the interval of 114-126 Ma, which has been accompanied by lead supply. Within the limits of estimation error, the same age around 120 Ma corresponds to crystallization of hydrothermal apatite, formation of sticks and micro-inclusions in cassiterite from greisens and is suggested for Au-As-Sb-Pb ore mineralization, which calls for further confirmation. Xenogenous zircon from quartz-apatite vein does not react to this relatively low-temperature hydrothermal event either with building up new generations (sticks, areas of recrystallization or with rebalancing of U-Pb isotope system. The age of greisen formation has been confirmed to be around 305 Ma by PbLS method on final phases of cassiterite leaching. Earlier it was estimated with 40Ar/39Ar method on muscovite.
Energy Technology Data Exchange (ETDEWEB)
Tanahashi, M; Yao, t; Kokubo, T [Kyoto University, Kyoto (Japan). Faculty of Engineering; Minoda, M; Miyamoto, T [Kyoto University, Kyoto (Japan). Institute for Chemical Research; Nakamura, T [Kyoto University, Kyoto (Japan). Research Center for Biomedical Engineering; Yamamuro, T [Kyoto University, Kyoto (Japan). Faculty of Medicine
1994-09-01
In this investigation, CaO-SiO2-based glass, which was previously used as the nucleating agent, was replaced by Na2O-SiO2 glasses, SiO2 glass, and SiO2 gel. The induction period for the apatite nucleation on various organic polymer substrates and the adhesive strength of the apatite layer to the substrates were examined. It was considered that the short induction period for the glasses with high Na2O contents was attributed to high dissolution rates of sodium and silicate ions from them. It was also considered that highly polar carboxyl or sulfinyl groups were formed on the polymer surfaces by the hydrolysis of their ester, amide or sulfonyl group in simulated body fluid with its pH increased by the Na{sup +} dissolution from the glass, and that these polar groups formed a strong bond with the apatite. It is suggested that thus formed apatite-organic polymer composites are useful as the bone-repairing as well as soft tissue-repairing materials. 11 refs., 13 figs., 3 tabs.
DEFF Research Database (Denmark)
D'Souza, Maria; Carlson, Nicholas; Fosbøl, Emil
2018-01-01
Background Cancer may influence the risk of thromboembolism and bleeding associated with the CHA2DS2-VASc score. We examined the risk of thromboembolism and bleeding associated with the CHA2DS2-VASc score in atrial fibrillation patients with and without recent cancer. Methods and results Using...... nationwide registers all patients diagnosed with atrial fibrillation from 2000 to 2015 and not on oral anticoagulation or heparin therapy were included and followed for 2 years. Recent cancer was defined by a cancer diagnosis 5 years or fewer earlier. Risks of thromboembolism and bleeding were estimated...... in cumulative incidence curves and Cox regression models. We included 122,053 patients with incident atrial fibrillation, 12,014 (10%) had recent cancer. The 2-year cumulative incidence of thromboembolism and bleeding in patients with versus without recent cancer was 1.7% (95% confidence interval (CI) 0...
Kim, In Ae; Rhee, Sang-Hoon
2017-07-01
This article describes a novel method for the preparation of a biodegradable non-woven poly(ε-caprolactone) fabric with a partially embedded apatite surface designed for application as a scaffold material for bone tissue engineering. The non-woven poly(ε-caprolactone) fabric was generated by the electro-spinning technique and then apatite was coated in simulated body fluid after coating the PVA solution containing CaCl 2 ·2H 2 O. The apatite crystals were partially embedded or fully embedded into the thermoplastic poly(ε-caprolactone) fibers by controlling the degree of poly(ε-caprolactone) fiber surface melting in a convection oven. Identical apatite-coated poly(ε-caprolactone) fabric that did not undergo heat-treatment was used as a control. The features of the embedded apatite crystals were evaluated by FE-SEM, AFM, EDS, and XRD. The adhesion strengths of the coated apatite layers and the tensile strengths of the apatite coated fabrics with and without heat-treatment were assessed by the tape-test and a universal testing machine, respectively. The degree of water absorbance was assessed by adding a DMEM droplet onto the fabrics. Moreover, cell penetrability was assessed by seeding preosteoblastic MC3T3-E1 cells onto the fabrics and observing the degrees of cell penetration after 1 and 4 weeks by staining nuclei with DAPI. The non-woven poly(ε-caprolactone) fabric with a partially embedded apatite surface showed good water absorbance, cell penetrability, higher apatite adhesion strength, and higher tensile strength compared with the control fabric. These results show that the non-woven poly(ε-caprolactone) fabric with a partially embedded apatite surface is a potential candidate scaffold for bone tissue engineering due to its strong apatite adhesion strength and excellent cell penetrability. © 2016 Wiley Periodicals, Inc. J Biomed Mater Res Part A: 105A: 1973-1983, 2017. © 2017 Wiley Periodicals, Inc.
Quantum-mechanical calculations of the electronic structure of calcium and cadmium vanadate apatites
International Nuclear Information System (INIS)
Karbovskij, V.L.; Soroka, A.P.; Kasiyanenko, V.Kh.; Shpak, A.P.
2011-01-01
Electronic structures of compounds Me 10 (VO 4 ) 6 X 2 , where Me = Ca or Cd and X = F, Cl, OH are investigated using the full potential APW + lo method. The degrees of distortions of VO 4- tetrahedra with respect to the Td point group are analyzed using a relaxation of atomic positions. Apatites in the form of Ca 10 (VO 4 ) 6 X 2 , where X = F, Cl, OH, are established to decrease the band gap by 0.5-1.0 eV under the isomorphic substitution of calcium for cadmium. Apatites Ca 10 (VO 4 ) 6 X 2 , where X = F, Cl, OH are proven to decrease the degree of covalency of the oxygen-halogen bond under the isomorphic substitution of calcium for cadmium.
Directory of Open Access Journals (Sweden)
Fokina N. V.
2017-03-01
Full Text Available The number and trophic diversity of bacteria in flotation samples of apatite-nepheline and sulfide copper-nickel ores at the concentration plants of JSC "Apatite" and Kola Mining and Metallurgical Company have been determined. The study of the size and diversity of the microbiota has been conducted by culture on selective nutrient media. The total number and biomass of bacteria have been considered by fluorescence microscopy using Cyclopore polycarbonate membrane filters. Bacteria have been identified by molecular genetic methods. The least amount of both saprotrophic and other trophic groups of bacteria has been observed in the samples of ore and recycled water as at the concentrating factory of Apatit JSC, and also at the plant "Pechenganikel". It has been found out that the bacteria contained in the ore and recycling water flowing from the tailings increased their number during the flotation process due to coming of the nutrients with the flotation reagents, aeration and increased temperature. Strains which occurrence is more than 60 % have been extracted from recycled water and basic flotation products and classified as Pseudomonas. Two strains with occurrence of more than 60 % have been discovered at Apatit JSC and classified as Stenotrophomonas and Acinetobacter. The number of fungi in the cycle of apatite-nepheline ore enrichment at the factories is very low (1 to 24 CFU / 1 ml or 1 g of ore. Fungi of the genus Penicillium have been dominated, fungi of the genera Acremonium, Aureobasidium, Alternaria, Chaetomium have also been detected. At the plant "Pechenganikel" species Aspergillus fumigatus, Penicillium aurantiogriseum and P. glabrum have been extracted. It has been shown that the bacteria deteriorate the apatite flotation as a result of their interaction with active centers of calcium-containing minerals and intensive flocculation decreasing the floatation selectivity. Also some trend of copper and nickel recovery change has been
Venäläinen, Salla H
2011-10-01
This study investigated the use of tailings from apatite ore beneficiation in the remediation of a heavily contaminated shooting range soil. The tailings originating in Siilinjärvi carbonatite complex, Finland, consist of apatite residues accompanied by phlogopite and calcite. In a pot experiment, organic top layer of a boreal forest soil predisposed to pellet-derived lead (Pb) was amended with tailings of various particle-sizes (Ø>0.2mm, Øremediation technique at polluted sites. Copyright © 2011 Elsevier B.V. All rights reserved.
Hydroxyl radical induced degradation of ibuprofen
Energy Technology Data Exchange (ETDEWEB)
Illés, Erzsébet, E-mail: erzsebet.illes@chem.u-szeged.hu [Institute of Chemistry, Research Group of Environmental Chemistry, University of Szeged, Szeged (Hungary); Institute of Isotopes, Centre for Energy Research, Hungarian Academy of Sciences, Budapest (Hungary); Takács, Erzsébet [Institute of Isotopes, Centre for Energy Research, Hungarian Academy of Sciences, Budapest (Hungary); Dombi, András [Institute of Chemistry, Research Group of Environmental Chemistry, University of Szeged, Szeged (Hungary); Gajda-Schrantz, Krisztina [Institute of Chemistry, Research Group of Environmental Chemistry, University of Szeged, Szeged (Hungary); Department of Inorganic and Analytical Chemistry, University of Szeged, Szeged (Hungary); EMPA, Laboratory for High Performance Ceramics, Duebendorf (Switzerland); Rácz, Gergely; Gonter, Katalin; Wojnárovits, László [Institute of Isotopes, Centre for Energy Research, Hungarian Academy of Sciences, Budapest (Hungary)
2013-03-01
Pulse radiolysis experiments were used to characterize the intermediates formed from ibuprofen during electron beam irradiation in a solution of 0.1 mmol dm{sup −3}. For end product characterization {sup 60}Co γ-irradiation was used and the samples were evaluated either by taking their UV–vis spectra or by HPLC with UV or MS detection. The reactions of {sup ·}OH resulted in hydroxycyclohexadienyl type radical intermediates. The intermediates produced in further reactions hydroxylated the derivatives of ibuprofen as final products. The hydrated electron attacked the carboxyl group. Ibuprofen degradation is more efficient under oxidative conditions than under reductive conditions. The ecotoxicity of the solution was monitored by Daphnia magna standard microbiotest and Vibrio fischeri luminescent bacteria test. The toxic effect of the aerated ibuprofen solution first increased upon irradiation indicating a higher toxicity of the first degradation products, then decreased with increasing absorbed dose. Highlights: ► In hydroxyl radical attack on the ring mainly hydroxylated products form ► The hydrated electron attacks the carboxyl group. ► Oxidative conditions are more effective in ibuprofen decomposition than reductive. ► Ecotoxicity of ibuprofen solution first increases then decreases with irradiation.
Hydroxyl radical induced degradation of ibuprofen
International Nuclear Information System (INIS)
Illés, Erzsébet; Takács, Erzsébet; Dombi, András; Gajda-Schrantz, Krisztina; Rácz, Gergely; Gonter, Katalin; Wojnárovits, László
2013-01-01
Pulse radiolysis experiments were used to characterize the intermediates formed from ibuprofen during electron beam irradiation in a solution of 0.1 mmol dm −3 . For end product characterization 60 Co γ-irradiation was used and the samples were evaluated either by taking their UV–vis spectra or by HPLC with UV or MS detection. The reactions of · OH resulted in hydroxycyclohexadienyl type radical intermediates. The intermediates produced in further reactions hydroxylated the derivatives of ibuprofen as final products. The hydrated electron attacked the carboxyl group. Ibuprofen degradation is more efficient under oxidative conditions than under reductive conditions. The ecotoxicity of the solution was monitored by Daphnia magna standard microbiotest and Vibrio fischeri luminescent bacteria test. The toxic effect of the aerated ibuprofen solution first increased upon irradiation indicating a higher toxicity of the first degradation products, then decreased with increasing absorbed dose. Highlights: ► In hydroxyl radical attack on the ring mainly hydroxylated products form ► The hydrated electron attacks the carboxyl group. ► Oxidative conditions are more effective in ibuprofen decomposition than reductive. ► Ecotoxicity of ibuprofen solution first increases then decreases with irradiation
Crystal Structure Studies of Human Dental Apatite as a Function of Age
Directory of Open Access Journals (Sweden)
Th. Leventouri
2009-01-01
Full Text Available Studies of the average crystal structure properties of human dental apatite as a function of age in the range of 5–87 years are reported. The crystallinity of the dental hydroxyapatite decreases with the age. The a-lattice constant that is associated with the carbonate content in carbonate apatite decreases with age in a systematic way, whereas the c-lattice constant does not change significantly. Thermogravimetric measurements demonstrate an increase of the carbonate content with the age. FTIR spectroscopy reveals both B and A-type carbonate substitutions with the B-type greater than the A-type substitution by a factor up to ~5. An increase of the carbonate content as a function of age can be deduced from the ratio of the 2CO3 to the 1PO4 IR modes.
Keskin, Kudret; Sezai Yıldız, Süleyman; Çetinkal, Gökhan; Aksan, Gökhan; Kilci, Hakan; Çetin, Şükrü; Sığırcı, Serhat; Kılıçkesmez, Kadriye
2017-11-01
Acute coronary syndrome is the most common cause of cardiac morbidity and death. Various scoring systems have been developed in order to identify patients who are at risk for adverse outcome and may benefit from more aggressive and effective therapies. This study was designed to evaluate the CHA 2 DS 2 VASC score as a predictor of mortality inpatients with ST-elevation myocardial infarction undergoing primary percutaneous coronary intervention (p-PCI). We evaluated 300 patients diagnosed with ST-elevation myocardial infarction who underwent p-PCI and calculated their CHA 2 DS 2 VASC scores. According to their CHA 2 DS 2 VASC scores, patients were divided into three groups. Group 1: 0-1 points (n = 101), Group 2: 2-3 points (n = 129), and Group 3: 4-9 points (n = 70). The mean, median and minimum duration of follow-up were 21.7 ± 9.4, 21, and 12 months, respectively. All-cause mortality was defined as the primary endpoint of the study. All-cause mortality was 4% in Group 1, 8.5% in Group 2 and 27.1% in Group 3 respectively. Kaplan-Meier analysis showed that Group 3 (CHA 2 DS 2 VASC ≥ 4) had a significantly higher incidence of death [p (log-rank) < 0.001]. In ROC analysis, AUC values for in hospital, 12-month and long-term mortality were 0.88 (0.77-0.99 95% CI), 0.82 (0.73-0.92 95% CI) and 0.79 (0.69-0.88 95% CI), respectively. CHA 2 DS 2 VASC score can be used for predicting both in-hospital, 12-month and long-term mortality in patients with STEMI who have undergone p-PCI.
Apatite formability of boron nitride nanotubes
International Nuclear Information System (INIS)
Lahiri, Debrupa; Keshri, Anup K; Agarwal, Arvind; Singh, Virendra; Seal, Sudipta
2011-01-01
This study investigates the ability of boron nitride nanotubes (BNNTs) to induce apatite formation in a simulated body fluid environment for a period of 7, 14 and 28 days. BNNTs, when soaked in the simulated body fluid, are found to induce hydroxyapatite (HA) precipitation on their surface. The precipitation process has an initial incubation period of ∼ 4.6 days. The amount of HA precipitate increases gradually with the soaking time. High resolution TEM results indicated a hexagonal crystal structure of HA needles. No specific crystallographic orientation relationship is observed between BNNT and HA, which is due to the presence of a thin amorphous HA layer on the BNNT surface that disturbs a definite orientation relationship.
Energy Technology Data Exchange (ETDEWEB)
Fix, N. J.
2008-03-28
This Quality Assurance Project Plan provides the quality assurance requirements and processes that will be followed by staff working on the 100-NR-2 Apatite Project. The U.S. Department of Energy, Fluor Hanford, Inc., Pacific Northwest National Laboratory, and the Washington Department of Ecology agreed that the long-term strategy for groundwater remediation at 100-N would include apatite sequestration as the primary treatment, followed by a secondary treatment. The scope of this project covers the technical support needed before, during, and after treatment of the targeted subsurface environment using a new high-concentration formulation.
Infrared absorption characteristics of hydroxyl groups in coal tars
Energy Technology Data Exchange (ETDEWEB)
Cannon, S A; Chu, C J; Hange, R H; Margrave, J L
1987-01-01
Tar evolution was observed over a temperature range of 150-600 C for four coals. Pittsburgh bituminous, Illinois No.6, Rawhide subbituminous, and Texas lignite. Isolation of the evolved tars in a nitrogen matrix at 15 degrees K produced better resolved infrared spectra than those in a coal matrix, thus enhancing structural characterization of the tar molecules. Two distinct hydroxyl functional groups in the tar molecules free of hydrogen bonding were identified for the first time without interference from H/sub 2/O absorptions. These absorptions at 3626.5 cm/sup -1/ have been assigned to phenolic hydroxyls. It is suggested that carboxylic and aliphatic hydroxyl groups do not survive the vaporization process. Tars from Illinois No.6 were found to contain the largest amount of phenolic hydroxyl; Pittsburgh No. 8 tar contains approximately half of that for Illinois No.6 while Rawhide and Texas lignite contain much less phenolic than either of the other coals. 10 references, 6 figures, 1 table.
Directory of Open Access Journals (Sweden)
Florent Chazarenc
2010-08-01
Full Text Available Laboratory scale studies have repeatedly reported high P-retention in slag, a by-product of the steel manufacturing industry. Thus, it has emerged as a potential material to increase P-removal from constructed wetlands (CWs. However, several limitations were highlighted by field experiments, including the high pH of treated water and clogging. We hypothesized that the addition of sedimentary rocks to slag would preserve P-removal properties while reducing the pH of treated water. Four 2.5 L-columns were filled with 100% apatite (column A; a 50% weight each mixture of limestone with apatite (column B; 10% steel slag located at the inlet, plus 45% limestone mixed with 45% apatite (column C; and a mixture of steel slag (10%, limestone (45% apatite (45% (column D. A synthetic effluent (26 mg P/L and a reconstituted sludge fish farm effluent containing 97 mg/L total suspended solids (TSS, 220 mg/L chemical oxygen demand (COD and 23.5 mg P/L phosphorus (P were applied sequentially during 373 and 176 days, under saturated flow conditions and 12–24 hours hydraulic residence time (HRT, respectively. Treatment performance, P-removal, pH and calcium (Ca2+ were monitored. Results indicated that columns that contained 10% weight steel slag resulted in a higher P retention capacity than the columns without steel slag. The highest P removal was achieved in column C, containing a layer of slag in the inlet zone, 45% apatite and 45% limestone. Feeding the columns with a reconstituted fish farm effluent led to biofilm development, but this had little effect on the P-removal. A combination of slag and sedimentary rocks represents a promising filtration material that could be useful downstream of CWs to further increase P-removal.
Directory of Open Access Journals (Sweden)
Cohn Corey A
2008-02-01
Full Text Available Abstract Background Reactive oxygen species including hydroxyl radicals can cause oxidative stress and mutations. Inhaled particulate matter can trigger formation of hydroxyl radicals, which have been implicated as one of the causes of particulate-induced lung disease. The extreme reactivity of hydroxyl radicals presents challenges to their detection and quantification. Here, three fluorescein derivatives [aminophenyl fluorescamine (APF, amplex ultrared, and dichlorofluorescein (DCFH] and two radical species, proxyl fluorescamine and tempo-9-ac have been compared for their usefulness to measure hydroxyl radicals generated in two different systems: a solution containing ferrous iron and a suspension of pyrite particles. Results APF, amplex ultrared, and DCFH react similarly to the presence of hydroxyl radicals. Proxyl fluorescamine and tempo-9-ac do not react with hydroxyl radicals directly, which reduces their sensitivity. Since both DCFH and amplex ultrared will react with reactive oxygen species other than hydroxyl radicals and another highly reactive species, peroxynitite, they lack specificity. Conclusion The most useful probe evaluated here for hydroxyl radicals formed from cell-free particle suspensions is APF due to its sensitivity and selectivity.
Energy Technology Data Exchange (ETDEWEB)
Abdel-Fattah, Wafa I; Elkhooly, Tarek A, E-mail: nrcfifi@yahoo.co [Department of Biomaterials, National Research Center, Cairo (Egypt)
2010-06-01
The degradation and/or apatite layer precipitation ability of porous {beta}-tricalcium phosphate ({beta}-TCP) samples treated and untreated with microwave radiation during synthesis is investigated. Microwave heating was used to accelerate the formation of CDHA with the Ca/P ratio 1.5 in a shorter processing time which later forms {beta}-TCP at around 650 {sup 0}C. Soaking in simulated body fluid (SBF) for several periods (4, 8, 12, 24, 36, 48, 60 and 72 h) is performed in a cumulative manner. The deposition of an apatite layer is followed through diffuse reflected FT-IR, SEM and EDS. A microwave-treated sample having a smaller particle size than its parent induces the formation of a homogeneous carbonated apatite layer on its surface. On the other hand, the parent {beta}-TCP sample exhibited less ability to induce Ca-P formation after being soaked in SBF. The formation of an apatite layer is attributed to the increase in surface area consequent to reduced particle and grain sizes besides the presence of a minor amount of hydroxyapatite phase in the microwave-treated {beta}-TCP sample. The results prove that it is possible to control the biodegradation and apatite layer formation on sintered {beta}-TCP porous disks through controlling the particle size.
Danesh, F; Vahid, A; Jahanbani, J; Mashhadiabbas, F; Arman, E
2012-01-01
To evaluate the effects of apatite precipitation on the biocompatibility and hard tissue induction properties of white mineral trioxide aggregate (WMTA) in a dental pulp model. Pulp exposures were created on the axial walls of 32 sound canine teeth of eight dogs. Four additional sound teeth served as controls. The pulps were capped either with WMTA or apatite derivatives [biomimetic carbonated apatite (BCAp)] in the interaction of WMTA with a synthetic tissue fluid and restored with zinc oxide-eugenol cement. After 7 and 70 days, the animals were killed, and the histological specimens taken from the teeth were stained with haematoxylin and eosin for histomorphological evaluation. The Brown and Brenn technique was employed to stain bacteria. The data were subjected to nonparametric Kruskall-Wallis analysis and Mann-Whitney U_tests. Biomimetic carbonated apatite did not induce hard tissue bridge formation. WMTA performed significantly better than BCAp in this respect at both periods (P 0.05). White mineral trioxide aggregate induced hard tissue formation via a mechanism other than that postulated via apatite formation. © 2011 International Endodontic Journal.
Lipa, Danuta; Puziewicz, Jacek; Ntaflos, Theodoros; Matusiak-Małek, Magdalena
2015-04-01
The Cenozoic basanite from the Ostrzyca Proboszczowicka in Lower Silesia (SW Poland) belongs to numerous lavas occurring in the NE part of the Central European Volcanic Province. Basanite contains clinopyroxene megacrysts up to 3 cm in size. The clinopyroxene has the composition of aluminian-sodian diopside (mg# 0.61-0.70, 0.08-0.12 atoms Na pfu and 0.88-0.93 atoms Ca pfu). Cr is absent. The REE contents are above the primitive mantle reaching up to 18 x PM at Nd. Primitive-mantle normalized REE patterns show enrichment in LREE relative to HREE (LaN/LuN=3.81-5.01). The REE patterns of all the megacrysts show deflection in La-Nd. The trace element patterns are characterized by positive Zr, Hf and in some cases also Ta anomalies, and negative U, La, Sr, Ti and Pb ones. In some samples strong depletion (down to 0.01 x PM) in Rb and Ba is observed.The Ostrzyca megacrysts formed cumulate, which crystallized from magma similar to the host basanite, but more fractionated and enriched in REE, particularly in LREE (Lipa et al., 2014). This happened at mid-crustal depths (10-15 km) and the new pulse of basanitic magma entrained the crystals forming the non-solidified cumulate and brought them to the surface (Lipa et al., 2014). Clinopyroxene megacrysts contain large, transparent, euhedral apatite crystals up to 7 mm. The major element composition indicates the fluor-apatite with F content ranging from 0.87 to 1.93 wt.%. Chlorine content is strongly variable between grains (0.05-1.75 wt.%). Apatite is strongly enriched in LREE relative to HREE (LaN/LuN=60.39-62.23, about 1000 x PM for LREE and about 10 x PM for HREE). The REE patterns are nearly linear, with slight positive Nd and Gd anomalies. The trace element patterns are characterized by very strong negative anomalies of HFSE (Nb, Ta, Zr, Hf, Ti) and Pb, and weaker negative Sr anomaly. Concentration of Yb and Lu is on the level 10 x PM, whereas Rb, Hf and Ti are depleted relative to PM. Apatite preceded clinopyroxene
Skelton, Richard; Walker, Andrew M.
2018-03-01
The material properties of the common phosphate mineral apatite are influenced by the identity of the channel anion, which is usually F-, Cl-, or (OH)-. Density functional theory calculations have been used to determine the effect of channel anion identity on the compressibility and structure of apatite. Hydroxyapatite and fluorapatite are found to have similar zero pressure bulk moduli, of 79.2 and 82.1 GPa, respectively, while chlorapatite is considerably more compressible, with K 0 = 55.0 GPa. While the space groups of hydroxyapatite and fluorapatite do not change between 0 and 25 GPa, symmetrization of the Cl- site in chlorapatite at 7.5 GPa causes the space group to change from P2 1 /b to P6 3 /m. Examination of the valence electron density distribution in chlorapatite reveals that this symmetry change is associated with a change in the coordination of the Cl- anion from threefold to sixfold coordinated by Ca. We also calculate the pressure at which apatite decomposes to form tuite, a calcium orthophosphate mineral, and find that the transition pressure is sensitive to the identity of the channel anion, being lowest for fluorapatite (13.8 GPa) and highest for chlorapatite (26.9 GPa). Calculations are also performed within the DFT-D2 framework to investigate the influence of dispersion forces on the compressibility of apatite minerals.
High-speed photometry of the dwarf nova Z Cha in quiescence
International Nuclear Information System (INIS)
Wood, Janet; Horne, Keith; Berriman, Graham; O'Donoghue, Darragh; Warner, Brian
1986-01-01
High-speed white light photometry of the cataclysmic variable star Z Cha is used to study the structure of the system and to derive the properties of its components. The white dwarf and bright spot eclipse timings require a mass ratio, q=Msub(R)/Msub(WD) of 0.146 0 .9>i>81 0 .6. The infalling stream passes through the light centre of the bright spot. If the central luminous object is the white dwarf its mass is 0.54+-0.01 Msolar mass which corresponds to a secondary star mass of 0.081+-0.003 Msolar mass. Agreement between colour and brightness temperatures for the white dwarf and bright spot provide a rough confirmation of the 97 pc distance. (author)
Calvaruso, Christophe; Turpault, Marie-Pierre; Frey-Klett, Pascale; Uroz, Stéphane; Pierret, Marie-Claire; Tosheva, Zornitza; Kies, Antoine
2013-04-01
The release of nutritive elements through apatite dissolution represents the main source of phosphorus, calcium, and several micronutrients (e.g., Zn, Cu) for organisms in non-fertilized forest ecosystems. The aim of this study was to quantify, for the first time, the dissolution rate of apatite grains by tree roots that were or were not associated with a mineral weathering bacterial strain, and by various acids known to be produced by tree roots and soil bacterial strains in open-system flow microcosms. In addition, we explored whether the mobilization of trace elements (including rare earth elements) upon apatite dissolution was affected by the presence of trees and associated microorganisms. The dissolution rate of apatite by Scots pine plants that were or were not inoculated with the strain Burkholderia glathei PML1(12)Rp, and by inorganic (nitric) and organic (citric, oxalic and gluconic) acids at pH 5.5, 4.8, 3.8, 3.5, 3.0, and 2.0 was monitored in two controlled experiments: "plant-bacteria interaction" and "inorganic and organic acids". Analyses of the outlet solutions in the "plant-bacteria interaction" experiment showed that Scots pine roots and B. glathei PML1(12)Rp produced protons and organic acids such as gluconate, oxalate, acetate, and lactate. The weathering budget calculation revealed that Scots pines (with or without PML1(12)Rp) significantly increased (factor > 10) the release of Ca, P, As, Sr, Zn, U, Y, and rare earth elements such as Ce, La, Nd from apatite, compared to control abiotic treatment. Scanning electron microscopy observation confirmed traces of apatite dissolution in contact of roots. Most dissolved elements were taken up by Scots pine roots, i.e., approximately 50% of Ca, 70% of P, 30% of As, 70% of Sr, 90% of Zn, and 100% of U, Y, and rare earth elements. Interestingly, no significant additional effect due to the bacterial strain PML1(12)Rp on apatite dissolution and Scots pine nutrition and growth was observed. The "inorganic
The stability of the hydroxylated (0001) surface of alpha-Al2O3
DEFF Research Database (Denmark)
Lodziana, Zbigniew; Nørskov, Jens Kehlet; Stoltze, Per
2003-01-01
Self-consistent density functional calculations of the hydroxylated (0001) corundum surfaces are presented. It is demonstrated that the hydroxylated surfaces are the most stable under most, but not all, conditions. Hydroxylation significantly lowers the surface free energy of alpha-alumina. The s......Self-consistent density functional calculations of the hydroxylated (0001) corundum surfaces are presented. It is demonstrated that the hydroxylated surfaces are the most stable under most, but not all, conditions. Hydroxylation significantly lowers the surface free energy of alpha......-alumina. The stability of the hydrated surface resolves the discrepancies between the morphology of the alpha-alumina (0001) surface observed under ultra-high vacuum, and at ambient conditions. A method for the calculation of the equilibrium surface stoichiometry is proposed. The proposed approach provides a valuable...
International Nuclear Information System (INIS)
Barinov, S.M.; Rau, J.V.; Fadeeva, I.V.; Cesaro, S. Nunziante; Ferro, D.; Trionfetti, G.; Komlev, V.S.; Bibikov, V.Yu.
2006-01-01
This study was aimed at the investigation of the thermal stability of Mg-substituted carbonated apatites over the wide temperature range. Two different apatites were studied, which were prepared by either precipitation from aqueous solution or by solid-liquid interaction. The following methods were employed: FTIR spectroscopy of the condensed gas phase to evaluate the CO and CO 2 release with increasing temperature, FTIR of the solid residue after heating, XRD analysis, thermogravimetry and scanning electron microscopy. Decomposition behavior was shown to depend significantly on the synthesis method. Wet-synthesized powders are significantly less thermally stable compared with those prepared by solid-liquid interaction. Intensive release of carbon oxides from the former was observed at 300 deg. C, whereas the latter powder was relatively stable up to temperature about 1000 deg. C
Tuning the Slide-Roll Motion Mode of Carbon Nanotubes via Hydroxyl Groups
Li, Rui; Wang, Shiwei; Peng, Qing
2018-05-01
Controlling the motion of carbon nanotubes is critical in manipulating nanodevices, including nanorobots. Herein, we investigate the motion behavior of SWCNT (10,10) on Si substrate utilizing molecular dynamics simulations. We show that hydroxyl groups have sensitive effect on the carbon nanotube's motion mode. When the hydroxyl groups' ratio on carbon nanotube and silicon substrate surfaces is larger than 10 and 20%, respectively, the motion of carbon nanotube transforms from sliding to rolling. When the hydroxyl groups' ratio is smaller, the slide or roll mode can be controlled by the speed of carbon nanotube, which is ultimately determined by the competition between the interface potential energy and kinetic energy. The change of motion mode holds true for different carbon nanotubes with hydroxyl groups. The chirality has little effect on the motion behavior, as opposed to the diameter, attributed to the hydroxyl groups' ratio. Our study suggests a new route to control the motion behavior of carbon nanotube via hydroxyl groups.
International Nuclear Information System (INIS)
Liu Xuanyong; Chu, Paul K.; Ding Chuanxian
2007-01-01
Hydrogenated amorphous silicon films were fabricated on p-type, 100 mm diameter silicon wafers by plasma-enhanced chemical vapor deposition (PECVD) using silane and hydrogen. The structure and composition of the hydrogenated amorphous silicon films were investigated using micro-Raman spectroscopy and cross-sectional transmission electron microscopy (XTEM). The hydrogenated amorphous silicon films were subsequently soaked in simulated body fluids to evaluate apatite formation. Carbonate-containing hydroxyapatite (bone-like apatite) was formed on the surface suggesting good bone conductivity. The amorphous structure and presence of surface Si-H bonds are believed to induce apatite formation on the surface of the hydrogenated amorphous silicon film. A good understanding of the surface bioactivity of silicon-based materials and means to produce a bioactive surface is important to the development of silicon-based biosensors and micro-devices that are implanted inside humans
Energy Technology Data Exchange (ETDEWEB)
Liu Xuanyong [Shanghai Institute of Ceramics, Chinese Academy of Sciences, 1295 Dingxi Road, Shanghai 200050 (China) and Department of Physics and Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China)]. E-mail: xyliu@mail.sic.ac.cn; Chu, Paul K. [Department of Physics and Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China)]. E-mail: paul.chu@cityu.edu.hk; Ding Chuanxian [Shanghai Institute of Ceramics, Chinese Academy of Sciences, 1295 Dingxi Road, Shanghai 200050 (China)
2007-01-15
Hydrogenated amorphous silicon films were fabricated on p-type, 100 mm diameter <1 0 0> silicon wafers by plasma-enhanced chemical vapor deposition (PECVD) using silane and hydrogen. The structure and composition of the hydrogenated amorphous silicon films were investigated using micro-Raman spectroscopy and cross-sectional transmission electron microscopy (XTEM). The hydrogenated amorphous silicon films were subsequently soaked in simulated body fluids to evaluate apatite formation. Carbonate-containing hydroxyapatite (bone-like apatite) was formed on the surface suggesting good bone conductivity. The amorphous structure and presence of surface Si-H bonds are believed to induce apatite formation on the surface of the hydrogenated amorphous silicon film. A good understanding of the surface bioactivity of silicon-based materials and means to produce a bioactive surface is important to the development of silicon-based biosensors and micro-devices that are implanted inside humans.
Directory of Open Access Journals (Sweden)
Yihui Li
Full Text Available BACKGROUND: The CHADS2/CHA2DS2-VASc scores are used to predict thrombo-embolic/stroke in patients with nonvalvular atrial fibrillation (AF. Nevertheless, limited data are available regarding the association between these risk stratification for stroke and left atrial (LA remodeling status of AF patients. The purpose of this study was to explore the association between these scores and LA remodeling status assessed quantificationally by echocardiography in AF patients. METHODS: One hundred AF patients were divided into 3 groups based on the CHA2DS2-VASc/CHADS2 score: the score of 0 (low stroke risk, the score of 1 (moderate stroke risk and the score of ≥2 (high stroke risk. All patients were performed through conventional and velocity vector imaging echocardiography. Echocardiographic parameters: maximum LA volume index (LAVImax, LA total emptying fraction (LAEFt and LA mean strain were obtained to assess quantificationally LA remodeling status. RESULTS: On categorizing with CHA2DS2-VASc, the score of 1 group showed augment in LAVImax and attenuation in LA mean strain derived from VVI, compared with the score of 0 group (LAVImax: 40.27±21.91 vs. 26.79±7.87, p=0.002; LA mean strain: 15.18±6.36 vs. 22±8.54, p=0.001. On categorizing with the CHADS2 score, similar trends were seen between the score of ≥2 and 1 groups (LAVImax: 43.72±13.77 vs. 31.41±9.50, p<0.001; LA mean strain: 11.01±5.31 vs. 18.63±7.00, p<0.001. With multivariate logistic regression, LAVImax (odds ratio: 0.92 , 95% C=I: 0.85 to 0.98, p= 0.01 and LA mean strain reflecting LA remodeling (odds ratio: 1.10, 95% CI: 1.02 to 1.19, p=0.01 were strongly predictive of the CHA2DS2-VASc score of 0. CONCLUSIONS: The superiority of the CHADS2 score may lay in identifying LA remodeling of AF patients with high stroke risk. Whereas, the CHA2DS2-VASc score was better than the CHADS2 score at identifying LA remodeling of AF patients presenting low stroke risk.
Wakasugi, Y.; Ichino, K.; Tanioka, Y.; Wakaki, S.; Tsuboi, M.; Ishikawa, T.
2017-12-01
Apatite is a major accessory mineral in igneous rocks. Because Rb contents in apatite are very low, 87Sr/86Sr ratios of magmatic apatite are useful to estimate the initial 87Sr/86Sr ratio (SrI) of igneous rocks. Secondary post-magmatic event such as hydrothermal alteration may also crystallize secondary apatite, which may inhibit the estimation of SrI of igneous rocks. In this study, we examine the effects of secondary apatite on the initial 87Sr/86Sr ratio determination of granitic rocks by using acid leaching technique. Leached apatite samples were first separated from the whole rock powder as a heavy mineral fraction by heavy liquid technique, and the heavy mineral fraction was then leached by 3 M HNO3. The isotopic ratios of Sr and the concentrations of Rb and Sr were analyzed by TIMS and ICP-MS at Kochi Core Center, respectively. The Tadamigawa Older-stage granites, which locate in the Taishaku Mountains at the northeastern part of Japan, intrude into the Ashio Jurassic complex, and the ages of these rocks are late Cretaceous to Paleogene. The U-Pb ages of zircon and the K-Ar ages of biotite for these rocks are c. 100 Ma [1, 2]. Rb-Sr whole-rock isochron age of the pluton is 96.5 ± 1.3 Ma (SrI = 0.70534 ± 0.00003) and it is concordant with other radiometric ages. Rb-Sr mineral isochron ages range from 84.4 to 97.3 Ma and these ages are relatively younger than the Rb-Sr whole-rock isochron age. The difference among radiometric ages may reflect the difference of the closure temperature in each isotopic system. The Tadamigawa Older-stage granites have SrI for Rb-Sr mineral isochron range from 0.7053 to 0.7061 and are very similar to that (0.70534) for Rb-Sr whole-rock isochron. These may suggest that the Tadamigawa Older-stage granites are generated from same parental magma. However, 87Sr/86Sr ratios of the leached apatite samples were 0.70544-0.70856 and are relatively higher than SrI obtained from the Rb-Sr mineral isochrons (0.7053-0.7061). This result
International Nuclear Information System (INIS)
Li Hongfei; Guo Fuqiang; Zhang Zhifeng; Li Deqian; Wang Zhonghuai
2006-01-01
In this paper, a new process is proposed to recover rare earths from nitric acid leaching of apatite without interfering with the normal route for fertilizer production using solvent extraction with dimethyl heptyl methyl phosphonate CH 3 P(O)(OC 8 H 17 ) 2 (P 35 , B). In the present work, the leaching conditions are studied. In selected condition, apatite was dissolved in 20% (v/v) nitric acid solution at 60-70 deg. C while agitating. The most suitable acidity for extraction is 0.4 M HNO 3 . More than 98% of rare earths in apatite can be recovered using countercurrent extraction process with six stages when phase ratio = 0.5, and defluorination is unnecessary. The influences of phase ratio, stage number, acidity and salting-out agent on extractabilities of P 35 are studied. The results show that rare earths can be separated with P 35 from Ca, P, Fe and other impurities. Mixed rare earth oxides (REO) of which purity is more than 95% with yield over 98% can be obtained
Hydroxyl radical production in plasma electrolysis with KOH electrolyte solution
Energy Technology Data Exchange (ETDEWEB)
Saksono, Nelson; Febiyanti, Irine Ayu, E-mail: irine.ayu41@ui.ac.id; Utami, Nissa; Ibrahim [Department of Chemical Engineering, Universitas Indonesia, Depok 16424, Indonesia Phone: +62217863516, Fax: +62217863515 (Indonesia)
2015-12-29
Plasma electrolysis is an effective technology for producing hydroxyl radical (•OH). This method can be used for waste degradation process. This study was conducted to obtain the influence of applied voltage, electrolyte concentration, and anode depth in the plasma electrolysis system for producing hydroxyl radical. The materials of anode and cathode, respectively, were made from tungsten and stainless steel. KOH solution was used as the solution. Determination of hydroxyl radical production was done by measuring H{sub 2}O{sub 2} amount formed in plasma system using an iodometric titration method, while the electrical energy consumed was obtained by measuring the electrical current throughout the process. The highest hydroxyl radical production was 3.51 mmol reached with 237 kJ energy consumption in the power supply voltage 600 V, 0.02 M KOH, and 0.5 cm depth of anode.
Apatite fission track dating and thermal history of Qing-He region in Altay Mountains
International Nuclear Information System (INIS)
Bao Zengkuan; Chinese Academy of Sciences, Beijing; Yuan Wanming; Dong Jinquan; Gao Shaokai
2005-01-01
Fission track ages (FTA) and track lengths of apatite from Qing-He diorite intrusion in Altay Mountains are measured. Apatite fission track ages of three diorite samples is range from (78±5) Ma to (95 ± 5) Ma, and the lengths of horizontal confined spontaneous fission tracks are (13.2 ± 1.2)-(13.5 ±1.3) μm. The distribution of the track length is narrow and symmetrical with a mean length of approximately 13.3 μm and a standard deviation of around 0.1 μm. The inverse modeling results show that thermal history of this region has four stages, two rapid uplift of this region still existed magmatic intrusion and tectonic movements in Yanshanian. (authors)
International Nuclear Information System (INIS)
Kral, J.; Burchart, J.
1983-01-01
The coefficient of variation for grain-by-grain fission track uranium analysis of apatites from igneous rocks seems to reflect the temperature of crystallization and the cooling rate. For metamorphic rocks the coefficient represents a complex record of the homogeneity of the source and of metamorphic neocrystallization. As a test case 41 West Carpathian rocks have been examined and the coefficients of variation for U in apatites found to be: granitic rocks 0.30-0.79, paragneisses 0.35-0.95, migmatites 0.55-0.87, and volcanic rocks 0.30-0.40. Most of the frequency distributions are lognormal, though for some cases a normal distribution gives a better fit, and some are incompatible with either of the two distributions. (orig.)
Development of layered anode structures supported over Apatite-type Solid Electrolytes
Directory of Open Access Journals (Sweden)
Pandis P.
2016-01-01
Full Text Available Apatite-type lanthanum silicates (ATLS materials have attracted interest in recent literature as solid electrolytes for SOFCs. The fabrication of an ATLS based fuel cell with the state-of-art electrodes (NiO/YSZ as anode and LSCF or LSM as cathode can show degradation after long operation hours due to Si diffusion mainly towards the anode. In this work, we report a “layer-by-layer anodic electrodes” fabrication by means of spin coating and physical spraying. The overall aim of this work is the successful fabrication of such a layered structure including suitable blocking layers towards the inhibition of Si interdiffusion from the apatite electrolyte to the anode. The results showed that the deposition of 3 layers of LFSO/GDC (3μm, NiO/GDC (4μm and the final NiO/YSZ anode layer provided a stable half-cell, with no solid state reaction occurring among the electrodes and no Si diffusion observed towards the anode after thermal treatment at 800°C for 120h.
Effect of curcumin against oxidation of biomolecules by hydroxyl radicals.
Borra, Sai Krishna; Mahendra, Jaideep; Gurumurthy, Prema; Jayamathi; Iqbal, Shabeer S; Mahendra, Little
2014-10-01
Among various reactive oxygen species, hydroxyl radicals have the strongest chemical activity, which can damage a wide range of essential biomolecules such as lipids, proteins, and DNA. The objective of this study was to investigate the beneficial effects of curcumin on prevention of oxidative damage of biomolecules by hydroxyl radicals generated in in vitro by a Fenton like reaction. We have incubated the serum, plasma and whole blood with H2O2/Cu2+/ Ascorbic acid system for 4 hours at 37 0C and observed the oxidation of biomolecules like albumin, lipids, proteins and DNA. Curcumin at the concentrations of 50,100 and 200 μmoles, prevented the formation of ischemia modified albumin, MDA, protein carbonyls, oxidized DNA and increased the total antioxidant levels and GSH significantly. These observations suggest the hydroxyl radical scavenging potentials of curcumin and protective actions to prevent the oxidation of biomolecules by hydroxyl radicals.
Glorie, Stijn; Alexandrov, Igor; Nixon, Angus; Jepson, Gilby; Gillespie, Jack; Jahn, Bor-Ming
2017-08-01
Sakhalin Island represents a key locality to study the tectonic evolution of the western Pacific. The island is located at the Amur-Okhotsk plate margin and records a complex thermotectonic history. Apatite double dating (U-Pb and fission track) and thermal history modelling were applied to three late Eocene granitoid massifs within central and southern Sakhalin: the Aniva, Okhotsk and Langeri complexes. Apatite U-Pb results yield consistent late Eocene (∼40-37 Ma) ages, suggesting rapid post-magmatic cooling. Apatite fission track results reveal bimodal age distributions with late Eocene - early Oligocene (∼38-33 Ma) and early Miocene (∼20-17 Ma) age populations that can be correlated with variations in Uranium and Chlorine concentrations. Thermal history modelling translates the AFT age bimodality into two-phase cooling histories. The timing of the early cooling phase (∼38-33 Ma) corresponds with the apatite U-Pb ages, indicating rapid cooling to at least ∼100 °C during the late Oligocene. The second cooling phase at ∼20-17 Ma cooled the samples to near-surface temperatures. Both cooling phases correspond with regional unconformities and subsequent accelerations in sedimentation rate, suggesting that cooling was a response to rapid exhumation. In addition, our data suggests that the studied terranes record differential exhumation with respect to the structural architecture. The Miocene exhumation pulse is coeval with the timing of transpressional fault displacement and the subsequent opening of the Kuril Basin.
Oxygen isotope variations in phosphate of biogenic apatites. Pt. 2. Phosphorite rocks
Energy Technology Data Exchange (ETDEWEB)
Kolodny, Y; Luz, B; Shemesh, A [Hebrew Univ., Jerusalem (Israel). Dept. of Geology
1983-09-01
Phosphorites from sedimentary sequences ranging in age from Archaen to Recent were analysed for delta/sup 18/O in both the PO/sub 4/ (delta/sup 18/Osub(p)) and CO/sub 3/ (delta/sup 18/Osub(c)) in the apatite lattice. The oxygen isotope record is considerably better preserved in phosphates than in either carbonates or cherts. The use of the Longinelli and Nuti temperature equation yields temperatures for Recent phosphorites that are in good agreement with those measured in the field. The delta/sup 18/Osub(p) values of ancient phosphorites decrease with increasing age. These changes with time are not likely to be due to post-depositional exchange. Changes in delta/sup 18/O values of seawater and variations of temperatures with time can account for the delta/sup 18/Osub(p) time trend, but the latter explanation is preferred. In Ancient phosphorites delta/sup 18/Osub(c) in structurally bound carbonate in apatite is not a reliable geochemical indicator.
An extensive apatite fission-track study throughout the Northern Apennines Nappe belt
International Nuclear Information System (INIS)
Abbate, E.; Balestrieri, M.L.; Bigazzi, G.; Ventura, B.; Zattin, M.; Zuffa, G.G.
1999-01-01
This paper takes into consideration more than 100 apatite fission-track analyses on samples coming from an approximately west-east cross-section throughout the Northern Apennines. This collisional chain is made of structural units and nappes (Ligurian and Tuscan Nappe) accreted to the Adriatic Foreland during the Neogene, which overthrust the Miocene turbiditic successions of the Cervarola and Marnoso-arenacea Formations. Different cooling ages and degrees of annealing delineate different evolution histories for these units. Exhumation of the western outcrops of the Ligurian Nappe can be placed at 8 Ma and follows a first denudation event occurred in Eocene times. Timing of exhumation decreases eastwards. A break in this general trend is shown by the Apuan Alps, that occupy an intermediate position and yielded the youngest cooling ages. In the external part of the Marnoso-arenacea foredeep deposits this tendency could not be tested because total annealing of the apatite system has not been reached. In this case, modeling of data allows evaluating maximum burial temperatures
Characterization of the Ornithine Hydroxylation Step in Albachelin Biosynthesis
Directory of Open Access Journals (Sweden)
Kendra Bufkin
2017-10-01
Full Text Available N-Hydroxylating monooxygenases (NMOs are involved in siderophore biosynthesis. Siderophores are high affinity iron chelators composed of catechol and hydroxamate functional groups that are synthesized and secreted by microorganisms and plants. Recently, a new siderophore named albachelin was isolated from a culture of Amycolatopsis alba growing under iron-limiting conditions. This work focuses on the expression, purification, and characterization of the NMO, abachelin monooxygenase (AMO from A. alba. This enzyme was purified and characterized in its holo (FAD-bound and apo (FAD-free forms. The apo-AMO could be reconstituted by addition of free FAD. The two forms of AMO hydroxylate ornithine, while lysine increases oxidase activity but is not hydroxylated and display low affinity for NADPH.
Energy Technology Data Exchange (ETDEWEB)
Williams, Mark D.; Fritz, Brad G.; Mendoza, Donaldo P.; Rockhold, Mark L.; Thorne, Paul D.; Xie, YuLong; Bjornstad, Bruce N.; Mackley, Rob D.; Newcomer, Darrell R.; Szecsody, James E.; Vermeul, Vincent R.
2008-07-11
Following an evaluation of potential Sr-90 treatment technologies and their applicability under 100-NR-2 hydrogeologic conditions, U.S. Department of Energy, Fluor Hanford, Inc., Pacific Northwest National Laboratory, and the Washington Department of Ecology agreed that the long-term strategy for groundwater remediation at 100-N Area will include apatite sequestration as the primary treatment, followed by a secondary treatment if necessary (most likely phytoremediation). Since then, the agencies have worked together to agree on which apatite sequestration technology has the greatest chance of reducing Sr-90 flux to the river at a reasonable cost. In July 2005, aqueous injection, (i.e., the introduction of apatite-forming chemicals into the subsurface) was endorsed as the interim remedy and selected for field testing. Studies are in progress to assess the efficacy of in situ apatite formation by aqueous solution injection to address both the vadose zone and the shallow aquifer along the 300 ft of shoreline where Sr-90 concentrations are highest. This report describes the field testing of the shallow aquifer treatment.
Hydroxyl radical reactivity at the air-ice interface
Directory of Open Access Journals (Sweden)
T. F. Kahan
2010-01-01
Full Text Available Hydroxyl radicals are important oxidants in the atmosphere and in natural waters. They are also expected to be important in snow and ice, but their reactivity has not been widely studied in frozen aqueous solution. We have developed a spectroscopic probe to monitor the formation and reactions of hydroxyl radicals in situ. Hydroxyl radicals are produced in aqueous solution via the photolysis of nitrite, nitrate, and hydrogen peroxide, and react rapidly with benzene to form phenol. Similar phenol formation rates were observed in aqueous solution and bulk ice. However, no reaction was observed at air-ice interfaces, or when bulk ice samples were crushed prior to photolysis to increase their surface area. We also monitored the heterogeneous reaction between benzene present at air-water and air-ice interfaces with gas-phase OH produced from HONO photolysis. Rapid phenol formation was observed on water surfaces, but no reaction was observed at the surface of ice. Under the same conditions, we observed rapid loss of the polycyclic aromatic hydrocarbon (PAH anthracene at air-water interfaces, but no loss was observed at air-ice interfaces. Our results suggest that the reactivity of hydroxyl radicals toward aromatic organics is similar in bulk ice samples and in aqueous solution, but is significantly suppressed in the quasi-liquid layer (QLL that exists at air-ice interfaces.
Jannot, S.; Schiano, P.; Boivin, P.; Clocchiatti, R.; Chazot, G.
2003-04-01
The Massif Central area, characterized by a typical intraplate alkaline serie, is the largest magmatic province of the West-European Rift system. Although it has been the subject of several studies, the nature of Massif Central sources is still a matter of debate and many hypotheses are proposed, including deep-rooted continental hotspot, metasomatised spinel lherzolites and an asthenospheric flow linked to the lithospheric root of the Alpine chain. The Chaîne des Puys is the last magmatic province of the French Massif Central and is composed of hundred young well-preserved volcanoes. The present work aims to supply information on the nature and the origin of the source chemistry of alkaline serie from the Chaîne des Puys, by characterizing the trace and major element composition of minute melts preserved as quenched glass inclusions inside olivines phenocrysts in scoria from the Beaunit Maar. Heating stage experiments performed at ambient pressure on partially crystallised primary melt inclusions suggest CO_2 oversaturation of the trapped melt, and an entrapment temperature around 1200^oC±10^oC. Daughter minerals analyses point to a Ti-and Ca-rich basaltic paragenesis, in good agreement with that of erupted basalts from the Chaîne des Puys. Major element compositions show that melts trapped in inclusions evolve by limited fractional crystallization. Inclusions trapped in the more primitive olivine phenocrysts (Fo85) have alkali-basalt compositions that fall on the primitive end of the compositional trend define by the lavas of the Chaîne des Puys. Their major element chemistry rules out the hypothesis of a mantle source in the spinel stability field and requires a garnet-bearing mantle source. Analyzed for trace-element composition by LA-ICP-MS, they display homogeneous, enriched patterns, similar to those characterizing oceanic island and continental basalts. They have high concentration of LILE and LREE/HREE ratios. Such trace-element feature are typical of
COMPARISON OF APATITE II™ TREATMENT SYSTEM AT TWO MINES FOR METALS REMOVAL
Two abandoned lead-zinc mine sites, the Nevada Stewart Mine (NSM) and Success Mine, are located within the Coeur d'Alene Mining District, in northern Idaho. An Apatite II™ Treatment System (ATS) was implemented at each site to treat metal-laden water, mainly zinc. In the ATS, f...
Currie, Thayne; Lisse, Carey M.; Sicillia-Aguilar, Aurora; Rieke, George H.; Su, Kate Y. L.
2011-01-01
We describe Spitzer IRS spectroscopic observations of the approx. 10 Myr-old star, EF Chao Compositional modeling of the spectra from 5 micron to 35 micron confirms that it is surrounded by a luminous debris disk with L(sub D)/L(sub *) approx. 10(exp -3), containing dust with temperatures between 225 K and 430 K characteristic of the terrestrial zone. The EF Cha spectrum shows evidence for many solid-state features, unlike most cold, low-luminosity debris disks but like some other 10-20 Myr-old luminous, warm debris disks (e.g. HD 113766A). The EF Cha debris disk is unusually rich in a species or combination of species whose emissivities resemble that of finely-powdered, laboratory-measured phyllosilicate species (talc, saponite, and smectite), which are likely produced by aqueous alteration of primordial anhydrous rocky materials. The dust and, by inference, the parent bodies of the debris also contain abundant amorphous silicates and metal sulfides, and possibly water ice. The dust's total olivine to pyroxene ratio of approx. 2 also provides evidence of aqueous alteration. The large mass volume of grains with sizes comparable to or below the radiation blow-out limit implies that planetesimals may be colliding at a rate high enough to yield the emitting dust but not so high as to devolatize the planetesimals via impact processing. Because phyllosilicates are produced by the interactions between anhydrous rock and warm, reactive water, EF Cha's disk is a likely signpost for water delivery to the terrestrial zone of a young planetary system.
Hydroxyl-dependent Evolution of Oxygen Vacancies Enables the Regeneration of BiOCl photocatalyst
Wu, Sujuan
2017-05-02
Photoinduced oxygen vacancies (OVs) are widely investigated as a vital point defect in wide-band-gap semiconductors. Still, the formation mechanism of OVs remains unclear in various materials. To elucidate the formation mechanism of photoinduced OVs in bismuth oxychloride (BiOCl), we synthesized two surface hydroxyl discrete samples in light of the discovery of the significant variance of hydroxyl groups before and after UV light exposure. It is noted that OVs can be obtained easily after UV light irradiation in the sample with surface hydroxyl groups, while variable changes were observed in samples without surface hydroxyls. Density functional theory (DFT) calculations reveal that the binding energy of Bi-O is drastically influenced by surficial hydroxyl groups, which is intensely correlated to the formation of photoinduced OVs. Moreover, DFT calculations reveal that the adsorbed water molecules are energetically favored to dissociate into separate hydroxyl groups at the OV sites via proton transfer to a neighboring bridging oxygen atom, forming two bridging hydroxyl groups per initial oxygen vacancy. This result is consistent with the experimental observation that the disappearance of photoinduced OVs and the recovery of hydroxyl groups on the surface of BiOCl after exposed to a H2O(g)-rich atmosphere, and finally enables the regeneration of BiOCl photocatalyst. Here, we introduce new insights that the evolution of photoinduced OVs is dependent on surface hydroxyl groups, which will lead to the regeneration of active sites in semiconductors. This work is useful for controllable designs of defective semiconductors for applications in photocatalysis and photovoltaics.
Energy Technology Data Exchange (ETDEWEB)
Agougui, Hassen; Aissa, Abdallah [Laboratoire de Physico-Chimie des Materiaux, Faculte des Sciences de Monastir, 5019 Monastir (Tunisia); Debbabi, Mongi, E-mail: m.debbabi@yahoo.fr [Laboratoire de Physico-Chimie des Materiaux, Faculte des Sciences de Monastir, 5019 Monastir (Tunisia)
2012-11-15
Highlights: Black-Right-Pointing-Pointer Surface reactivity of apatites toward methyl phosphonic dichloride is tested. Black-Right-Pointing-Pointer Chemical analysis shows that hydroxyapatite is more reactive. Black-Right-Pointing-Pointer NMR spectra show the formation of Ca-O-P{sub org} and P{sub inorg}-O-P{sub org} bonds. Black-Right-Pointing-Pointer AFM indicated that the texture surface was changed by grafting. - Abstract: The nature of apatite-organic molecule interaction was the subject of many investigations. Grafting the organic molecule onto the inorganic support may precede through either formation of covalent bonds or ionic interaction between superficial hydroxyl on the apatite surface and organic functions. The hybrid materials obtained by functionalization of apatite surfaces with phosphonate moieties are of interest for their potential applications such in catalysis, chromatography and biomedical domain. In this scope, calcium hydroxyl and fluoroapatite (CaHAp and CaFAp) were prepared in the presence of the methyl phosphonic dichloride (MPO), by contact method in organic solvent at 25 Degree-Sign C for 2 days. The products are rigorously characterized by chemical analysis, infrared (IR), MAS-NMR spectroscopies, powder X-ray diffraction (XRD), atomic force microscopy (AFM) and specific surface area (SSA). The X-ray powder analysis showed that the crystallinity was sensibly affected by the presence of organic moieties. The IR spectroscopy showed new vibration modes appearing related to phosphonate groups essentially at 2930, 1315, 945, 764 and 514 cm{sup -1}. The {sup 31}P MAS NMR spectrum for hydroxy and fluoroapatite exhibits a single signal at 2.8 ppm. After reaction with (MPO) the spectra show the presence of new signals, assigned to the formation of organic-inorganic bond between the superficial hydroxyl groups of the apatite ({identical_to}CaOH) and ({identical_to}POH) and methyl phosphonic dichloride. The SSA decreases with increasing
Wiegel, Juergen; Zhang, Xiaoming; Wu, Qingzhong
1999-01-01
Ten years after reports on the existence of anaerobic dehalogenation of polychlorinated biphenyls (PCBs) in sediment slurries, we report here on the rapid reductive dehalogenation of para-hydroxylated PCBs (HO-PCBs), the excreted main metabolites of PCB in mammals, which can exhibit estrogenic and antiestrogenic activities in humans. The anaerobic bacterium Desulfitobacterium dehalogenans completely dehalogenates all flanking chlorines (chlorines in ortho position to the para-hydroxyl group) ...
Energy Technology Data Exchange (ETDEWEB)
Duc, M
2002-11-15
Sorption-desorption phenomena play an important role in the transport of toxic and radioactive elements in surface and underground water in contact with solid matter. Selenium, which is one of the long-lived radionuclides present in radioactive waste, is characterized by several oxidation states and by anionic species in aqueous solutions. In order to predict its transport, we need a good knowledge of its sorption processes. We have studied the sorption of Se(IV) and Se(VI) on two types of solids present in natural media or which have been proposed as additives to active barriers: hydroxy-apatites, fluoro-apatite and iron oxi-hydroxides (goethite and hematite). Sorption mechanisms have been studied through an approach including several different and complementary methods: titrimetry, zeta-metry, scanning and transmission electron microscopy, infrared spectroscopy, X-ray diffraction, X-ray photo electron spectroscopy, etc... Results showed that Se(VI) is much less sorbed than Se(VI) on both types of solids. For Se(IV) the sorption mechanisms are different for iron oxides and apatites. On oxides, sorption increases when pH decreases. It can be interpreted by a surface complexation model, essentially through an inner sphere complex (monodentate or bidentate). Modelling of Se sorption curves was performed after the determination of acido-basic properties of oxides. However, the determination of the intrinsic properties of oxides is disturbed by several parameters identified as impurities, evolution of the solid in solution, kinetic and solubility of the solid. For apatites, selenium sorption proceeds by exchange with superficial groups, with a maximum of fixation at approximately pH 8. Thanks to XPS measurements and the elaboration of a mathematical model, we could determine the depth of penetration of both selenium and cadmium on apatites. (author)
Genesis of iron-apatite ores in Posht-e-Badam Block (Central Iran ...
Indian Academy of Sciences (India)
Central Iran; iron-apatite ore; Kiruna-type; Posht-e-Badam Block; REE geochemistry. J. Earth Syst ... ferent ore genesis models have been proposed for ...... volatile-rich magma systems stress the important .... Laco magnetite flow deposits, northern Chile: An up-to- ... economic report on iron ore prevision of the Esfahan steel.
Functionalization of hydroxyl terminated polybutadiene with ...
Indian Academy of Sciences (India)
CBDT), has been covalently attached at the terminal carbon atoms of the hydroxyl terminated polybutadiene (HTPB) backbone. The modification of HTPB backbone by CBDT molecule does not affect the unique physico-chemical properties such ...
Yao, Ge; Zhang, Zelong; Wang, Jianwei
2017-09-27
Apatite-structured materials have been considered for the immobilization of a number of fission products from reprocessing nuclear fuel because of their chemical durability as well as compositional and structural flexibility. It is hypothesized that the effect of beta decay on the stability can be mitigated by introducing an appropriate electron acceptor at the neighboring sites in the structure. The decay series 137 Cs → 137 Ba and 90 Sr → 90 Y → 90 Zr were investigated using a spin-polarized DFT approach to test the hypothesis. Apatites with compositions of Ca 10 (PO 4 ) 6 F 2 and Ca 4 Y 6 (SiO 4 ) 6 F 2 were selected as model systems for the incorporation of radionuclides Cs and Sr, respectively. Ferric iron was introduced in the structure as an electron acceptor. Electron density of states, crystal and defect structures, and energies before and after beta decay were calculated. The calculated electron density of states suggests that the extra electron is localized at the ferric iron, which changes its oxidation state and becomes ferrous iron. The crystal and defect structures were analyzed based on the volume, lattice parameters, radial distribution functions, metal cation to coordinating oxygen distances, and the metaprism twist angle of the apatite crystal structure. The results show that there are minor changes in the crystal and defect structures of CsFeCa 8 (PO 4 ) 6 F 2 with Cs + and Fe 3+ substitutions undergoing the Cs → Ba transmutation, and of Ca 3 SrY 4 Fe 2 (SiO 4 ) 6 F 2 with Sr 2+ and Fe 3+ substitutions undergoing the Sr → Y → Zr transmutations. The last decay change, from Y 3+ → Zr 4+ , causes relatively larger changes in the local defect structure around Zr involving the coordination environment but the change is not significant to the crystal structure. The results on calculated cohesive energy suggest that the transmutations Cs + → Ba 2+ and Sr 2+ → Y 3+ → Zr 4+ in both apatite compositions are energetically favorable
International Nuclear Information System (INIS)
Liu, Yang; Zhou, Huihao; Zhu, Juanjuan; Gao, Yongxiang; Niu, Liwen; Liu, Jing; Teng, Maikun
2009-01-01
An antibody–antigen complex consisting of a single-chain variable fragment of the potential therapeutic antibody chA21 and an N-terminal fragment (residues 1–192) of the human ErbB2 extracellular domain was expressed, purified and crystallized. X-ray diffraction data were collected to 2.45 Å resolution. ErbB2 is a transmembrane tyrosine kinase, the overexpression of which causes abnormality and disorder in cell signalling and leads to cell transformation. Previously, an anti-ErbB2 single-chain chimeric antibody chA21 that specifically inhibits the growth of ErbB2-overexpressing cancer cells in vitro and in vivo was developed. Here, an antibody–antigen complex consisting of the single-chain variable fragment (scFv) of chA21 and an N-terminal fragment (residues 1–192, named EP I) of the ErbB2 extracellular domain was crystallized using the sitting-drop vapour-diffusion method. An X-ray diffraction data set was collected to 2.45 Å resolution from a single flash-cooled crystal; the crystal belonged to space group P2 1 2 1 2 1
Highly porous polymer-derived wollastonite-hydroxycarbonate apatite ceramics for bone regeneration.
Fiocco, L; Li, S; Bernardo, E; Stevens, M M; Jones, J R
2016-04-12
A novel strategy was employed to synthesize highly porous wollastonite-hydroxycarbonate apatite ceramic scaffolds for bone regeneration. A commercial liquid preceramic polymer filled with micro-CaCO3 powders was foamed at low temperature (at 350 °C), using the decomposition of a hydrazine additive, and then converted into ceramic by a treatment at 700 °C. Hydroxycarbonate apatite was later developed by a phosphatization treatment of ceramized foams, in a P-rich solution, while wollastonite was obtained by a second firing, at 900 °C. The effectiveness of the method was proven by x-ray diffraction analysis, showing the presence of the two expected crystalline phases. Porosity, interconnect size distribution and mechanical strength were in the range that is thought to be suitable for bone regeneration in non-load bearing sites (compressive strength ≈ 3 MPa, porosity ≈ 90%, modal interconnect diameter ≈ 130-160 μm). In addition, bioactivity and ion release rate were assessed in simulated body fluid (SBF). MC3T3 osteoblast precursor cells were able to colonize the material in vitro through the pore architecture and expressed osteogenic markers.
Devonian climate and reef evolution: Insights from oxygen isotopes in apatite
Joachimski, M. M.; Breisig, S.; Buggisch, W.; Talent, J. A.; Mawson, R.; Gereke, M.; Morrow, J. R.; Day, J.; Weddige, K.
2009-07-01
Conodonts, microfossils composed of carbonate-fluor apatite, are abundant in Palaeozoic-Triassic sediments and have a high potential to preserve primary oxygen isotope signals. In order to reconstruct the palaeotemperature history of the Devonian, the oxygen isotope composition of apatite phosphate was measured on 639 conodont samples from sequences in Europe, North America and Australia. The Early Devonian (Lochkovian; 416-411 Myr) was characterized by warm tropical temperatures of around 30 °C. A cooling trend started in the Pragian (410 Myr) with intermediate temperatures around 23 to 25 °C reconstructed for the Middle Devonian (397-385 Myr). During the Frasnian (383-375 Myr), temperatures increased again with temperatures to 30 °C calculated for the Frasnian-Famennian transition (375 Myr). During the Famennian (375-359 Myr), surface water temperatures slightly decreased. Reconstructed Devonian palaeotemperatures do not support earlier views suggesting the Middle Devonian was a supergreenhouse interval, an interpretation based partly on the development of extensive tropical coral-stromatoporoid communities during the Middle Devonian. Instead, the Devonian palaeotemperature record suggests that Middle Devonian coral-stromatoporoid reefs flourished during cooler time intervals whereas microbial reefs dominated during the warm to very warm Early and Late Devonian.
Sorption behavior of Zn(II) ions on synthetic apatitic calcium phosphates
Sebei, Haroun; Pham Minh, Doan; Nzihou, Ange; Sharrock, Patrick
2015-12-01
The synthesis, characterization and the reactivity of apatitic calcium phosphates (Ca-HA, chemical formula Ca10(PO4)6(OH)2) is reported. Calcium carbonate (CaCO3) and potassium dihydrogen orthophosphate (KH2PO4) were selected as economical starting materials for the synthesis of Ca-HA under atmospheric conditions. Monocalcium phosphate monohydrate (MCPM), dicalcium phosphate dihydrate (DCPD), and octacalcium phosphate pentahydrate (OCP) were identified as the main intermediates of the synthesis reaction. The product obtained after 48 h of reaction contains mainly low-crystalline Ca-HA and small amounts of other calcium phosphates such as octacalcium phosphate (OCP), B-type carbonate apatite (CAP), as well as unreacted calcium carbonate. This Ca-HA was found to be active for the removal of Zn2+ from an aqueous solution. Its sorption capacity reached up to 120 mg of Zn2+ per g of Ca-HA powder after 24 h of reaction. The monitoring of soluble Zn, Ca and P during the sorption experiment allowed characterizing the mechanism of Zn uptake. Dissolution-precipitation, ionic exchange and surface complexation are the three main mechanisms involved in the sorption processes. The contribution of these mechanisms is discussed in detail.
Fedotova Panin, YuV, VI
2018-03-01
The results of the statistical retrospective analysis of the officially recorded geodynamic events in mines of Apatit Company within the Khibiny Massif are presented. The risks and aftereffects of geodynamic events have been calculated. Under discussion are the results of three calculation variants taking into account the scale of human impact on rock mass. The analysis shows that the main damage due to geodynamic events is different-degree destruction of mine workings while the remaining aftereffects account for less than ten percent. That is, the geodynamic risk in apatite mines can be identified as technological.
Denudation history of the Snowy Mountains: constraints from apatite fission track thermochronology
International Nuclear Information System (INIS)
Kohn, B.P.; Gleadow, A.J.W.; Cox, S.J.D.
1999-01-01
Apatite fission track thermo chronology from Early Palaeozoic granitoids centred around the Kosciuszko massif of the Snowy Mountains, records a denudation history that was episodic and highly variable. The form of the apatite fission track age profile assembled from vertical sections and hydro-electric tunnels traversing the mountains, together with numerical forward modelling, provide strong evidence for two episodes of accelerated denudation, commencing in Late Permian - Early Triassic (ca 270 250 Ma) and mid-Cretaceous (ca 110-100 Ma) times, and a possible third episode in the Cenozoic. Denudation commencing in the Late Permian - Early Triassic wins widespread in the eastern and Central Snowy Mountains area, continued through much of the Triassic, and amounted to at least ∼2.0-2,4 km. This episode was probably the geomorphic response to the Hunter-Bowen Orogeny. Post-Triassic denudation to the present in these areas amounted to ∼2.0-2.2 km. Unambiguous evidence for mid-Cretaceous cooling and possible later cooling is confined to a north-south-trending sinuous belt, up to ∼15km wide by at least 35km long, of major reactivated Palaeozoic faults on the western side of the mountains. This zone is the most deeply exposed area of the Kosciuszko block. Denudation accompanying these later events totalled up to ∼1.8-2.0 km and ∼2.0 2.25 km respectively. Mid-Cretaceous denudation marks the onset of renewed tectonic activity in the south-eastern highlands following a period of relative quiescence since the Late Triassic, and establishes a temporal link with the onset of extension related to the opening of the Tasman Sea. Much of the present day relief of the mountains resulted from surface uplift which disrupted the post-mid-Cretaceous apatite fission track profile by variable offsets on faults. Copyright (1999) Geological Society of Australia
Thermophysical properties of hydroxyl ammonium ionic liquids
International Nuclear Information System (INIS)
Kurnia, K.A.; Wilfred, C.D.; Murugesan, T.
2009-01-01
The thermophysical properties of hydroxyl ammonium ionic liquids: density ρ, T = (293.15 to 363.15) K; dynamic viscosity η, T = (298.2 to 348.2) K; and refractive indices n D , T = (293.15 to 333.15) K have been measured. The coefficients of thermal expansion α, values were calculated from the experimental density results using an empirical correlation for T = (293.15 to 363.15) K. The variation of volume expansion of ionic liquids studied was found to be independent of temperature within the range covered in the present work. The thermal decomposition temperature 'T d ' for all the six hydroxyl ammonium ionic liquids is also investigated using thermogravimetric analyzer (TGA)
Directory of Open Access Journals (Sweden)
Poutiainen, M.
1995-06-01
Full Text Available In the studied zircon and apatite crystals, data recorded two different compositional types of fluid inclusions: Type 1 H2O-CO2, low salinity inclusions (XCO2 = 0.42 to 0.87; XNaCl = 0.001 to 0.005 with bulk densities of 0.73 to 0.87 g/cm3, and Type 2 H2O moderate salinity (XNaCl = 0.03 to 0.06 inclusions with densities of 0.83 to 1.02 g/cm3. The Type 1 inclusions are not present in apatite. In zircon, the observed fluid inclusion types occur in separate domains: around (Type 1 and outside (Type 2 the apparent core. Fluid inclusions are further subdivided into pseudosecondary and secondary inclusions. Using a combination of SEM-EDS, optical characteristics and crushing-stage, various daughter and captive minerals were identified. The fluid inclusion data suggest that the pseudosecondary Type 1 and Type 2 inclusions in zircon and apatite were trapped during the pre-emplacement evolution of the carbonatite at mid-crustal conditions (P≥4 kbar, T≥625°C. The Type 1 fluid was depleted in CO2, during crystal fractionation and cooling leading to a fluid phase enriched in water and alkalies. Fenitization was obviously induced by these saline aqueous fluids. During emplacement of the carbonatite to the present level, zircon phenocrysts were intensively fractured, some Type 1 inclusions were re-equilibrated, and multiphase Type 2 inclusions were trapped. It is assumed that all these inclusions in zircon and the pseudosecondary Type 2 inclusions in apatite have a magmatic origin. In apatite, calcite inclusions occur side-by-side with the secondary Type 2 inclusions. These calcites co-existed with the aqueous fluid during fracturing and metamorphic re-crystallization of apatites. Probably, this metamorphic fluid also is responsible for the transport and deposition of at least some of the calcite at low temperatures (200-350°C.
Energy Technology Data Exchange (ETDEWEB)
Szecsody, James E.; Burns, Carolyn A.; Moore, Robert C.; Fruchter, Jonathan S.; Vermeul, Vincent R.; Williams, Mark D.; Girvin, Donald C.; McKinley, James P.; Truex, Michael J.; Phillips, Jerry L.
2007-10-01
This report summarizes laboratory scale studies investigating the remediation of Sr-90 by Ca-citrate-PO4 solution injection/infiltration to support field injection activities in the Hanford 100N area. This study is focused on experimentally testing whether this remediation technology can be effective under field scale conditions to mitigate Sr-90 migration 100N area sediments into the Columbia River. Sr-90 is found primarily adsorbed to sediments by ion exchange (99% adsorbed, < 1% in groundwater) in the upper portion of the unconfined aquifer and lower vadose zone. Although primarily adsorbed, Sr-90 is still considered a high mobility risk as it is mobilized by seasonal river stage increases and by plumes of higher ionic strength relative to groundwater. This remediation technology relies upon the Ca-citrate-PO4 solution forming apatite precipitate [Ca6(PO4)10(OH)2], which incorporates some Sr-90 during initial precipitation and additionally slowly incorporates Sr-90 by solid phase substitution for Ca. Sr substitution occurs because Sr-apatite is thermodynamically more stable than Ca-apatite. Once the Sr-90 is in the apatite structure, Sr-90 will decay to Y-90 (29.1 y half-life) then Zr-90 (64.1 h half-life) without the potential for migration into the Columbia River. For this technology to be effective, sufficient apatite needs to be emplaced in sediments to incorporate Sr and Sr-90 for 300 years (~10 half-lives of Sr-90), and the rate of incorporation needs to exceed the natural groundwater flux rate of Sr in the 100N area. A primary objective of this study is to supply an injection sequence to deliver sufficient apatite into subsurface sediments that minimizes initial mobility of Sr-90, which occurs because the injection solution has a higher ionic strength compared to groundwater. This can be accomplished by sequential injections of low, then high concentration injection of Ca-citrate-PO4 solutions. Assessment of low concentration Ca-citrate-PO4, citrate-PO4
Madupalli, Honey; Pavan, Barbara; Tecklenburg, Mary M. J.
2017-11-01
The mineral component of bone and other biological calcifications is primarily a carbonate substituted calcium apatite. Integration of carbonate into two sites, substitution for phosphate (B-type carbonate) and substitution for hydroxide (A-type carbonate), influences the crystal properties which relate to the functional properties of bone. In the present work, a series of AB-type carbonated apatites (AB-CAp) having varying A-type and B-type carbonate weight fractions were prepared and analyzed by Fourier transform infrared spectroscopy (FTIR), powder X-ray diffraction (XRD), and carbonate analysis. A detailed characterization of A-site and B-site carbonate assignment in the FTIR ν3 region is proposed. The mass fractions of carbonate in A-site and B-site of AB-CAp correlate differently with crystal axis length and crystallite domain size. In this series of samples reduction in crystal domain size correlates only with A-type carbonate which indicates that carbonate in the A-site is more disruptive to the apatite structure than carbonate in the B-site. High temperature methods were required to produce significant A-type carbonation of apatite, indicating a higher energy barrier for the formation of A-type carbonate than for B-type carbonate. This is consistent with the dominance of B-type carbonate substitution in low temperature synthetic and biological apatites.
Malusà, Marco G.; Wang, Jiangang; Garzanti, Eduardo; Liu, Zhi-Chao; Villa, Igor M.; Wittmann, Hella
2017-10-01
Detrital thermochronology is often employed to assess the evolutionary stage of an entire orogenic belt using the lag-time approach, i.e., the difference between the cooling and depositional ages of detrital mineral grains preserved in a stratigraphic succession. The impact of different eroding sources to the final sediment sink is controlled by several factors, including the short-term erosion rate and the mineral fertility of eroded bedrock. Here, we use apatite fertility data and cosmogenic-derived erosion rates in the Po river catchment (Alps-Apennines) to calculate the expected percentage of apatite grains supplied to the modern Po delta from the major Alpine and Apenninic eroding sources. We test these predictions by using a cutting-edge dataset of trace-element and Nd-isotope signatures on 871 apatite grains from 14 modern sand samples, and we use apatite fission-track data to validate our geochemical approach to provenance discrimination. We found that apatite grains shed from different sources are geochemically distinct. Apatites from the Lepontine dome in the Central Alps show relative HREE enrichment, lower concentrations in Ce and U, and higher 147Sm/144Nd ratios compared to apatites derived from the External Massifs. Derived provenance budgets point to a dominant apatite contribution to the Po delta from the high-fertility Lepontine dome, consistent with the range independently predicted from cosmonuclide and mineral-fertility data. Our results demonstrate that the single-mineral record in the final sediment sink can be largely determined by high-fertility source rocks exposed in rapidly eroding areas within the drainage. This implies that the detrital thermochronology record may reflect processes affecting relatively small parts of the orogenic system under consideration. A reliable approach to lag-time analysis would thus benefit from an independent provenance discrimination of dated mineral grains, which may allow to proficiently reconsider many
H-Isotopic Composition of Apatite in Northwest Africa 7034
McCubbin, F. M.; Barnes, J. J.; Santos, A. R.; Boyce, J. W.; Anand, M.; Franchi, I. A.; Agee, C. B.
2016-01-01
Northwest Africa (NWA) 7034 and its pairings comprise a regolith breccia with a basaltic bulk composition [1] that yields a better match than any other martian meteorite to estimates of Mars' bulk crust composition [1]. Given the similarities between NWA 7034 and the martian crust, NWA 7034 may represent an important sample for constraining the crustal composition of components that cannot be measured directly by remote sensing. In the present study, we seek to constrain the H isotopic composition of the martian crust using Cl-rich apatite in NWA 7034.
Directory of Open Access Journals (Sweden)
Yorihiko Koeda
2017-10-01
Conclusion: Calculation of the CHADS2 and mCHA2DS2-VASc scores in order to evaluate the risk of systemic thromboembolism was useful to predict the onset of CHF, but not all-cause death, in patients with NVAF.
Energy Technology Data Exchange (ETDEWEB)
Goel, Ashutosh [Rutgers Univ., New Brunswick, NJ (United States); McCloy, John S. [Washington State Univ., Pullman, WA (United States); Riley, Brian J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Matyas, Josef [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2017-12-30
The goal of the project was to utilize the knowledge accumulated by the team, in working with minerals for chloride wastes and biological apatites, toward the development of advanced waste forms for immobilizing 129I and mixed-halide wastes. Based on our knowledge, experience, and thorough literature review, we had selected two minerals with different crystal structures and potential for high chemical durability, sodalite and CaP/PbV-apatite, to form the basis of this project. The focus of the proposed effort was towards: (i) low temperature synthesis of proposed minerals (iodine containing sodalite and apatite) leading to the development of monolithic waste forms, (ii) development of a fundamental understanding of the atomic-scale to meso-scale mechanisms of radionuclide incorporation in them, and (iii) understanding of the mechanism of their chemical corrosion, alteration mechanism, and rates. The proposed work was divided into four broad sections. deliverables. 1. Synthesis of materials 2. Materials structural and thermal characterization 3. Design of glass compositions and synthesis glass-bonded minerals, and 4. Chemical durability testing of materials.
Impact of Surface Potential on Apatite Formation in Ti Alloys Subjected to Acid and Heat Treatments.
Yamaguchi, Seiji; Hashimoto, Hideki; Nakai, Ryusuke; Takadama, Hiroaki
2017-09-24
Titanium metal (Ti) and its alloys are widely used in orthopedic and dental fields. We have previously shown that acid and heat treatment was effective to introduce bone bonding, osteoconduction and osteoinduction on pure Ti. In the present study, acid and heat treatment with or without initial NaOH treatment was performed on typical Ti-based alloys used in orthopedic and dental fields. Dynamic movements of alloying elements were developed, which depended on the kind of treatment and type of alloy. It was found that the simple acid and heat treatment enriched/remained the alloying elements on Ti-6Al-4V, Ti-15Mo-5Zr-3Al and Ti-15Zr-4Nb-4Ta, resulting in neutral surface charges. Thus, the treated alloys did not form apatite in a simulated body fluid (SBF) within 3 days. In contrast, when the alloys were subjected to a NaOH treatment prior to an acid and heat treatment, alloying elements were selectively removed from the alloy surfaces. As a result, the treated alloys became positively charged, and formed apatite in SBF within 3 days. Thus, the treated alloys would be useful in orthopedic and dental fields since they form apatite even in a living body and bond to bone.
Hydroxyl migration disorders the surface structure of hydroxyapatite nanoparticles
Cheng, Xiajie; Wu, Hong; Zhang, Li; Ma, Xingtao; Zhang, Xingdong; Yang, Mingli
2017-09-01
The surface structure of nano-hydroxyapatite (HAP) was investigated using a combined simulated annealing and molecular dynamics method. The stationary structures of nano-HAP with 4-7 nm in diameter and annealed under different temperatures were analyzed in terms of pair distribution function, structural factor, mean square displacement and atomic coordination number. The particles possess different structures from bulk crystal. A clear radial change in their atomic arrangements was noted. From core to surface the structures change from ordered to disordered. A three-shell model was proposed to describe the structure evolution of nano-HAP. Atoms in the core zone keep their arrangements as in crystal, while atoms in the surface shell are in short-range order and long-range disorder, adopting a typically amorphous structure. Atoms in the middle shell have small displacements and/or deflections but basically retain their original locations as in crystal. The disordered shell is about 1 nm in thickness, in agreement with experimental observations. The disordering mainly stems from hydroxyl migration during which hydroxyls move to the surface and bond with the exposed Ca ions, and their left vacancies bring about a rearrangement of nearby atoms. The disordering is to some extent different for particles unannealed under different temperatures, resulting from fewer number of migrated hydroxyls at lower temperatures. Particles with different sizes have similar surface structures, and their surface energy decreases with increasing size. Moreover, the surface energy is reduced by hydroxyl migration because the exposed Ca ions on the surface are ionically bonded with the migrated hydroxyls. Our calculations proposed a new structure model for nano-HAP, which indicates a surface structure with activities different from those without surface reorganization. This is particularly interesting because most bioactivities of biomaterials are dominated by their surface activity.
Hydroxyapatite-phosphonoformic acid hybrid compounds prepared by hydrothermal method
Turki, Thouraya; Othmani, Masseoud; Bantignies, Jean-Louis; Bouzouita, Khaled
2014-01-01
Hydroxyapatites were prepared in the presence of different amounts of phosphonoformic acid (PFA) via the hydrothermal method. The obtained powders were characterized through chemical analysis, XRD, IR, 31P MAS-NMR, TEM, and TG-TDA. The XRD showed that the PFA did not affect the apatite composition. Indeed, only a reduction of the crystallite size was noted. After grafting of PFA, the IR spectroscopy revealed the appearance of new bands belonging to HPO42- and carboxylate groups of the apatite and organic moiety, respectively. Moreover, the 31P MAS-NMR spectra exhibited a peak with a low intensity assigned to the terminal phosphonate group of the organic moiety in addition to that of the apatite. Based on these results, a reaction mechanism involving the surface hydroxyl groups (tbnd Casbnd OH) of the apatite and the carboxyl group of the acid was proposed.
International Nuclear Information System (INIS)
Duc, M.
2002-11-01
Sorption-desorption phenomena play an important role in the transport of toxic and radioactive elements in surface and underground water in contact with solid matter. Selenium, which is one of the long-lived radionuclides present in radioactive waste, is characterized by several oxidation states and by anionic species in aqueous solutions. In order to predict its transport, we need a good knowledge of its sorption processes. We have studied the sorption of Se(IV) and Se(VI) on two types of solids present in natural media or which have been proposed as additives to active barriers: hydroxy-apatites, fluoro-apatite and iron oxi-hydroxides (goethite and hematite). Sorption mechanisms have been studied through an approach including several different and complementary methods: titrimetry, zeta-metry, scanning and transmission electron microscopy, infrared spectroscopy, X-ray diffraction, X-ray photo electron spectroscopy, etc... Results showed that Se(VI) is much less sorbed than Se(VI) on both types of solids. For Se(IV) the sorption mechanisms are different for iron oxides and apatites. On oxides, sorption increases when pH decreases. It can be interpreted by a surface complexation model, essentially through an inner sphere complex (monodentate or bidentate). Modelling of Se sorption curves was performed after the determination of acido-basic properties of oxides. However, the determination of the intrinsic properties of oxides is disturbed by several parameters identified as impurities, evolution of the solid in solution, kinetic and solubility of the solid. For apatites, selenium sorption proceeds by exchange with superficial groups, with a maximum of fixation at approximately pH 8. Thanks to XPS measurements and the elaboration of a mathematical model, we could determine the depth of penetration of both selenium and cadmium on apatites. (author)
Testosterone 15β-hydroxylation by solvent tolerant Pseudomonas putida S12
Ruijssenaars, H.J.; Sperling, E.M.G.M.; Wiegerinck, P.H.G.; Brands, F.T.L.; Wery, J.; Bont, J.A.M.de
2007-01-01
A steroid 15β-hydroxylating whole-cell solvent tolerant biocatalyst was constructed by expressing the Bacillus megaterium steroid hydroxylase CYP106A2 in the solvent tolerant Pseudomonas putida S12. Testosterone hydroxylation was improved by a factor 16 by co-expressing Fer, a putative Fe-S protein
Apatite fission-track dating of erosion in the eastern Andes, Bolivia
International Nuclear Information System (INIS)
Crough, S.T.
1983-01-01
Three samples from a Triassic-age batholith in the eastern Andes northeast of La Paz, Bolivia yield apatitic fission-track ages of 11-13 Ma. Interpreting these young ages as due to uplift and erosion requires approximately 2.5-5.0 km of erosion in the past 12 Ma, an amount which is consistent with the known geology and which is typical of many active mountain ranges. (orig.)
Roldán, Vanessa; Rivera-Caravaca, José Miguel; Shantsila, Alena; García-Fernández, Amaya; Esteve-Pastor, María Asunción; Vilchez, Juan Antonio; Romera, Marta; Valdés, Mariano; Vicente, Vicente; Marín, Francisco; Lip, Gregory Y H
2018-02-01
Atrial fibrillation (AF)-European guidelines suggest the use of biomarkers to stratify patients for stroke and bleeding risks. We investigated if a multibiomarker strategy improved the predictive performance of CHA 2 DS 2 -VASc and HAS-BLED in anticoagulated AF patients. We included consecutive patients stabilized for six months on vitamin K antagonists (INRs 2.0-3.0). High sensitivity troponin T, NT-proBNP, interleukin-6, von Willebrand factor concentrations and glomerular filtration rate (eGFR; using MDRD-4 formula) were quantified at baseline. Time in therapeutic range (TTR) was recorded at six months after inclusion. Patients were follow-up during a median of 2375 (IQR 1564-2887) days and all adverse events were recorded. In 1361 patients, adding four blood biomarkers, TTR and MDRD-eGFR, the predictive value of CHA 2 DS 2 -VASc increased significantly by c-index (0.63 vs. 0.65; p = .030) and IDI (0.85%; p originals scores. Addition of biomarkers enhanced the predictive value of CHA 2 DS 2 -VASc and HAS-BLED, although the overall improvement was modest and the added predictive advantage over original scores was marginal. Key Messages Recent atrial fibrillation (AF)-European guidelines for the first time suggest the use of biomarkers to stratify patients for stroke and bleeding risks, but their usefulness in real world for risk stratification is still questionable. In this cohort study involving 1361 AF patients optimally anticoagulated with vitamin K antagonists, adding high sensitivity troponin T, N-terminal pro-B-type natriuretic peptide, interleukin 6, von Willebrand factor, glomerular filtration rate (by the MDRD-4 formula) and time in therapeutic range, increased the predictive value of CHA 2 DS 2 -VASc for cardiovascular events, but not the predictive value of HAS-BLED for major bleeding. Reclassification analyses did not show improvement adding multiple biomarkers. Despite the improvement observed, the added predictive advantage is marginal and
Duan, Deng-Fei; Jiang, Shao-Yong
2018-06-01
In order to find criteria to discriminate the synchronous ore-associated and barren granitoid rocks, we have determined apatite chemistry associated with ore-associated (Cu-Au) and barren granitoid rocks in the Edong district of the Middle and Lower Yangtze River metallogenic belt, South China. Both rock types give zircon U-Pb ages between 135.0 and 138.7 Ma. Apatite has a higher volatile and Li content (Cl: 0.19-0.57 wt%, average 0.35 wt%, SO3: 0.08-0.71 wt%, average 0.32 wt%, Li: 0.49-7.99 ppm, average 3.23 ppm) in ore-associated rocks than those in barren rocks (Cl: 0.09-0.31 wt%, average 0.16 wt%, SO3: 0.06-0.28 wt%, average 0.16 wt%, Li: 0.15-0.89 ppm, average 0.36 ppm). Apatite (La/Yb)N ratios and Eu/Eu* values are relatively high and show wider variation in ore-associated rocks than those in barren rocks. Apatite (La/Sm)N and (Yb/Sm)N show positive correlation in ore-associated rocks but negative in barren rocks. The higher volatile content occurs in ore-associated magma, favoring Cu-Au transportation and deposition. Furthermore, amphibole fractional crystallization in ore-associated magma further enriched the ore elements in the residual melt. Barren rocks may have undergone fluid exsolution before emplacement, which makes it barren in Cl, S and ore elements (Cu, S). These signatures emphases the significance of volatile and magma evolution in mineralization and indicate that analyses of magmatic apatite can serve to distinguish ore-associated from barren intrusions.
Differential effects of collagen prolyl 3-hydroxylation on skeletal tissues.
Directory of Open Access Journals (Sweden)
Erica P Homan
2014-01-01
Full Text Available Mutations in the genes encoding cartilage associated protein (CRTAP and prolyl 3-hydroxylase 1 (P3H1 encoded by LEPRE1 were the first identified causes of recessive Osteogenesis Imperfecta (OI. These proteins, together with cyclophilin B (encoded by PPIB, form a complex that 3-hydroxylates a single proline residue on the α1(I chain (Pro986 and has cis/trans isomerase (PPIase activity essential for proper collagen folding. Recent data suggest that prolyl 3-hydroxylation of Pro986 is not required for the structural stability of collagen; however, the absence of this post-translational modification may disrupt protein-protein interactions integral for proper collagen folding and lead to collagen over-modification. P3H1 and CRTAP stabilize each other and absence of one results in degradation of the other. Hence, hypomorphic or loss of function mutations of either gene cause loss of the whole complex and its associated functions. The relative contribution of losing this complex's 3-hydroxylation versus PPIase and collagen chaperone activities to the phenotype of recessive OI is unknown. To distinguish between these functions, we generated knock-in mice carrying a single amino acid substitution in the catalytic site of P3h1 (Lepre1(H662A . This substitution abolished P3h1 activity but retained ability to form a complex with Crtap and thus the collagen chaperone function. Knock-in mice showed absence of prolyl 3-hydroxylation at Pro986 of the α1(I and α1(II collagen chains but no significant over-modification at other collagen residues. They were normal in appearance, had no growth defects and normal cartilage growth plate histology but showed decreased trabecular bone mass. This new mouse model recapitulates elements of the bone phenotype of OI but not the cartilage and growth phenotypes caused by loss of the prolyl 3-hydroxylation complex. Our observations suggest differential tissue consequences due to selective inactivation of P3H1 hydroxylase
Presence of hydrogen peroxide, a source of hydroxyl radicals, in acid electrolyzed water.
Directory of Open Access Journals (Sweden)
Takayuki Mokudai
Full Text Available BACKGROUND: Acid electrolyzed water (AEW, which is produced through the electrolysis of dilute sodium chloride (NaCl or potassium chloride solution, is used as a disinfectant in various fields because of its potent antimicrobial activity. The hydroxyl radical, an oxygen radical species, is often suggested as a putative active ingredient for AEW antimicrobial activity. METHODOLOGY/PRINCIPAL FINDINGS: The aim of the present study is to detect hydroxyl radicals in AEW. The hydroxyl radicals in AEW prepared under different conditions were determined using an electron spin resonance (ESR technique. A signal from 5,5-dimethyl-1-pyrroline N-oxide (DMPO-OH, an adduct of DMPO and the hydroxyl radical, was detected in AEW prepared by double or triple electrolyses of 1% NaCl but not of 0.1% NaCl solution. Then the presence of hydrogen peroxide as a proposed source of hydroxyl radicals was examined using a combination of ESR and a Fenton reaction. The DMPO-OH signal was clearly detected, even in AEW prepared by single electrolysis of 0.1% NaCl solution, when ferrous sulfate was added to induce a Fenton reaction, indicating the presence of hydrogen peroxide in the AEW. Since sodium formate, a hydroxyl radical scavenger, did not affect the bactericidal activity of AEW, it is concluded that the radical is unlikely to contribute to the antimicrobial activity of AEW, although a small amount of the radical is produced from hydrogen peroxide. Dimethyl sulfoxide, the other hydroxyl radical scavenger used in the present study, canceled the bactericidal activity of AEW, accompanied by complete depletion of free available chlorine, suggesting that hypochlorous acid is probably a major contributor to the antimicrobial activity. CONCLUSIONS: It is strongly suggested that although hydrogen peroxide is present in AEW as a source of hydroxyl radicals, the antimicrobial activity of AEW does not depend on these radicals.
Kim, Y.; Konecke, B.; Fiege, A.; Simon, A. C.; Becker, U.
2017-12-01
We use ab-initio calculations to investigate the energetics and geometry of incorporation of S with its oxidation states S6+, S4+, and S2- into the apatite end-members fluor-, chlor-, and hydroxylapatite, [Ca10(PO4)6(F,Cl,OH)2]. The reaction energy of the balanced equation indicates the stability of the modeled S-incorporated apatite relative to the host apatite, the source, and sink phases. One possible coupled substitution mechanism involves the replacement of La3+ + PO43- ↔ Ca2+ + SO42-. Our results show that the incorporation of SO42- into La- and Na-bearing apatite, Ca8NaLa(PO4)6(F,Cl,OH)2, is energetically favored over the incorporation into La- and Si-bearing apatite, Ca9La(PO4)5(SiO4)(F,Cl,OH)2. Co-incorporation of SO42- and SO32- is energetically favored when the lone pair electrons of SO32- face towards the anion column site, compared to facing away from it. Full or partial incorporation of S2- is favored on the column anion site in the form of [Ca10(PO4)6S] and [Ca20(PO4)12SX2)], where X = F, Cl, or OH. Upon full incorporation (i.e., replacing all column ions by sulfide ions), S2- is positioned in the anion column at z = 0.5 (half way between the mirror planes at z = 1/4 and z = 3/4) in the energy-optimized structure. The calculated energies for partial incorporation of S2- demonstrate that in an energy-optimized structure, S2- is displaced from the mirror plane at z = 1/4 or 3/4, by 1.0 to 1.6 Å, depending on the surrounding species (F-, Cl- or OH-); however, the probability for S2- to be incorporated into the apatite structure is highest for chlorapatite end-members. Our results describe energetically feasible incorporation mechanisms for all three oxidations states of S (S6+, S4+, S2-) in apatite, along with structural distortion and concurring electronic structure changes. These observations are consistent with recently published experimental results (Konecke et al. 2017) that demonstrate S6+, S4+ and S2- incorporation into apatite, where the
Brown, Alexander; France, Kevin; Walter, Frederick M.; Schneider, P. Christian; Brown, Timothy M.; Andrews, Sean M.; Wilner, David J.
2018-06-01
The young (7 Myr) 1.5 solar mass T Tauri star T Chamaeleontis shows dramatic variability. The optical extinction varies by at least 3 magnitudes on few hour time-scales with no obvious periodicity. The obscuration is produced by material at the inner edge of the circumstellar disk and therefore characterizing the absorbing material can reveal important clues regarding the transport of gas and dust within such disks. The inner disk of T Cha is particularly interesting, because T Cha has a transitional disk with a large gap at 0.2-15 AU in the dust disk and allows study of the gas and dust structure in the terrestrial planet formation zone during this important rapid phase of protoplanetary disk evolution. For this reason we have conducted a major multi-spectral-region observing campaign to study the UV/X-ray/optical variability of T Cha. During 2018 February/March we monitored the optical photometric and spectral variability using LCOGT (Chile/South Africa/Australia) and the SMARTS telescopes in Chile. These optical data provide a broad context within which to interpret our shorter UV and X-ray observations. We observed T Cha during 3 coordinated observations (each 5 HST orbits + 25 ksec XMM; on 2018 Feb 22, Feb 26, Mar 2) using the HST COS/STIS spectrographs to measure the FUV/NUV spectra and XMM-Newton to measure the corresponding X-ray energy distribution. The observed spectral changes are well correlated and demonstrate the influence of the same absorbing material in all the spectral regions observed. By examining which spectral features change and by how much we can determine the location of different emitting regions relative to the absorbers along the line-of-sight to the star. In this poster we provide an overview of the variability seen in the different spectral regions and quantify the dust and gas content of T Cha's inner disk edge.(This work is supported by grant HST-GO-15128 and time awarded by HST, XMM-Newton, LCOGT, and SMARTS. We acknowledge the
Barra, F.; Rojas, P.; Reich, M.; Deditius, A.; Simon, A. C.
2017-12-01
Iron oxide-apatite (IOA) or "Kiruna-type" deposits are an important source of Fe, P, REE, among other essential elements for society. Three main hypotheses have been proposed to explain the genesis of these controversial deposits, which invoke liquid immiscibility, hydrothermal replacement or a magmatic-hydrothermal origin driven by flotation of magnetite-bubble pairs. Here we focus on the El Romeral, one of the largest IOA deposits located in the southernmost part of the Cretaceous Chilean Iron Belt. We combined SEM observations and EMPA analyses of magnetite, actinolite, pyrite, and apatite, with micro-Raman determinations of mineral inclusions within magnetite grains. Two textural types of magnetite were identified at El Romeral: (i) inclusion-rich magnetite (Mag I), and (ii) inclusion-poor magnetite (Mag II) that are commonly surrounding the inclusion-rich Mag I grains. Mag I is characterized by high V ( 2500-2800 ppm) and Ti (300-1000 ppm) contents with high-temperature mineral inclusions such as ilmenite, Ti-pargasite and clinochlore at depth, and quartz and phlogopite inclusions in shallower samples. These characteristics are consistent with a magmatic origin for Mag I. Inclusion-poor magnetite (Mag II) have high V (2400-2600 ppm) and lower Ti (70-200 ppm) contents than Mag I, which point to chemical changes of the mineralizing fluid(s). An increase in thermal gradient with depth is evidenced by the presence of high-temperature (low #Fe) actinolite, as well as F-rich apatite and pyrite with high Co:Ni (>1) in the deep zones. In contrast, lower Co:Ni ratios (<0.5) in pyrite and higher Cl contents in OH-rich apatite are detected in samples from shallower levels. This vertical chemical variation supports a magmatic-hydrothermal origin for the El Romeral deposit, and point to compositional changes driven by decompression of a magnetite-fluid suspension.
Functionalization of hydroxyl terminated polybutadiene with ...
Indian Academy of Sciences (India)
Administrator
The hydroxyl terminated polybutadiene (HTPB) used in this work was prepared by free radical polymerization using hydrogen peroxide as initiator and was received from HEMRL Pune, India, as a gift sample. The molecu- lar weight and polydispersity of the HTPB was deter- mined by using gel permeable chromatography ...
DEFF Research Database (Denmark)
Pinholt, E M; Ruyter, I E; Haanaes, H R
1992-01-01
The purpose of this study was to evaluate four commercial apatite products. Subperiosteal alveolar ridge augmentation was performed on the maxilla of rats by implantation of granules of two dense products and of two porous products, and the tissue response was compared with the material character...
Dekker, Robert J.; de Bruijn, Joost Dick; Stigter, Martin; Barrère, F.; Layrolle, Pierre; van Blitterswijk, Clemens
2005-01-01
Poor fixation of bone replacement implants, e.g. the artificial hip, in implantation sites with inferior bone quality and quantity may be overcome by the use of implants coated with a cultured living bone equivalent. In this study, we tested, respectively, amorphous carbonated apatite (CA)- and
The shape of ion tracks in natural apatite
Schauries, D.; Afra, B.; Bierschenk, T.; Lang, M.; Rodriguez, M. D.; Trautmann, C.; Li, W.; Ewing, R. C.; Kluth, P.
2014-05-01
Small angle X-ray scattering measurements were performed on natural apatite of different thickness irradiated with 2.2 GeV Au swift heavy ions. The evolution of the track radius along the full ion track length was estimated by considering the electronic energy loss and the velocity of the ions. The shape of the track is nearly cylindrical, slightly widening with a maximum diameter approximately 30 μm before the ions come to rest, followed by a rapid narrowing towards the end within a cigar-like contour. Measurements of average ion track radii in samples of different thicknesses, i.e. containing different sections of the tracks are in good agreement with the shape estimate.
The shape of ion tracks in natural apatite
International Nuclear Information System (INIS)
Schauries, D.; Afra, B.; Bierschenk, T.; Lang, M.; Rodriguez, M.D.; Trautmann, C.; Li, W.; Ewing, R.C.; Kluth, P.
2014-01-01
Small angle X-ray scattering measurements were performed on natural apatite of different thickness irradiated with 2.2 GeV Au swift heavy ions. The evolution of the track radius along the full ion track length was estimated by considering the electronic energy loss and the velocity of the ions. The shape of the track is nearly cylindrical, slightly widening with a maximum diameter approximately 30 μm before the ions come to rest, followed by a rapid narrowing towards the end within a cigar-like contour. Measurements of average ion track radii in samples of different thicknesses, i.e. containing different sections of the tracks are in good agreement with the shape estimate
Wu, Hang; Wu, Shixiang; Qiu, Nansheng; Chang, Jian; Bao, Rima; Zhang, Xin; Liu, Nian; Liu, Shuai
2018-01-01
Apatite fission-track (AFT) analysis, a widely used low-temperature thermochronology method, can provide details of the hydrocarbon generation history of source rocks for use in hydrocarbon exploration. The AFT method is based on the annealing behavior of fission tracks generated by 238 U fission in apatite particles during geological history. Due to the cumbersome experimental steps and high expense, it is imperative to find an efficient and inexpensive technique to determinate the annealing degree of AFT. In this study, on the basis of the ellipsoid configuration of tracks, the track volume fraction model (TVFM) is established and the fission-track volume index is proposed. Furthermore, terahertz time domain spectroscopy (THz-TDS) is used for the first time to identify the variation of the AFT annealing degree of Durango apatite particles heated at 20, 275, 300, 325, 450, and 500 ℃ for 10 h. The THz absorbance of the sample increases with the degree of annealing. In addition, the THz absorption index is exponentially related to annealing temperature and can be used to characterize the fission-track volume index. Terahertz time domain spectroscopy can be an ancillary technique for AFT thermochronological research. More work is urgently needed to extrapolate experimental data to geological conditions.
Cellular Adaptation: Culture conditions of R. opacus and bioflotation of apatite and quartz
Directory of Open Access Journals (Sweden)
Antonio Gutiérrez Merma
Full Text Available Abstract It is well known that the culture conditions of microorganisms may affect their surface properties, zeta potential and hydrophobicity via the modification of the cell wall functional groups or metabolic products. The R. opacus bacteria strain was separately adapted to the presence of apatite and quartz, after which a cellular adaptation procedure was developed by repeated sub-culturing with a successive increase in the mineral content. Zeta potential, surface tension, FTIR and microflotation studies were used to evaluate the behavior of the cells that were developed under defined culture conditions. The cellular adaptation induced a modification of the bacterial surface charge. The FTIR results showed a modification of its functional groups. The surface tension results suggested that longer growing time promoted a higher production of metabolites. The use of mineral-adapted cells promoted an improvement in the flotability of both minerals, but it was more significant for apatite flotation. Additionally, the mineral flotability remained unchanged when the cells developed under a longer culture time. Nevertheless, there was a reduction in the surface tension.
Hu, Yufei; Zhang, Zhujun; Yang, Chunyan
2008-07-01
Measurement methods for ultrasonic fields are important for reasons of safety. The investigation of an ultrasonic field can be performed by detecting the yield of hydroxyl radicals resulting from ultrasonic cavitations. In this paper, a novel method is introduced for detecting hydroxyl radicals by a chemiluminescence (CL) reaction of luminol-hydrogen peroxide (H2O2)-K5[Cu(HIO6)2](DPC). The yield of hydroxyl radicals is calculated directly by the relative CL intensity according to the corresponding concentration of H2O2. This proposed CL method makes it possible to perform an in-line and real-time assay of hydroxyl radicals in an ultrasonic aqueous solution. With flow injection (FI) technology, this novel CL reaction is sensitive enough to detect ultra trace amounts of H2O2 with a limit of detection (3sigma) of 4.1 x 10(-11) mol L(-1). The influences of ultrasonic output power and ultrasonic treatment time on the yield of hydroxyl radicals by an ultrasound generator were also studied. The results indicate that the amount of hydroxyl radicals increases with the increase of ultrasonic output power (< or = 15 W mL(-1)). There is a linear relationship between the time of ultrasonic treatment and the yield of H2O2. The ultrasonic field of an ultrasonic cleaning baths has been measured by calculating the yield of hydroxyl radicals.
DEFF Research Database (Denmark)
Pedersen, Annette; Nybroe, Ole; Winding, Anne
2009-01-01
How bacterial feeding fauna affects colonization and survival of bacteria in soil is not well understood, which constrains the applicability of bacterial inoculants in agriculture. This study aimed to unravel how food quality of bacteria and bacterial feeders with different feeding habits (the......50090 or one of two biocontrol strains P. fluorescens CHA0 or Pseudomonas sp. DSS73) or combinations of two bacterial strains. DSM50090 is a suitable food bacterium, DSS73 is of intermediate food quality, and CHA0 is inedible to the bacterial feeders. Bacterial and protozoan cell numbers were measured...... predation pressure. Hence, the results suggested that the outcome of competition among bacteria depended on their ability to cope with the prevailing bacterial predator....
Querido, William; Campos, Andrea P C; Martins Ferreira, Erlon H; San Gil, Rosane A S; Rossi, Alexandre M; Farina, Marcos
2014-09-01
We evaluate the effects of strontium ranelate on the composition and crystal structure of the biological bone-like apatite produced in osteoblast cell cultures, a system that gave us the advantage of obtaining mineral samples produced exclusively during treatment. Cells were treated with strontium ranelate at concentrations of 0.05 and 0.5 mM Sr(2+). Mineral substances were isolated and analyzed by using a combination of methods: Fourier transform infrared spectroscopy, solid-state (1)H nuclear magnetic resonance, X-ray diffraction, micro-Raman spectroscopy and energy dispersive X-ray spectroscopy. The minerals produced in all cell cultures were typical bone-like apatites. No changes occurred in the local structural order or crystal size of the minerals. However, we noticed several relevant changes in the mineral produced under 0.5 mM Sr(2+): (1) increase in type-B CO3 (2-) substitutions, which often lead to the creation of vacancies in Ca(2+) and OH(-) sites; (2) incorporation of Sr(2+) by substituting slightly less than 10 % of Ca(2+) in the apatite crystal lattice, resulting in an increase in both lattice parameters a and c; (3) change in the PO4 (3-) environments, possibly because of the expansion of the lattice; (4) the Ca/P ratio of this mineral was reduced, but its (Ca+Sr)/P ratio was the same as that of the control, indicating that its overall cation/P ratio was preserved. Thus, strontium ranelate changes the composition and crystal structure of the biological bone-like apatite produced in osteoblast cell cultures.
Mechanism of aromatic hydroxylation of lidocaine at a Pt electrode under acidic conditions
International Nuclear Information System (INIS)
Gul, Turan; Bischoff, Rainer; Permentier, Hjalmar P.
2017-01-01
Aromatic hydroxylation reactions, which are mainly catalyzed by cytochrome P450 (CYP) enzymes in vivo, are some of the most important reactions of Phase I metabolism, because insertion of a hydroxyl group into a lipophilic drug compound increases its hydrophilicity and prepares it for subsequent Phase II metabolic conjugation reactions as a prerequisite to excretion. Aromatic hydroxylation metabolites of pharmaceuticals may be obtained through various synthetic and enzymatic methods Electrochemical oxidation is an alternative with advantages in terms of mild reaction conditions and less hazardous chemicals. In the present study, we report that aromatic hydroxylation metabolites of lidocaine can be readily obtained electrochemically under aqueous acidic conditions at platinum electrodes. Our results show that the dominant N-dealkylation reaction can be suppressed by decreasing the solution pH below 0.5 resulting in selective 3-hydroxylidocaine, which is an in vivo metabolite of lidocaine. Experiments in 18 O labelled water indicated that water is the primary source of oxygen, while dissolved molecular oxygen contributes to a minor extent to the hydroxylation reaction.
The hydroxyl species and acid sites on diatomite surface: a combined IR and Raman study
Yuan, P.; Wu, D. Q.; He, H. P.; Lin, Z. Y.
2004-04-01
Diffuse reflectance infrared Fourier transform spectroscopy (DRIFT), Raman spectroscopy of adsorbed pyridine molecules (Py-Raman) and in situ Py-IR have been used to investigate the hydroxyl species and acid sites on diatomite surfaces. The Lewis (L) and Brønsted (B) acid sites, and various hydroxyl species, including isolated hydroxyl groups, H-bonded hydroxyl groups and physically adsorbed water, are identified. The L acid sites in diatomite samples are resulted from the clay impurities, and the B acid sites are resulted from some moderate strength H-bonded hydroxyl groups. At room temperature, both of the isolated and H-bonded silanols associate with the physically adsorbed water by hydrogen bond. After calcination treatment, physically adsorbed water will be desorbed from the silanols, and the silanols will condense with the increase of temperature. Generally, the H-bonded silanols condense more easily than the isolated ones. The properties of surface hydroxyl species of diatomaceous silica are more similar to precipitated silica rather than fumed silica.
Phosphorous availability influences the dissolution of apatite by soil fungi
Rosling, A.; Suttle, K. B.; Johansson, E.; van Hees, P. W.; Banfield, J. F.
2007-12-01
We conducted mineral dissolution experiments using fungi isolated from a grassland soil in northern California to determine the response of fungi to different levels of phosphorus availability and to identify pathways of apatite dissolution by fungal exudates. Fluorapatite dissolution experiments were performed either with fungi present or under abiotic conditions using cell-free liquid media conditioned by fungal growth at different phosphorus and calcium availabilities. Among biogeochemically active soil fungal isolates apatite dissolution was either active in response to phosphorus limiting growth conditions or passive as a result of mycelial growth. Zygomycete isolates in the order of Mucorales acidify their growth media substrate in the presence of phosphorus, mainly through production of oxalic acid. Cell-free exudates induced fluorapatite dissolution at a rate of 10 -0.9 ± 0.14 and 10 -1.2 ± 0.22 mmol P/m2/s. The Ascomycete isolate, in the family Trichocomaceae, induced fluorapatite dissolution at a rate of 10 - 1.1 ± 0.05 mmol P/m2/s by lowering the pH of the media under phosphorus-limited conditions, without producing significant amounts of low molecular weight organic acids (LMWOAs). Oxalate strongly etches fluorapatite along channels parallel to [001], forming needle like features, while exudates from Trichocomaceae induced surface rounding. We conclude that while LMWOAs are well-studied weathering agents these does not appear to be produced by fungi in response to phosphorus limiting growth conditions.
Magmatic apatite - a window into melt evolution of the Dalgety pluton.
Pope, M. D.; Tailby, N.; Webster, J. D.
2017-12-01
The Dalgety Pluton is located in the Lachlan Fold Belt in southeastern Australia, and is a coarse grained, peraluminous, S-type, biotite granodiorite. Historically, pluton emplacement has been thought of as cooling from a single, large body of magma over a geologically quick period. Current studies suggest issues with this model and propose a slower, incremental model of emplacement in some settings (Glazner et al., 2004). This work proposes that the emplacement of the Dalgety Pluton occurred in incremental phases demonstrated through halogen, minor, and trace element concentrations in apatites. Apatites from 13 samples collected along a north-south transect of the pluton were analyzed using a 5-spectrometer Cameca SX-100 calibrated for seventeen elements (F, Na, Cl, P, Mg, Al, Si, Ca, S, K, Ti, Mn, Fe, Sr, Ba, La, and Ce) at the American Museum of Natural History. The majority of apatites are fluorapatites, having >50 % F, <15 % Cl, and <25 % OH (calculated from Ketchum et al., 2015). However, the concentrations of the halogens vary throughout the pluton with the highest Cl concentrations near the southern edge. Two of the minor elements, Mn and Fe, also show distinct variation with the lowest concentrations being 0.35 wt% in Mn and 0.25 wt% in Fe and the highest being 1.10 wt% and 0.95 wt%, respectively. Trace elements Ce and La vary as well with their highest concentrations being 0.29 wt% and 0.11 wt% and their lowest for both being below the detection limit of the electron probe. Elemental variation across the pluton is seen in the concentration of minor elements and halogens with a sharp increases at 10,000 meters and again at 21,000 meters from the southern rim of the pluton. Similar shifts in concentration are also seen in the trace elements, however the concentrations decrease at these distances. These wholesale elemental fluctuations in composition are indicative of a dramatic shift in melt composition supporting the hypothesis of multiple melt injection
Chapman, Scott A; St Hill, Catherine A; Little, Meg M; Swanoski, Michael T; Scheiner, Shellina R; Ware, Kenric B; Lutfiyya, M Nawal
2017-02-11
Ischemic stroke is a risk associated with atrial fibrillation (AF) and is estimated to occur five times more often in afflicted patients than in those without AF. Anti-thrombotic therapy is recommended for the prevention of ischemic stroke. Risk stratification tools, such as the CHADS 2 , and more recently the CHA 2 DS 2 -VASc, for predicting stroke in patients with AF have been developed to determine the level of stroke risk and assist clinicians in the selection of antithrombotic therapy. Warfarin, for stroke prevention in AF, is the most commonly prescribed anticoagulant in North America. The purpose of this study was to examine the utility of using the CHADS 2 score levels (low and high) in contrast to the CHA 2 DS 2 -VASc when examining the outcome of warfarin prescriptions for adult patients with AF. The CHA 2 DS 2 -VASc tool was not widely used in 2010, when the data analyzed were collected. It has only been since 2014 that CHA 2 DS 2 -VASc criteria has been recommended to guide anticoagulant treatment in updated AF treatment guidelines. Bivariate and multivariate data analysis strategies were used to analyze 2010 National Ambulatory Care Survey (NAMCS) data. NAMCS is designed to collect data on the use and provision of ambulatory care services nationwide. The study population for this research was US adults with a diagnosis of AF. Warfarin prescription was the dependent variable for this study. The study population was 7,669,844 AF patients. Bivariate analysis revealed that of those AF patients with a high CHADS 2 score, 25.1% had received a warfarin prescription and 18.8 for those with a high CHA 2 DS 2 -VASc score. Logistic regression analysis yielded that patients with AF had higher odds of having a warfarin prescription if they had a high CHADS 2 score, were Caucasian, lived in a zip code where guideline adherence in alignment with risk stratification for stroke prevention. Interprofessional health care teams can provide improved medical management of
Andersen, Søren Due; Gorst-Rasmussen, Anders; Lip, Gregory Y H; Bach, Flemming W; Larsen, Torben Bjerregaard
2015-09-01
The CHA2DS2VASc score and the Essen Stroke Risk Score are respectively used for risk stratification in patients with atrial fibrillation and in patients with cerebrovascular incidents. We aimed to test the ability of the 2 scores to predict stroke recurrence, death, and cardiovascular events (stroke, transient ischemic attack, myocardial infarction, or arterial thromboembolism) in a nationwide Danish cohort study, among patients with incident ischemic stroke and no atrial fibrillation. We conducted a registry-based study in patients with incident ischemic stroke and no atrial fibrillation. Patients were stratified according to the CHA2DS2VASc score and the Essen Stroke Risk Score and were followed up until stroke recurrence or death. We estimated stratified incidence rates and hazard ratios and calculated the cumulative risks. 42 182 patients with incident ischemic stroke with median age 70.1 years were included. The overall 1-year incidence rates of recurrent stroke, death, and cardiovascular events were 3.6%, 10.5%, and 6.7%, respectively. The incidence rates, the hazard ratios, and the cumulative risk of all outcomes increased with increasing risk scores. C-statistics for both risk scores were around 0.55 for 1-year stroke recurrence and cardiovascular events and correspondingly for death around 0.67 for both scores. In this cohort of non-atrial fibrillation patients with incident ischemic stroke, increasing CHA2DS2VASc score and Essen Stroke Risk Score was associated with increasing risk of recurrent stroke, death, and cardiovascular events. Their discriminatory performance was modest and further refinements are required for clinical application. © 2015 American Heart Association, Inc.
Structure and Dynamics of Hydroxyl-Functionalized Protic Ammonium Carboxylate Ionic Liquids.
Thummuru, Dhileep Nagi Reddy; Mallik, Bhabani S
2017-10-26
We performed classical molecular dynamics simulations to investigate the structure and dynamics of protic ionic liquids, 2-hydroxy ethylammonium acetate, ethylammonium hydroxyacetate, and 2-hydroxyethylammonium hydroxyacetate at ambient conditions. Structural properties such as density, radial distribution functions, spatial distribution functions, and structure factors have been calculated. Dynamic properties such as mean square displacements, as well as residence and hydrogen bond dynamics have also been calculated. Hydrogen bond lifetimes and residence times change with the addition of hydroxyl groups. We observe that when a hydroxyl group is present on the cation, dynamics become very slow and it forms a strong hydrogen bond with carboxylate oxygen atoms of the anion. The hydroxyl functionalized ILs show more dynamic diversity than structurally similar ILs.
Atmospheric hydroxyl radical production from electronically excited NO2 and H2O.
Li, Shuping; Matthews, Jamie; Sinha, Amitabha
2008-03-21
Hydroxyl radicals are often called the "detergent" of the atmosphere because they control the atmosphere's capacity to cleanse itself of pollutants. Here, we show that the reaction of electronically excited nitrogen dioxide with water can be an important source of tropospheric hydroxyl radicals. Using measured rate data, along with available solar flux and atmospheric mixing ratios, we demonstrate that the tropospheric hydroxyl contribution from this source can be a substantial fraction (50%) of that from the traditional O(1D) + H2O reaction in the boundary-layer region for high solar zenith angles. Inclusion of this chemistry is expected to affect modeling of urban air quality, where the interactions of sunlight with emitted NOx species, volatile organic compounds, and hydroxyl radicals are central in determining the rate of ozone formation.
Directory of Open Access Journals (Sweden)
Xing YL
2016-07-01
Full Text Available Yunli Xing, Qing Ma, Xiaoying Ma, Cuiying Wang, Dai Zhang, Ying Sun Department of Geriatrics and Gerontology, Beijing Friendship Hospital, Capital Medical University, Beijing, People’s Republic of China Aim: The study aims to compare the ability of CHA2DS2-VASc (defined as congestive heart failure, hypertension, age ≥75 years [two scores], type 2 diabetes mellitus, previous stroke, transient ischemic attack, or thromboembolism [TE] [doubled], vascular disease, age 65–74 years, and sex category and CHADS2 (defined as congestive heart failure, hypertension, age ≥75 years, type 2 diabetes mellitus, previous stroke [doubled] scores to predict the risk of ischemic stroke (IS or TE among patients with nonvalvular atrial fibrillation (NVAF.Methods: A total of 413 patients with NVAF aged ≥65 years, and not on oral anticoagulants for the previous 6 months, were enrolled in the study. The predictive value of the CHA2DS2-VASc and CHADS2 scores for IS/TE events was evaluated by the Kaplan–Meier method.Results: During a follow-up period of 1.99±1.29 years, 104 (25.2% patients died and 59 (14.3% patients developed IS/TE. The CHADS2 score performed better than the CHA2DS2-VASc score in predicting IS/TE as assessed by c-indexes (0.647 vs 0.615, respectively; P<0.05. Non-CHADS2 risk factors, such as vascular disease and female sex, were not found to be predictive of IS/TE (hazard ratio 1.518, 95% CI: 0.832–2.771; hazard ratio 1.067, 95% CI: 0.599–1.899, respectively. No differences in event rates were found in patients with the CHADS2 scores of 1 and 2 (7.1% vs 7.8%. It was observed that patients with a CHADS2 score of ≥3 were most in need of anticoagulation therapy.Conclusion: In patients with NVAF aged ≥65 years, the CHADS2 score was found to be significantly better in predicting IS/TE events when compared to the CHA2DS2-VASc score. Patients with a CHADS2 score of ≥3 were associated with high risk of IS/TE events. Keywords: NVAF
Hydroxyl-dependent Evolution of Oxygen Vacancies Enables the Regeneration of BiOCl photocatalyst
Wu, Sujuan; Xiong, Jiawei; Sun, Jianguo; Hood, Zachary D.; Zeng, Wen; Yang, Zhenzhong; Gu, Lin; Zhang, Xixiang; Yang, Shize
2017-01-01
irradiation in the sample with surface hydroxyl groups, while variable changes were observed in samples without surface hydroxyls. Density functional theory (DFT) calculations reveal that the binding energy of Bi-O is drastically influenced by surficial
SU-F-T-676: Measurement of Hydroxyl Radicals in Radiolized Water Systems
Energy Technology Data Exchange (ETDEWEB)
Ouyang, Z; Ngwa, W [University of Massachusetts Lowell, Lowell, MA (United States); Brigham and Women’s Hospital, Dana-Farber Cancer Institute and Harvard Medical School, Boston, MA (United States); Strack, G; Sajo, E [University of Massachusetts Lowell, Lowell, MA (United States)
2016-06-15
Purpose: Hydroxyl radicals can be produced within tissue by radiation therapy, and they are largely responsible for DNA damage and cell killing. Coumarin-3-carboxylic acid (3-CCA) and crystal violet are reported to react with hydroxyl radicals and can be used for fluorescence and absorbance measurements, respectively. This study assesses the ability of hydroxyl measurement for both 3-CCA and crystal violet in radiolized water systems in order to provide dosimetric information in radiation chemistry and radiation biology experiments. Methods: 3-CCA and crystal violet were both dissolved in phosphate buffered saline (PBS, pH 7.4) with final concentrations 0.5 mg/mL and 0.05 mg/mL. 3-CCA and control solutions (PBS only) were loaded in black bottom 96-well plates. Crystal violet and control solutions were loaded in clear bottom 96-well plates. The prepared solutions were irradiated at 2 Gy using a small animal radiation research platform. Fluorescence reading with 360 nm excitation wavelength and 485 nm emission wavelength was done for 3-CCA, and absorbance reading at wavelength 580 nm was done for crystal violet before and after radiation. Results: 3-CCA showed clear difference in fluorescence before and after radiation, which suggested hydroxyl production during radiation. However, crystal violet absorbance at 580 nm was not changed significantly by radiation. Conclusion: The overall conclusion is that 3-CCA can be used for hydroxyl measurement in radiolized water systems, while crystal violet cannot, although crystal violet is reported widely to react with hydroxyl radicals produced in Fenton reactions. Possible reasons could relate to reaction pH.
National Oceanic and Atmospheric Administration, Department of Commerce — Edgetech 216 chirp data (SEG-Y format) collected for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project, OCE-1130843. Survey area covers...
Proline-hydroxylated hypoxia-inducible factor 1α (HIF-1α upregulation in human tumours.
Directory of Open Access Journals (Sweden)
Cameron E Snell
Full Text Available The stabilisation of HIF-α is central to the transcriptional response of animals to hypoxia, regulating the expression of hundreds of genes including those involved in angiogenesis, metabolism and metastasis. HIF-α is degraded under normoxic conditions by proline hydroxylation, which allows for recognition and ubiquitination by the von-Hippel-Lindau (VHL E3 ligase complex. The aim of our study was to investigate the posttranslational modification of HIF-1α in tumours, to assess whether there are additional mechanisms besides reduced hydroxylation leading to stability. To this end we optimised antibodies against the proline-hydroxylated forms of HIF-1α for use in formalin fixed paraffin embedded (FFPE immunohistochemistry to assess effects in tumour cells in vivo. We found that HIF-1α proline-hydroxylated at both VHL binding sites (Pro402 and Pro564, was present in hypoxic regions of a wide range of tumours, tumour xenografts and in moderately hypoxic cells in vitro. Staining for hydroxylated HIF-1α can identify a subset of breast cancer patients with poorer prognosis and may be a better marker than total HIF-1α levels. The expression of unhydroxylated HIF-1α positively correlates with VHL in breast cancer suggesting that VHL may be rate-limiting for HIF degradation. Our conclusions are that the degradation of proline-hydroxylated HIF-1α may be rate-limited in tumours and therefore provides new insights into mechanisms of HIF upregulation. Persistence of proline-hydroxylated HIF-1α in perinecrotic areas suggests there is adequate oxygen to support prolyl hydroxylase domain (PHD activity and proline-hydroxylated HIF-1α may be the predominant form associated with the poorer prognosis that higher levels of HIF-1α confer.
International Nuclear Information System (INIS)
Arne, D.C.; Duddy, I.R.; Green, P.F.; Lambert, I.B.
1987-01-01
Epigenetic, carbonate-hosted Pb-Zn mineralization of the Mississippi Valley-Type (MVT) is considered to form from warm basinal brines in the temperature range 50-200 deg.C. A variety of genetic fluid flow models have been proposed to explain MVT mineralization, but all suffer from a lack of constraint concerning the timing of ore formation. Fission tracks in apatite resulting from the spontaneous decay of trace amounts of 238 U are thermally unstable over the range of temperatures proposed for MVT ore formation, and may therefore record thermal events related to Pb-Zn mineralization provided sufficient time is allowed for track annealing to occur. Zinc mineralization in Devonian carbonates of the Lennard Shelf, northwest Australia is also considered to be of the Mississippi Valley-type. Mean apatite ages from Precambrian basement and from Devonian carbonates generally average 300Ma. Studies of well sequences indicate a period of uplift for the Lennard Shelf area around the Late Triassic/Early Jurassic. For carbonate outcrop samples, a thermal history is proposed involving burial in the Late Paleozoic/Early Mesozoic followed by uplift and cooling from peak temperatures around 70 deg.C. No difference in apatite annealing effects are observed in the vicinity of zinc mineralization. Coupled with other evidence, this suggests that the mineralizing episode was of short duration given temperatures of ore formation in the range 70-110 deg.C indicated by fluid inclusion homogenization temperatures. 3 refs
CATALYTIC PERFORMANCES OF Fe2O3/TS-1 CATALYST IN PHENOL HYDROXYLATION REACTION
Directory of Open Access Journals (Sweden)
Didik Prasetyoko
2010-07-01
Full Text Available Hydroxylation reaction of phenol into diphenol, such as hydroquinone and catechol, has a great role in many industrial applications. Phenol hydroxylation reaction can be carried out using Titanium Silicalite-1 (TS-1 as catalyst and H2O2 as an oxidant. TS-1 catalyst shows high activity and selectivity for phenol hydroxylation reaction. However, its hydrophobic sites lead to slow H2O2 adsorption toward the active site of TS-1. Consequently, the reaction rate of phenol hydroxylation reaction is tends to be low. Addition of metal oxide Fe2O3 enhanced hydrophilicity of TS-1 catalyst. Liquid phase catalytic phenol hydroxylation using hydrogen peroxide as oxidant was carried out over iron (III oxide-modified TS-1 catalyst (Fe2O3/TS-1, that were prepared by impregnation method using iron (III nitrate as precursor and characterized by X-ray diffraction, infrared spectroscopy, nitrogen adsorption, pyridine adsorption, and hydrophilicity techniques. Catalysts 1Fe2O3/TS-1 showed maximum catalytic activity of hydroquinone product. In this research, the increase of hydroquinone formation rate is due to the higher hydrophilicity of Fe2O3/TS-1 catalysts compare to the parent catalyst, TS-1. Keywords: Fe2O3/TS-1, hydrophilic site, phenol hydroxylation
McDannell, Kalin T.; Zeitler, Peter K.; Janes, Darwin G.; Idleman, Bruce D.; Fayon, Annia K.
2018-02-01
Old slowly-cooled apatites often yield dispersed (U-Th)/He ages for a variety of reasons, some well understood and some not. Analytical protocols like careful grain selection can reduce the impact of this dispersion but add costs in time and resources and too often have proven insufficient. We assess a new analytical protocol that utilizes static-gas measurement during continuous ramped heating (CRH) as a means to rapidly screen apatite samples. In about the time required for a conventional total-gas analysis, this method can discriminate between samples showing expected volume-diffusion behavior and those showing anomalous release patterns inconsistent with their direct use in thermochronologic applications. This method also appears able to discriminate between the radiogenic and extraneous 4He fractions released by a sample, potentially allowing ages to be corrected. Well-behaved examples such as the Durango standard and other apatites with good age reproducibility show the expected smooth, sigmoidal gas-release curves predicted for volume diffusion using typical apatite kinetics, with complete exhaustion by ∼900 °C for linear heating at 20 °C/min. Secondary factors such as U and Th zoning and alpha-loss distribution have a relatively minor impact on such profiles. In contrast, samples having greater age dispersion show significant He release in the form of outgassing spikes and He release deferred to higher temperatures. Screening results for a range of samples permit us to assess the degree to which CRH screening can identify misbehaving grains, give insight into the source of extraneous He, and suggest that in some cases it may be possible to correct ages for the presence of such components.
Stoehr, Andrea; Yang, Yanqin; Patel, Sajni; Evangelista, Alicia M; Aponte, Angel; Wang, Guanghui; Liu, Poching; Boylston, Jennifer; Kloner, Philip H; Lin, Yongshun; Gucek, Marjan; Zhu, Jun; Murphy, Elizabeth
2016-06-01
Protein hydroxylases are oxygen- and α-ketoglutarate-dependent enzymes that catalyse hydroxylation of amino acids such as proline, thus linking oxygen and metabolism to enzymatic activity. Prolyl hydroxylation is a dynamic post-translational modification that regulates protein stability and protein-protein interactions; however, the extent of this modification is largely uncharacterized. The goals of this study are to investigate the biological consequences of prolyl hydroxylation and to identify new targets that undergo prolyl hydroxylation in human cardiomyocytes. We used human induced pluripotent stem cell-derived cardiomyocytes in combination with pulse-chase amino acid labelling and proteomics to analyse the effects of prolyl hydroxylation on protein degradation and synthesis. We identified 167 proteins that exhibit differences in degradation with inhibition of prolyl hydroxylation by dimethyloxalylglycine (DMOG); 164 were stabilized. Proteins involved in RNA splicing such as serine/arginine-rich splicing factor 2 (SRSF2) and splicing factor and proline- and glutamine-rich (SFPQ) were stabilized with DMOG. DMOG also decreased protein translation of cytoskeletal and sarcomeric proteins such as α-cardiac actin. We searched the mass spectrometry data for proline hydroxylation and identified 134 high confidence peptides mapping to 78 unique proteins. We identified SRSF2, SFPQ, α-cardiac actin, and cardiac titin as prolyl hydroxylated. We identified 29 prolyl hydroxylated proteins that showed a significant difference in either protein degradation or synthesis. Additionally, we performed next-generation RNA sequencing and showed that the observed decrease in protein synthesis was not due to changes in mRNA levels. Because RNA splicing factors were prolyl hydroxylated, we investigated splicing ± inhibition of prolyl hydroxylation and detected 369 alternative splicing events, with a preponderance of exon skipping. This study provides the first extensive
Hydroxyl radical induced degradation of salicylates in aerated aqueous solution
International Nuclear Information System (INIS)
Szabó, László; Tóth, Tünde; Homlok, Renáta; Rácz, Gergely; Takács, Erzsébet; Wojnárovits, László
2014-01-01
Ionizing radiation induced degradation of acetylsalicylic acid, its hydrolysis product salicylic acid and a salicylic acid derivative 5-sulpho-salicylic acid, was investigated in dilute aqueous solutions by UV–vis spectrophotometry, HPLC separation and diode-array or MS/MS detection, chemical oxygen demand, total organic carbon content and by Vibrio fischeri toxicity measurements. Hydroxyl radicals were shown to degrade these molecules readily, and first degradation products were hydroxylated derivatives in all cases. Due to the by-products, among them hydrogen peroxide, the toxicity first increased and then decreased with the absorbed dose. With prolonged irradiation complete mineralization was achieved. - Highlights: • In OH induced reactions of salicylates first products are hydroxylated derivatives. • With prolonged irradiation dihydroxy derivatives also form. • In aerated solutions the one-electron oxidant OH induces 3–4 oxidations. • Toxicity first increases and then decreases with dose mainly due to H 2 O 2 formation. • The toxicity in tap water is smaller than in pure water
δ18O of apatite phosphate in small pelagic fish: insights from wild-caught and tank-grown specimens
Lambert, T.; Javor, B.; Paytan, A.
2011-12-01
Oxygen isotope ratios of mineralized structures in fish reflect the temperature and isotopic composition of the water in which they grow. For bulk samples (e.g., whole scales, bones, and otoliths), understanding how this signal is integrated across time and space is critical, especially for organisms exposed to high variability in growth conditions. Here, we assess the response of fish scale δ18O (from apatite phosphate) to experimentally manipulated water conditions. Wild-caught sardines were grown at controlled temperatures (13°C, 17°C, and 21°C) for 11 months. Higher growth temperatures correlated to lower δ18O values, representing a combination of scale apatite deposited before and after the temperature manipulation. Models that account for both biomineral allometry and exposure to varying water properties (e.g., by overlaying migration routes, isoscapes, and temperature maps) have the potential to quantify the varying contributions of minerals grown under different conditions. We use this method to predict δ18O of apatite phosphate for small pelagic fish found in California coastal waters, then compare expected values to those obtained from collected samples. Since phosphate oxygen is relatively resistant to diagenesis, this modern calibration establishes a framework for paleo studies.
Gandolfi, Maria Giovanna; Taddei, Paola; Tinti, Anna; De Stefano Dorigo, Elettra; Rossi, Piermaria Luigi; Prati, Carlo
2010-12-01
The bioactivity of calcium silicate mineral trioxide aggregate (MTA) cements has been attributed to their ability to produce apatite in presence of phosphate-containing fluids. This study evaluated surface morphology and chemical transformations of an experimental accelerated calcium-silicate cement as a function of soaking time in different phosphate-containing solutions. Cement discs were immersed in Dulbecco's phosphate-buffered saline (DPBS) or Hank's balanced salt solution (HBSS) for different times (1-180 days) and analysed by scanning electron microscopy connected with an energy dispersive X-ray analysis (SEM-EDX) and micro-Raman spectroscopy. SEM-EDX revealed Ca and P peaks after 14 days in DPBS. A thin Ca- and P-rich crystalline coating layer was detected after 60 days. A thicker multilayered coating was observed after 180 days. Micro-Raman disclosed the 965-cm(-1) phosphate band at 7 days only on samples stored in DPBS and later the 590- and 435-cm(-1) phosphate bands. After 60-180 days, a layer approximately 200-900 μm thick formed displaying the bands of carbonated apatite (at 1,077, 965, 590, 435 cm(-1)) and calcite (at 1,088, 713, 280 cm(-1)). On HBSS-soaked, only calcite bands were observed until 90 days, and just after 180 days, a thin apatite-calcite layer appeared. Micro-Raman and SEM-EDX demonstrated the mineralization induction capacity of calcium-silicate cements (MTAs and Portland cements) with the formation of apatite after 7 days in DPBS. Longer time is necessary to observe bioactivity when cements are immersed in HBSS.
International Nuclear Information System (INIS)
Chairat, C.
2005-11-01
The motivation for this study is to assess the potential of using apatite structured ceramics as long-lived actinide storage hosts. To assess their ability to resist aqueous corrosion, the dissolution of natural fluoro-apatite and synthetic Nd-britholite (neodymium is a proxy for the trivalent actinides) was studied. Mineral surfaces were characterized using a combined spectrometric, electrokinetic and potentiometric approach and dissolution rates were measured in closed and open system reactors as a function of solution composition. Experimental results suggest apatitic minerals dissolve via distinct step sequence: 1) fluoride release, 2) release of the calcium situated in the M1, and 3) the simultaneous removal of phosphate and calcium II via the breaking of only Ca-O bonds. TST based rate equations based in this mechanism accurately describe fluoro-apatite and synthetic britholite dissolution rates as a function of solution composition. Nd release rates are limited by precipitation of Nd-rhabdophane. (author)
Energy Technology Data Exchange (ETDEWEB)
Mousa, Hamouda M. [Department of Bionanosystem Engineering, Chonbuk National University, Jeonju, Jeonbuk 561-756 (Korea, Republic of); Department of Engineering Materials and Mechanical Design, Faculty of Engineering, South Valley University, Qena 83523 (Egypt); Lee, Do Hee [Department of Bionanosystem Engineering, Chonbuk National University, Jeonju, Jeonbuk 561-756 (Korea, Republic of); Park, Chan Hee, E-mail: biochan@jbnu.ac.kr [Department of Bionanosystem Engineering, Chonbuk National University, Jeonju, Jeonbuk 561-756 (Korea, Republic of); Division of Mechanical Design Engineering, Chonbuk National University, Jeonju, Jeonbuk 561-756 (Korea, Republic of); Kim, Cheol Sang, E-mail: chskim@jbnu.ac.kr [Department of Bionanosystem Engineering, Chonbuk National University, Jeonju, Jeonbuk 561-756 (Korea, Republic of); Division of Mechanical Design Engineering, Chonbuk National University, Jeonju, Jeonbuk 561-756 (Korea, Republic of)
2015-10-01
Graphical abstract: - Highlights: • Anodizing process was used for the surface modification of AZ31B magnesium alloy. • An appetite-like film was deposited on the surface of AZ31B magnesium alloy. • Ceramic film was investigated by XRD and XPS. • Nano-plates growth are observed though the implemented experimental design. • Significant increase in the substrate hardness and surface roughness was observed. - Abstract: In this study, for the first time, the degradation performance of AZ31B Mg alloy was tuned by an in situ deposition of apatite thin layer within a short time in one step. Using Taguchi method for experimental design, anodization process was designed under control conditions (time and voltage), and simulated body fluid (SBF) was used as the electrolyte to nucleate apatite-like compounds. The coated alloy was characterized through field emission scanning electron microscopy (FE-SEM), EDS, X-ray diffraction and XPS analysis. The results show that the applied voltage has a significant effect on the formation of apatite-like layers. Compared to the uncoated samples, microhardness and surface roughness of the coated samples showed remarkably different values. The potentiodynamic polarization results demonstrate that the polarization resistance of the anodized samples is higher than the substrate polarization resistance, thus improving the alloy corrosion resistant. Based on the experimental results, the proposed nanostructure apatite-like coating can offer a promising way to improve the biocompatibility and degradability properties of the Mg alloy for bone tissue regeneration.
Plachokova, A.S.; Dolder, J. van den; Stoelinga, P.J.W.; Jansen, J.A.
2007-01-01
OBJECTIVE: The early effect of platelet-rich plasma (PRP) on bone regeneration in combination with dense biphasic hydroxyl apatite (HA)/beta-tricalcium phosphate (TCP) particles (ratio 60%/40%) was evaluated in rat cranial defects with a diameter of 6.2 mm. We hypothesize that PRP exerts its
Rate constant for reaction of hydroxyl radicals with bicarbonate ions
International Nuclear Information System (INIS)
Buxton, G.V.; Elliot, A.J.
1986-01-01
The rate constant for reaction of hydroxyl radicals with the bicarbonate ion has been determined to be 8.5 x 10 6 dm 3 mol -1 s -1 . This value was calculated from: the measured rate of formation of the CO 3 - radical in pulsed electron irradiation of bicarbonate solutions over the pH range 7.0 to 9.4; the pK for the equilibrium HCO 3 - = CO 3 2- + H + ; and the rate constant for hydroxyl radicals reacting with the carbonate ion. (author)
11 µ-Hydroxylation of cortexolone using immobilized ...
African Journals Online (AJOL)
Transformation of cortexolone to cortisol and prednisolone by the filamentous fungus Cunninghamella elegans protoplasts as a research tool was studied. The immobilized protoplasts of the fungus hydroxylated cortexolone at 11β -position had significantly higher activity than the free protoplasts. Sucrose as an osmotic ...
Regioselective hydroxylation of isoflavones by Streptomyces avermitilis MA-4680.
Roh, Changhyun; Seo, Su-Hyun; Choi, Kwon-Young; Cha, Minho; Pandey, Bishnu Prasad; Kim, June-Hyung; Park, Jun-Seong; Kim, Duck Hee; Chang, Ih Seop; Kim, Byung-Gee
2009-07-01
Screening of bacterial whole cells was performed for regioselective hydroxylation of daidzein and genistein. Among the strains examined, Streptomyces avermitilis MA-4680 showed high ortho-dihydroxylation activity to produce 3',4',7-trihydroxyisoflavone and 3',4',5,7-tetrahydroxyisoflavone from daidzein (4',7-dihydroxyisoflavone) and genistein (4',5,7-trihydroxyisoflavone), respectively. Using 100 mg cells (wet wt.) and 1% (v/v) Triton X100 in 1 ml of total reaction volume, where 100 microl of the substrate solution (0.5 mM in 10% (v/v) mixed solvent of DMSO:MeOH = 3:7) was added to 900 microl of potassium phosphate buffer (100 mM, pH 7.2), a 16% molar conversion yield of 3',4',7-trihydroxyisoflavone was obtained from 0.5 mM daidzein after 24 h of reaction time at 28 degrees C and 200 rpm. Ketoconazole significantly (ca. 90%) inhibited the ortho-hydroxylation activity of daidzein, suggesting that cytochrome P450 enzymes putatively play roles in regiospecific daidzein hydroxylation. The analysis of the reaction products was determined by gas chromatography/mass spectrometry (GC/MS) and (1)H NMR.
Monkey liver cytochrome P450 2C19 is involved in R- and S-warfarin 7-hydroxylation.
Hosoi, Yoshio; Uno, Yasuhiro; Murayama, Norie; Fujino, Hideki; Shukuya, Mitsunori; Iwasaki, Kazuhide; Shimizu, Makiko; Utoh, Masahiro; Yamazaki, Hiroshi
2012-12-15
Cynomolgus monkeys are widely used as primate models in preclinical studies. However, some differences are occasionally seen between monkeys and humans in the activities of cytochrome P450 enzymes. R- and S-warfarin are model substrates for stereoselective oxidation in humans. In this current research, the activities of monkey liver microsomes and 14 recombinantly expressed monkey cytochrome P450 enzymes were analyzed with respect to R- and S-warfarin 6- and 7-hydroxylation. Monkey liver microsomes efficiently mediated both R- and S-warfarin 7-hydroxylation, in contrast to human liver microsomes, which preferentially catalyzed S-warfarin 7-hydroxylation. R-Warfarin 7-hydroxylation activities in monkey liver microsomes were not inhibited by α-naphthoflavone or ketoconazole, and were roughly correlated with P450 2C19 levels and flurbiprofen 4-hydroxylation activities in microsomes from 20 monkey livers. In contrast, S-warfarin 7-hydroxylation activities were not correlated with the four marker drug oxidation activities used. Among the 14 recombinantly expressed monkey P450 enzymes tested, P450 2C19 had the highest activities for R- and S-warfarin 7-hydroxylations. Monkey P450 3A4 and 3A5 slowly mediated R- and S-warfarin 6-hydroxylations. Kinetic analysis revealed that monkey P450 2C19 had high V(max) and low K(m) values for R-warfarin 7-hydroxylation, comparable to those for monkey liver microsomes. Monkey P450 2C19 also mediated S-warfarin 7-hydroxylation with V(max) and V(max)/K(m) values comparable to those for recombinant human P450 2C9. R-warfarin could dock favorably into monkey P450 2C19 modeled. These results collectively suggest high activities for monkey liver P450 2C19 toward R- and S-warfarin 6- and 7-hydroxylation in contrast to the saturation kinetics of human P450 2C9-mediated S-warfarin 7-hydroxylation. Copyright © 2012 Elsevier Inc. All rights reserved.
Apatite/Melt Partitioning Experiments Reveal Redox Sensitivity to Cr, V, Mn, Ni, Eu, W, Th, and U
Righter, K.; Yang, S.; Humayun, M.
2016-01-01
Apatite is a common mineral in terrestrial, planetary, and asteroidal materials. It is commonly used for geochronology (U-Pb), sensing volatiles (H, F, Cl, S), and can concentrate rare earth elements (REE) during magmatic fractionation and in general. Some recent studies have shown that some kinds of phosphate may fractionate Hf and W and that Mn may be redox sensitive. Experimental studies have focused on REE and other lithophile elements and at simplified or not specified oxygen fugacities. There is a dearth of partitioning data for chalcophile, siderophile and other elements between apatite and melt. Here we carry out several experiments at variable fO2 to study the partitioning of a broad range of trace elements. We compare to existing data and then focus on several elements that exhibit redox dependent partitioning behavior.
National Oceanic and Atmospheric Administration, Department of Commerce — Edgetech 216 chirp data (SEG-Y format) collected for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project, OCE-1130843. Survey area covers...
National Oceanic and Atmospheric Administration, Department of Commerce — Edgetech 216 chirp data (SEG-Y format) collected for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project, OCE-1130843. Survey area covers...
DEFF Research Database (Denmark)
Svendsen, Jesper Hastrup; Nielsen, Jens Cosedis; Darkner, Stine
2013-01-01
The risk of stroke in patients with atrial fibrillation (AF) can be assessed by use of the CHADS2 and the CHA2DS2-VASc score system. We hypothesised that these risk scores and their individual components could also be applied to patients paced for sick sinus syndrome (SSS) to evaluate risk of str...
Synthesis of hydroxyl liquid polybutadiene by photochemical decomposition of hydrogen peroxide
International Nuclear Information System (INIS)
Moutinho, Marcus Tadeu Moura
1995-01-01
The synthesis of hydroxyl terminated polybutadienes (HTPB) by photochemical decomposition (λ=254 nm) of hydrogen peroxide (H 2 O 2 ) in alcoholic medium was studied. The influence of reaction time, H 2 O 2 and alcohol concentrations, type of alcohol and radiation intensity on the polymerization rate was determined. Higher polymerization rates were attained when t-butyl alcohol was used as the compatibilizing agent (19% conversion after 8 hours). The HTPBs were characterized by hydroxyl content (acetylation), functionality, IR microstructure and types of hydroxyl groups ( 1 H-NMR and 13 C-NMR), 2-vinyl cyclohexene (VCH) content and viscosity. The polymers showed molecular weights (Mn) in the range of 458 to 1,099, molecular weight distribution (Mw/Mn) in the range of 1.20 to 1.46 and functionality between 1.2 and 3.2 depending on the alcohol used. NMR results 1 H and 13 C) revealed low cis content for the polybutadienes and identified primary and secondary hydroxyl groups, depending on the alcohol employed as compatibilizing agent. The incorporation of alcohol in polymer chain ends was evidenced. The produced HTPBs presented viscosities in the range of 850 to 1,250 cP (at 25 deg C) and were VCH free. (author)
Mechanism of aromatic hydroxylation of lidocaine at a Pt electrode under acidic conditions
Gul, Turan; Bischoff, Rainer; Permentier, Hjalmar P.
2017-01-01
Aromatic hydroxylation reactions, which are mainly catalyzed by cytochrome P450 (CYP) enzymes in vivo, are some of the most important reactions of Phase I metabolism, because insertion of a hydroxyl group into a lipophilic drug compound increases its hydrophilicity and prepares it for subsequent
Study of hydroxylation of benzene and toluene using a micro-DBD plasma reactor
International Nuclear Information System (INIS)
Sekiguchi, H; Ando, M; Kojima, H
2005-01-01
The hydroxylation behaviour of benzene and toluene were studied using a micro-plasma reactor, where an atmospheric non-thermal plasma was generated by a dielectric barrier discharge (DBD). The results indicated that oxidation products primarily consisted of phenol and C 4 -compounds for benzene hydroxylation, whereas cresol, benzaldehyde, benzylalcohol and C 4 -compounds were detected for toluene hydroxylation. By taking into consideration the reaction mechanism in the plasma reactor, these products were classified into (1) oxidation of the aromatic ring and functional group on the ring and (2) cleavage of the aromatic ring or dissociation of the functional group on the ring
Atomistic modelling study of lanthanide incorporation in the crystal lattice of an apatite
International Nuclear Information System (INIS)
Louis-Achille, V.
1999-01-01
Studies of natural and synthetic apatites allow to propose such crystals as matrix for nuclear waste storage. The neodymium substituted britholite, Ca 9 Nd(PO 4 ) 5 (SiO 4 )F 2 . is a model for the trivalent actinide storage Neodymium can be substituted in two types of sites. The aim of this thesis is to compare the chemical nature of this two sites in fluoro-apatite Ca 9 (PO 4 ) 6 F 2 and then in britholite, using ab initio atomistic modeling. Two approaches are used: one considers the infinite crystals and the second considers clusters. The calculations of the electronic structure for both were performed using Kohn and Sham density functional theory in the local approximation. For solids, pseudopotentials were used, and wave functions are expanded in plane waves. For clusters, a frozen core approximation was used, and the wave functions are expanded in a linear combination of Slater type atomic orbitals. The pseudopotential is semi-relativistic for neodymium, and the Hamiltonian is scalar relativistic for the clusters. The validation of the solid approach is performed using two test cases: YPO 4 and ScPO 4 . Two numerical tools were developed to compute electronic deformation density map, and calculate partial density of stases. A full optimisation of the lattice parameters with a relaxation of the atomic coordinates leads to correct structural and thermodynamic properties for the fluoro-apatite, compared to experience. The electronic deformation density maps do not show any significant differences. between the two calcium sites. but Mulliken analysis on the solid and on the clusters point out the more ionic behavior of the calcium in site 2. A neodymium substituted britholite is then studied. Neodymium location only induces local modifications in; the crystalline structure and few changes in the formation enthalpy. The electronic study points out an increase of the covalent character the bonding involving neodymium compared with the one related to calcium
Hydroxylation of the Herbicide Isoproturon by Fungi Isolated from Agricultural Soil
Rønhede, Stig; Jensen, Bo; Rosendahl, Søren; Kragelund, Birthe B.; Juhler, René K.; Aamand, Jens
2005-01-01
Several asco-, basidio-, and zygomycetes isolated from an agricultural field were shown to be able to hydroxylate the phenylurea herbicide isoproturon [N-(4-isopropylphenyl)-N′,N′-dimethylurea] to N-(4-(2-hydroxy-1-methylethyl)phenyl)-N′,N′-dimethylurea and N-(4-(1-hydroxy-1-methylethyl)phenyl)-N′,N′-dimethylurea. Bacterial metabolism of isoproturon has previously been shown to proceed by an initial demethylation to N-(4-isopropylphenyl)-N′-methylurea. In soils, however, hydroxylated metaboli...
Hydroxyl-radical induced dechlorination of pentachlorophenol in water
International Nuclear Information System (INIS)
He Yongke; Wu Jilan; Fang Xingwang; Sonntag, C. von
1998-01-01
The hydroxyl-radical induced dechlorination of pentachlorophenol (PCP) in water has been investigated pulse radiolytically. Hydroxyl radicals react with PCP by both electron transfer and addition. The former process results in pentachlorophenoxyl radicals (PCP-O), the latter process followed by rapid HCl elimination gives birth to deprotonated hydroxytetrachlorophenoxyl radicals ( - O-TCP-O). These phenoxyl radicals exhibit maximum absorption around 452 nm, which hinders the proper estimation of the ratio of the two processes. However, these two processes cause different changes in conductivity. In basic solution, the electron transfer causes a conductivity increase due to the formation of OH - whereas an addition followed by HCl elimination results in a conductivity decrease. The concurrence of these two processes reduces the relative variation in conductivity, from which about 53% electron transfer is deduced
In situ Sr/Sr investigation of igneous apatites and carbonates using laser-ablation MC-ICP-MS
DEFF Research Database (Denmark)
Bizzarro, Martin; Simonetti, A.; Stevenson, R.K.
2003-01-01
In situ Sr isotopic compositions of coexisting apatite and carbonate for carbonatites from the Sarfartoq alkaline complex, Greenland, have been determined by laser-ablation multicollector inductively coupled plasma mass spectrometry. This study is the first to examine the extent of Sr isotopic ho...
International Nuclear Information System (INIS)
Mochizuki, Chihiro; Hara, Hiroki; Oya, Kei; Aoki, Shun; Hayakawa, Tohru; Fujie, Hiromichi; Sato, Mitsunobu
2014-01-01
Four carbonated apatite films having average thicknesses of 1.3–0.11 μm, proportions of network sizes above 10 μm of 41–68%, and average border heights of the characteristic network structure of 0.98–0.29 μm were fabricated on a titanium plate by aqueous spray coating. These carbonated apatite films after heat treatment showed good mineralization ability in Hanks' balanced salt solution. Assessment of initial cell attachment and calcination on these films and on the Ti plate using osteoblastic MC3T3-E1 indicated that the carbonated apatite film heat treated at 600 °C, whose film thickness, proportion of network sizes above 10 μm, and border height were 0.11 μm, 61%, and 0.31 μm, respectively, was most preferred by osteoblastic cells. Field emission scanning electron microscopic observation of the cells attached to the films showed that the wide network and low border height of the network structure on the carbonated apatite film play an important role in the development of the filopodia of the osteoblastic cells. - Highlights: • Osteoblastic MC3T3-E1 behaviors on aqueous spray coating-derived carbonated apatite (CA) films • The network size of CA films is important. • CA films having a low network border height are better for cell proliferation
Energy Technology Data Exchange (ETDEWEB)
Mochizuki, Chihiro; Hara, Hiroki [Division of Liberal Arts, Kogakuin University, 2665-1 Nakano, Hachioji, Tokyo 192-0015 (Japan); Oya, Kei [Research Institute for Science and Technology, Kogakuin University, 2665-1 Nakano, Hachioji, Tokyo 192-0015 (Japan); School of Engineering, Tokai University, 4-1-1 Kitakanane, Hiratsuka, Kanagawa 259-1292 (Japan); Aoki, Shun [Faculty of System Design, Tokyo Metropolitan University, 6-6 Asahigaoka, Hino, Tokyo 191-0065 (Japan); Hayakawa, Tohru [Department of Dental Engineering, Tsurumi University School of Dental Medicine, 2-1-3 Tsurumi, Yokohama City, Kanagawa 230-8501 (Japan); Fujie, Hiromichi [Faculty of System Design, Tokyo Metropolitan University, 6-6 Asahigaoka, Hino, Tokyo 191-0065 (Japan); Sato, Mitsunobu, E-mail: lccsato@cc.kogakuin.ac.jp [Division of Liberal Arts, Kogakuin University, 2665-1 Nakano, Hachioji, Tokyo 192-0015 (Japan)
2014-06-01
Four carbonated apatite films having average thicknesses of 1.3–0.11 μm, proportions of network sizes above 10 μm of 41–68%, and average border heights of the characteristic network structure of 0.98–0.29 μm were fabricated on a titanium plate by aqueous spray coating. These carbonated apatite films after heat treatment showed good mineralization ability in Hanks' balanced salt solution. Assessment of initial cell attachment and calcination on these films and on the Ti plate using osteoblastic MC3T3-E1 indicated that the carbonated apatite film heat treated at 600 °C, whose film thickness, proportion of network sizes above 10 μm, and border height were 0.11 μm, 61%, and 0.31 μm, respectively, was most preferred by osteoblastic cells. Field emission scanning electron microscopic observation of the cells attached to the films showed that the wide network and low border height of the network structure on the carbonated apatite film play an important role in the development of the filopodia of the osteoblastic cells. - Highlights: • Osteoblastic MC3T3-E1 behaviors on aqueous spray coating-derived carbonated apatite (CA) films • The network size of CA films is important. • CA films having a low network border height are better for cell proliferation.
Kozlik, Michael; Gerdes, Axel; Raith, Johann G.
2016-02-01
The in-situ Sr isotopic systematics of scheelite and apatite from the Felbertal W deposit and a few regional Variscan orthogneisses ("Zentralgneise") have been determined by LA-MC-ICP-MS. The 87Sr/86Sr ratios of scheelite and apatite from the deposit are highly radiogenic and remarkably scattering. In the early magmatic-hydrothermal scheelite generations (Scheelite 1 and 2) the 87Sr/86Sr ratios range from 0.72078 to 0.76417 and from 0.70724 to 0.76832, respectively. Metamorphic Scheelite 3, formed by recrystallisation and local mobilisation of older scheelite, is characterised by even higher 87Sr/86Sr values between 0.74331 and 0.80689. Statistics allows discriminating the three scheelite generations although there is considerable overlap between Scheelite 1 and 2; they could be mixtures of the same isotopic reservoirs. The heterogeneous and scattering 87Sr/86Sr ratios of the two primary scheelite generations suggest modification of the Sr isotope system due to fluid-rock interaction and isotopic disequilibrium. Incongruent release of 87Sr from micas in the Early Palaeozoic host rocks of the Habach Complex contributed to the solute budget of the hydrothermal fluids and may explain the radiogenic Sr isotope signature of scheelite. Spatially resolved analyses revealed isotopic disequilibrium even on a sub-mm scale within zoned Scheelite 2 crystals indicating scheelite growth in an isotopic dynamical hydrothermal system. Zoned apatite from the W mineralised Early Carboniferous K1-K3 orthogneiss in the western ore field yielded 87Sr/86Sr of 0.72044-0.74514 for the cores and 0.74535-0.77937 for the rims. Values of magmatic apatite cores from the K1-K3 orthogneiss are comparable to those of primary Scheelite 1; they are too radiogenic to be magmatic. The Sr isotopic composition of apatite cores was therefore equally modified during the hydrothermal mineralisation processes, therefore supporting the single-stage genetic model in which W mineralisation is associated with
Jess, S.; Stephenson, R.; Brown, R. W.
2017-12-01
The elevated continental margins of the North Atlantic continue to be a focus of considerable geological and geomorphological debate, as the timing of major tectonic events and the age of topographic relief remain controversial. The West Greenland margin, on the eastern flank of Baffin Bay, is believed by some authors to have experienced tectonic rejuvenation and uplift during the Neogene. However, the opposing flank, Baffin Island, is considered to have experienced a protracted erosional regime with little tectonic activity since the Cretaceous. This work examines the thermal evolution of the Cumberland Peninsula, SE Baffin Island, using published apatite fission track (AFT) data with the addition of 103 apatite (U-Th)/He (AHe) ages. This expansion of available thermochronological data introduces a higher resolution of thermal modelling, whilst the application of the newly developed `Broken Crystals' technique provides a greater number of thermal constraints for an area dominated by AHe age dispersion. Results of joint thermal modelling of the AFT and AHe data exhibit two significant periods of cooling across the Cumberland Peninsula: Devonian/Carboniferous to the Triassic and Late Cretaceous to present. The earliest phase of cooling is interpreted as the result of major fluvial systems present throughout the Paleozoic that flowed across the Canadian Shield to basins in the north and south. The later stage of cooling is believed to result from rift controlled fluvial systems that flowed into Baffin Bay during the Mesozoic and Cenozoic during the early stages and culmination of rifting along the Labrador-Baffin margins. Glaciation in the Late Cenozoic has likely overprinted these later river systems creating a complex fjordal distribution that has shaped the modern elevated topography. This work demonstrates how surface processes, and not tectonism, can explain the formation of elevated continental margins and that recent methodological developments in the field of
Biomineral processing of high apatite containing low-grade indian uranium ore
International Nuclear Information System (INIS)
Abhilash; Mehta, K.D.; Pandey, B.D.; Ray, L.; Tamrakar, P.K.
2010-01-01
Microbial species isolated from source mine water, primarily an enriched culture of Acidithiobacillus ferrooxidans was employed for bio-leaching of uranium from a low-grade apatite rich uranium ore of Narwapahar Mines, India while varying pH, pulp density (PD), particle size, etc. The ore (0.047% U_3O_8), though of Singhbhum area (richest deposit of uranium ores in India), due to presence of some refractory minerals and high apatite (5%) causes a maximum 78% recovery through conventional processing. Bioleaching experiments were carried out by varying pH at 35"oC using 20%(w/v) PD and <76μm size particles resulting in 83.5% and 78% uranium bio-recovery at 1.7 and 2.0 pH in 40 days as against maximum recovery of 46% and 41% metal in control experiments respectively. Finer size (<45μm) ore fractions exhibited higher uranium dissolution (96%) in 40 days at 10% (w/v) pulp density (PD), 1.7 pH and 35"oC. On increasing the pulp density from 10% to 20% under the same conditions, the biorecovery of uranium fell down from 96% to 82%. The higher uranium dissolution during bioleaching at 1.7 pH with the fine size particles (<45μm) can be correlated with increase in redox potential from 598 mV to 708 mV and the corresponding variation of Fe(III) ion concentration in 40 days. (author)
Development of nanosized silver-substituted apatite for biomedical applications: A review.
Lim, Poon Nian; Chang, Lei; Thian, Eng San
2015-08-01
The favorable biocompatibility of hydroxyapatite (HA) makes it a popular bone graft material as well as a coating layer on metallic implant. To reduce implant-related infections, silver ions were either incorporated into the apatite during co-precipitation process (AgHA-CP) or underwent ion-exchange with the calcium ions in the apatite (AgHA-IE). However, the distribution of silver ions in AgHA-CP and AgHA-IE was different, thus affecting the antibacterial action. Several studies reported that nanosized AgHA-CP containing 0.5 wt.% of silver provided an optimal trade-off between antibacterial properties and cytotoxicity. Nevertheless, nanosized AgHA and AgHA nanocoatings could not function ideally due to the compromise in the bone differentiation of mesenchymal stem cells, as evidenced in the reduced alkaline phosphatase, type I collagen and osteocalcin. Preliminary studies showed that biological responses of nanosized AgHA and AgHA nanocoatings could be improved with the addition of silicon. This review will discuss on nanosized AgHA and AgHA nanocoatings. In many patients needing bone graft material, hydroxyapatite (HA) has proven to be a popular choice. Nonetheless, implant-related infections remain a major concern. Hence, effective preventive measures are needed. In this review article, the authors discussed the application of incorporating silver nanoparticles in HA and its use as bone graft biomaterials together with the addition of silica. Copyright © 2015 Elsevier Inc. All rights reserved.
Mg substituted apatite coating from alkali conversion of acidic calcium phosphate
Energy Technology Data Exchange (ETDEWEB)
Navarro da Rocha, Daniel, E-mail: dnr.navarro@gmail.com [Military Institute of Engineering-IME, Pça. Gen. Tiburcio, 80, P. Vermelha, Urca, Rio de Janeiro, R.J. (Brazil); Cruz, Leila Rosa de Oliveira [Military Institute of Engineering-IME, Pça. Gen. Tiburcio, 80, P. Vermelha, Urca, Rio de Janeiro, R.J. (Brazil); Campos, José Brant de [Rio de Janeiro State University - UERJ, Rio de Janeiro, R.J. (Brazil); Marçal, Rubens L. Santana Blazutti [Military Institute of Engineering-IME, Pça. Gen. Tiburcio, 80, P. Vermelha, Urca, Rio de Janeiro, R.J. (Brazil); Mijares, Dindo Q.; Coelho, Paulo G. [Department of Biomaterials and Biomimetics, New York University College of Dentistry (NYU), New York, NY (United States); Prado da Silva, Marcelo H. [Military Institute of Engineering-IME, Pça. Gen. Tiburcio, 80, P. Vermelha, Urca, Rio de Janeiro, R.J. (Brazil)
2017-01-01
In this work, two solutions were developed: the first, rich in Ca{sup 2+}, PO{sub 4}{sup 3−} ions and the second, rich in Ca{sup 2+}, PO{sub 4}{sup 3−} and Mg{sup 2+}, defined as Mg-modified precursor solution. For each Mg-modified precursor solution, the concentrations of Mg{sup 2+} ions were progressively increased by 5%, 10% and 15%wt. The aims of this research were to investigate the influence of magnesium ions substitution in calcium phosphate coatings on titanium surface and to evaluate these coatings by bioactivity assay in McCoy culture medium. The obtained coatings were characterized by X-ray diffraction (XRD) and Fourier transform infrared spectroscopy (FTIR) analysis, and the presence of Mg ions was confirmed by the inductively coupled plasma atomic emission spectroscopy (ICP) analysis. In vitro bioactivity assay in McCoy culture medium showed bioactivity after 14 days in incubation for the HA and 10% Mg-monetite coatings. The high chemical stability of Mg-HA coatings was verified by the bioactivity assays, and no bone-like apatite deposition, characteristic of bioactivity, was observed for Mg-HA coatings, for the time period used in this study. - Highlights: • The presence of Mg ions influenced the final apatite phase present in the produced coatings. • A lower efficiency in heterogeneous deposition and an exposure of Ti substrate in 5% Mg-monetite coatings was soon verified. • McCoy culture medium was effective in predicting the coatings bioactivity.
Biomineral processing of high apatite containing low-grade indian uranium ore
Energy Technology Data Exchange (ETDEWEB)
Abhilash; Mehta, K.D.; Pandey, B.D., E-mail: biometnml@gmail.com [National Metallurgical Laboratory (CSIR), Jamshedpur (India); Ray, L. [Jadavpur Univ., FTBE Dept., Kolkata (India); Tamrakar, P.K. [Uranium Corp. of India Limited, CR& D Dept., Jaduguda (India)
2010-07-01
Microbial species isolated from source mine water, primarily an enriched culture of Acidithiobacillus ferrooxidans was employed for bio-leaching of uranium from a low-grade apatite rich uranium ore of Narwapahar Mines, India while varying pH, pulp density (PD), particle size, etc. The ore (0.047% U{sub 3}O{sub 8}), though of Singhbhum area (richest deposit of uranium ores in India), due to presence of some refractory minerals and high apatite (5%) causes a maximum 78% recovery through conventional processing. Bioleaching experiments were carried out by varying pH at 35{sup o}C using 20%(w/v) PD and <76μm size particles resulting in 83.5% and 78% uranium bio-recovery at 1.7 and 2.0 pH in 40 days as against maximum recovery of 46% and 41% metal in control experiments respectively. Finer size (<45μm) ore fractions exhibited higher uranium dissolution (96%) in 40 days at 10% (w/v) pulp density (PD), 1.7 pH and 35{sup o}C. On increasing the pulp density from 10% to 20% under the same conditions, the biorecovery of uranium fell down from 96% to 82%. The higher uranium dissolution during bioleaching at 1.7 pH with the fine size particles (<45μm) can be correlated with increase in redox potential from 598 mV to 708 mV and the corresponding variation of Fe(III) ion concentration in 40 days. (author)
Matsugaki, Aira; Aramoto, Gento; Ninomiya, Takafumi; Sawada, Hiroshi; Hata, Satoshi; Nakano, Takayoshi
2015-01-01
Morphological and directional alteration of cells is essential for structurally appropriate construction of tissues and organs. In particular, osteoblast alignment is crucial for the realization of anisotropic bone tissue microstructure. In this article, the orientation of a collagen/apatite extracellular matrix (ECM) was established by controlling osteoblast alignment using a surface geometry with nanometer-sized periodicity induced by laser ablation. Laser irradiation induced self-organized periodic structures (laser-induced periodic surface structures; LIPSS) with a spatial period equal to the wavelength of the incident laser on the surface of biomedical alloys of Ti-6Al-4V and Co-Cr-Mo. Osteoblast orientation was successfully induced parallel to the grating structure. Notably, both the fibrous orientation of the secreted collagen matrix and the c-axis of the produced apatite crystals were orientated orthogonal to the cell direction. To the best of our knowledge, this is the first report demonstrating that bone tissue anisotropy is controllable, including the characteristic organization of a collagen/apatite composite orthogonal to the osteoblast orientation, by controlling the cell alignment using periodic surface geometry. Copyright © 2014 Elsevier Ltd. All rights reserved.
On the spatial coincidence of hydroxyl and methanol masers
Hartquist, T. W.; Menten, K. M.; Lepp, S.; Dalgarno, A.
1995-01-01
We argue that purely gas-phase chemical models for the production of OH in hydroxyl masers around ultracompact H II regions such as W3(OH) cannot account for the CH_3OH in the methanol masers that are found to coincide with the hydroxyl masers in these sources. We suggest that the CH_3OH in the masers is injected into the gas phase by evaporation of the grain mantles, the grains being heated by the passage of weak shocks. Gas evaporation also injects H_2O into the gas. Photodissociation of H_2O, CH_3OH and OH occur at similar rates, and substantial abundances of CH_3OH and OH coexist.
Directory of Open Access Journals (Sweden)
Sultana Mehbuba Hossain
2018-03-01
Full Text Available Biodegradable inorganic apatite-based particle complex is popular for its pH-sensitivity at the endosomal acidic environment to facilitate drug release following cellular uptake. Despite being a powerful anticancer drug, doxorubicin shows severe off-target effects and therefore would need a carrier for the highest effectiveness. We aimed to chemically modify carbonate apatite (CA with Krebs cycle intermediates, such as citrate and succinate in order to control the growth of the resultant particles to more efficiently carry and transport the anticancer drug into the cancer cells. Citrate- or succinate-modified CA particles were synthesized with different concentrations of sodium citrate or sodium succinate, respectively, in the absence or presence of doxorubicin. The drug loading efficiency of the particles and their cellular uptake were observed by quantifying fluorescence intensity. The average diameter and surface charge of the particles were determined using Zetasizer. Cell viability was assessed by MTT assay. Citrate-modified carbonate apatite (CMCA exhibited the highest (31.38% binding affinity for doxorubicin and promoted rapid cellular uptake of the drug, leading to the half-maximal inhibitory concentration 1000 times less than that of the free drug in MCF-7 cells. Hence, CMCA nanoparticles with greater surface area enhance cytotoxicity in different breast cancer cells by enabling higher loading and more efficient cellular uptake of the drug.
Childress, Tristan; Simon, Adam C.; Day, Warren C.; Lundstrom, Craig C.; Bindeman, Ilya N.
2016-01-01
New O and Fe stable isotope ratios are reported for magnetite samples from high-grade massive magnetite of the Mesoproterozoic Pea Ridge and Pilot Knob magnetite-apatite ore deposits and these results are compared with data for other iron oxide-apatite deposits to shed light on the origin of the southeast Missouri deposits. The δ18O values of magnetite from Pea Ridge (n = 12) and Pilot Knob (n = 3) range from 1.0 to 7.0 and 3.3 to 6.7‰, respectively. The δ56Fe values of magnetite from Pea Ridge (n = 10) and Pilot Knob (n = 6) are 0.03 to 0.35 and 0.06 to 0.27‰, respectively. These δ18O and the δ56Fe values suggest that magnetite crystallized from a silicate melt (typical igneous δ56Fe ranges 0.06–0.49‰) and grew in equilibrium with a magmatic-hydrothermal aqueous fluid. We propose that the δ18O and δ56Fe data for the Pea Ridge and Pilot Knob magnetite-apatite deposits are consistent with the flotation model recently proposed by Knipping et al. (2015a), which invokes flotation of a magmatic magnetite-fluid suspension and offers a plausible explanation for the igneous (i.e., up to ~15.9 wt % TiO2 in magnetite) and hydrothermal features of the deposits.
National Oceanic and Atmospheric Administration, Department of Commerce — Edgetech 216 chirp data (SEG-Y format) collected for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project, OCE-1130843. Survey area covers...
Energy Technology Data Exchange (ETDEWEB)
Luo Yi [Key Laboratory of Pollution Processes and Environmental Criteria (Nankai University), Ministry of Education, College of Environmental Sciences and Engineering, Nankai University, Tianjin 300071 (China); Wang Xiaorong, E-mail: yiyluo@gmail.com [State Key Laboratory of Pollution Control and Resources Reuse, School of Environment, Nanjing University, Nanjing 210093 (China); Ji Liangliang; Su Yan [State Key Laboratory of Pollution Control and Resources Reuse, School of Environment, Nanjing University, Nanjing 210093 (China)
2009-11-15
In the present study, direct evidence of hydroxyl radical production in livers of Carassius auratus exposed to pentachlorophenol (PCP) was provided using electron paramagnetic resonance (EPR) with spin-trapping. A dose-effect relationship was obtained between hydroxyl radical intensities and PCP exposure. It was observed that hydroxyl radical was significantly induced by 0.001 mg l{sup -1} (below the criteria for Chinese fishery water quality) of PCP exposure. A strong positive correlation (r = 0.9581, p < 0.001) was observed between PCP liver concentrations and hydroxyl radical intensities within 7 d of PCP exposure, which suggests that hydroxyl radical are mainly produced from PCP itself. However, no correlation was observed between PCP liver concentrations and hydroxyl radical intensities after 7 d, and a higher intensity of hydroxyl radical could still be observed when the PCP liver concentrations decreased to a lower level, which suggests that other mechanisms may possibly contribute to hydroxyl radical production after 7 d. The glutathione/oxidized glutathione (GSH/GSSG) ratio decreased below that of the control level during the entire period of PCP exposure (0.05 mg l{sup -1}), which suggested oxidative stress occurred.
Progress modelling of aqueous electrons and hydroxyl radicals in RAIM code
Energy Technology Data Exchange (ETDEWEB)
Kim, A Yeong; Kim, Han-Chul; Lee, Jongseong [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)
2015-10-15
In this paper, the RAIM code was revised minutely with regards to aqueous electrons and hydroxyl radicals, and simulated the P10T2 test. The recent study indicated that the RAIM had the potential for improvement of simulating the iodine behavior influenced by water radiolysis products such as aqueous electrons and hydroxyl radicals. In the existing RAIM modelling, it was considered that aqueous electrons only interacted with oxygen as a consumption reaction, but the reaction with hydrogen peroxide also could be major contributor to the iodine behavior as well as the consumption reaction of aqueous electrons. In case of hydroxyl radicals, RAIM took no notice of the pH impact. In other words, it dealt with the consumption reaction constants but not as a variable of pH. In this communication, the procedures to develop the model related to aqueous electrons and hydroxyl radicals in RAIM will be addressed. And the upgraded RAIM (RAIM-1, 2, 3) codes were applied to OECD-BIP P10T2 test which showed the effect of pH on the iodine behavior and compared with the existing RAIM1.8.3 code. Comparing with the existing RAIM, the improvement reduced the difference about 10%. However, the absolute difference values that is about one order at pH 10 could not be reduced by this approach.
Heidarian, Hassan; Lentz, David; Alirezaei, Saeed; Peighambari, Sima; Hall, Douglas
2016-12-01
Textural and compositional data are presented for different types of magnetite in the Chadormalu iron deposit to discern the genesis of various styles of mineralization. Samples were chosen according to their paragenetic relations to apatite and their host setting: magnetite-apatite veins in the altered host rocks, disseminated magnetite-apatite assemblages in the marginal parts of the main ore body, and massive magnetite associated with irregular apatite veinlets from internal part of the main ore body. Scanning electron microscopy - back scatter electron (SEM-BSE) images reveal that there are three main generations of magnetite in each of the different magnetite-apatite assemblages. Primary magnetite (Mag1) features abundant porosity and a dark appearance. A second generation of magnetite (Mag2) replacing Mag1 shows a lighter appearance with both sharp and gradational contacts with the primary magnetite crystals. The two magnetite types are related to dissolution-precipitation processes due to changing physico-chemical parameters of the ore fluids. A third type of magnetite (Mag3) with a recrystallized appearance and foam-like triple junctions was mostly observed in magnetite-apatite veins in the main ore body and in veins hosted by altered rocks. Electron probe microanalyses (EPMA) were utilized to discriminate the various magnetite generations in the different magnetite-apatite assemblages. Applying published elemental discrimination diagrams shows that most primary magnetites fall into the hydrothermal- and Kiruna-type fields. Primary magnetite contains lower FeO (88.77-93.65 wt.%; average 91.5 wt.%), and higher SiO2 (0.21-2.26 wt.%; ave. 0.32 wt.%), Al2O3 (0.001-0.45 wt.%; ave. 0.053 wt.%), and CaO (0.002-0.48 wt.%; ave. 0.078 wt.%) contents, which might be related to magmatically derived fluids. Secondary magnetites have higher FeO (89.23-93.49 wt.%; ave. 92.11 wt.%), lower SiO2 (0.037-0.189 wt.%; ave. 0.072 wt.%), Al2O3 (0.004-0.072 wt.%; ave. 0.019 wt
Regioselective alkane hydroxylation with a mutant CYP153A6 enzyme
Koch, Daniel J.; Arnold, Frances H.
2013-01-29
Cytochrome P450 CYP153A6 from Myobacterium sp. strain HXN1500 was engineered using in-vivo directed evolution to hydroxylate small-chain alkanes regioselectively. Mutant CYP153A6-BMO1 selectively hydroxylates butane and pentane at the terminal carbon to form 1-butanol and 1-pentanol, respectively, at rates greater than wild-type CYP153A6 enzymes. This biocatalyst is highly active for small-chain alkane substrates and the regioselectivity is retained in whole-cell biotransformations.
National Oceanic and Atmospheric Administration, Department of Commerce — Edgetech 216 chirp data (SEG-Y format) collected for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project, OCE-1130843. Survey area covers the...
International Nuclear Information System (INIS)
Wu Qianhong; Liu Shunsheng
2002-01-01
By using the fission track dating technique, a preliminary study was carried out on the fission track ages (FTA) of apatite, their distribution patterns and hints over the tectonics activities during Mesozoic and Cenozoic in the east Dabie area. Attempts were also made to improve the conventional statistical method for the tracks. Ranging from 59.4 +- 3.4 Ma to 105.6 +- 9.8 Ma, the FTA results of apatite spread in the wide range and increased rapidly from the east to the west area. Sine 95 Ma, the uplift rate has been quite slow and asymmetry. The FTA value in the middle area of Xiaotian-Mozitan Fault may imply its uplift in Cretaceous. The faulting should be the main control factor for the uplift of this area
Energy Technology Data Exchange (ETDEWEB)
Louis-Achille, V
1999-07-01
Studies of natural and synthetic apatites allow to propose such crystals as matrix for nuclear waste storage. The neodymium substituted britholite, Ca{sub 9}Nd(PO{sub 4}){sub 5}(SiO{sub 4})F{sub 2}. is a model for the trivalent actinide storage Neodymium can be substituted in two types of sites. The aim of this thesis is to compare the chemical nature of this two sites in fluoro-apatite Ca{sub 9}(PO{sub 4}){sub 6}F{sub 2} and then in britholite, using ab initio atomistic modeling. Two approaches are used: one considers the infinite crystals and the second considers clusters. The calculations of the electronic structure for both were performed using Kohn and Sham density functional theory in the local approximation. For solids, pseudopotentials were used, and wave functions are expanded in plane waves. For clusters, a frozen core approximation was used, and the wave functions are expanded in a linear combination of Slater type atomic orbitals. The pseudopotential is semi-relativistic for neodymium, and the Hamiltonian is scalar relativistic for the clusters. The validation of the solid approach is performed using two test cases: YPO{sub 4} and ScPO{sub 4}. Two numerical tools were developed to compute electronic deformation density map, and calculate partial density of stases. A full optimisation of the lattice parameters with a relaxation of the atomic coordinates leads to correct structural and thermodynamic properties for the fluoro-apatite, compared to experience. The electronic deformation density maps do not show any significant differences. between the two calcium sites. but Mulliken analysis on the solid and on the clusters point out the more ionic behavior of the calcium in site 2. A neodymium substituted britholite is then studied. Neodymium location only induces local modifications in; the crystalline structure and few changes in the formation enthalpy. The electronic study points out an increase of the covalent character the bonding involving neodymium
Alternate dipping preparation of biomimetic apatite layers in the presence of carbonate ions
International Nuclear Information System (INIS)
Chatelain, Grégory; Bourgeois, Damien; Meyer, Daniel; Ravaux, Johann; Averseng, Olivier; Vidaud, Claude
2014-01-01
The classical simulated body fluids method cannot be employed to prepare biomimetic apatites encompassing metallic ions that lead to very stable phosphates. This is the case for heavy metals such as uranium, whose presence in bone mineral after contamination deserves toxicological study. We have demonstrated that existing methods, based on alternate dipping into calcium and phosphate ions solutions, can be adapted to achieve this aim. We have also especially studied the impact of the presence of carbonate ions in the medium as these are necessary to avoid hydrolysis of the contaminating metallic cations. Both the apatite–collagen complex method and a standard chemical (STD) method employing only mineral solutions lead to biomimetic apatites when calcium and carbonate ions are introduced simultaneously. The obtained materials were fully characterized and we established that the STD method tolerates the presence of carbonate ions much better, and this leads to homogeneous samples. Emphasis was set on the repeatability of the method to ensure the relevancy of further work performed on series of samples. Finally, osteoblasts cultured on these samples also proved a similar yield and standard-deviation in their adenosine triphosphate content when compared to commercially available substrates designed to study of such cell cultures. (paper)
Directory of Open Access Journals (Sweden)
Long Pang
2013-01-01
Full Text Available Background: In bone tissue engineering, extracellular matrix exerts critical influence on cellular interaction with porous biomaterial and the apatite playing an important role in the bonding process of biomaterial to bone tissue. The aim of this study was to observe the therapeutic effects of hybrid rapid prototyping (RP scaffolds comprising polylactic-co-glycolic acid (PLGA, β-tricalciumphosphate (β-TCP, collagen I and apatite (PLGA/β-TCP-collagen I/apatite on segmental bone defects in conjunction with combination with bone marrow mesenchymal stem cells (BMSCs. Materials and Methods: BMSCs were seeded into the hybrid RP scaffolds to repair 15 mm defect in the radius of rabbits. Radiograph, microcomputed tomography and histology were used to evaluate new bone formation. Results: Radiographic analysis done from 12 to 36 weeks postoperative period demonstrated that new bone formed at the radial defect site and continues to increase until the medullary cavity is recanalized and remodelling is complete. The bone defect remained unconnected in the original RP scaffolds (PLGA/β-TCP during the whole study. Histological observations conformed to the radiographic images. In hybrid RP scaffold group, woven bone united the radial defect at 12 weeks and consecutively remodeled into lamellar bone 24 weeks postoperation and finally matured into cortical bone with normal marrow cavity after another 12 weeks. No bone formation but connective tissue has been detected in RP scaffold at the same time. Conclusion: Collagen I/apatite sponge composite coating could improve new bone formation in vivo. The hybrid RP scaffold of PLGA/β-TCP skeleton with collagen I/apatite sponge composite coating is a promising candidate for bone tissue engineering.
2015-03-01
-Stormwater runoff introduces heavy metals to surface waters that are harmful to aquatic organisms, : including endangered salmon. This work evaluates Apatite II, a biogenic fish bone based adsorbent, for removing metal : from stormwater. The meta...
Magnetic apatite for structural insights on the plasma membrane
International Nuclear Information System (INIS)
Stanca, Sarmiza E; Müller, Robert; Dellith, Jan; Deckert, Volker; Krafft, Christoph; Popp, Jürgen; Fritzsche, Wolfgang; Nietzsche, Sandor; Stöckel, Stephan; Biskup, Christoph
2015-01-01
The iron oxide-hydroxyapatite (FeOxHA) nanoparticles reported here differ from those reported before by their advantage of homogeneity and simple preparation; moreover, the presence of carboxymethyldextran (CMD), together with hydroxyapatite (HA), allows access to the cellular membrane, which makes our magnetic apatite unique. These nanoparticles combine magnetic behavior, Raman label ability and the property of interaction with the cellular membrane; they therefore represent an interesting material for structural differentiation of the cell membrane. It was observed by Raman spectroscopy, scanning electron microscopy (SEM) and fluorescence microscopy that FeOxHA adheres to the plasma membrane and does not penetrate the membrane. These insights make the nanoparticles a promising material for magnetic cell sorting, e.g. in microfluidic device applications. (paper)
Magnetic apatite for structural insights on the plasma membrane
Stanca, Sarmiza E.; Müller, Robert; Dellith, Jan; Nietzsche, Sandor; Stöckel, Stephan; Biskup, Christoph; Deckert, Volker; Krafft, Christoph; Popp, Jürgen; Fritzsche, Wolfgang
2015-01-01
The iron oxide-hydroxyapatite (FeOxHA) nanoparticles reported here differ from those reported before by their advantage of homogeneity and simple preparation; moreover, the presence of carboxymethyldextran (CMD), together with hydroxyapatite (HA), allows access to the cellular membrane, which makes our magnetic apatite unique. These nanoparticles combine magnetic behavior, Raman label ability and the property of interaction with the cellular membrane; they therefore represent an interesting material for structural differentiation of the cell membrane. It was observed by Raman spectroscopy, scanning electron microscopy (SEM) and fluorescence microscopy that FeOxHA adheres to the plasma membrane and does not penetrate the membrane. These insights make the nanoparticles a promising material for magnetic cell sorting, e.g. in microfluidic device applications.
Novel denture-cleaning system based on hydroxyl radical disinfection.
Kanno, Taro; Nakamura, Keisuke; Ikai, Hiroyo; Hayashi, Eisei; Shirato, Midori; Mokudai, Takayuki; Iwasawa, Atsuo; Niwano, Yoshimi; Kohno, Masahiro; Sasaki, Keiichi
2012-01-01
The purpose of this study was to evaluate a new denture-cleaning device using hydroxyl radicals generated from photolysis of hydrogen peroxide (H2O2). Electron spin resonance analysis demonstrated that the yield of hydroxyl radicals increased with the concentration of H2O2 and light irradiation time. Staphylococcus aureus, Pseudomonas aeruginosa, and methicillin-resistant S aureus were killed within 10 minutes with a > 5-log reduction when treated with photolysis of 500 mM H2O2; Candida albicans was killed within 30 minutes with a > 4-log reduction with photolysis of 1,000 mM H2O2. The clinical test demonstrated that the device could effectively reduce microorganisms in denture plaque by approximately 7-log order within 20 minutes.
Directory of Open Access Journals (Sweden)
Hidetatsu Tanaka
Full Text Available Ti-6Al-4V alloy is widely prevalent as a material for orthopaedic implants because of its good corrosion resistance and biocompatibility. However, the discrepancy in Young's modulus between metal prosthesis and human cortical bone sometimes induces clinical problems, thigh pain and bone atrophy due to stress shielding. We designed a Ti-Nb-Sn alloy with a low Young's modulus to address problems of stress disproportion. In this study, we assessed effects of anodic oxidation with or without hot water treatment on the bone-bonding characteristics of a Ti-Nb-Sn alloy. We examined surface analyses and apatite formation by SEM micrographs, XPS and XRD analyses. We also evaluated biocompatibility in experimental animal models by measuring failure loads with a pull-out test and by quantitative histomorphometric analyses. By SEM, abundant apatite formation was observed on the surface of Ti-Nb-Sn alloy discs treated with anodic oxidation and hot water after incubation in Hank's solution. A strong peak of apatite formation was detected on the surface using XRD analyses. XPS analysis revealed an increase of the H2O fraction in O 1s XPS. Results of the pull-out test showed that the failure loads of Ti-Nb-Sn alloy rods treated with anodic oxidation and hot water was greater than those of untreated rods. Quantitative histomorphometric analyses indicated that anodic oxidation and hot water treatment induced higher new bone formation around the rods. Our findings indicate that Ti-Nb-Sn alloy treated with anodic oxidation and hot water showed greater capacity for apatite formation, stronger bone bonding and higher biocompatibility for osteosynthesis. Ti-Nb-Sn alloy treated with anodic oxidation and hot water treatment is a promising material for orthopaedic implants enabling higher osteosynthesis and lower stress disproportion.
McCubbin, F. M.; Barnes, J. J.; Santos, A. R.; Boyce, J. W.; Anand, M.; Franchi, I. A.; Agee, C. B.
2016-01-01
Northwest Africa (NWA) 7034 and its pairings comprise a regolith breccia with a basaltic bulk composition [1] that yields a better match than any other martian meteorite to visible-infrared reflectance spectra of the martian surface measured from orbit [2]. The composition of the fine-grained matrix within NWA 7034 bears a striking resemblance to the major element composition estimated for the martian crust, with several exceptions. The NWA 7034 matrix is depleted in Fe, Ti, and Cr and enriched in Al, Na, and P [3]. The differences in Al and Fe are the most substantial, but the Fe content of NWA 7034 matrix falls within the range reported for the southern highlands crust [6]. It was previously suggested by [4] that NWA 7034 was sourced from the southern highlands based on the ancient 4.4 Ga ages recorded in NWA 7034/7533 zircons [4, 5]. In addition, the NWA 7034 matrix material is enriched in incompatible trace elements by a factor of 1.2-1.5 [7] relative to estimates of the bulk martian crust. The La/Yb ratio of the bulk martian crust is estimated to be approximately 3 [7], and the La/Yb of the NWA 7034 matrix materials ranges from approximately 3.9 to 4.4 [3, 8], indicating a higher degree of LREE enrichment in the NWA 7034 matrix materials. This elevated La/Yb ratio and enrichment in incompatible lithophile trace elements is consistent with NWA 7034 representing a more geochemically enriched crustal terrain than is represented by the bulk martian crust, which would be expected if NWA 7034 represents the bulk crust from the southern highlands. Given the similarities between NWA 7034 and the martian crust, NWA 7034 may represent an important sample for constraining the composition of the martian crust, particularly the ancient highlands. In the present study, we seek to constrain the H isotopic composition of the martian crust using Cl-rich apatite in NWA 7034. Usui et al., [9] recently proposed that a H isotopic reservoir exists within the martian crust that has
Steroid hydroxylations: A paradigm for cytochrome P450 catalyzed mammalian monooxygenation reactions
International Nuclear Information System (INIS)
Estabrook, Ronald W.
2005-01-01
The present article reviews the history of research on the hydroxylation of steroid hormones as catalyzed by enzymes present in mammalian tissues. The report describes how studies of steroid hormone synthesis have played a central role in the discovery of the monooxygenase functions of the cytochrome P450s. Studies of steroid hydroxylation reactions can be credited with showing that: (a) the adrenal mitochondrial enzyme catalyzing the 11β-hydroxylation of deoxycorticosterone was the first mammalian enzyme shown by O 18 studies to be an oxygenase; (b) the adrenal microsomal enzyme catalyzing the 21-hydroxylation of steroids was the first mammalian enzyme to show experimentally the proposed 1:1:1 stoichiometry (substrate:oxygen:reduced pyridine nucleotide) of a monooxygenase reaction; (c) application of the photochemical action spectrum technique for reversal of carbon monoxide inhibition of the 21-hydroxylation of 17α-OH progesterone was the first demonstration that cytochrome P450 was an oxygenase; (d) spectrophotometric studies of the binding of 17α-OH progesterone to bovine adrenal microsomal P450 revealed the first step in the cyclic reaction scheme of P450, as it catalyzes the 'activation' of oxygen in a monooxygenase reaction; (e) purified adrenodoxin was shown to function as an electron transport component of the adrenal mitochondrial monooxygenase system required for the activity of the 11β-hydroxylase reaction. Adrenodoxin was the first iron-sulfur protein isolated and purified from mammalian tissues and the first soluble protein identified as a reductase of a P450; (f) fractionation of adrenal mitochondrial P450 and incubation with adrenodoxin and a cytosolic (flavoprotein) fraction were the first demonstration of the reconstitution of a mammalian P450 monooxygenase reaction
National Oceanic and Atmospheric Administration, Department of Commerce — Edgetech 216 chirp data (SEG-Y format) collected for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project, OCE-1130843. Survey area covers...
International Nuclear Information System (INIS)
Sader, Marcia S.; Martins, Virginia C.A.; Gomez, Santiago; LeGeros, Racquel Z.; Soares, Gloria A.
2013-01-01
3D porous scaffolds are relevant biomaterials to bone engineering as they can be used as templates to tissue reconstruction. The aim of the present study was to produce and characterize in vitro 3D magnesium-carbonate apatite/collagen (MCA/col) scaffolds. They were prepared by using biomimetic approach, followed by cross-linking with 0.25% glutaraldehyde solution (GA) and liofilization. Results obtained with Fourier-transform infrared spectroscopy (FT-IR) confirmed the type-B carbonate substitution, while by X-ray diffraction (XRD), a crystallite size of ∼ 10 nm was obtained. Optical and electron microscopy showed that the cylindrical samples exhibited an open-porous morphology, with apatite nanocrystals precipitated on collagen fibrils. The cross-linked 3D scaffolds showed integrity when immersed in culture medium up to 14 days. Also, the immersion of such samples into an acid buffer solution, to mimic the osteoclastic resorption environment, promotes the release of important ions for bone repair, such as calcium, phosphorus and magnesium. Bone cells (SaOs2) adhered, and proliferated on the 3D composite scaffolds, showing that synthesis and the cross-linking processes did not induce cytotoxicity. Highlights: • 3D scaffolds of Mg-carbonate–apatite and anionic-collagen were produced. • The biomimetic approach and the cross-linking with 0.25% GA solution were employed. • The scaffolds showed open-porous structure and apatite crystals on collagen fibrils. • The cross-linked scaffolds exhibited integrity when immersed in culture medium. • SaOs2 cells adhered and proliferated on the cross-linked scaffolds confirming no cytotoxicity
Energy Technology Data Exchange (ETDEWEB)
Sader, Marcia S., E-mail: msader@metalmat.ufrj.br [Prog. Engenharia Metalúrgica e Materiais, COPPE/UFRJ, RJ (Brazil); Martins, Virginia C.A. [Depto. de Química e Física Molecular, IQSC/USP, SP (Brazil); Gomez, Santiago [Dept. Anatomía Patológica, Universidad de Cádiz, Cadiz (Spain); LeGeros, Racquel Z. [Department of Biomaterials and Biomimetics, New York University College of Dentistry, NY (United States); Soares, Gloria A. [Prog. Engenharia Metalúrgica e Materiais, COPPE/UFRJ, RJ (Brazil)
2013-10-15
3D porous scaffolds are relevant biomaterials to bone engineering as they can be used as templates to tissue reconstruction. The aim of the present study was to produce and characterize in vitro 3D magnesium-carbonate apatite/collagen (MCA/col) scaffolds. They were prepared by using biomimetic approach, followed by cross-linking with 0.25% glutaraldehyde solution (GA) and liofilization. Results obtained with Fourier-transform infrared spectroscopy (FT-IR) confirmed the type-B carbonate substitution, while by X-ray diffraction (XRD), a crystallite size of ∼ 10 nm was obtained. Optical and electron microscopy showed that the cylindrical samples exhibited an open-porous morphology, with apatite nanocrystals precipitated on collagen fibrils. The cross-linked 3D scaffolds showed integrity when immersed in culture medium up to 14 days. Also, the immersion of such samples into an acid buffer solution, to mimic the osteoclastic resorption environment, promotes the release of important ions for bone repair, such as calcium, phosphorus and magnesium. Bone cells (SaOs2) adhered, and proliferated on the 3D composite scaffolds, showing that synthesis and the cross-linking processes did not induce cytotoxicity. Highlights: • 3D scaffolds of Mg-carbonate–apatite and anionic-collagen were produced. • The biomimetic approach and the cross-linking with 0.25% GA solution were employed. • The scaffolds showed open-porous structure and apatite crystals on collagen fibrils. • The cross-linked scaffolds exhibited integrity when immersed in culture medium. • SaOs2 cells adhered and proliferated on the cross-linked scaffolds confirming no cytotoxicity.
International Nuclear Information System (INIS)
Belyakov, M.A.; Terent'eV, Eh.P.; Frolov, V.A.
1982-01-01
A technique for a neutron activation rapid analysis of fluorine is described. A mean-square error of the analysis makes up 0,g3 per cent F. The investigation has been carried out and a close correlation has been established for the Hibine massif exploited apatite deposits on the basis of the neutron activation analysis of fluorine and chemical analysis of P 2 O 5 . Possibilities are shown of using the neutron activation analysis of P 2 O 5 in ores and certain ore con-- centrates of ''Apatit'' works from the radioactivity induced in fluorine. A mean-square error of the analysis makes up 0,35 per cent P 2 O 5
Glutathione--hydroxyl radical interaction: a theoretical study on radical recognition process.
Directory of Open Access Journals (Sweden)
Béla Fiser
Full Text Available Non-reactive, comparative (2 × 1.2 μs molecular dynamics simulations were carried out to characterize the interactions between glutathione (GSH, host molecule and hydroxyl radical (OH(•, guest molecule. From this analysis, two distinct steps were identified in the recognition process of hydroxyl radical by glutathione: catching and steering, based on the interactions between the host-guest molecules. Over 78% of all interactions are related to the catching mechanism via complex formation between anionic carboxyl groups and the OH radical, hence both terminal residues of GSH serve as recognition sites. The glycine residue has an additional role in the recognition of OH radical, namely the steering. The flexibility of the Gly residue enables the formation of further interactions of other parts of glutathione (e.g. thiol, α- and β-carbons with the lone electron pair of the hydroxyl radical. Moreover, quantum chemical calculations were carried out on selected GSH/OH(• complexes and on appropriate GSH conformers to describe the energy profile of the recognition process. The relative enthalpy and the free energy changes of the radical recognition of the strongest complexes varied from -42.4 to -27.8 kJ/mol and from -21.3 to 9.8 kJ/mol, respectively. These complexes, containing two or more intermolecular interactions, would be the starting configurations for the hydrogen atom migration to quench the hydroxyl radical via different reaction channels.
International Nuclear Information System (INIS)
LeGeros, R.Z.; Orly, I.; LeGeros, J.P.; Gomez, C.; Kazimiroff, J.; Tarpley, T.; Kerebel, B.
1988-01-01
A review of the use of scanning electron microscopy (SEM) and electron probe microanalyses in the study of dental calculus showed that such studies provided confirmatory and supplementary data on the morphological features of human dental calculi but gave only limited information on the identity of the crystalline or inorganic components. This study aimed to explore the potential of combined SEM and microanalyses in the identification of the crystalline components of the human and animal dental calculi. Human and animal calculi were analyzed. Identification of the crystalline components were made based on the combined information of the morphology (SEM) and Ca/P molar ratios of the crystals with the morphology and Ca/P molar ratio of synthetic calcium phosphates (brushite or DCPD; octacalcium phosphate, OCP; Mg-substituted whitlockite, beta-TCMP; CO 3 -substituted apatite, (CHA); and calcite. SEM showed similarities in morphological features of human and animal dental calculi but differences in the forms of crystals present. Microanalyses and crystal morphology data suggested the presence of CaCO 3 (calcite) and CHA in the animal (cat, dog, tiger) and of OCP, beta-TCMP and CHA in human dental calculi. X-ray diffraction and infrared (IR) absorption analyses confirmed these results. This exploratory study demonstrated that by taking into consideration what is known about the crystalline components of human and animal dental calculi, combined SEM and microanalyses can provide qualitative identification
Energy Technology Data Exchange (ETDEWEB)
Bazin, D.; Carpentier, X.; Brocheriou, I.; Dorfmuller, P.; Aubert, S.; Chappard, C.; Thiaudiere, D.; Reguer, S.; Waychunas, G.; Jungers, P.; Daudon, M.
2009-04-01
The role of oligo-elements such as Zn in the genesis of pathological calcifications is widely debated in the literature. An essential element of discussion is given by their localization either at the surface or within the Ca apatite crystalline network. To determine the localization, X-ray absorption experiments have been performed at SOLEIL. The Exafs results suggest that Zn atoms, present in the Zn{sup 2+} form, are bound to about 4 O atoms at a distance of 2.00{angstrom}, while the interatomic distance R{sub CaO} ranges between 2.35 {angstrom} and 2.71 {angstrom}. Taking into account the content of Zn (around 1000 ppm) and the difference in ionic radius between Zn{sup 2+} (0.074 nm) and Ca{sup 2+} (0.099 nm), a significant longer interatomic distance would be expected in the case of Zn replacing Ca within the apatite crystalline network. We thus conclude that Zn atoms are localized at the surface and not in the apatite nanocrystal structure. Such structural result has essential biological implications for at least two reasons. Some oligoelements have a marked effect on the transformation of chemical phases, and may modify the morphology of crystals. These are both major issues because, in the case of kidney stones, the medical treatment depends strongly on the precise chemical phase and on the morphology of the biological entities at both macroscopic and mesoscopic scales.
V color centers in electrolytically colored hydroxyl-doped sodium chloride crystals
International Nuclear Information System (INIS)
Gu Hongen; Song Cuiying; Han Li
2006-01-01
Hydroxyl-doped sodium chloride crystals were successfully colored electrolytically by using pointed anode and flat cathode at various temperatures and under various electric field strengths. V 2 and V 3 color centers were produced in the colored crystals. Current-time curves for the electrolytic colorations were given, and activation energy for the V 2 and V 3 color center migration was determined. Production of the V 2 and V 3 color centers and formation of current zones for the electrolytic colorations of the hydroxyl-doped sodium chloride crystals are explained
Hydroxylation of the Herbicide Isoproturon by Fungi Isolated from Agricultural soil
DEFF Research Database (Denmark)
Rønhede, S.; Jensen, Bo; Rosendahl, Søren
2005-01-01
Several asco-, basidio-, and zygomycetes isolated from an agricultural field were shown to be able to hydroxylate the phenylurea herbicide isoproturon [N-(4-isopropylphenyl)-N',N'-dimethylurea] to N-(4-(2-hydroxy-1-methylethyl)phenyl)-N',N'-dimethylurea and N-(4-(1-hydroxy-1-methylethyl)phenyl)-N......Several asco-, basidio-, and zygomycetes isolated from an agricultural field were shown to be able to hydroxylate the phenylurea herbicide isoproturon [N-(4-isopropylphenyl)-N',N'-dimethylurea] to N-(4-(2-hydroxy-1-methylethyl)phenyl)-N',N'-dimethylurea and N-(4-(1-hydroxy-1-methylethyl...
Energy Technology Data Exchange (ETDEWEB)
Miro, S
2004-12-15
This work lies within the scope of the study of the radionuclides containment matrices. The choice of the fluoro-apatites as potential matrices of containment was suggested by the notable properties of these latter (thermal and chemical stability even under radioactive radiation). By irradiations with heavy ions and a helium implantation we simulated the effects related to the alpha radioactivity and to the spontaneous nuclear fission of the radionuclides. Thanks to the study of Durango fluoro-apatite single crystals and fluoro-apatite sintered ceramics, we evidenced that the damage fraction as well as the unit cell deformations increase with the electronic energy loss and with the substitution. These effects are followed at high fluences by a phenomenon of re-crystallization. The study of the helium diffusion points out that the thermal diffusion process improves with the substitution and strongly increases with heavy ions irradiation. (author)
Mechanism and Kinetics for the Dissolution of Apatitic Materials in Acid Solutions
Directory of Open Access Journals (Sweden)
Calmanovici C.E.
1997-01-01
Full Text Available Abstract - This work concerns the study of the digestion step in the production process of phosphoric acid. Some qualitative experiments indicate that the difference between the pH at the surface of the phosphate and that in the bulk of the solution is negligible and that the dissolution is controlled by diffusion of products away from the phosphate particle. In further experiments, to isolate the dissolution phenomenon from the formation of calcium sulfate, the sulfuric acid normally used industrially is replaced by hydrochloric acid. The phosphate material used in our experiments is a model apatitic material: synthetic hydroxyapatite (HAP. The dissolution of calcium hydroxyapatite was studied with increasing amounts of calcium and phosphate at different temperatures. A simple method was developed for this observation based on the time required for complete dissolution of the HAP powder. The results confirm that the dissolution is controlled by a diffusional process through an interface of calcium and phosphate ions released from the solid surface. A kinetic model for the dissolution of apatitic materials is proposed which assumes a shrinking particle behaviour controlled by diffusion of calcium ions. The experimental results are fitted to this model to determine the mass transfer constant for HAP dissolution in acid solutions. The activation energy of the reaction is about 14kJ/mol. This study was carried on in conditions similar to the industrial ones for the production of phosphoric acid by the dihydrate-process
Lai, Lin; Barnard, Amanda S
2011-06-01
Understanding nanodiamond functionalisation is of great importance for biological and medical applications. Here we examine the stabilities of oxygen, hydroxyl, and water functionalisation of the nanodiamonds using the self-consistent charge density functional tight-binding simulations. We find that the oxygen and hydroxyl termination are thermodynamically favourable and form strong C–O covalent bonds on the nanodiamond surface in an O2 and H2 gas reservoir, which confirms previous experiments. Yet, the thermodynamic stabilities of oxygen and hydroxyl functionalisation decrease dramatically in a water vapour reservoir. In contrast, H2O molecules are found to be physically adsorbed on the nanodiamond surface, and forced chemical adsorption results in decomposition of H2O. Moreover, the functionalisation efficiency is found to be facet dependent. The oxygen functionalisation prefers the {100} facets as opposed to alternative facets in an O2 and H2 gas reservoir. The hydroxyl functionalisation favors the {111} surfaces in an O2 and H2 reservoir and the {100} facets in a water vapour reservoir, respectively. This facet selectivity is found to be largely dependent upon the environmental temperature, chemical reservoir, and morphology of the nanodiamonds.
Electrolytic coloration and spectral properties of hydroxyl-doped potassium chloride single crystals
International Nuclear Information System (INIS)
Gu Hongen; Wu Yanru
2011-01-01
Hydroxyl-doped potassium chloride single crystals are colored electrolytically at various temperatures and voltages using a pointed cathode and a flat anode. Characteristic OH - spectral band is observed in the absorption spectrum of uncolored single crystal. Characteristic O - , OH - , U, V 2 , V 3 , O 2- -V a + , F, R 2 and M spectral bands are observed simultaneously in absorption spectra of colored single crystals. Current-time curve for electrolytic coloration of hydroxyl-doped potassium chloride single crystal and its relationship with electrolytic coloration process are given. Production and conversion of color centers are explained. - Highlights: → Expanded the traditional electrolysis method. → Hydroxyl-doped potassium chloride crystals were colored electrolytically for the first time. → Useful V, F and F-aggregate color centers were produced in colored crystals. → V color centers were produced directly and F and F-aggregate color centers indirectly.
FIH Regulates Cellular Metabolism through Hydroxylation of the Deubiquitinase OTUB1.
Directory of Open Access Journals (Sweden)
Carsten C Scholz
2016-01-01
Full Text Available The asparagine hydroxylase, factor inhibiting HIF (FIH, confers oxygen-dependence upon the hypoxia-inducible factor (HIF, a master regulator of the cellular adaptive response to hypoxia. Studies investigating whether asparagine hydroxylation is a general regulatory oxygen-dependent modification have identified multiple non-HIF targets for FIH. However, the functional consequences of this outside of the HIF pathway remain unclear. Here, we demonstrate that the deubiquitinase ovarian tumor domain containing ubiquitin aldehyde binding protein 1 (OTUB1 is a substrate for hydroxylation by FIH on N22. Mutation of N22 leads to a profound change in the interaction of OTUB1 with proteins important in cellular metabolism. Furthermore, in cultured cells, overexpression of N22A mutant OTUB1 impairs cellular metabolic processes when compared to wild type. Based on these data, we hypothesize that OTUB1 is a target for functional hydroxylation by FIH. Additionally, we propose that our results provide new insight into the regulation of cellular energy metabolism during hypoxic stress and the potential for targeting hydroxylases for therapeutic benefit.
CSIR Research Space (South Africa)
Mkhonto, D
2008-01-01
Full Text Available the surface silicon and oxygen species rearrange to form O–Si–O links. Any dangling silicon and oxygen bonds at the silica surfaces are saturated by coordination to oxygen and calcium atoms in the apatite layer, but the extra reactivity afforded by these under...
- Hydroxylated Anthraquinones Produced by Geosmithia species
Czech Academy of Sciences Publication Activity Database
Stodůlková, Eva; Kolařík, Miroslav; Křesinová, Zdena; Kuzma, Marek; Šulc, Miroslav; Man, Petr; Novák, Petr; Maršík, Petr; Landa, Přemysl; Olšovská, Jana; Chudíčková, Milada; Pažoutová, Sylvie; Černý, J.; Bella, J.; Flieger, Miroslav
2009-01-01
Roč. 54, č. 3 (2009), s. 179-187 ISSN 0015-5632 R&D Projects: GA AV ČR KAN200200651; GA MŠk LC07017; GA MŠk 1M0506; GA ČR GP203/05/P575 Grant - others:CZ(CZ) 205/2004 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z50380511 Keywords : hydroxylated anthraquinones * staphylococcus aureus * mammalian cell lines Subject RIV: EE - Microbiology, Virology Impact factor: 0.978, year: 2009
Hydrotreating of compounds and mixtures of compounds having mercapto and hydroxyl groups
Energy Technology Data Exchange (ETDEWEB)
Viljava, T.R.; Krause, A.O.I. [Helsinki University of Technology, Espoo (Finland)
1997-07-01
Simultaneous hydrodesulfurization (HDS) and hydrodeoxygenation (HDO) of mercapto and hydroxyl group containing benzenes was studied using a commercial presulfided CoMo/{gamma}- Al{sub 2}O{sub 3} catalyst under hydrotreating conditions (150-280 deg C, 7 MPa). Mercaptobenzene, phenol and 4-mercaptophenol were used as model compounds, and CS{sub 2} was used as precursor for H{sub 2}S. The HDS rate of a mercapto group in the presence of a hydroxyl substituent in the para position was higher than that for the molecule containing only a mercapto group. When the hydroxyl group was present as phenol, the HDS rate of the mercapto group was about 30% lower than that for mercaptobenzene without an oxygen-containing additive. The decrease in the HDS rate was independent of the initial molar ratio of sulfur and oxygen within the ratios studied (5:1-1:1). The HDO rate of a hydroxyl group was suppressed by the mercapto group present either in the same or in a separate molecule. HDO reactions did not start until HDS conversion was almost complete. CS{sub 2} also decreased the HDO rate of phenol. When compared to the reactions of phenol alone, the rate of the hydrogenolysis route to benzene was decreased in the presence of a sulfur additive more than the hydrogenolysis- hydrogenation route to cyclohexane. 19 refs.
Tanaka, Hidetatsu; Mori, Yu; Noro, Atsushi; Kogure, Atsushi; Kamimura, Masayuki; Yamada, Norikazu; Hanada, Shuji; Masahashi, Naoya; Itoi, Eiji
2016-01-01
Ti-6Al-4V alloy is widely prevalent as a material for orthopaedic implants because of its good corrosion resistance and biocompatibility. However, the discrepancy in Young’s modulus between metal prosthesis and human cortical bone sometimes induces clinical problems, thigh pain and bone atrophy due to stress shielding. We designed a Ti-Nb-Sn alloy with a low Young’s modulus to address problems of stress disproportion. In this study, we assessed effects of anodic oxidation with or without hot water treatment on the bone-bonding characteristics of a Ti-Nb-Sn alloy. We examined surface analyses and apatite formation by SEM micrographs, XPS and XRD analyses. We also evaluated biocompatibility in experimental animal models by measuring failure loads with a pull-out test and by quantitative histomorphometric analyses. By SEM, abundant apatite formation was observed on the surface of Ti-Nb-Sn alloy discs treated with anodic oxidation and hot water after incubation in Hank’s solution. A strong peak of apatite formation was detected on the surface using XRD analyses. XPS analysis revealed an increase of the H2O fraction in O 1s XPS. Results of the pull-out test showed that the failure loads of Ti-Nb-Sn alloy rods treated with anodic oxidation and hot water was greater than those of untreated rods. Quantitative histomorphometric analyses indicated that anodic oxidation and hot water treatment induced higher new bone formation around the rods. Our findings indicate that Ti-Nb-Sn alloy treated with anodic oxidation and hot water showed greater capacity for apatite formation, stronger bone bonding and higher biocompatibility for osteosynthesis. Ti-Nb-Sn alloy treated with anodic oxidation and hot water treatment is a promising material for orthopaedic implants enabling higher osteosynthesis and lower stress disproportion. PMID:26914329
Remediation of lead, cadmium and uranium contaminated water and soil by apatite amendment
International Nuclear Information System (INIS)
Raicevic, S.; Plecas, I.; Kaludjerovic, T.
2002-01-01
During the past years as a consequence of war and some accidents in neighboring countries large areas in Serbia were contaminated by toxic heavy metals, including lead, cadmium and uranium. For example, the concentrations of Pb, Cd, Cu and Cr have been doubled above the allowed maximum value in the Romanian part of the Danube while sediments near the border in Bulgaria have higher concentrations of Pb 3 times, Cu 1400 times and Cd 30 times more than the average long-standing levels. Furthermore, an estimated 10 tons of depleted uranium (DU) was spread mainly throughout the territory of Kosovo. This contamination is a potential source of different chronic diseases including malignant diseases and represents a long-term threat for the population living in the affected areas. For this reason, remediation of contaminated sites represents an urgent need and priority. The standard remediation procedure which includes soil removal, treatment (washing, chelating), conditioning etc. is costly, disruptive and not sustainable. This study was carried out to evaluate apatite from the Lisina deposit as soil amendment for in situ stabilization of toxic heavy metals. Preliminary theoretical and experimentally results presented here point out this natural apatite as an ecological, nontoxic material which can be used for efficient and cost-effective remediation of large areas contaminated with Pb, Cd and U. (author)
International Nuclear Information System (INIS)
Zhang Hua; Ye Xiaojian; Li Jiashun
2009-01-01
An apatite/wollastonite-derived (A/W) porous glass ceramic scaffold with highly interconnected pores was successfully fabricated by adding a plastic porosifier. The morphology, porosity and mechanical strength were characterized. The results showed that the glass ceramic scaffold with controllable pore size and porosity displayed open macropores. In addition, good in vitro bioactivity was found for the scaffold obtained by soaking it in simulated body fluid. Mesenchymal stem cells (MSCs) were cultured, expanded and seeded on the scaffold, and the adhesion and proliferation of MSCs were determined using MTT assay and environmental scanning electron microscopy (ESEM). The results revealed that the scaffold was biocompatible and had no negative effects on the MSCs in vitro. The in vivo biocompatibility and osteogenicity were investigated by implanting both the pure scaffold and the MSC/scaffold construct in rabbit mandibles and studying histologically. The results showed that the glass ceramic scaffold exhibited good biocompatibility and osteoconductivity. Moreover, the introduction of MSCs into the scaffold observably improved the efficiency of new bone formation, especially at the initial stage after implantation. However, the glass ceramic scaffold showed the same good biocompatibility and osteogenicity as the hybrid one at the later stage. These results indicate that porous bioactive scaffolds based on the original apatite-wollastonite glass ceramic fulfil the basic requirements of a bone tissue engineering scaffold.
Directory of Open Access Journals (Sweden)
Longbin Zheng
Full Text Available Curcumin is extracted from the rhizomes of the traditional Chinese herb Curcuma longa. Our previous study indicated curcumin was able to function as a sonosensitizer. Hydroxyl acylated curcumin was synthesized from curcumin to eliminate the unstable hydroxy perssad in our group. The potential use of Hydroxyl acylated curcumin as a sonosensitizer for sonodynamic therapy (SDT requires further exploration. This study investigated the sonodynamic effect of Hydroxyl acylated curcumin on THP-1 macrophage. THP-1 macrophages were cultured with Hydroxyl acylated curcumin at a concentration of 5.0 μg/mL for 4 hours and then exposed to pulse ultrasound irradiation (0.5 W/cm2 with 1.0 MHz for 5 min, 10 min and 15 min. Six hours later, cell viability decreased significantly by CCK-8 assay. After ultrasound irradiation, the ratio of apoptosis and necrosis in SDT group was higher than that in control, Hydroxyl acylated curcumin alone and ultrasound alone. Moreover, the apoptotic rate was higher than necrotic rate with the flow cytometry analysis. Furthermore, Hydroxyl acylated curcumin-SDT induced reactive oxygen species (ROS generation in THP-1 macrophages immediately after the ultrasound treatment while ROS generation was reduced significantly with the scavenger of singlet oxygen Sodium azide (NaN3. Hydroxyl acylated curcumin-SDT led to a conspicuous loss of mitochondrial membrane potential (MMP compared with other groups, while MMP was increased significantly with the scavenger of singlet oxygen Sodium azide (NaN3, ROS inhibitor N-acetyl cysteine (NAC and Mitochondrial Permeability Transition Pore (MPTP inhibitor Cyclosporin A (CsA. The cytochrome C, cleaved-Caspase-9, cleaved-Caspase-3 and cleaved-PARP upregulated after SDT through Western blotting. These findings suggested that Hydroxyl acylated curcumin under low-intensity ultrasound had sonodynamic effect on THP-1 macrophages via generation of intracellular singlet oxygen and mitochondria
In-situ Strontium Isotopes Analysis on Single Conodont Apatite by LA-MC-ICP-MS
Zhao, L.; Zhang, L.; Chen, Z. Q.; Ma, D.; Qiu, H.; Lv, Z.; Hu, Z.; Wang, F.
2014-12-01
Strontium isotope played an important role in stratigraphic chronology and sedimentary geochemistry research (McArthur et al., 2001). Conodonts is a kind of extinct species of marine animals and widely distributed in marine sediments all over the world. Rich in radiogenic Sr contents and difficulty to be affected during diagenesis alteration makes conodonts a good choice in seawater Sr isotope composition studies (John et al., 2008). Conodont samples were collected from 24th to 39th layer across Permian-Triassic boundary at Meishan D section (GSSP), Zhejiang Province, South China (Yin et al., 2001). Conodonts was originated from fresh limestone and only conodont elements with CAIextinction events during the Permian-Triassic transition. Our study also makes is possible for high resolution 87Sr/ 86Sr ratio testing on the single conodont apatite and riched the in-situ studies on the conodont apatite, which of great significance for the future conodont Sr isotope research (Zhao et al., 2009; Zhao et al., 2013). Keywords: Conodonts, Strontium isotope, LA-MC-ICP-MS, Permian-Triassic transition, Meishan D section [1] John et al., 2008 3P[2] McArthur et al., 2001 J. of Geology [3] Yin et al., 2001 Episodes [4] Zhao et al., 2009 Earth Science J. of CUG [5] Zhao et al., 2013 GPC.
International Nuclear Information System (INIS)
Brown, R.W.; Gleadow, A.J.W.; Rust, D.J.; Summerfield, M.A.; De Wit, M.C.J.
1990-01-01
Apatite fission track ages and confined track length distributions have been determined for rock samples from the south-western continental margin of Africa. The apatite ages fall into two groups, one having early Cretaceous ages and mean confined track lengths of ∼ 14 μm with very few short tracks, and the other having older ages with confined track length distributions containing a significant proportion of strongly annealed tracks (<10 μm). In any particular area the older apatite ages only occur above a critical threshold elevation, forming a regional pattern in the data and indicating cooling of the upper few kilometres of the crust during the early cretaceous. This episode of cooling is shown to have been the consequence of an accelerated phase of erosion associated with the early stages of rifting and break-up of Gondwana, and correlates with sedimentation patterns derived from borehole data for the adjacent offshore basin. (author)
Energy Technology Data Exchange (ETDEWEB)
Brown, R.W.; Gleadow, A.J.W. (La Trobe Univ., Bundoora (Australia)); Rust, D.J.; Summerfield, M.A. (Edinburgh Univ. (UK)); De Wit, M.C.J. (De Beers Consolidated Mines Ltd., Kimberley (South Africa))
1990-01-01
Apatite fission track ages and confined track length distributions have been determined for rock samples from the south-western continental margin of Africa. The apatite ages fall into two groups, one having early Cretaceous ages and mean confined track lengths of {approx} 14 {mu}m with very few short tracks, and the other having older ages with confined track length distributions containing a significant proportion of strongly annealed tracks (<10 {mu}m). In any particular area the older apatite ages only occur above a critical threshold elevation, forming a regional pattern in the data and indicating cooling of the upper few kilometres of the crust during the early cretaceous. This episode of cooling is shown to have been the consequence of an accelerated phase of erosion associated with the early stages of rifting and break-up of Gondwana, and correlates with sedimentation patterns derived from borehole data for the adjacent offshore basin. (author).
Protein-free formation of bone-like apatite: New insights into the key role of carbonation.
Deymier, Alix C; Nair, Arun K; Depalle, Baptiste; Qin, Zhao; Arcot, Kashyap; Drouet, Christophe; Yoder, Claude H; Buehler, Markus J; Thomopoulos, Stavros; Genin, Guy M; Pasteris, Jill D
2017-05-01
The nanometer-sized plate-like morphology of bone mineral is necessary for proper bone mechanics and physiology. However, mechanisms regulating the morphology of these mineral nanocrystals remain unclear. The dominant hypothesis attributes the size and shape regulation to organic-mineral interactions. Here, we present data supporting the hypothesis that physicochemical effects of carbonate integration within the apatite lattice control the morphology, size, and mechanics of bioapatite mineral crystals. Carbonated apatites synthesized in the absence of organic molecules presented plate-like morphologies and nanoscale crystallite dimensions. Experimentally-determined crystallite size, lattice spacing, solubility and atomic order were modified by carbonate concentration. Molecular dynamics (MD) simulations and density functional theory (DFT) calculations predicted changes in surface energy and elastic moduli with carbonate concentration. Combining these results with a scaling law predicted the experimentally observed scaling of size and energetics with carbonate concentration. The experiments and models describe a clear mechanism by which crystal dimensions are controlled by carbonate substitution. Furthermore, the results demonstrate that carbonate substitution is sufficient to drive the formation of bone-like crystallites. This new understanding points to pathways for biomimetic synthesis of novel, nanostructured biomaterials. Copyright © 2017 Elsevier Ltd. All rights reserved.
Reactivity of glycyl-amino acids toward hydroxyl radical in neutral aqueous solutions
International Nuclear Information System (INIS)
Masuda, Takahiro; Iwashita, Naomi; Shinohara, Hiroyuki; Kondo, Masaharu
1978-01-01
Rate constants for reactions of hydroxyl radicals with several glycyl-amino acids were determined by a competition method using p-nitrosodimethylailine as a reference compound. For glycyl-aliphatic amino acids, the enhancement of reactivity was observed as compared with the corresponding free amino acids. The reactivity was explained qualitatively in terms of partial reactivities assigned to each C-H bond of the dipeptides. For glycyl-aromatic amino acids, the rate constants were found to be almost equal to those of the corresponding free amino acids. The reactivity of a protein toward hydroxyl radical was well understood by summation of the rate constants, corrected by steric factors, of amino acid residues located on surface of the protein. The enhanced reactivity of the aliphatic peptides was interpreted in terms of the difference in interaction energy between NH 2 - and NH 3 + -forms of an aliphatic amino acid, which was calculated for the system including glycine and hydroxyl radical according to CNDO/2 method. (auth.)
Electrolytic coloration and spectral properties of hydroxyl-doped potassium bromide single crystals
International Nuclear Information System (INIS)
Qi, Lan; Song, Cuiying; Gu, Hongen
2013-01-01
Hydroxyl-doped potassium bromide single crystals are colored electrolytically at various temperatures and voltages by using a pointed cathode and a flat anode. The characteristic OH − spectral band is observed in absorption spectrum of uncolored single crystal. The characteristic O − , OH − , U, V 2 , O 2− −V a + , M L1 , F and M spectral bands are observed simultaneously in absorption spectra of colored single crystals. Current–time curve for electrolytic coloration of hydroxyl-doped potassium bromide single crystal and its relationship with electrolytic coloration processes are given. Production and conversion of color centers are explained. - Highlights: ► We expanded the traditional electrolysis method. ► Hydroxyl-doped potassium bromide crystals were colored electrolytically for the first time. ► Useful V, F and F-aggregate color centers were produced in colored crystals. ► V color centers were produced directly and F as well as F-aggregate color centers indirectly.
Trimeric Hydrogen Bond in Geometrically Frustrated Hydroxyl Cobalt Halogenides
International Nuclear Information System (INIS)
Xiao-Dong, Liu; Masato, Hagihala; Xu-Guang, Zheng; Dong-Dong, Meng; Wan-Jun, Tao; Sen-Lin, Zhang; Qi-Xin, Guo
2011-01-01
The mid-infrared absorption spectra of geometrically frustrated hydroxyl cobalt halogenides Co 2 (OH) 3 Cl and Co 2 (OH) 3 Br are measured by FTIR spectrometers, and the stretching vibrational modes of hydroxyl groups are found to be 3549cm −1 and 3524cm −1 respectively. Through finding their true terminal O-H group stretching vibration frequencies, we obtain 107cm −1 and 99cm −1 red shift caused by the corresponding O-H···Cl and O-H···Br hydrogen bonds. Rarely reported trimeric hydrogen bonds (Co 3 ≡O-H) 3 ···Cl/Br are pointed out to demonstrate the relative weakness of this kind of hydrogen bond which may have a critical effect on the lattice symmetry and magnetic structures. (condensed matter: electronic structure, electrical, magnetic, and optical properties)
Directory of Open Access Journals (Sweden)
A. L. M. Maia F.
2013-12-01
Full Text Available The clinical challenge in the reconstruction of bone defects has stimulated several studies in search of alternatives to repair these defects. The ceramics are considered as synthetic scaffolds and are used in dentistry and orthopedics. This study aimed to evaluate by micro energy-dispersive X-ray fluorescence spectrometry (µ-EDXRF and scanning electron microscopy-energy dispersive spectroscopy (SEM-EDS, the influence of uncoated and apatite-coated Al2O3 implants on bone regeneration. Twelve samples of Al2O3 implants were prepared and half of this samples (n = 6 were apatite-coated by the modified biomimetic method and then the ceramic material were implanted in the tibia of rabbits. Three experimental groups were tested: Group C - control, surgery procedure without ceramic implant, Group Ce - uncoated Al2O3 implants (n = 6 and Group CeHA - apatite-coated Al2O3 implants (n = 6. The deposition of bone tissue was determined by measuring the weight content of Ca and P through surface mapping of bone-implant interface by µ-EDXRF and through point analysis by EDS. It was observed after thirty days of treatment a greater deposition of Ca and P in the group treated with CeHA (p <0.001 compared to group C. The results suggest that ceramic coated with hydroxyapatite (CeHA can be an auxiliary to bone deposition in tibia defect model in rabbits.
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
The use of 45S5 glass composition is one such material able to bond strongly to bone within 42 days. The 45S5 bioglass® ® system develops a hydroxyl carbonate apatite (HCA) layer, which is chemically and crystallographically similar to mineral phase of bone. But it has low fracture toughness and mechanical weakness ...
Iron-functionalized Al-SBA-15 for benzene hydroxylation
Li, Y.; Xia, H.; Fan, F.; Feng, Z.; Santen, van R.A.; Hensen, E.J.M.; Li, Can
2008-01-01
For the first time an ordered mesoporous silica (Fe–Al-SBA-15) with catalytically active isolated Fe surface species for the hydroxylation of benzene with nitrous oxide is prepared by introduction of Fe3+ in the synthesis gel of Al-SBA-15. Graphical abstract image for this article (ID: b717079c)
Energy Technology Data Exchange (ETDEWEB)
Audubert, F
1995-11-08
The aim of this thesis is the study of the conditioning of iodine 129 from the reprocessing of nuclear wastes. Because of its long half life (1.57 10{sup 7} years), the conditioning of iodine 129 requires a matrix stable during several thousands of years. The study of natural minerals allows the selection of mineral phases having a good long term behaviour. In the first part the policy of nuclear wastes management, and in particular of iodine, is recalled. A naturalistic approach is used to define the best conditioning material and the remarkable properties of apatite in this way are described. In the second part, the preparation and physical-chemical characterization of iodo-apatites are described. A demonstration is made that iodine can penetrate inside vanadate or lead phospho-vanadate apatite-based compounds. The third part deals with the preparation of the conditioning material. The sintering reaction under pressure allows the preparation of composite ceramics including iodo-apatite. A multi-layer coating process is defined: coating of PbI{sub 2} with a Pb{sub 3}(VO{sub 4}){sub 1.6}(PO{sub 4}){sub 0.4} layer and a Ca{sub 10}(PO{sub 4}){sub 6}F{sub 2} layer. Sintering is performed at 700 deg. celsius under a 25 MPa pressure. (J.S.). 131 refs.
The Influence of Hydroxylated Carbon Nanotubes on Epoxy Resin Composites
Directory of Open Access Journals (Sweden)
Jiaoxia Zhang
2012-01-01
Full Text Available Hydroxylated multiwall carbon nanotubes (MWNTs/epoxy resin nanocomposites were prepared with ultrasonic dispersion and casting molding. The effect of hydroxylated MWNTs content on reactive activity of composites is discussed. Then the flexural and electrical properties were studied. Transmission electron microscope was employed to characterize the microstructure of nanocomposites. As a result, the reactive activity of nanocomposites obtained increases with the increasing content of MWNTs. When MWNTs content of the composites is 1 wt%, as compared to neat resin, the flexural strength increases from 143 Mpa to 156 MPa, the modulus increases from 3563 Mpa to 3691 MPa, and the volume and surface resistance of nanocomposites decrease by two orders of magnitude, respectively.
Babot, Esteban D.; del Río, José C.; Cañellas, Marina; Sancho, Ferran; Lucas, Fátima; Guallar, Víctor; Kalum, Lisbeth; Lund, Henrik; Gröbe, Glenn; Scheibner, Katrin; Ullrich, René; Hofrichter, Martin; Martínez, Angel T.
2015-01-01
The goal of this study is the selective oxyfunctionalization of steroids under mild and environmentally friendly conditions using fungal enzymes. With this purpose, peroxygenases from three basidiomycete species were tested for the hydroxylation of a variety of steroidal compounds, using H2O2 as the only cosubstrate. Two of them are wild-type enzymes from Agrocybe aegerita and Marasmius rotula, and the third one is a recombinant enzyme from Coprinopsis cinerea. The enzymatic reactions on free and esterified sterols, steroid hydrocarbons, and ketones were monitored by gas chromatography, and the products were identified by mass spectrometry. Hydroxylation at the side chain over the steroidal rings was preferred, with the 25-hydroxyderivatives predominating. Interestingly, antiviral and other biological activities of 25-hydroxycholesterol have been reported recently (M. Blanc et al., Immunity 38:106–118, 2013, http://dx.doi.org/10.1016/j.immuni.2012.11.004). However, hydroxylation in the ring moiety and terminal hydroxylation at the side chain also was observed in some steroids, the former favored by the absence of oxygenated groups at C-3 and by the presence of conjugated double bonds in the rings. To understand the yield and selectivity differences between the different steroids, a computational study was performed using Protein Energy Landscape Exploration (PELE) software for dynamic ligand diffusion. These simulations showed that the active-site geometry and hydrophobicity favors the entrance of the steroid side chain, while the entrance of the ring is energetically penalized. Also, a direct correlation between the conversion rate and the side chain entrance ratio could be established that explains the various reaction yields observed. PMID:25862224
Radionuclide Incorporation and Long Term Performance of Apatite Waste Forms
Energy Technology Data Exchange (ETDEWEB)
Wang, Jianwei [Louisiana State Univ., Baton Rouge, LA (United States); Lian, Jie [Rensselaer Polytechnic Inst., Troy, NY (United States); Gao, Fei [Univ. of Michigan, Ann Arbor, MI (United States)
2016-01-04
This project aims to combines state-of-the-art experimental and characterization techniques with atomistic simulations based on density functional theory (DFT) and molecular dynamics (MD) simulations. With an initial focus on long-lived I-129 and other radionuclides such as Cs, Sr in apatite structure, specific research objectives include the atomic scale understanding of: (1) incorporation behavior of the radionuclides and their effects on the crystal chemistry and phase stability; (2) stability and microstructure evolution of designed waste forms under coupled temperature and radiation environments; (3) incorporation and migration energetics of radionuclides and release behaviors as probed by DFT and molecular dynamics (MD) simulations; and (4) chemical durability as measured in dissolution experiments for long term performance evaluation and model validation.
Formation of Hydroxylamine from Ammonia and Hydroxyl Radicals
Krim, Lahouari; Zins, Emilie-Laure
2014-06-01
In the interstellar medium, as well as in icy comets, ammonia may be a crucial species in the first step toward the formation of amino-acids and other prebiotic molecules such as hydroxylamine (NH2OH). It is worth to notice that the NH3/H2 ratio in the ISM is 3 10-5 compared the H2O/H2 one which is only 7 10-5. Using either electron-UV irradiations of water-ammonia ices or successive hydrogenation of solid nitric oxide, laboratory experiments have already shown the feasibility of reactions that may take place on the surface of ice grains in molecular clouds, and may lead to the formation of this precursor. Herein is proposed a new reaction pathway involving ammonia and hydroxyl radicals generated in a microwave discharge. Experimental studies, at 3 and 10 K, in solid phase as well as in neon matrix have shown that this reaction proceed via a hydrogen abstraction, leading to the formation of NH2 radical, that further recombine with hydroxyl radical to form hydroxylamine, under non-energetic conditions.
Thyroid hormone-like and estrogenic activity of hydroxylated PCBs in cell culture
International Nuclear Information System (INIS)
Kitamura, Shigeyuki; Jinno, Norimasa; Suzuki, Tomoharu; Sugihara, Kazumi; Ohta, Shigeru; Kuroki, Hiroaki; Fujimoto, Nariaki
2005-01-01
The thyroid hormone-disrupting activity of hydroxylated PCBs was examined. 4-Hydroxy-2,2',3,4',5,5'-hexachlorobiphenyl (4-OH-2,2',3,4',5,5'-HxCB), 4-hydroxy-3,3',4',5-tetrachlorobiphenyl (4-OH-3,3',4',5-TCB) and 4,4'-dihydroxy-3,3',5,5'-tetrachlorobiphenyl (4,4'-diOH-3,3',5,5'-TCB), which have been detected as metabolites of PCBs in animals and humans, and six other 4-hydroxylated PCBs markedly inhibited the binding of triiodothyronine (1 x 10 -10 M) to thyroid hormone receptor (TR) in the concentration range of 1 x 10 -6 to 1 x 10 -4 M. However, 4-hydroxy-2',4',6'-trichlorobiphenyl (4-OH-2',4',6'-TCB), 3-hydroxy-2,2',5,5'-tetrachlorobiphenyl, 4-hydroxy-2,2',5,5'-tetrachlorobiphenyl, 4-hydroxy-2,3,3',4'-tetrachlorobiphenyl, 2,3',5,5'-tetrachlorobiphenyl and 2,3',4',5,5'-pentachlorodiphenyl did not show affinity for TR. The thyroid hormonal activity of PCBs was also examined using rat pituitary cell line GH3 cells, which grow and release growth hormone in a thyroid hormone-dependent manner. 4-OH-2,2',3,4',5,5'-HxCB, 4,4'-diOH-3,3',5,5'-TCB and 4-OH-3,3',4',5-TCB enhanced the proliferation of GH3 cells and stimulated their production of growth hormone in the concentration range of 1 x 10 -7 to 1 x 10 -4 M, while PCBs which had no affinity for thyroid hormone receptor were inactive. In contrast, only 4-OH-2',4',6'-TCB exhibited a significant estrogenic activity using estrogen-responsive reporter assay in MCF-7 cells. However, the 3,5-dichloro substitution of 4-hydroxylated PCBs markedly decreased the estrogenic activity. These results suggest that, at least for the 17 PCB congeners and hydroxylated metabolites tested, a 4-hydroxyl group in PCBs is essential for thyroid hormonal and estrogenic activities, and that 3,5-dichloro substitution favors thyroid hormonal activity, but not estrogenic activity
International Nuclear Information System (INIS)
Louit, G.
2005-10-01
The hydroxyl radical is involved in a wide range of different fields, from oxidative stress to atmospheric chemistry. In addition to the study of oxidative damage in biological media, the hydroxyl radical detection allows to perform a dosimetry when it is produced by ionising radiation. The aims of this work have been double: - to improve the detection of the hydroxyl radical by the design of new probes - to improve knowledge on the reactive pathways in which the hydroxyl radical is involved. We have studied the coumarin molecule, as well as 6 derivatives that we have synthesised, as fluorescent probes of the hydroxyl radical. Firstly, fluorescence spectroscopy and HPLC chromatography have allowed the evaluation of the sensibility and selectivity of detection of the probes. Consequently to this study, two applications have been developed, concerning the determination of rate constants by competition kinetics and bidimensional dosimetry. Secondly, we have studied the reactivity of the hydroxyl radical through the regioselectivity of its addition on the aromatic cycle. This problem was addressed by the combined use of experimental methods such as time resolved kinetics and HPLC along with interpretation from classical and ab initio modelization. (author)
Structure, electronic properties, and aggregation behavior of hydroxylated carbon nanotubes
Energy Technology Data Exchange (ETDEWEB)
López-Oyama, A. B.; Silva-Molina, R. A.; Ruíz-García, J.; Guirado-López, R. A., E-mail: guirado@ifisica.uaslp.mx [Instituto de Física “Manuel Sandoval Vallarta,” Universidad Autónoma de San Luis Potosí, Álvaro Obregón 64, 78000 San Luis Potosí, San Luis Potosí (Mexico); Gámez-Corrales, R. [Departamento de Física, Universidad de Sonora, Apartado Postal 5-088, 83190, Hermosillo, Sonora (Mexico)
2014-11-07
We present a combined experimental and theoretical study to analyze the structure, electronic properties, and aggregation behavior of hydroxylated multiwalled carbon nanotubes (OH–MWCNT). Our MWCNTs have average diameters of ∼2 nm, lengths of approximately 100–300 nm, and a hydroxyl surface coverage θ∼0.1. When deposited on the air/water interface the OH–MWCNTs are partially soluble and the floating units interact and link with each other forming extended foam-like carbon networks. Surface pressure-area isotherms of the nanotube films are performed using the Langmuir balance method at different equilibration times. The films are transferred into a mica substrate and atomic force microscopy images show that the foam like structure is preserved and reveals fine details of their microstructure. Density functional theory calculations performed on model hydroxylated carbon nanotubes show that low energy atomic configurations are found when the OH groups form molecular islands on the nanotube's surface. This patchy behavior for the OH species is expected to produce nanotubes having reduced wettabilities, in line with experimental observations. OH doping yields nanotubes having small HOMO–LUMO energy gaps and generates a nanotube → OH direction for the charge transfer leading to the existence of more hole carriers in the structures. Our synthesized OH–MWCNTs might have promising applications.
Synthesis and properties evaluation of sulfobetaine surfactant with double hydroxyl
Zhou, Ming; Luo, Gang; Zhang, Ze; Li, Sisi; Wang, Chengwen
2017-09-01
A series of sulfobetaine surfactants {N-[(3-alkoxy-2-hydroxyl)propoxy] ethyl-N,N-dimethyl-N-(2-hydroxyl)propyl sulfonate} ammonium chloride were synthesized with raw materials containing linear saturated alcohol, N,N-dimethylethanolamine, sodium 3-chloro-2-hydroxyl propane sulfonic acid and epichlorohydrin. The molecule structures of sulfobetaine surfactants were characterized by FTIR, 1HNMR and elemental analysis. Surface tension measurements can provide us information about the surface tension at the CMC (γCMC), pC20, Γmax and Amin. The pC20 values of sulfobetaine surfactants increase with the hydrophobic chain length increasing. Amin values of the surfactants decrease with increasing hydrophobic chain length from 10 to 14. The critical micelle concentration (CMC) and surface tension (γCMC) values of the sulfobetaine surfactants decrease with increasing hydrophobic chain length from 10 to 16. The lipophilicity of surfactant was enhanced with the increase of the carbon chain, however, the ability of anti-hard water was weakened. The minimum oil/water interfacial tension of four kinds of sulfobetaine surfactants is 10-2-10-3 mN/m magnitude, which indicates that the synthesized bis-hydroxy sulfobetaine surfactants have a great ability to reduce interfacial tension in the surfactant flooding system. The surface tension (γCMC) values of synthesized surfactants were lower compared with conventional anionic surfactant sodium dodecyl sulfonate.
Energy Technology Data Exchange (ETDEWEB)
Cao, Shiyi [College of Physics and Electronic Science, Changsha University of Science and Technology, Changsha 410114 (China); Liu, Tiangui, E-mail: tianguiliu@gmail.com [College of Physics and Microelectronics Science, Hunan University, Changsha 410082 (China); Tsang, Yuenhong [Department of Applied Physics, The Hong Kong Polytechnic University, Hong Kong, 999077 (China); Chen, Chuansheng, E-mail: 1666423158@qq.com [College of Physics and Electronic Science, Changsha University of Science and Technology, Changsha 410114 (China)
2016-09-30
Graphical abstract: The structure model and enhancement mechanism of hydroxylation treatment on adsorbability and photocatalytic activity. - Highlights: • Highly-hydroxylated TiO{sub 2}/rGO hybrids can be obtained by UV pre-excitation and microwave method. • Surface hydroxylation induces many defects (Ti{sup 3+}, O vacancy and Ti-OH) and changes color into yellow. • Hydroxylation expands the light absorption up to about 600 nm and benefits to adsorb organic dyes. • ESR reveals the self-accumulation of hydroxyl radicals under the irradiation of UV and visible light. • The photoinduced defects and rGO/TiO{sub 2}@OH-TiO{sub 2} heterojunctions enable the excellent applicability. - Abstract: To extend the spectra response of TiO{sub 2} and enhance its photocatalytic activity, surface modification and catalyst supporter have attracted great attention. In this report, a simple and versatile approach has been developed to hydroxylate the reduced graphene oxide/TiO{sub 2} hybrids (OH-rGO/TiO{sub 2}) by UV-microwave method, and the enhanced mechanisms of hydroxylation were analyzed in details. Experimental results show that TiO{sub 2} nanocrystals@OH-TiO{sub 2} heterojunctions formed on rGO sheets in situ by UV/H{sub 2}O{sub 2} process. Hydroxylation not only can induce many surface defects (Ti{sup 3+}, O vacancy and Ti-OH) on the surface of TiO{sub 2}, but also change the color into yellow and strengthen the interaction between rGO and TiO{sub 2}. OH-rGO/TiO{sub 2} hybrids showed excellent durability for high-concentration dyes, and exhibited strong adsorbability and photocatalytic activity. These enhancements are attributed to the excellent property of rGO and surface defects of TiO{sub 2} induced by hydroxylation, which expand the light absorption up to 600 nm, benefit to the self-dispersion of hybrids, and improve the adsorption dynamic and charge transfer with lower carrier’s recombination.
Formation of hydroxyl radicals in the human lens is related to the severity of nuclear cataract
DEFF Research Database (Denmark)
Garner, B; Davies, Michael Jonathan; Truscott, R J
2000-01-01
Recent studies have identified specific hydroxylated amino acid oxidation products which strongly suggest the presence of hydroxyl radical (HO.)-damaged proteins in human cataractous lenses. In the present study, the ability of early stage (type II) and advanced (type IV) nuclear cataractous lens...
Ma, Xiaohua
2012-05-08
A newly designed diamine monomer, 3,3,3′,3′-tetramethyl-1, 1′-spirobisindane-5,5′-diamino-6,6′-diol, was successfully used to synthesize two types of polyimides for membrane-based gas separation applications. The novel polymers integrate significant microporosity and polar hydroxyl groups, showing the combined features of polymers of intrinsic microporosity (PIMs) and functional polyimides (PIs). They possess high thermal stability, good solubility, and easy processability for membrane fabrication; the resulting membranes exhibit good permeability owing to the intrinsic microporosity introduced by the highly contorted PIM segments as well as high CO 2/CH 4 selectivity that arises from the hydroxyl groups. The membranes show CO 2/CH 4 selectivities of >20 when tested with a 1:1 CO 2/CH 4 mixture for feed pressures up to 50 bar. In addition, the incorporation of hydroxyl groups and microporosity in the polymers enhances their affinity to water, leading to remarkable water sorption capacities of up to 22 wt % at 35 °C and 95% relative humidity. © 2012 American Chemical Society.
Valanezahad, Alireza; Ishikawa, Kunio; Tsuru, Kanji; Maruta, Michito; Matsuya, Shigeki
2011-01-01
To understand the feasibility of calcium (Ca) modification of type 316L stainless steel (316L SS) surface using hydrothermal treatment, 316L SS plates were treated hydrothermally in calcium chloride (CaCl(2)) solution. X-ray photoelectron spectroscopic analysis revealed that the surface of 316L SS plate was modified with Ca after hydrothermal treatment at 200°C. And the immobilized Ca increased with CaCl(2) concentration. However no Ca-modification was occurred for 316L SS plates treated at 100°C. When Ca-modified 316L SS plate was immersed in simulated body fluid (SBF) with ion concentrations nearly equal to those of human blood plasma, low crystalline apatite was precipitated on its surface whereas no precipitate was observed on non Ca-modified 316L SS. The results obtained in the present study indicated that hydrothermal treatment at 200°C in CaCl(2) solution is useful for Ca-modification of 316L SS, and Ca-modification plays important role for apatite precipitation in SBF.
International Nuclear Information System (INIS)
Campayo, L.
2003-04-01
Two phosphate-based materials were investigated for cesium immobilization after its partitioning from spent nuclear fuel: apatites and rhabdophanes. The incorporation of cesium into the apatitic lattice creates steric stresses. These stresses induce the formation of secondary phases which are rapidly leached. The effectiveness of the cesium immobilization in this material is not therefore validated. A second phosphate CsCaNd(PO 4 ) 2 was consistently found at the end of the leach test and its properties were further characterized. The structure of CsCaNd(PO 4 ) 2 , which is rhabdophane-like, is made of large channels which enable the incorporation of the largest alkaline cations. The synthesis involves two intermediates: the monazite, NdPO 4 , and a soluble phosphate, CsCaPO 4 . The study of a rhabdophane with 10 wt.% of cesium reveals satisfactory intrinsic properties: a thermal stability up to 1100 C and a leach rate of 10 -2 g/(m 2 .d). The next step will be to improve the reaction yield. (author)
International Nuclear Information System (INIS)
Chairat, C.; Oelkers, E.H.; Schott, J.; Lartigue, J.E.
2007-01-01
The surface chemistry of fluoro-apatite in aqueous solution was investigated using electrokinetic techniques, potentiometric titrations, solubility measurements, and attenuated total reflection infrared spectroscopy. All methods indicate the formation of Ca/F depleted, P enriched altered layer via exchange reactions between H + and Ca 2+ , and OH - and F - at the fluoro-apatite (FAP) surface. Observations suggest that this leached layer has a di-calcium phosphate (CaHPO 4 ) composition and that it controls the apparent solubility of FAP. Electrokinetic measurements yield an iso-electric point value of 1 ± 0.5 consistent with a negatively charged FAP surface at pH ≥ 1. In contrast, surface titrations give an apparent pH of point of zero charge of similar to 7.7, consistent with a positively charged surface at pH ≤ 7.7. These differences are shown to stem from proton consumption by both proton exchange and dissolution reactions at the FAP surface. After taking account for these effects, FAP surface charge is shown to be negative to at least pH 4 by surface titration analysis. (authors)
International Nuclear Information System (INIS)
Wagner, G.A.; Miller, D.S.
1979-01-01
Previous radiometric dating studies indicated that the Bergell region, in contrast to other regions of the Central Alps, experienced an early, rapid uplift, but with decreasing rate. Furthermore, there is also a geological record of the early uplift history of the Bergell granite by the existence of boulders which were derived from this granite and which occur in the Late Oligocene sediments of the Po plain. In this work the uplift history of the Bergell is studied in more detail by fission track dating of additional apatites from the Bergell region. Secondly, by determining apatite fission track ages the granitic boulders of the Po plain can be re-assigned to their original vertical position within the Bergell intrusive before erosion removed them in Late Oligocene time. A rather conservative estimate replaces them 6 km above the present morphology of the Bergell massif. Thus, the thickness of the Bergell granite must have been at least 8 km. Generally, fission track studies on boulders may become an important tool to study the vertical extent of mountain chains during the geological past. (Auth.)
Gallacher, Christopher; Thomas, Russell; Lord, Richard; Kalin, Robert M; Taylor, Chris
2017-08-15
Coal tars are a mixture of organic and inorganic compounds that were by-products from the manufactured gas and coke making industries. The tar compositions varied depending on many factors such as the temperature of production and the type of retort used. For this reason a comprehensive database of the compounds found in different tar types is of value to understand both how their compositions differ and what potential chemical hazards are present. This study focuses on the heterocyclic and hydroxylated compounds present in a database produced from 16 different tars from five different production processes. Samples of coal tar were extracted using accelerated solvent extraction (ASE) and derivatized post-extraction using N,O-bis(trimethylsilyl)trifluoroacetamide (BSTFA) with 1% trimethylchlorosilane (TMCS). The derivatized samples were analysed using two-dimensional gas chromatography combined with time-of-flight mass spectrometry (GCxGC/TOFMS). A total of 865 heterocyclic compounds and 359 hydroxylated polycyclic aromatic hydrocarbons (PAHs) were detected in 16 tar samples produced by five different processes. The contents of both heterocyclic and hydroxylated PAHs varied greatly with the production process used, with the heterocyclic compounds giving information about the feedstock used. Of the 359 hydroxylated PAHs detected the majority would not have been be detected without the use of derivatization. Coal tars produced using different production processes and feedstocks yielded tars with significantly different heterocyclic and hydroxylated contents. The concentrations of the individual heterocyclic compounds varied greatly even within the different production processes and provided information about the feedstock used to produce the tars. The hydroxylated PAH content of the samples provided important analytical information that would otherwise not have been obtained without the use of derivatization and GCxGC/TOFMS. Copyright © 2017 John Wiley & Sons, Ltd.
Yamamoto, S; Han, L; Noiri, Y; Okiji, T
2017-12-01
To evaluate the Ca 2+ -releasing, alkalizing and apatite-like surface precipitate-forming abilities of a prototype tricalcium silicate cement, which was mainly composed of synthetically prepared tricalcium silicate and zirconium oxide radiopacifier. The prototype tricalcium silicate cement, white ProRoot MTA (WMTA) and TheraCal LC (a light-cured resin-modified calcium silicate-filled material) were examined. The chemical compositions were analysed with a wavelength-dispersive X-ray spectroscopy electron probe microanalyser with an image observation function (SEM-EPMA). The pH and Ca 2+ concentrations of water in which the set materials had been immersed were measured, and the latter was assessed with the EDTA titration method. The surface precipitates formed on the materials immersed in phosphate-buffered saline (PBS) were analysed with SEM-EPMA and X-ray diffraction (XRD). Kruskal-Wallis tests followed by Mann-Whitney U-test with Bonferroni correction were used for statistical analysis (α = 0.05). The prototype cement contained Ca, Si and Zr as major elemental constituents, whereas it did not contain some metal elements that were detected in the other materials. The Ca 2+ concentrations and pH of the immersion water samples exhibited the following order: WMTA = prototype cement > TheraCal LC (P prototype cement and WMTA. The prototype tricalcium silicate cement exhibited similar Ca 2+ -releasing, alkalizing and apatite-like precipitate-forming abilities to WMTA. The Ca 2+ -releasing, alkalizing and apatite-like precipitate-forming abilities of TheraCal LC were lower than those of the other materials. © 2016 International Endodontic Journal. Published by John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Sergey V. Dorozhkin
2009-11-01
Full Text Available Recent developments in biomineralization have already demonstrated that nanosized particles play an important role in the formation of hard tissues of animals. Namely, the basic inorganic building blocks of bones and teeth of mammals are nanodimensional and nanocrystalline calcium orthophosphates (in the form of apatites of a biological origin. In mammals, tens to hundreds nanocrystals of a biological apatite were found to be combined into self-assembled structures under the control of various bioorganic matrixes. In addition, the structures of both dental enamel and bones could be mimicked by an oriented aggregation of nanosized calcium orthophosphates, determined by the biomolecules. The application and prospective use of nanodimensional and nanocrystalline calcium orthophosphates for a clinical repair of damaged bones and teeth are also known. For example, a greater viability and a better proliferation of various types of cells were detected on smaller crystals of calcium orthophosphates. Thus, the nanodimensional and nanocrystalline forms of calcium orthophosphates have a great potential to revolutionize the field of hard tissue engineering starting from bone repair and augmentation to the controlled drug delivery devices. This paper reviews current state of knowledge and recent developments of this subject starting from the synthesis and characterization to biomedical and clinical applications. More to the point, this review provides possible directions of future research and development.
MLS/Aura L2 Hydroxyl (OH) Mixing Ratio V002
National Aeronautics and Space Administration — ML2OH is the EOS Aura Microwave Limb Sounder (MLS) standard product for hydroxyl derived from radiances measured by the THz radiometer. The current version is 2.2....
Van Den Ham, Hendrika A.; Klungel, Olaf H.; Singer, Daniel E.; Leufkens, Hubert G.M.; Van Staa, Tjeerd P.
2014-01-01
Background: Atrial fibrillation (AF) increases the risk of ischaemic stroke and treatment with anticoagulants should be prescribed according to stroke risk. Objectives: To compare the predictive ability of the currently recommended CHA2DS2-VASc ischaemic stroke risk score with the new ATRIA stroke
Microbial carbonylation and hydroxylation of 20(R)-panaxadiol by Aspergillus niger.
Yan, Bin; Chen, Zhihua; Zhai, Xuguang; Yin, Guibo; Ai, Yafei; Chen, Guangtong
2018-04-01
20(R)-panaxadiol (PD) was metabolised by the fungus Aspergillus niger AS 3.3926 to its C-3 carbonylated metabolite and five other hydroxylated metabolites (1-6). Their structures were elucidated as 3-oxo-20(R)-panaxadiol (1), 3-oxo-7β-hydroxyl- 20(R)-panaxadiol (2), 3-oxo-7β,23α-dihydroxyl-20(R)-panaxadiol (3), 3,12-dioxo- 7β,23β-dihydroxyl-20(R)-panaxadiol (4), 3-oxo-1α,7β-dihydroxyl-20(R)-panaxadiol (5) and 3-oxo-7β,15β-dihydroxyl-20(R)-panaxadiol (6) by spectroscopic analysis. Among them, compounds 2-6 were new compounds. Pharmacological studies revealed that compound 6 exhibited significant anti-hepatic fibrosis activity.
International Nuclear Information System (INIS)
Liu Hongxu; Dong Wenming; Liu Zhangyue; Chen Xiaolin
2009-01-01
The apatite fission track dating and inversion result of geological thermal history of four rock specimens from Sawafuqi area and Talike area in northern Tarim Basin show that two areas uplifted at different ages. The apatite fission track ages of Sawafuqi range from 3.5 to 3.9 Ma, while the ages of Talike range from 53 to 59 Ma. The thermal history recorded by rock samples reveals that there are at least three prominent cooling phases since Late Cretaceous epoch. Detailed study was made on the division of uplifting stages during Mesozoic and Cenozoic tectonic evolution with the existing data in northern Tarim area. And new ideas on tectonic evolution and sandstone-type uranium mineralization have been put forward by combining with the sandstone-type uranium mineralization ages in this area.(authors)
The effect of hydroxylation on CNT to form Chitosan-CNT composites: A DFT study
International Nuclear Information System (INIS)
Yu, Rui; Ran, Maofei; Wen, Jie; Sun, Wenjing; Chu, Wei; Jiang, Chengfa; He, Zhiwei
2015-01-01
Graphical abstract: - Highlights: • The effect of hydroxylation on CNT to form Chitosan-CNT composites was studied. • The adsorption of Chitosan on CNTs is very weak by electrostatic interactions. • Chitosan loads onto CNT-OH_n via hydrogen-bond interactions. • Chitosan transfers electron to CNT-OH_n and thus improves the reactivity of CNT. - Abstract: The effect of types of CNTs (pristine and hydroxylated) on the synthesis of Chitosan-CNT (CS-CNT) composites was investigated theoretically. The adsorption energy (E_a_d_s) of CS on the pristine CNT and hydroxylated CNTs (CNT-OH_n, n = 1–6) as well as the structural and electronic properties of said composites have been investigated. Results show that the adsorption of CS on CNT and CNT-OH_n is thermodynamically favored. The E_a_d_s of CS on CNTs was calculated to be −20.387 kcal/mol from electrostatic interactions. For CS adsorbed into CNT-OH_n, E_a_d_s ranges from −20.612 to −37.567 kcal/mol. Hydroxyl groups on CNT are the main adsorption sites for CS loading onto CNT-OH_n via hydrogen-bond interactions. The CS-CNT-OH_3 is the most sable composite among tested complexes. The energy gap (ΔE_g_a_p) of CS-CNT-OH_3 was calculated less than pristine CNT and CNT-OH_3, indicative of the composites being more reactive than that of pristine CNTs and CNT-OH_3. It was proved that CS can transfer electron to the hydroxylated CNTs, thus overcoming the drawbacks of CNTs being chemically inert.
The effect of hydroxylation on CNT to form Chitosan-CNT composites: A DFT study
Energy Technology Data Exchange (ETDEWEB)
Yu, Rui [China-America Cancer Research Institute, Key Laboratory for Medical Molecular Diagnostics of Guangdong Province, Guangdong Medical University, Dongguan, Guangdong 523808 (China); Department of Chemical Engineering, Sichuan University, Chengdu 610065 (China); Ran, Maofei [College of Chemistry & Environment Protection Engineering, Southwest University for Nationalities, Chengdu 610041, Sichuan (China); Wen, Jie [College of Chemistry and Chemical Engineering, Southwest Petroleum University, Chengdu 610500, Sichuan (China); Sun, Wenjing, E-mail: swj_gdmc@163.com [China-America Cancer Research Institute, Key Laboratory for Medical Molecular Diagnostics of Guangdong Province, Guangdong Medical University, Dongguan, Guangdong 523808 (China); Chu, Wei; Jiang, Chengfa [Department of Chemical Engineering, Sichuan University, Chengdu 610065 (China); He, Zhiwei, E-mail: zhiweihe688@yahoo.com [China-America Cancer Research Institute, Key Laboratory for Medical Molecular Diagnostics of Guangdong Province, Guangdong Medical University, Dongguan, Guangdong 523808 (China)
2015-12-30
Graphical abstract: - Highlights: • The effect of hydroxylation on CNT to form Chitosan-CNT composites was studied. • The adsorption of Chitosan on CNTs is very weak by electrostatic interactions. • Chitosan loads onto CNT-OH{sub n} via hydrogen-bond interactions. • Chitosan transfers electron to CNT-OH{sub n} and thus improves the reactivity of CNT. - Abstract: The effect of types of CNTs (pristine and hydroxylated) on the synthesis of Chitosan-CNT (CS-CNT) composites was investigated theoretically. The adsorption energy (E{sub ads}) of CS on the pristine CNT and hydroxylated CNTs (CNT-OH{sub n}, n = 1–6) as well as the structural and electronic properties of said composites have been investigated. Results show that the adsorption of CS on CNT and CNT-OH{sub n} is thermodynamically favored. The E{sub ads} of CS on CNTs was calculated to be −20.387 kcal/mol from electrostatic interactions. For CS adsorbed into CNT-OH{sub n}, E{sub ads} ranges from −20.612 to −37.567 kcal/mol. Hydroxyl groups on CNT are the main adsorption sites for CS loading onto CNT-OH{sub n} via hydrogen-bond interactions. The CS-CNT-OH{sub 3} is the most sable composite among tested complexes. The energy gap (ΔE{sub gap}) of CS-CNT-OH{sub 3} was calculated less than pristine CNT and CNT-OH{sub 3}, indicative of the composites being more reactive than that of pristine CNTs and CNT-OH{sub 3}. It was proved that CS can transfer electron to the hydroxylated CNTs, thus overcoming the drawbacks of CNTs being chemically inert.
Van Den Ham, H.A.; Klungel, O.H.; Singer, D.E.; Leufkens, H.G.M.; Van Staa, T.P.
2014-01-01
Purpose: To compare the predictive ability of the currently recommended CHA2DS2-VASc ischaemic stroke risk score with the new ATRIA stroke risk score in patients with atrial fibrillation (AF). Methods: Patients with AF, not using warfarin, were assembled from the Clinical Practice Research Datalink
Stability, electrochemical behaviors and electronic structures of iron hydroxyl-phosphate
International Nuclear Information System (INIS)
Wang Zhongli; Sun Shaorui; Li Fan; Chen Ge; Xia Dingguo; Zhao Ting; Chu Wangsheng; Wu Ziyu
2010-01-01
Iron hydroxyl-phosphate with a uniform spherical particle size of around 1 μm, a compound of the type Fe 2-y □ y (PO 4 )(OH) 3-3y (H 2 O) 3y-2 (where □ represents a vacancy), has been synthesized by hydrothermal methods. The particles are composed of spheres of diameter -1 and 120 mAh g -1 at current densities of 170 mA g -1 and 680 mA g -1 , respectively. The stability of crystal structure of this material was studied by TGA and XRD which show that the material remains stable at least up to the temperature 200 deg. C. Investigation of the electronic structure of the iron hydroxyl-phosphate by GGA + U calculation has indicated that it has a better electronic conductivity than LiFePO 4 .
Covalent modification of calcium hydroxyapatite surface by grafting phenyl phosphonate moieties
International Nuclear Information System (INIS)
Aissa, Abdallah; Debbabi, Mongi; Gruselle, Michel; Thouvenot, Rene; Gredin, Patrick; Traksmaa, Rainer; Tonsuaadu, Kaia
2007-01-01
The reaction between phenyl phosphonic dichloride (C 6 H 5 P(O)Cl 2 ) and synthetic calcium hydroxy- and fluorapatite has been investigated. The presence of mono- or polymeric (C 6 H 5 PO) fragment bound to hydroxyapatite was evidenced by IR, and solid-state 31 P NMR spectroscopy. X-ray powder analysis has shown that the apatitic structure remains unchanged during the reaction. In contrast, no reaction was found using fluorapatite. According to the results found for these two different apatites a mechanism was proposed for the formation of covalent P-O-P bonds as the result of a reaction between the C 6 H 5 P(O)Cl 2 organic reagent and (HPO 4 ) - and/or OH - ions of the hydroxyapatite. - Graphical abstract: Representation of the first step of the reaction between the phenyl phosphonic dichloride and the hydroxyl groups on the surface of the apatite, leading to covalent P-O-P bond with elimination of HCl
Lanthanum germanate-based apatites as electrolyte for SOFCs
Energy Technology Data Exchange (ETDEWEB)
Marrero-Lopez, D.; Diaz-Carrasco, P.; Ramos-Barrado, J.R. [Departamento de Fisica Aplicada I, Laboratorio de Materiales y Superficies (Unidad Asociada al C.S.I.C.), Universidad de Malaga, 29071 Malaga (Spain); Pena-Martinez, J. [Instituto de Energias Renovables, Parque Tecnologico, Universidad de Castilla La Mancha, 02006 Albacete (Spain); Ruiz-Morales, J.C. [Departamento de Quimica Inorganica, Universidad de La Laguna, 38200 La Laguna, Tenerife (Spain)
2011-02-15
Germanate apatites with composition La{sub 10-x}Ge{sub 5.5}Al{sub 0.5}O{sub 26.75-3x/2} have been evaluated for the first time as possible electrolytes for solid oxide fuel cells (SOFCs). Different electrode materials have been considered in this study, i.e. manganite, ferrite, nickelates and cobaltite as cathode materials; and NiO-CGO composite and chromium-manganite as anodes. The chemical compatibility and electrochemical performance of these electrodes with La{sub 9.8}Ge{sub 5.5}Al{sub 0.5}O{sub 26.45} have been studied by X-ray powder diffraction (XRPD) and impedance spectroscopy. The XRPD analysis did not reveal appreciable bulk reactivity with the formation of reaction products between the germanate electrolyte and these electrodes up to 1,200 C. However, a significant cation interdiffusion was observed by energy dispersive spectroscopy (EDS) at the electrode/electrolyte interface, which leads to a significant decrease of the performance of these electrodes. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Bile acid synthesis in man. In vivo activity of the 25-hydroxylation pathway
International Nuclear Information System (INIS)
Duane, W.C.; Pooler, P.A.; Hamilton, J.N.
1988-01-01
During biosynthesis of bile acid, carbons 25-26-27 are removed from the cholesterol side-chain. Side-chain oxidation begins either with hydroxylation at the 26-position, in which case the three-carbon fragment is released as propionic acid, or with hydroxylation at the 25-position, in which case the three-carbon fragment is released as acetone. We have previously shown in the rat that the contribution of the 25-hydroxylation pathway can be quantitated in vivo by measuring production of [ 14 C]acetone from [ 14 C]26-cholesterol. In the present study, we adapted this method to human subjects. 4 d after oral administration of 100 microCi of [ 14 C]26-cholesterol and 1 d after beginning a constant infusion of 16.6 mumol/min unlabeled acetone, three men and two women underwent breath collections. Expired acetone was trapped and purified as the 2,4 dinitrophenylhydrazine derivative. 14 CO 2 was trapped quantitatively using phenethylamine. Specific activity of breath acetone was multiplied by the acetone infusion rate to calculate production of [ 14 C]acetone. [ 14 C]Acetone production averaged 4.9% of total release of 14 C from [ 14 C]26-cholesterol, estimated by 14 CO2 output. The method was validated by showing that [ 14 C]acetone production from [ 14 C]isopropanol averaged 86.9% of the [ 14 C]-isopropanol infusion rate. We conclude that in man, as in the rat, the 25-hydroxylation pathway accounts for less than 5% of bile acid synthesis
Khatri, Yogan; Jóźwik, Ilona K; Ringle, Michael; Ionescu, Irina Alexandra; Litzenburger, Martin; Hutter, Michael Christopher; Thunnissen, Andy-Mark W H; Bernhardt, Rita
The production of regio- and stereoselectively hydroxylated steroids is of high pharmaceutical interest and can be achieved by cytochrome P450-based biocatalysts. CYP260A1 from Sorangium cellulosum strain So ce56 catalyzes hydroxylation of C19 or C21 steroids at the very unique 1-position. However,
On-line sampling of apatite-nepheline ore using apron feeders by gamma-gamma method
Energy Technology Data Exchange (ETDEWEB)
Bliznyuk, G.I.
1981-01-01
The yield flow of an underground mine equipped with a crushing complex was investigated. /sup 241/Am source and 20x20 mm NaI(Tl) crystal were used; the lump size of apatite-nepheline ore was 200 mm, P/sub 2/O/sub 5/ content varied from 10 to 22%. The mean-square error was 1% P/sub 2/O/sub 5/ in 100-ton portions of mined ore. The method can be also applied for sampling iron, copper-nickel, and polymetallic ores.
Czech Academy of Sciences Publication Activity Database
Martínek, K.; Svojtka, Martin; Filip, Jiří
2006-01-01
Roč. 20, - (2006), s. 91-92 ISSN 1210-9606. [Meeting of the Central European Tectonic Studies Group /4./. Zakopane, 19.04.2006-22.04.2006] Institutional research plan: CEZ:AV0Z30130516 Keywords : fission-track * Krkonoše * apatite Subject RIV: DB - Geology ; Mineralogy http://geolines.gli.cas.cz/fileadmin/volumes/volume20/G20-091b.pdf
Y. Michelin; C. Poix
1998-01-01
By using a discrete event method, simulation of land use evolution has been applied to a landscape model of “la ChaÎne des Puys” (French Massif Central) during along period (XV–XVIII centuries). The indications concerning the evolution of land use are in conformity with the observation of actual situations but the dynamic changes are faster than in actual facts. In spite of limitations due to necessary simplifications, it is now established that the discrete event method is efficient to simu...
Directory of Open Access Journals (Sweden)
Fitya Syarifa Mozar
2017-06-01
Full Text Available pH sensitive nanoparticles of carbonate apatite (CA have been proven to be effective delivery vehicles for DNA, siRNAs and proteins. More recently, conventional anti-cancer drugs, such as doxorubicin, methotrexate and cyclophosphamide have been successfully incorporated into CA for intracellular delivery to breast cancer cells. However, physical and chemical properties of drug molecules appeared to affect their interactions with CA, with hydrophillic drug so far exhibiting better binding affinity and cellular uptakes compared to hydrophobic drugs. In this study, anastrozole, a non-steroidal aromatase inhibitor which is largely hydrophobic, and gemcitabine, a hydrophilic nucleoside inhibitor were used as solubility models of chemotherapy drug. Aggregation tendency of poorly soluble drugs resulting in larger particle-drug complex size might be the main factor hindering their delivery effectiveness. For the first time, surface modification of CA with poly(ethylene glycol (PEG has shown promising result to drastically reduce anastrozole- loaded CA particle size, from approximately 1000 to 500 nm based on zeta sizer analysis. Besides PEG, a cell specific ligand, in this case fibronectin, was attached to the particles in order to facilitate receptor mediated endocytosis based on fibronectin–integrin interaction. High-performance liquid chromatography (HPLC was performed to measure uptake of the drugs by breast cancer cells, revealing that surface modification increased the drug uptake, especially for the hydrophobic drug, compared to the uncoated particles and the free drug. In vitro chemosensitivity assay and in vivo tumor regression study also showed that coated apatite/drug nanoparticle complexes presented higher cytotoxicity and tumor regression effects than uncoated apatite/drug nanoparticles and free drugs, indicating that surface modification successfully created optimum particles size with the consequence of more effective uptake along with
Energy Technology Data Exchange (ETDEWEB)
Kumar, P. Nandha; Mishra, Sandeep K.; Kannan, S., E-mail: para_kanna@yahoo.com
2015-11-15
A series of magnesium doped non-stoichiometric calcium deficient apatites were synthesized through an aqueous precipitation route. The resultant structural changes during heat treatment were investigated by X-ray diffraction, Raman and FT-IR spectroscopy and Rietveld refinement. The results confirmed the formation of biphasic mixtures comprising Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2} and β-Ca{sub 3}(PO{sub 4}){sub 2} after heat treatment at 1000 °C with the preferential occupancy of Mg{sup 2+} at the crystal lattice of β-Ca{sub 3}(PO{sub 4}){sub 2}. The concentration of Mg{sup 2+} uptake in β-Ca{sub 3}(PO{sub 4}){sub 2} is limited till reaching the stoichiometric ratio of (Ca+Mg)/P=1.67 and beyond this stoichiometric value [(Ca+Mg)/P>1.67], Mg{sup 2+} precipitates as Mg(OH){sub 2} and thereafter gets converted to MgO during heat treatment. Any kind of Mg{sup 2+} uptake in the crystal lattice of Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2} is discarded from the investigation. - Highlights: • Aqueous co-precipitation of calcium deficient apatites with excess magnesium (Mg{sup 2+}) additions. • Heat treatments beyond 800 °C results in the formation of biphasic apatite mixtures. • Mg{sup 2+} gets accommodated at the β-Ca{sub 3}(PO{sub 4}){sub 2} lattice of biphasic mixtures. • Mg{sup 2+} additions exceeding stoichiometric value (Ca/P>1.67) results in its formation as MgO. • Mg{sup 2+} occupancy at β-Ca{sub 3}(PO{sub 4}){sub 2} lattice delays its allotropic conversion α-Ca{sub 3}(PO{sub 4}){sub 2} till 1350 °C.
Hydroxyl radical scavenging activity of peptide from sea cucumber ...
African Journals Online (AJOL)
enzyme complex, sea cucumber protein hydrolysis was carried out to obtain hydrolysates that have hydroxyl-radical-scavenging activity (HRSA). The hydrolytic process was monitored by HRSA and conditions for this process were optimized as follows: pH 6.5, temperature 35°C, 12 mg enzyme complex in a reaction solution ...
Hydroxylative activity of Aspergillus niger towards androst-4-ene and androst-5-ene steroids.
Świzdor, Alina; Panek, Anna; Milecka-Tronina, Natalia
2017-10-01
Aspergillus niger, one of fungal species most frequently used for experimental and industrial-scale biotransformations of various organic compounds, is generally known to transform steroids at 16β position. In this work, application of the strain A. niger KCH910 to bioconversion of dehydroepiandrosterone (DHEA), androstenediol and testosterone is described, with emphasis on the metabolic steps leading to the products. Evidence from this study indicated that incubated 5-ene steroids underwent bioconversion within two metabolic pathways: oxidation by the action of 3β-HSD (3β-hydroxysteroid dehydrogenase) to 4-ene steroids, and minor allylic hydroxylation to epimeric 7-alcohols. Further transformation of the 3-oxo-4-ene metabolites resulted in non-selective 16-hydroxylation. It is the first report on an A. niger strain able to introduce not only 16β- but also 16α-hydroxyl function into steroids. Copyright © 2017. Published by Elsevier Inc.
Lee, Seon Hwa; Kyung, Hyunsook; Yokota, Ryo; Goto, Takaaki; Oe, Tomoyuki
2015-01-20
The hydroxyl radical-mediated oxidation of peptides and proteins constitutes a large group of post-translational modifications that can result in structural and functional changes. These oxidations can lead to hydroxylation, sulfoxidation, or carbonylation of certain amino acid residues and cleavage of peptide bonds. In addition, hydroxyl radicals can convert the N-terminus of peptides to an α-ketoamide via abstraction of the N-terminal α-hydrogen and hydrolysis of the ketimine intermediate. In the present study, we identified N-terminal cyclization as a novel modification mediated by a hydroxyl radical. The reaction of angiotensin (Ang) II (DRVYIHPF) and the hydroxyl radical generated by the Cu(II)/ascorbic acid (AA) system or UV/hydrogen peroxide system produced N-terminal cyclized-Ang II (Ang C) and pyruvamide-Ang II (Ang P, CH3COCONH-RVYIHPF). The structure of Ang C was confirmed by mass spectrometry and comparison to an authentic standard. The subsequent incubation of isolated Ang P in the presence of Cu(II)/AA revealed that Ang P was the direct precursor of Ang C. The proposed mechanism involves the formation of a nitrogen-centered (aminyl) radical, which cyclizes to form a five-membered ring containing the alkoxy radical. The subsequent β-scission reaction of the alkoxyl radical results in the cleavage of the terminal CH3CO group. The initial aminyl radical can be stabilized by chelation to the Cu(II) ions. The affinity of Ang C toward the Ang II type 1 receptor was significantly lower than that of Ang II or Ang P. Ang C was not further metabolized by aminopeptidase A, which converts Ang II to Ang III. Hydroxyl radical-mediated N-terminal cyclization was also observed in other Ang peptides containing N-terminal alanine, arginine, valine, and amyloid β 1-11 (DAEFRHDSGYE).
Optimization of CHA-PCFC Hybrid Material for the Removal of Radioactive Cs from Waste Seawater
Energy Technology Data Exchange (ETDEWEB)
Lee, Keun-Young; Kim, Jimin; Park, Minsung; Kim, Kwang-Wook; Lee, Eil-Hee; Chung, Dong-Yong; Moon, Jei-Kwon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2015-05-15
The liquid waste treatment processes in the normal operation of nuclear power plant are commercialized, those in the abnormal accidents have not been fully developed until now. In the present study, as a preliminary research for the development of precipitation-based treatment process specialized for the removal of Cs from waste seawater generated in the emergency case, the performance test of a hybrid material combining chabazite and potassium cobalt ferrocyanide was conducted. Also the synthesis method for the hybrid adsorbent was optimized for the best Cs removal efficiency on the actual contamination level of waste seawater. Because the temperature effect on the synthesis of PCFC was confirmed by preliminary experiments, the optimization of CHA-PCFC synthesis was also conducted. The hybrid material synthesized at 40 .deg. C showed the highest distribution coefficient of Cs in the same manner of the performance of PCFC synthesized at the lower temperature than that of conventional methods.
Winn, C.; Karlstrom, K. E.; Shuster, D. L.; Kelley, S.; Fox, M.
2017-12-01
The application of low-temperature apatite thermochronology to the incision history of the Grand Canyon has led to conflicting hypotheses of either a 70 Ma ("old") or conflict with these lines of evidence and indicate a much older ( 70 Ma) westernmost Grand Canyon. We reconcile this conflict by applying apatite (U-Th)/He ages (AHe), 4He/3He thermochronometry, and apatite fission track ages and lengths (AFT) to the same sample at a key location. Using HeFTy, t-T paths that predict these data show cooling from ˜100 °C to 40-60 °C at 70-50 Ma, long-term residence at 40-60 °C from 50-10 Ma, and cooling to surface temperatures after 10 Ma, indicating young incision. New AFT (5) and AHe (3) datasets are also presented here. When datasets are examined separately, AHe data show t-T paths that cool to surface temperatures during the Laramide, consistent with an "old" Canyon. When multiple methods are applied, t-T paths instead show young incision. This inconsistency demonstrates the age of the Grand Canyon controversy. Here we reconcile the difference in t-T paths by adjusting model parameters to account for uncertainty in the rate of radiation damage annealing in apatite during burial heating and the resulting variations in He retentivity. In this area, peak burial conditions during the Laramide were likely insufficient to fully anneal radiation damage that accumulated during prolonged near-surface residence prior to burial. We conclude that application of multiple thermochronometers from common rocks reconciles conflicting thermochronologic interpretations and these data are best explained by a "young" westernmost Grand Canyon.
Jung, E M; Kubale, R; Jungius, K-P; Jung, W; Lenhart, M; Clevert, D-A
2006-01-01
To investigate the dynamic value of contrast medium-enhanced ultrasonography with Optison for appraisal of the vascularization of hepatic tumors using harmonic imaging, 3D-/power Doppler and B-flow. 60 patients with a mean age of 56 years (range 35-76 years) with 93 liver tumors, including histopathologically proven hepatocellular carcinoma (HCC) [15 cases with 20 lesions], liver metastases of colorectal tumors [17 cases with 33 lesions], metastases of breast cancer [10 cases with 21 lesions] and hemangiomas [10 cases with 19 lesions] were prospectively investigated by means of multislice CT as well as native and contrast medium-enhanced ultrasound using a multifrequency transducer (2.5-4 MHz, Logig 9, GE). B scan was performed with additional color and power Doppler, followed by a bolus injection of 0.5 ml Optison. Tumor vascularization was evaluated with coded harmonic angio (CHA), pulse inversion imaging with power Doppler, 3D power Doppler and in the late phase (>5 min) with B-flow. In 15 cases with HCC, i.a. DSA was performed in addition. The results were also correlated with MRT and histological findings. Compared to spiral-CT/MRT, only 72/93 (77%) of the lesions could be detected in the B scan, 75/93 (81%) with CHA and 93/93 (100%) in the pulse inversion mode. Tumor vascularization was detectable in 43/93 (46%) of lesions with native power Doppler, in 75/93 (81%) of lesions after administering contrast medium in the CHA mode, in 81/93 (87%) of lesions in the pulse inversion mode with power Doppler and in 77/93 (83%) of lesions with contrast-enhanced B-flow. Early arterial and capillary perfusion was best detected with CHA, particularly in 20/20 (100%) of the HCC lesions, allowing a 3D reconstruction. 3D power Doppler was especially useful in investigating the tumor margins. Up to 20 min after contrast medium injection, B-flow was capable of detecting increased metastatic tumor vascularization in 42/54 (78%) of cases and intratumoral perfusion in 17/20 (85
Heyno, Eiri; Mary, Véronique; Schopfer, Peter; Krieger-Liszkay, Anja
2011-07-01
Production of reactive oxygen species (hydroxyl radicals, superoxide radicals and hydrogen peroxide) was studied using EPR spin-trapping techniques and specific dyes in isolated plasma membranes from the growing and the non-growing zones of hypocotyls and roots of etiolated soybean seedlings as well as coleoptiles and roots of etiolated maize seedlings. NAD(P)H mediated the production of superoxide in all plasma membrane samples. Hydroxyl radicals were only produced by the membranes of the hypocotyl growing zone when a Fenton catalyst (FeEDTA) was present. By contrast, in membranes from other parts of the seedlings a low rate of spontaneous hydroxyl radical formation was observed due to the presence of small amounts of tightly bound peroxidase. It is concluded that apoplastic hydroxyl radical generation depends fully, or for the most part, on peroxidase localized in the cell wall. In soybean plasma membranes from the growing zone of the hypocotyl pharmacological tests showed that the superoxide production could potentially be attributed to the action of at least two enzymes, an NADPH oxidase and, in the presence of menadione, a quinone reductase.
International Nuclear Information System (INIS)
Chen Xiaoning; Yuan Wanming; Hao Nana; Duan Hongwei; Feng Yunlei; Zhang Aikui
2014-01-01
Background: Qimantage is an important tectonic metallogenic belt in western part of East Kunlun Mountain. It has experienced complex geological evolution, and significant mineralization. However, because of the plateau climate and inaccessibility, fewer research works have been done on this area, especially after Indo-sinian epoch. Purpose: Our work is to research tectonic activity, thermal history and uplifting around Bayinguole river in Qimantage belt. Methods: The apatite fission-track method was applied to research the tectonic setting, simulate the thermal history and calculate the uplift size and uplift speed. Results: A series of apatite fission track ages from granitoid samples in Bayinguole area of Eastern Kunlun Mountain were obtained, ranging from 120 Ma to 47 Ma that might be divided into three groups': 120-100 Ma, 67 Ma and 54-47 Ma. These ages reflected tectonic events in this area very well. Conclusions: The 120-100 Ma and 67 Ma ages present collision-convergences of Gangdese terrane and Himalayan terrane with their north-side terranes in Early Cretaceous and Late Cretaceous respectively. The ages of 54-47 Ma reflect post-orogenic stretching events in Eocene. Three stages of thermal evolution history are revealed by apatite fission track modeling in this area. Stage one 180-140 Ma is in the bottom temperature of apatite fission track anneal zone. Stage two 140-13 Ma records slow cooling. The last stage after 13 Ma records rapid cooling with temperature dropped 50℃. The uplifting ranges for these three stages are 1.0 km, 0.6 km and 1.4 km, respectively. The cumulative amount of uplift is about 3.0 km. The formula calculations for the 3 samples have their rock uplifts of 3623 m, 3317 m and 3769 m, respectively, averaging 3570 m, in accordance with the results based on the 3 stage thermal history. (authors)
Energy Technology Data Exchange (ETDEWEB)
Rovetta, M. R.; Blacic, J. D.; Hervig, R. L.; Holloway, J. R.
1989-05-10
We have measured the concentrations of hydroxyl, deuterium, Al, Fe, Li,Na, K, and Rb in a natural quartz crystal before and after hydrothermaltreatment at 1.5 GPa and 800/degree/--1050 /degree/C. We employed microbeam infraredspectroscopy and ion probe techniques to avoid impurities trapped in healedcracks and fluid inclusions that might bias a normal bulk analysis.The /ital f//sub H/sub 2// of our experiments were buffered to thehematite-magnetite-(OH)fluid, nickel-nickel oxide-(OH)fluid, oriron-wustite-(OH)fluid phase assemblages. After hydrothermal treatment,the samples contained local concentrations of hydrogen or deuterium ofseveral hundred atoms/10/sup 6/ Si (the starting crystal contained 45 H/10/sup 6/ Si).We did several experiments with Al/sub 2/O/sub 3/ or RbCl added to the sample chargeand found local Al enrichment where the deuterium concentration was highbut no Rb enrichment. Finally, we measured trace elements and hydroxyl in aquartz sample after plastic deformation in a talc furnace assembly; inregions of the sample containing basal and prismatic deformation lamellae(but no visible healed microcracks at 400/times/ optical magnification)hydroxyl had increased to /similar to/200 oO/10/sup 6/ Si with no increase in Al or Fe.Samples enriched in hydroxyl but not Al (including the plastically strainedsample) gave infrared spectra resembling natural amethyst crystals.
Directory of Open Access Journals (Sweden)
Adrian Paz Ramos
Full Text Available The biomimetic method is used for the deposition of calcium phosphate coatings (Ca - P on the surface of different biomaterials. However, the application of this method requires long exposure times in order to obtain a suitable layer thickness for its use in medical devices. In this paper, we present a fast approach to obtain apatite coatings on titanium, using a combination of supersaturated calcification solution (SCS with chemical modification of the titanium surface. Also, it was evaluated the effect of four different surface treatments on the apatite deposition rate. Commercially pure titanium plates were activated by chemical or thermochemical treatments. Then, the activated samples were immersed in a solution with high content of calcium and phosphate ions at 37 ºC for 24 h, mimicking the physiological conditions. The coatings were studied by Fourier transform infrared spectroscopy (FTIR, X-ray diffraction (XRD, scanning electron microscopy (SEM and energy dispersive X-ray spectroscopy (EDX. The use of SCS solutions allowed the formation of crystalline hydroxyapatite coatings within a period of 24 h with a thickness between 1 and 5.3 µm. Besides, precipitates of hydroxyapatite nanoparticles with a globular configuration, forming aggregates with submicrometer size, were found in SCS solutions.
International Nuclear Information System (INIS)
Chen, Cong; Li, Wei Zhong; Song, Yong Chen; Weng, Lin Dong; Zhang, Ning
2012-01-01
Molecular dynamics simulations have been performed to investigate hydrogen bonding characteristics of hydroxyl groups in glucose aqueous solutions with different concentrations. The hydrogen bonding abilities and strength of different O and H atom types have been calculated and compared. The acceptor/donor efficiencies have been predicted and it has been found that: (1) O2-HO2 and O3-HO3 are more efficient intramolecular hydrogen bonding acceptors than donors; (2) O1-HO1, O4-HO4 and O6-HO6 are more efficient intramolecular hydrogen bonding donors than acceptors; (5) O1-HO1 and O6-HO6 are more efficient intermolecular hydrogen bonding acceptors than donors while hydroxyl groups O2-HO2 and O4-HO4 are more efficient intermolecular hydrogen bonding donors than acceptors. The hydrogen bonding abilities of hydroxyl groups revealed that: (1) the hydrogen bonding ability of OH2-H w is larger than that of hydroxyl groups in glucose; (2) among the hydroxyl groups in glucose, the hydrogen bonding ability of O6-HO6 is the largest and the hydrogen bonding ability of O4-HO4 is the smallest; (3) the intermolecular hydrogen bonding ability of O6-HO6 is the largest; (4) the order for intramolecular hydrogen bonding abilities (from large to small) is O2-HO2, O1-HO1, O3-HO3, O6-HO6 and O4-HO4
Hydroxyl and water molecule orientations in trypsin: Comparison to molecular dynamics structures
Energy Technology Data Exchange (ETDEWEB)
McDowell, R.S.; Kossiakoff, A.A. [Genentech, Inc., South San Francisco, CA (United States)
1994-12-31
A comparison is presented of experimentally observed hydroxyl and water hydrogens in trypsin determined from neutron density maps with the results of a 140ps molecular dynamics (MD) simulation. Experimental determination of hydrogen and deuterium atom positions in molecules as large as proteins is a unique capability of neutron diffraction. The comparison addresses the degree to which a standard force-field approach can adequately describe the local electrostatic and van der Waals forces that determine the orientations of these hydrogens. Neutron densities, derived from 2.1{Angstrom} D{sub 2}O-H{sub 2}O difference Fourier maps, provide a database of 27 well-ordered hydroxyl hydrogens. Most of the simulated hydroxyl orientations are within a standard deviation of the experimentally-observed positions, including several examples in which both the simulation and the neutron density indicate that a hydroxyl group is shifted from a {open_quote}standard{close_quote} rotamer. For the most highly ordered water molecules, the hydrogen distributions calculated from the trajectory were in good agreement with neutron density; simulated water molecules that displayed multiple hydrogen bonding networks had correspondingly broadened neutron density profiles. This comparison was facilitated by development of a method to construct a pseudo 2{Angstrom} density map based on the hydrogen atom distributions from the simulation. The degree of disorder of internal water molecules is shown to result primarily from the electrostatic environment surrounding that water molecule as opposed to the cavity size available to the molecule. A method is presented for comparing the discrete observations sampled in a dynamics trajectory with the time- averaged data obtained from X-ray or neutron diffraction studies. This method is particularly useful for statically-disordered water molecules, in which the average location assigned from a trajectory may represent a site of relatively low occupancy.
Klarian Vergara, José
2017-01-01
El presente trabajo estudia la localidad de Chañaral, ubicada en la Región de Atacama en el norte de Chile, dado que ella reviste especial importancia debido a los problemas ambientales que impactan la salud de sus habitantes. Se buscó, a través de una actividad Focus Group, identificar aquellas variables que, a juicio de representantes clave, tienen alta importancia desde la perspectiva de la calidad de vida de la comunidad. Entre 14 áreas temáticas, se i...
Properties of the Nafion membrane impregnated with hydroxyl ammonium based ionic liquids
International Nuclear Information System (INIS)
Garaev, Valeriy; Pavlovica, Sanita; Vaivars, Guntars; Kleperis, Janis
2012-01-01
In this work, the Nafion 112 membrane impregnated with nine various hydroxyl ammonium based ionic liquids have been investigated. The used ionic liquids were combined from hydroxyl ammonium cations (2-hydroxyethylammonium/HEA, bis(2- hydroxyethyl)ammonium/BHEA, tris(2-hydroxyethyl)ammonium/THEA) and carboxylate anions (formate, acetate, lactate). The membranes are characterized by conductivity and thermal stability measurements. It was found, that almost all composites have 10 times higher ion conductivity than a pure Nafion 112 at 90 °C in ambient environment due to the higher thermal stability. The thermal stability of Nafion membrane was increased by all studied nine ionic liquids. In this work, only biodegradable ionic liquids were used for composite preparation.
Effect of nitrogen doping of graphene oxide on hydrogen and hydroxyl adsorption
Energy Technology Data Exchange (ETDEWEB)
Min, Byeong June; Jeong, Hae Kyung [Daegu University, Kyungsan (Korea, Republic of)
2014-05-15
We investigate how nitrogen-doping affects the hydrogen (H) and the hydroxyl (OH) adsorption on graphene oxide (GO) and on nitrogen-doped GO (NGO) via pseudopotential plane wave density functional calculations within the local spin density approximation. We find that the nitrogen doping brings about drastic changes in the hydrogen and the hydroxyl adsorption energetics, but its effects depend sensitively on the nitrogen configuration in NGO. The H and the OH adsorption energies are comparable only for pyrrolic NGO. In GO and quarternary NGO, the H adsorption energy is greater than the OH adsorption energy while the trend is reversed in pyridinic NGO. Also, the OH adsorption process is less affected by nitrogen-doping than the H adsorption is.
Enhanced osteoconductivity of sodium-substituted hydroxyapatite by system instability.
Sang Cho, Jung; Um, Seung-Hoon; Su Yoo, Dong; Chung, Yong-Chae; Hye Chung, Shin; Lee, Jeong-Cheol; Rhee, Sang-Hoon
2014-07-01
The effect of substituting sodium for calcium on enhanced osteoconductivity of hydroxyapatite was newly investigated. Sodium-substituted hydroxyapatite was synthesized by reacting calcium hydroxide and phosphoric acid with sodium nitrate followed by sintering. As a control, pure hydroxyapatite was prepared under identical conditions, but without the addition of sodium nitrate. Substitution of calcium with sodium in hydroxyapatite produced the structural vacancies for carbonate ion from phosphate site and hydrogen ion from hydroxide site of hydroxyapatite after sintering. The total system energy of sodium-substituted hydroxyapatite with structural defects calculated by ab initio methods based on quantum mechanics was much higher than that of hydroxyapatite, suggesting that the sodium-substituted hydroxyapatite was energetically less stable compared with hydroxyapatite. Indeed, sodium-substituted hydroxyapatite exhibited higher dissolution behavior of constituent elements of hydroxyapatite in simulated body fluid (SBF) and Tris-buffered deionized water compared with hydroxyapatite, which directly affected low-crystalline hydroxyl-carbonate apatite forming capacity by increasing the degree of apatite supersaturation in SBF. Actually, sodium-substituted hydroxyapatite exhibited markedly improved low-crystalline hydroxyl-carbonate apatite forming capacity in SBF and noticeably higher osteoconductivity 4 weeks after implantation in calvarial defects of New Zealand white rabbits compared with hydroxyapatite. In addition, there were no statistically significant differences between hydroxyapatite and sodium-substituted hydroxyapatite on cytotoxicity as determined by BCA assay. Taken together, these results indicate that sodium-substituted hydroxyapatite with structural defects has promising potential for use as a bone grafting material due to its enhanced osteoconductivity compared with hydroxyapatite. © 2013 Wiley Periodicals, Inc.
Ma, Xiaohua
2014-01-01
A novel o-hydroxyl-functionalized spirobifluorene-based diamine monomer, 2,2′-dihydroxyl-9,9′-spiro-bifluorene- 3,3′-diamine (HSBF), was successfully prepared by a universal synthetic method. Two o-hydroxyl-containing polyimides, denoted as 6FDA-HSBF and SPDA-HSBF, were synthesized and characterized. The BET surface areas of 6FDA-HSBF and SPDA-HSBF are 70 and 464 m2 g-1, respectively. To date, SPDA-HSBF exhibits the highest CO2 permeability (568 Barrer) among all hydroxyl-containing polyimides. The HSBF-based polyimides exhibited higher CO2/CH4 selectivity than their spirobifluorene (SBF) analogues (42 for 6FDA-HSBF vs. 27 for 6FDA-SBF) due to an increase in their diffusivity selectivity. Polybenzoxazole (PBO) membranes obtained from HSBF-based polyimide precursors by thermal rearrangement showed enhanced permeability but at the cost of significantly decreased selectivity.
Decomposition of water into highly combustible hydroxyl gas used in ...
African Journals Online (AJOL)
The method proposed involves the decomposition of water into highly combustible hydroxyl gas via electrolysis, which is used in internal combustion engines of electrical generators for electricity generation. The by-product obtained from combustion of this gas is water vapour and oxygen to replenish the atmosphere.
Kim, Do-Kyung; Jeong, Hyeon-Seok; Kwon, Hyeok Bin; Kim, Young-Rae; Kang, Shin-Won; Bae, Jin-Hyuk
2018-05-01
We propose a simple hydroxyl group transfer method to improve the electrical characteristics of solution-processed amorphous InGaZnO (IGZO) thin-film transistors (TFTs). Tuned poly(dimethylsiloxane) elastomer, which has a hydroxyl group as a terminal chemical group, was adhered temporarily to an IGZO thin-film during the solidification step to transfer and supply sufficient hydroxyl groups to the IGZO thin-film. The transferred hydroxyl groups led to efficient hydrolysis and condensation reactions, resulting in a denser metal–oxygen–metal network being achieved in the IGZO thin-film compared to the conventional IGZO thin-film. In addition, it was confirmed that there was no morphological deformation, including to the film thickness and surface roughness. The hydroxyl group transferred IGZO based TFTs exhibited enhanced electrical properties (field-effect mobility of 2.21 cm2 V‑1 s‑1, and on/off current ratio of 106) compared to conventional IGZO TFTs (field-effect mobility of 0.73 cm2 V‑1 s‑1 and on/off current ratio of 105).
Stability, electrochemical behaviors and electronic structures of iron hydroxyl-phosphate
Energy Technology Data Exchange (ETDEWEB)
Wang Zhongli; Sun Shaorui; Li Fan; Chen Ge [College of Environmental and Energy Engineering, Beijing University of Technology, Pingleyuan 100, Chaoyang District, Beijing 100022 (China); Xia Dingguo, E-mail: dgxia@bjut.edu.cn [College of Environmental and Energy Engineering, Beijing University of Technology, Pingleyuan 100, Chaoyang District, Beijing 100022 (China); Zhao Ting; Chu Wangsheng [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); University of Science and Technology of China, Hefei 230026 (China); Wu Ziyu, E-mail: wuzy@ihep.ac.cn [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); University of Science and Technology of China, Hefei 230026 (China)
2010-09-01
Iron hydroxyl-phosphate with a uniform spherical particle size of around 1 {mu}m, a compound of the type Fe{sub 2-y}{open_square}{sub y}(PO{sub 4})(OH){sub 3-3y}(H{sub 2}O){sub 3y-2} (where {open_square} represents a vacancy), has been synthesized by hydrothermal methods. The particles are composed of spheres of diameter <100 nm. The compound exhibits good electrochemical performance, with reversible capacities of around 150 mAh g{sup -1} and 120 mAh g{sup -1} at current densities of 170 mA g{sup -1} and 680 mA g{sup -1}, respectively. The stability of crystal structure of this material was studied by TGA and XRD which show that the material remains stable at least up to the temperature 200 deg. C. Investigation of the electronic structure of the iron hydroxyl-phosphate by GGA + U calculation has indicated that it has a better electronic conductivity than LiFePO{sub 4}.
Vacuum-sintered body of a novel apatite for artificial bone
Tamura, Kenichi; Fujita, Tatsushi; Morisaki, Yuriko
2013-12-01
We produced regenerative artificial bone material and bone parts using vacuum-sintered bodies of a novel apatite called "Titanium medical apatite (TMA®)" for biomedical applications. TMA was formed by chemically connecting a Ti oxide molecule with the reactive [Ca10(PO4)6] group of Hydroxyapatite (HAp). The TMA powders were kneaded with distilled water, and solid cylinders of compacted TMA were made by compression molding at 10 MPa using a stainless-steel vessel. The TMA compacts were dried and then sintered in vacuum (about 10-3 Pa) or in air using a resistance heating furnace in the temperature range 1073-1773 K. TMA compacts were sintered at temperatures greater than 1073 K, thus resulting in recrystallization. The TMA compact bodies sintered in the range 1273-1773 K were converted into mixtures composed of three crystalline materials: α-TCP (tricalcium phosphate), β-TCP, and Perovskite-CaTiO3. The Perovskite crystals were stable and hard. In vacuum-sintering, the Perovskite crystals were transformed into fibers (approximately 1 µm in diameter × 8 µm in length), and the fiber distribution was uniform in various directions. We refer to the TMA vacuum-sintered bodies as a "reinforced composite material with Perovskite crystal fibers." However, in atmospheric sintering, the Perovskite crystals were of various sizes and were irregularly distributed as a result of the effect of oxygen. After sintering temperature at 1573 K, the following results were obtained: the obtained TMA vacuum-sintered bodies (1) were white, (2) had a density of approximately 2300 kg/m3 (corresponding to that of a compact bone or a tooth), and had a thermal conductivity of approximately 31.3 W/(m·K) (corresponding to those of metal or ceramic implants). Further, it was possible to cut the TMA bodies into various forms with a cutting machine. An implant made of TMA and inserted into a rabbit jaw bone was covered by new bone tissues after just one month because of the high
Directory of Open Access Journals (Sweden)
Lin Sen
2018-02-01
Full Text Available The inhibitive effects of serum proteins on apatite growth was compared between melt-derived 45S5 Bioglass® and sol-gel derived bioactive glass of the 70S30C (70 mol% SiO2, 30 mol% CaO. By using techniques of XRD, TEM and Raman spectroscopy, the transformation of amorphous calcium phosphate to crystalline apatite, and the resulting size and aspect ratio of the crystals, in simulated body fluid (SBF, was seen to decrease in the presence of serum. XRD showed more rapid HA formation on Bioglass particles, compared to that forming on 70S30C particles, however TEM showed similar size and frequency of the needle-like crystals. Phosphate reduction in SBF was similar for Bioglass and 70S30C. Calcium carbonate formation was more likely on the phosphate-free sol-gel glass than on Bioglass.
Paul, Andre N.; Spikings, Richard A.; Ulianov, Alexey; Ovtcharova, Maria
2018-05-01
Quantitative reconstruction of thermal histories can be a powerful tool to study numerous natural processes such as tectonic plate interaction, cratonic stability and extra-terrestrial phenomena such as asteroid ejection. A majority of thermochronological studies have focused on temperatures lower than 300 °C. Few previous studies have demonstrated that U-Pb data from apatite and other accessory phases can be used to recover thermal history information at T > 350 °C. We present U-Pb data from apatite, to constrain the thermal histories of Triassic peralluminous anatectites from the Northern Andes between the temperatures of ∼350-550 °C. The accuracy of the thermal history models is assessed by comparisons with previous geological models, and comparisons with pre-existing and newly acquired U/Pb (titanite and rutile), 40Ar/39Ar (muscovite) and low temperature thermochronological data. This study also examines the feasibility of using a large, regionally dispersed apatite U-Pb data set to obtain continuous thermal history paths along a long-lived (>500 Ma) active margin. A second aim of this study is to further test the hypothesis that the dominant mechanism for Pb displacement through apatite is volume diffusion, as opposed to aqueous fluid interaction. The thermal history models derived from the Triassic anatectites exposed in the Andes of Colombia and Ecuador are entirely consistent with lower temperature thermochronological constraints, and previously established geochronological and geochemical constraints. They reveal and quantify trench parallel changes in the amount of Jurassic - Early Cretaceous extension, significantly bolstering and adding to previous tectonic interpretations. Confirmation of the utility of U-Pb thermochronology provides geologists with a powerful tool for investigating the high-temperature thermal evolution of accessory minerals.
Hydroxyl group as IR probe to detect the structure of ionic liquid-acetonitrile mixtures
Xu, Jing; Deng, Geng; Zhou, Yu; Ashraf, Hamad; Yu, Zhi-Wu
2018-06-01
Task-specific ionic liquids (ILs) are those with functional groups introduced in the cations or anions of ILs to bring about specific properties for various tasks. In this work, the hydrogen bonding interactions between a hydroxyl functionalized IL 1-(2-hydroxylethyl)-3-methylimidazolium tetrafluoroborate ([C2OHMIM][BF4]) and acetonitrile were investigated in detail by infrared spectroscopy, excess spectroscopy, two-dimensional correlation spectroscopy, combined with hydrogen nuclear magnetic resonance and density functional theory calculations (DFT). The hydroxyl group rather than C2sbnd H is found to be the main interaction site in the cation. And the ν(Osbnd H) is more sensitive than v(C-Hs) to the environment, which has been taken as an intrinsic probe to reflect the structural change of IL. Examining the region of ν(Osbnd H), by combining excess spectroscopy and DFT calculation, a number of species were identified in the mixtures. Other than the hydrogen bond between a cation and an anion, the hydroxyl group allows the formation of a hydrogen bond between two like-charged cations. The Osbnd H⋯O hydrogen bonding interactions in the hydroxyl-mediated cation-cation complexes are cooperative, while Osbnd H⋯F and C2sbnd H⋯F hydrogen bonding interactions in cation-anion complexes are anti-cooperative. These in-depth studies on the properties of the ionic liquid-acetonitrile mixtures may shed light on exploring their applications as mixed solvents and understanding the nature of doubly ionic hydrogen bonds.
A note on frequency distributions of fission tracks in apatite
International Nuclear Information System (INIS)
He, Z.; Lerche, I.
1989-01-01
Two different formulae, both purportedly describing track length reduction in apatite, are converted to forms useful in prediction of track length distributions along sedimentary burial history paths. Using the formalism, track length distribution data from four NW Canning Basin wells are inverted to determine the physical (chemical) parameters associated with the models as well as the heat flux variation with time. For each formula the resulting physical parameters are consistent among the wells tested but differ from laboratory-derived parameter values, and the thermal histories are consistent with those inferred from geological data. Comparison of the two models shows no evidence that one model should be favored over the other based on the data available. It is also shown that the resolution of the parameters is dependent not only on the quantity of the data but also on the ''quality'' -explicitly upon the variation and distribution with depth. (author)
Directory of Open Access Journals (Sweden)
Szopa Krzysztof
2014-08-01
Full Text Available The main products of volcanic activity in the teschenite-picrite association (TPA are shallow, sub-volcanic intrusions, which predominate over extrusive volcanic rocks. They comprise a wide range of intrusive rocks which fall into two main groups: alkaline (teschenite, picrite, syenite, lamprophyre and subalkaline (dolerite. Previous 40Ar/39Ar and 40K/40Ar dating of these rocks in the Polish Outer Western Carpathians, performed on kaersutite, sub-silicic diopside, phlogopite/biotite as well as on whole rock samples has yielded Early Cretaceous ages. Fluorapatite crystals were dated by the U-Pb LA-ICP-MS method to obtain the age of selected magmatic rocks (teschenite, lamprophyre from the Cieszyn igneous province. Apatite-bearing samples from Boguszowice, Puńców and Lipowa yield U-Pb ages of 103± 20 Ma, 119.6 ± 3.2 Ma and 126.5 ± 8.8 Ma, respectively. The weighted average age for all three samples is 117.8 ± 7.3 Ma (MSWD = 2.7. The considerably smaller dispersion in the apatite ages compared to the published amphibole and biotite ages is probably caused by the U-Pb system in apatite being less susceptible to the effects of hydrothermal alternation than the 40Ar/39Ar or 40K/40Ar system in amphibole and/or biotite. Available data suggest that volcanic activity in the Silesian Basin took place from 128 to 103 Ma with the the main magmatic phase constrained to 128-120 Ma.
The hydroxyl-functionalized magnetic particles for purification of glycan-binding proteins.
Sun, Xiuxuan; Yang, Ganglong; Sun, Shisheng; Quan, Rui; Dai, Weiwei; Li, Bin; Chen, Chao; Li, Zheng
2009-12-01
Glycan-protein interactions play important biological roles in biological processes. Although there are some methods such as glycan arrays that may elucidate recognition events between carbohydrates and protein as well as screen the important glycan-binding proteins, there is a lack of simple effectively separate method to purify them from complex samples. In proteomics studies, fractionation of samples can help to reduce their complexity and to enrich specific classes of proteins for subsequent downstream analyses. Herein, a rapid simple method for purification of glycan-binding proteins from proteomic samples was developed using hydroxyl-coated magnetic particles coupled with underivatized carbohydrate. Firstly, the epoxy-coated magnetic particles were further hydroxyl functionalized with 4-hydroxybenzhydrazide, then the carbohydrates were efficiently immobilized on hydroxyl functionalized surface of magnetic particles by formation of glycosidic bond with the hemiacetal group at the reducing end of the suitable carbohydrates via condensation. All conditions of this method were optimized. The magnetic particle-carbohydrate conjugates were used to purify the glycan-binding proteins from human serum. The fractionated glycan-binding protein population was displayed by SDS-PAGE. The result showed that the amount of 1 mg magnetic particles coupled with mannose in acetate buffer (pH 5.4) was 10 micromol. The fractionated glycan-binding protein population in human serum could be eluted from the magnetic particle-mannose conjugates by 0.1% SDS. The methodology could work together with the glycan microarrays for screening and purification of the important GBPs from complex protein samples.
Chang, Jian; Qiu, Nansheng; Song, Xinying; Li, Huili
2016-06-01
Apatite fission track and vitrinite reflectance are integrated for the first time to study the cooling history in the Central Tarim, northwest China. The paleo-temperature profiles from vitrinite reflectance data of the Z1 and Z11 wells showed a linear relationship with depth, suggesting an approximately 24.8 °C/km paleo-geothermal gradient and 2700-3900 m of erosion during the Early Mesozoic. The measured apatite fission track ages from well Z2 in the Central Tarim range from 39 to 159 Ma and effectively record the Meso-Cenozoic cooling events that occurred in Central Tarim. Moreover, two cooling events at 190-140 Ma in the Early Jurassic-Early Cretaceous and 80-45 Ma in the Late Cretaceous-Paleocene revealed by measured AFT data and thermal modeling results are related to the collisions of the Qiangtang-Lhasa terranes and the Greater India Plate with the southern margin of the Eurasian Plate, respectively. This study provides new insights into the tectonic evolution of the Tarim Basin (and more broadly Central Asia) and for hydrocarbon generation and exploration in the Central Tarim.
International Nuclear Information System (INIS)
Ge, Linke; Na, Guangshui; Zhang, Siyu; Li, Kai; Zhang, Peng; Ren, Honglei; Yao, Ziwei
2015-01-01
The ubiquity and photoreactivity of fluoroquinolone antibiotics (FQs) in surface waters urge new insights into their aqueous photochemical behavior. This study concerns the photochemistry of 6 FQs: ciprofloxacin, danofloxacin, levofloxacin, sarafloxacin, difloxacin and enrofloxacin. Methods were developed to calculate their solar direct photodegradation half-lives (t d,E ) and hydroxyl-radical oxidation half-lives (t ·OH,E ) in sunlit surface waters. The t d,E values range from 0.56 min to 28.8 min at 45° N latitude, whereas t ·OH,E ranges from 3.24 h to 33.6 h, suggesting that most FQs tend to undergo fast direct photolysis rather than hydroxyl-radical oxidation in surface waters. However, a case study for levofloxacin and sarafloxacin indicated that the hydroxyl-radical oxidation induced risky photochlorination and resulted in multi-degradation pathways, such as piperazinyl hydroxylation and clearage. Changes in the antibacterial activity of FQs caused by photodegradation in various waters were further examined using Escherichia coli, and it was found that the activity evolution depended on primary photodegradation pathways and products. Primary intermediates with intact FQ nuclei retained significant antibacterial activity. These results are important for assessing the fate and risk of FQs in surface waters. - Highlights: • It is first reported on hydroxyl-radical oxidation of 6 fluoroquinolone antibiotics. • Methods were developed to assess photolysis and oxidation fate in surface waters. • The neutral form reacted faster with hydroxyl radical than protonated forms. • The main oxidation intermediates and transformation pathways were clarified. • The antibacterial activity changes depend on dominant photolysis pathways
Energy Technology Data Exchange (ETDEWEB)
Oliveira, P.S. de; Mansur, H.S.; Peres, A.E.C., E-mail: eng.priscila.oliveira@gmail.com [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)
2016-07-01
The present research characterizes the Pataua palm (Oenocarpus bataua) oil regarding to its fatty acids profile and acidity index, and evaluates its use for apatite flotation. The Pataua oil evaluated is unsaturated e predominantly composed of cis-9-octadecenoic acid (oleic acid). The mineral sample characterization revealed a material composed by a fluoroapatite deficient in fluorine, a possibly result of isomorphic substitution, and with quartz and monazite inclusions. The analysis of the mineral after reagent conditioning, by Fourier Transform Infrared Spectroscopy (FTIR), pointed to the presence of characteristic bands of carbon chains and carboxylate group, suggesting the collector adsorption through the mechanisms of chemisorption and insoluble calcium salts precipitation. Thus, it is proposed the Pataua oil potential use in flotation systems aiming apatite recovery. (author)
International Nuclear Information System (INIS)
Mitchel, R.E.J.
1975-01-01
The ionizing radiation-induced release of a surface exonuclease from Micrococcus radiodurans is to a large extent inhibited by the removal of water. Irradiation of a cell suspension saturated with O 2 (an effective aqueous electron and hydrogen atom scavenger) allows the same release as irradiation in the presence of N 2 . Ethanol (a good hydroxyl radical scavenger) protects the enzyme from release. These data suggest that hydroxyl radicals produced by the radiolysis of water are important releasing agents. Hydroxyl radicals produced by the ultraviolet decomposition of H 2 O 2 were effective in releasing the enzyme
Baba Ismail, Yanny Marliana; Ferreira, Ana Marina; Bretcanu, Oana; Dalgarno, Kenneth; El Haj, Alicia J
2017-11-01
This paper presents a new approach in assembling bone extracellular matrix components onto PLA films, and investigates the most favourable environment which can be created using the technique for cell-material interactions. Poly (lactic acid) (PLA) films were chemically modified by covalently binding the poly(ethylene imine) (PEI) as to prepare the substrate for immobilization of polyelectrolyte multilayers (PEMs) coating. Negatively charged polyelectrolyte consists of well-dispersed silicon-carbonated hydroxyapatite (SiCHA) nanopowders in hyaluronic acid (Hya) was deposited onto the modified PLA films followed by SiCHA in collagen type I as the positively charged polyelectrolyte. The outermost layer was finally cross-linked by 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrocholoride and N-hydroxysulfosuccinimide sodium salt (EDC/NHS) solutions. The physicochemical features of the coated PLA films were monitored via X-ray Photoelectron Spectroscopy (XPS) and Atomic Force Microscope (AFM). The amounts of calcium and collagen deposited on the surface were qualitatively and quantitatively determined. The surface characterizations suggested that 5-BL has the optimum surface roughness and highest amounts of calcium and collagen depositions among tested films. In vitro human mesenchymal stem cells (hMSCs) cultured on the coated PLA films confirmed that the coating materials greatly improved cell attachment and survival compared to unmodified PLA films. The cell viability, cell proliferation and Alkaline Phosphatase (ALP) expression on 5-BL were found to be the most favourable of the tested films. Hence, this newly developed coating materials assembly could contribute to the improvement of the bioactivity of polymeric materials and structures aimed to bone tissue engineering applications. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Piccirillo, C.; Silva, M.F.; Pullar, R.C.; Braga da Cruz, I.; Jorge, R.; Pintado, M.M.E.; Castro, P.M.L.
2013-01-01
Apatite- and tricalcium phosphate-based materials were produced from codfish bones, thus converting a waste by-product from the food industry into high added-valued compounds. The bones were annealed at temperatures between 900 and 1200 °C, giving a biphasic material of hydroxyapatite and tricalcium phosphate (Ca 10 (PO 4 ) 6 (OH) 2 and β-Ca(PO 4 ) 3 ) with a molar proportion of 75:25, a material widely used in biomedical implants. The treatment of the bones in solution prior to their annealing changed the composition of the material. Single phase hydroxyapatite, chlorapatite (Ca 10 (PO 4 ) 6 Cl 2 ) and fluorapatite (Ca 10 (PO 4 ) 6 F 2 ) were obtained using CaCl 2 and NaF solutions, respectively. The samples were analysed by several techniques (X-ray diffraction, infrared spectroscopy, scanning electron microscopy and differential thermal/thermogravimetric analysis) and by elemental analyses, to have a more complete understanding of the conversion process. Such compositional modifications have never been performed before for these materials of natural origin to tailor the relative concentrations of elements. This paper shows the great potential for the conversion of this by-product into highly valuable compounds for biomedical applications, using a simple and effective valorisation process. - Highlights: ► Apatite and calcium phosphate compounds extraction from cod fish bones ► Bone calcination: biphasic material hydroxyapatite-calcium phosphate production ► Bone pre-treatments in solution change the material composition. ► Single phase materials (hydroxy-, chloro- or fluoroapatite) are obtained. ► Concentration of other elements (Na, F, Cl) suitable for biomedical applications
Energy Technology Data Exchange (ETDEWEB)
Perrone, Jane [Inst. de Physique Nucleaire, Paris-11 Univ., 91 - Orsay (France)
1999-07-12
Apatite minerals and particularly the carbonated species (francolites), are characterized by their chemical and geological stability and also by their capacity to retain durably a large number of elements. Therefore, they should be able to improve the retention properties of the engineered barriers of a deep geological nuclear waste repository. But there is a wide variety of francolites, so we focused our study on a synthetic carbonate fluoro-apatite of formula: Ca{sub 10}(PO{sub 4}){sub 5}(CO{sub 3})(F,OH){sub 3} and on a natural apatite. We first studied their solubility which is an important criterion for the choice of the materials. A particular attention was also paid to the determination of their surface characteristics and to the study of the radionuclide/solution interactions. Sorption experiments have been performed for the three radionuclides and the influence of various parameters has been investigated. The modelling of the sorption isotherms with surface complexation models leads us to estimate the values of the constants associated to the equilibria under consideration. We have also demonstrated that the phosphate ions of the solution participate to the immobilization of americium as the AmPO{sub 4},xH{sub 2}O compound. Both apatites show high retention levels for the actinides: the sorption is quite total over all the pH range studied and the Kd values are close to 10{sup 4} m{sup 3} kg{sup -1}. Consequently, the use of apatites could be considered as a specific solution for the immobilisation of heavy elements, specially actinides. Moreover, the results indicate that high amounts of carbonates and impurities do not alter the retention properties of francolites. This bears out the feasibility of the use of natural apatites as additives for the engineered barrier materials. (author)
Sepahvandi, Azadeh; Moztarzadeh, Fathollah; Mozafari, Masoud; Ghaffari, Maryam; Raee, Nahid
2011-09-01
Photoluminescence (PL) property is particularly important in the characterization of materials that contain significant proportions of noncrystalline components, multiple phases, or low concentrations of mineral phases. In this research, the ability of biomimetic bone-like apatite deposition on the surface of titanium alloy (Ti6Al4V) substrates in simulated body fluid (SBF) right after alkaline-treatment and subsequent heat-treatment was studied by the inherent luminescence properties of apatite. For this purpose, the metallic substrates were treated in 5 M NaOH solution at 60 °C. Subsequently, the substrates were heat-treated at 600 °C for 1 h for consolidation of the sodium titanate hydrogel layer. Then, they were soaked in SBF for different periods of time. Finally, the possibility to use of PL monitoring as an effective method and early detection tool is discussed. According to the obtained results, it was concluded that the PL emission peak did not have any significant shift to the shorter or higher wavelengths, and the PL intensity increased as the exposure time increased. This research proved that the observed inherent PL of the newly formed apatite coatings might be of specific interest for histological probing and bone remodelling monitoring. Copyright © 2011 Elsevier B.V. All rights reserved.
Umeda, Hirotsugu; Mano, Takamitsu; Harada, Koji; Tarannum, Ferdous; Ueyama, Yoshiya
2017-08-01
We have already reported that the apatite coating of titanium by the blast coating (BC) method could show a higher rate of bone contact from the early stages in vivo, when compared to the pure titanium (Ti) and the apatite coating of titanium by the flame spraying (FS) method. However, the detailed mechanism by which BC resulted in satisfactory bone contact is still unknown. In the present study, we investigated the importance of various factors including cell adhesion factor in osteoblast proliferation and differentiation that could affect the osteoconductivity of the BC disks. Cell proliferation assay revealed that Saos-2 could grow fastest on BC disks, and that a spectrophotometric method using a LabAssay TM ALP kit showed that ALP activity was increased in cells on BC disks compared to Ti disks and FS disks. In addition, higher expression of E-cadherin and Fibronectin was observed in cells on BC disks than Ti disks and FS disks by relative qPCR as well as Western blotting. These results suggested that the expression of cell-adhesion factors, proliferation and differentiation of osteoblast might be enhanced on BC disks, which might result higher osteoconductivity.
The Haber Process Made Efficient by Hydroxylated Graphene
Chaban, Vitaly; Prezhdo, Oleg
2016-01-01
The Haber-Bosch process is the main industrial method for producing ammonia from diatomic nitrogen and hydrogen. Very demanding energetically, it uses an iron catalyst, and requires high temperature and pressure. Any improvement of the Haber process will have an extreme scientific and economic impact. We report a significant increase of ammonia production using hydroxylated graphene. Exploiting the polarity difference between N2/H2 and NH3, as well as the universal proton acceptor behavior of...
Directory of Open Access Journals (Sweden)
CAZIN J. C.
1978-04-01
Full Text Available Ce travail décrit les conditions d'expérimentation d'un polychlorobiphényle commercial sur les différents maillons d'une chaîne alimentaire en eau douce : algues-crustacés-poissons. Après avoir déterminé les modalités de contamination compatibles avec la croissance normale des organismes végétaux et animaux, les cinétiques de concentration au niveau de chaque espèce, l'association des différents maillons a permis d'apprécier l'importance du transfert biologique du polluant qui apparaît limité, aux environs de 10 ppm, par l'état d'équilibre qui s'installe progressivement dans le milieu aquatique.
International Nuclear Information System (INIS)
Tanaskovic, D.; Jokic, B.; Socol, G.; Popescu, A.; Mihailescu, I.N.; Petrovic, R.; Janackovic, Dj.
2007-01-01
Functionally graded glass-apatite multistructures were synthesized by pulsed laser deposition on Ti substrates. We used sintered targets of hydroxyapatite Ca 10 (PO 4 ) 6 (OH) 2 , or bioglasses in the system SiO 2 -Na 2 O-K 2 O-CaO-MgO-P 2 O 5 with SiO 2 content of either 57 wt.% (6P57) or 61 wt.% (6P61). A UV KrF* (λ = 248 nm, τ > 7 ns) excimer laser source was used for the multipulse laser ablation of the targets. The hydroxyapatite thin films were obtained in H 2 O vapors, while the bioglass layers were deposited in O 2 . Thin films of 6P61 were deposited in direct contact with Ti, because Ti and this glass have similar thermal expansion behaviors, which ensure good bioglass adhesion to the substrate. This glass, however, is not bioactive, so yet more depositions of 6P57 bioglass and/or hydroxyapatite thin films were performed. All structures with hydroxyapatite overcoating were post-treated in a flux of water vapors. The obtained multistructures were characterized by various techniques. X-ray investigations of the coatings found small amounts of crystalline hydroxyapatite in the outer layers. The scanning electron microscopy analyses revealed homogeneous coatings with good adhesion to the Ti substrate. Our studies showed that the multistructures we had obtained were compatible with further use in biomimetic metallic implants with glass-apatite coating applications
Zhang, Lei; Cao, Ling; Zhao, Laishi; Algeo, Thomas J.; Chen, Zhong-Qiang; Li, Zhihong; Lv, Zhengyi; Wang, Xiangdong
2017-08-01
Conodont apatite has long been used in paleoenvironmental studies, often with minimal evaluation of the influence of diagenesis on measured elemental and isotopic signals. In this study, we evaluate diagenetic influences on conodonts using an integrated set of analytical techniques. A total of 92 points in 19 coniform conodonts from Ordovician marine units of South China were analyzed by micro-laser Raman spectroscopy (M-LRS), laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS), high-resolution X-ray microdiffraction (HXRD), and secondary ion mass spectrometry (SIMS). Each conodont element was analyzed along its full length, including the albid crown, hyaline crown, and basal body, in either a whole specimen (i.e., reflecting the composition of its outer layer) or a split specimen (i.e., reflecting the composition of its interior). In the conodonts of this study, the outer surfaces consist of hydroxyfluorapatite and the interiors of strontian hydroxyfluorapatite. Ionic substitutions resulted in characteristic Raman spectral shifts in the position (SS1) and width (SS2) of the ν1-PO43- stretching band. Although multiple elements were enriched (Sr2+, Mg2+) and depleted (Fe3+, Mn2+, Ca2+) during diagenesis, geochemical modeling constraints and known Raman spectral patterns suggest that Sr uptake was the dominant influence on diagenetic redshifts of SS1. All study specimens show lower SS2 values than modern bioapatite and synthetic apatite, suggesting that band width decreases with time in ancient bioapatite, possibly through an annealing process that produces larger, more uniform crystal domains. Most specimens consist mainly of amorphous or poorly crystalline apatite, which is inferred to represent the original microstructure of conodonts. In a subset of specimens, some tissues (especially albid crown) exhibit an increased degree of crystallinity developed through aggrading neomorphism. However, no systematic relationship was observed between