Phenotypic Plasticity of Cuticular Hydrocarbon Profiles in Insects.
Otte, Tobias; Hilker, Monika; Geiselhardt, Sven
2018-03-01
The insect integument is covered by cuticular hydrocarbons (CHCs) which provide protection against environmental stresses, but are also used for communication. Here we review current knowledge on environmental and insect-internal factors which shape phenotypic plasticity of solitary living insects, especially herbivorous ones. We address the dynamics of changes which may occur within minutes, but may also last weeks, depending on the species and conditions. Two different modes of changes are suggested, i.e. stepwise and gradual. A switch between two distinct environments (e.g. host plant switch by phytophagous insects) results in stepwise formation of two distinct adaptive phenotypes, while a gradual environmental change (e.g. temperature gradients) induces a gradual change of numerous adaptive CHC phenotypes. We further discuss the ecological and evolutionary consequences of phenotypic plasticity of insect CHC profiles by addressing the question at which conditions is CHC phenotypic plasticity beneficial. The high plasticity of CHC profiles might be a trade-off for insects using CHCs for communication. We discuss how insects cope with the challenge to produce and "understand" a highly plastic, environmentally dependent CHC pattern that conveys reliable and comprehensible information. Finally, we outline how phenotypic plasticity of CHC profiles may promote speciation in insects that rely on CHCs for mate recognition.
Wurdack, Mareike; Polidori, Carlo; Keller, Alexander; Feldhaar, Heike; Schmitt, Thomas
2017-11-01
The cuticle of insects is covered by a layer of hydrocarbons (CHC), whose original function is the protection from desiccation and pathogens. However, in most insects CHC profiles are species specific. While this variability among species was largely linked to communication and recognition functions, additional selective forces may shape insect CHC profiles. Here, we show that in Philanthinae digger wasps (Crabronidae) the CHC profile coevolved with a peculiar brood-care strategy. In particular, we found that the behavior to embalm prey stored in the nest with hydrocarbons is adaptive to protect larval food from fungi in those species hunting for Hymenoptera. The prey embalming secretion is identical in composition to the alkene-dominated CHC profile in these species, suggesting that their profile is adaptively conserved for this purpose. In contrast, prey embalming is not required in those species that switched to Coleoptera as prey. Released from this chemical brood-care strategy, Coleoptera-hunting species considerably diversified their CHC profiles. Differential needs to successfully protect prey types used as larval food have thus driven the diversification of CHCs profiles of female Philanthinae wasps. To the best of our knowledge, this is the first evidence of a direct link between selection pressure for food preservation and CHC diversity. © 2017 The Author(s). Evolution © 2017 The Society for the Study of Evolution.
Steiger, S; Capodeanu-Nägler, A; Gershman, S N; Weddle, C B; Rapkin, J; Sakaluk, S K; Hunt, J
2015-12-01
Indirect genetic benefits derived from female mate choice comprise additive (good genes) and nonadditive genetic benefits (genetic compatibility). Although good genes can be revealed by condition-dependent display traits, the mechanism by which compatibility alleles are detected is unclear because evaluation of the genetic similarity of a prospective mate requires the female to assess the genotype of the male and compare it to her own. Cuticular hydrocarbons (CHCs), lipids coating the exoskeleton of most insects, influence female mate choice in a number of species and offer a way for females to assess genetic similarity of prospective mates. Here, we determine whether female mate choice in decorated crickets is based on male CHCs and whether it is influenced by females' own CHC profiles. We used multivariate selection analysis to estimate the strength and form of selection acting on male CHCs through female mate choice, and employed different measures of multivariate dissimilarity to determine whether a female's preference for male CHCs is based on similarity to her own CHC profile. Female mating preferences were significantly influenced by CHC profiles of males. Male CHC attractiveness was not, however, contingent on the CHC profile of the choosing female, as certain male CHC phenotypes were equally attractive to most females, evidenced by significant linear and stabilizing selection gradients. These results suggest that additive genetic benefits, rather than nonadditive genetic benefits, accrue to female mate choice, in support of earlier work showing that CHC expression of males, but not females, is condition dependent. © 2015 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2015 European Society For Evolutionary Biology.
Evolution of Cuticular Hydrocarbons in the Hymenoptera: a Meta-Analysis.
Kather, Ricarda; Martin, Stephen J
2015-10-01
Chemical communication is the oldest form of communication, spreading across all forms of life. In insects, cuticular hydrocarbons (CHC) function as chemical cues for the recognition of mates, species, and nest-mates in social insects. Although much is known about the function of individual hydrocarbons and their biosynthesis, a phylogenetic overview is lacking. Here, we review the CHC profiles of 241 species of Hymenoptera, one of the largest and most important insect orders, which includes the Symphyta (sawflies), the polyphyletic Parasitica (parasitoid wasps), and the Aculeata (wasps, bees, and ants). We investigated whether these taxonomic groups differed in the presence and absence of CHC classes and whether the sociality of a species (solitarily vs. social) had an effect on CHC profile complexity. We found that the main CHC classes (i.e., n-alkanes, alkenes, and methylalkanes) were all present early in the evolutionary history of the Hymenoptera, as evidenced by their presence in ancient Symphyta and primitive Parasitica wasps. Throughout all groups within the Hymenoptera, the more complex a CHC the fewer species that produce it, which may reflect the Occam's razor principle that insects' only biosynthesize the most simple compound that fulfil its needs. Surprisingly, there was no difference in the complexity of CHC profiles between social and solitary species, with some of the most complex CHC profiles belonging to the Parasitica. This profile complexity has been maintained in the ants, but some specialization in biosynthetic pathways has led to a simplification of profiles in the aculeate wasps and bees. The absence of CHC classes in some taxa or species may be due to gene silencing or down-regulation rather than gene loss, as demonstrated by sister species having highly divergent CHC profiles, and cannot be predicted by their phylogenetic history. The presence of highly complex CHC profiles prior to the vast radiation of the social Hymenoptera indicates a
Gene expression profiles associated with depression in patients with chronic hepatitis C (CH-C).
Birerdinc, Aybike; Afendy, Arian; Stepanova, Maria; Younossi, Issah; Baranova, Ancha; Younossi, Zobair M
2012-09-01
The standard treatment for CH-C, pegylated interferon-α and ribavirin (PEG-IFN + RBV), is associated with depression. Recent studies have proposed a new role for cytokines in the pathogenesis of depression. We aimed to assess differential gene expression related to depression in CH-C patients treated with PEG-IFN + RBV. We included 67 CH-C patients being treated with PEG-IFN+RBV. Of the entire study cohort, 22% had pre-existing depression, while another 37% developed new depression in course of the treatment. Pretreatment blood samples were collected into PAXgene™ RNA tubes, the RNAs extracted from peripheral blood mononuclear cells (PBMCs) were used for one step RT-PCR to profile 160 mRNAs. Differentially expressed genes were separated into up- and down-regulated genes according to presence or absence of depression at baseline (pre-existing depression) or following the initiation of treatment (treatment-related depression). The mRNA expression profile associated with any depression and with treatment-related depression included four and six genes, respectively. Our data demonstrate a significant down-regulation of TGF-β1 and the shift of Th1-Th2 cytokine balance in the depression associated with IFN-based treatment of HCV infection. We propose that TGF-β1 plays an important role in the imbalance of Th1/Th2 in patients with CH-C and depression. With further validation, TGF-β1 and other components of Th1/Th2 regulation pathway may provide a future marker for CH-C patients predisposed to depression.
Hydrocarbon Patterns and Mating Behaviour in Populations of Drosophila yakuba
Directory of Open Access Journals (Sweden)
Béatrice Denis
2015-10-01
Full Text Available Drosophila yakuba is widespread in Africa. Here we compare the cuticular hydrocarbon (CHC profiles and mating behavior of mainland (Kounden, Cameroon and island (Mayotte, Sao-Tome, Bioko populations. The strains each had different CHC profiles: Bioko and Kounden were the most similar, while Mayotte and Sao-Tome contained significant amounts of 7-heptacosene. The CHC profile of the Sao-Tome population differed the most, with half the 7-tricosene of the other populations and more 7-heptacosene and 7-nonacosene. We also studied the characteristics of the mating behavior of the four strains: copulation duration was similar but latency times were higher in Mayotte and Sao-Tome populations. We found partial reproductive isolation between populations, especially in male-choice experiments with Sao-Tome females.
Cuticle hydrocarbons in saline aquatic beetles
Directory of Open Access Journals (Sweden)
María Botella-Cruz
2017-07-01
Full Text Available Hydrocarbons are the principal component of insect cuticle and play an important role in maintaining water balance. Cuticular impermeability could be an adaptative response to salinity and desiccation in aquatic insects; however, cuticular hydrocarbons have been poorly explored in this group and there are no previous data on saline species. We characterized cuticular hydrocarbons of adults and larvae of two saline aquatic beetles, namely Nebrioporus baeticus (Dytiscidae and Enochrus jesusarribasi (Hydrophilidae, using a gas chromatograph coupled to a mass spectrometer. The CHC profile of adults of both species, characterized by a high abundance of branched alkanes and low of unsaturated alkenes, seems to be more similar to that of some terrestrial beetles (e.g., desert Tenebrionidae compared with other aquatic Coleoptera (freshwater Dytiscidae. Adults of E. jesusarribasi had longer chain compounds than N. baeticus, in agreement with their higher resistance to salinity and desiccation. The more permeable cuticle of larvae was characterized by a lower diversity in compounds, shorter carbon chain length and a higher proportion of unsaturated hydrocarbons compared with that of the adults. These results suggest that osmotic stress on aquatic insects could exert a selection pressure on CHC profile similar to aridity in terrestrial species.
Dembeck, Lauren M; Böröczky, Katalin; Huang, Wen; Schal, Coby; Anholt, Robert R H; Mackay, Trudy F C
2015-11-14
Insect cuticular hydrocarbons (CHCs) prevent desiccation and serve as chemical signals that mediate social interactions. Drosophila melanogaster CHCs have been studied extensively, but the genetic basis for individual variation in CHC composition is largely unknown. We quantified variation in CHC profiles in the D. melanogaster Genetic Reference Panel (DGRP) and identified novel CHCs. We used principal component (PC) analysis to extract PCs that explain the majority of CHC variation and identified polymorphisms in or near 305 and 173 genes in females and males, respectively, associated with variation in these PCs. In addition, 17 DGRP lines contain the functional Desat2 allele characteristic of African and Caribbean D. melanogaster females (more 5,9-C27:2 and less 7,11-C27:2, female sex pheromone isomers). Disruption of expression of 24 candidate genes affected CHC composition in at least one sex. These genes are associated with fatty acid metabolism and represent mechanistic targets for individual variation in CHC composition.
2011-01-01
Background We characterized variation and chemical composition of epicuticular hydrocarbons (CHCs) in the seven species of the Drosophila buzzatii cluster with gas chromatography/mass spectrometry. Despite the critical role of CHCs in providing resistance to desiccation and involvement in communication, such as courtship behavior, mating, and aggregation, few studies have investigated how CHC profiles evolve within and between species in a phylogenetic context. We analyzed quantitative differences in CHC profiles in populations of the D. buzzatii species cluster in order to assess the concordance of CHC differentiation with species divergence. Results Thirty-six CHC components were scored in single fly extracts with carbon chain lengths ranging from C29 to C39, including methyl-branched alkanes, n-alkenes, and alkadienes. Multivariate analysis of variance revealed that CHC amounts were significantly different among all species and canonical discriminant function (CDF) analysis resolved all species into distinct, non-overlapping groups. Significant intraspecific variation was found in different populations of D. serido suggesting that this taxon is comprised of at least two species. We summarized CHC variation using CDF analysis and mapped the first five CHC canonical variates (CVs) onto an independently derived period (per) gene + chromosome inversion + mtDNA COI gene for each sex. We found that the COI sequences were not phylogenetically informative due to introgression between some species, so only per + inversion data were used. Positive phylogenetic signal was observed mainly for CV1 when parsimony methods and the test for serial independence (TFSI) were used. These results changed when no outgroup species were included in the analysis and phylogenetic signal was then observed for female CV3 and/or CV4 and male CV4 and CV5. Finally, removal of divergent populations of D. serido significantly increased the amount of phylogenetic signal as up to four out of five
Directory of Open Access Journals (Sweden)
Jackson Larry L
2011-06-01
Full Text Available Abstract Background We characterized variation and chemical composition of epicuticular hydrocarbons (CHCs in the seven species of the Drosophila buzzatii cluster with gas chromatography/mass spectrometry. Despite the critical role of CHCs in providing resistance to desiccation and involvement in communication, such as courtship behavior, mating, and aggregation, few studies have investigated how CHC profiles evolve within and between species in a phylogenetic context. We analyzed quantitative differences in CHC profiles in populations of the D. buzzatii species cluster in order to assess the concordance of CHC differentiation with species divergence. Results Thirty-six CHC components were scored in single fly extracts with carbon chain lengths ranging from C29 to C39, including methyl-branched alkanes, n-alkenes, and alkadienes. Multivariate analysis of variance revealed that CHC amounts were significantly different among all species and canonical discriminant function (CDF analysis resolved all species into distinct, non-overlapping groups. Significant intraspecific variation was found in different populations of D. serido suggesting that this taxon is comprised of at least two species. We summarized CHC variation using CDF analysis and mapped the first five CHC canonical variates (CVs onto an independently derived period (per gene + chromosome inversion + mtDNA COI gene for each sex. We found that the COI sequences were not phylogenetically informative due to introgression between some species, so only per + inversion data were used. Positive phylogenetic signal was observed mainly for CV1 when parsimony methods and the test for serial independence (TFSI were used. These results changed when no outgroup species were included in the analysis and phylogenetic signal was then observed for female CV3 and/or CV4 and male CV4 and CV5. Finally, removal of divergent populations of D. serido significantly increased the amount of phylogenetic signal as
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHC347 (Link to dictyBase) - - - - CHC347P (Link to Original s...ite) CHC347F 184 CHC347Z 431 CHC347P 595 - - Show CHC347 Library CH (Link to library) Clone ID CHC347 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...KRNKLIFNYKKK--- ---IGFGCLAXPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPREC NPRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KKK--- ---IGFGCLAXPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPREC NPRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS
Fürstenau, Benjamin; Hilker, Monika
2017-09-01
Parasitic wasps which attack insects infesting processed stored food need to locate their hosts hidden inside these products. Their host search is well-known to be guided by host kairomones, perceived via olfaction or contact. Among contact kairomones, host cuticular hydrocarbons (CHCs) may provide reliable information for a parasitoid. However, the chemistry of CHC profiles of hosts living in processed stored food products is largely unknown. Here we showed that the ectoparasitoid Holepyris sylvanidis uses CHCs of its host Tribolium confusum, a worldwide stored product pest, as kairomones for host location and recognition at short range. Chemical analysis of T. confusum larval extracts by gas chromatography coupled with mass spectrometry revealed a rich blend of long-chain (C25-C30) hydrocarbons, including n-alkanes, mono-, and dimethylalkanes. We further studied whether host larvae leave sufficient CHCs on a substrate where they walk along, thus allowing parasitoids to perceive a CHC trail and follow it to their host larvae. We detected 18 CHCs on a substrate that had been exposed to host larvae. These compounds were also found in crude extracts of host larvae and made up about a fifth of the CHC amount extracted. Behavioral assays showed that trails of host CHCs were followed by the parasitoids and reduced their searching time until successful host recognition. Host CHC trails deposited on different substrates were persistent for about a day. Hence, the parasitoid H. sylvanidis exploits CHCs of T. confusum larvae for host finding by following host CHC trails and for host recognition by direct contact with host larvae.
WHIM-3D-QSPR APPROACH FOR PREDICTING AQUEOUS SOLUBILITY OF CHLORINATED HYDROCARBONS
Directory of Open Access Journals (Sweden)
Oman Zuas
2010-06-01
Full Text Available The weighted holistic invariant molecular-three dimensional-quantitative structure property relationship (WHIM-3D-QSPR approach has been applied to the study of the aqueous solubility (- log Sw of chlorinated hydrocarbon compounds (CHC's. The obtained QSPR model is predictive and only requires four WHIM-3D descriptors in the calculation. The correlation equation of the model that is based on a training set of 50 CHC's compound has statistical parameters: standard coefficient correlation (R2 = 0.948; cross-validated correlation coefficients (Q2 = 0.935; Standard Error of Validation (SEV = 0.35; and average absolute error (AAE = 0.31. The application of the best model to a testing set of 50 CHC's demonstrates a reliable result with good predictability. Besides, it was possible to construct new model by applying WHIM-3D-QSPR approach without require any experimental physicochemical properties in the calculation of aqueous solubility. Keywords: WHIM-3D; QSPR; aqueous solubility; - Log Sw, chlorinated hydrocarbons, CHC's
Balabanidou, Vasileia; Kampouraki, Anastasia; MacLean, Marina; Blomquist, Gary J; Tittiger, Claus; Juárez, M Patricia; Mijailovsky, Sergio J; Chalepakis, George; Anthousi, Amalia; Lynd, Amy; Antoine, Sanou; Hemingway, Janet; Ranson, Hilary; Lycett, Gareth J; Vontas, John
2016-08-16
The role of cuticle changes in insecticide resistance in the major malaria vector Anopheles gambiae was assessed. The rate of internalization of (14)C deltamethrin was significantly slower in a resistant strain than in a susceptible strain. Topical application of an acetone insecticide formulation to circumvent lipid-based uptake barriers decreased the resistance ratio by ∼50%. Cuticle analysis by electron microscopy and characterization of lipid extracts indicated that resistant mosquitoes had a thicker epicuticular layer and a significant increase in cuticular hydrocarbon (CHC) content (∼29%). However, the CHC profile and relative distribution were similar in resistant and susceptible insects. The cellular localization and in vitro activity of two P450 enzymes, CYP4G16 and CYP4G17, whose genes are frequently overexpressed in resistant Anopheles mosquitoes, were analyzed. These enzymes are potential orthologs of the CYP4G1/2 enzymes that catalyze the final step of CHC biosynthesis in Drosophila and Musca domestica, respectively. Immunostaining indicated that both CYP4G16 and CYP4G17 are highly abundant in oenocytes, the insect cell type thought to secrete hydrocarbons. However, an intriguing difference was indicated; CYP4G17 occurs throughout the cell, as expected for a microsomal P450, but CYP4G16 localizes to the periphery of the cell and lies on the cytoplasmic side of the cell membrane, a unique position for a P450 enzyme. CYP4G16 and CYP4G17 were functionally expressed in insect cells. CYP4G16 produced hydrocarbons from a C18 aldehyde substrate and thus has bona fide decarbonylase activity similar to that of dmCYP4G1/2. The data support the hypothesis that the coevolution of multiple mechanisms, including cuticular barriers, has occurred in highly pyrethroid-resistant An gambiae.
Buellesbach, Jan; Vetter, Sebastian G; Schmitt, Thomas
2018-01-01
Cuticular hydrocarbons (CHC) have been documented to play crucial roles as species- and sex-specific cues in the chemical communication systems of a wide variety of insects. However, whether they are sufficient by themselves as the sole cue triggering sexual behavior as well as preference of con- over heterospecific mating partners is rarely assessed. We conducted behavioral assays in three representative species of parasitoid wasps (Hymenoptera: Pteromalidae) to determine their reliance on CHC as species-specific sexual signaling cues. We found a surprising degree of either unspecific or insufficient sexual signaling when CHC are singled out as recognition cues. Most strikingly, the cosmopolitan species Nasonia vitripennis , expected to experience enhanced selection pressure to discriminate against other co-occurring parasitoids, did not discriminate against CHC of a partially sympatric species from another genus, Trichomalopsis sarcophagae . Focusing on the latter species, in turn, it became apparent that CHC are even insufficient as the sole cue triggering conspecific sexual behavior, hinting at the requirement of additional, synergistic sexual cues particularly important in this species. Finally, in the phylogenetically and chemically most divergent species Muscidifurax uniraptor, we intriguingly found both CHC-based sexual signaling as well as species discrimination behavior intact although this species is naturally parthenogenetic with sexual reproduction only occurring under laboratory conditions. Our findings implicate a discrepancy in the reliance on and specificity of CHC as sexual cues in our tested parasitioid wasps. CHC profiles were not sufficient for unambiguous discrimination and preference behavior, as demonstrated by clear cross-attraction between some of our tested wasp genera. Moreover, we could show that only in T. sarcophagae , additional behavioral cues need to be present for triggering natural mating behavior, hinting at an interesting
Zhang, Bin; Xue, Huai-Jun; Song, Ke-Qing; Liu, Jie; Li, Wen-Zhu; Nie, Rui-E; Yang, Xing-Ke
2014-11-01
Chemical signals in insects have been documented to play an important role in mate recognition, and divergence in chemical signals can often cause sexual isolation between closely related species or populations within species. We investigated the role of cuticular hydrocarbons (CHCs), short distance chemical signals, in male mate recognition between the two sympatric elm leaf beetles, Pyrrhalta maculicollis and Pyrrhaltaaenescens. Mating experiments demonstrated that strong sexual isolation between the two species was driven by CHCs divergence. Males preferred to mate with conspecific females with intact conspecific CHCs or conspecific CHCs reapplied after removal. Males also preferred heterospecific females that were treated with conspecific CHCs. Chemical analysis showed that the CHC profiles differ significantly between species. In P. maculicollis dimethyl-branched alkanes between C29 and C35 account for the majority of the saturated alkanes while the CHC profile of P. aenescens mostly consisted of monomethyl-branched alkanes between C22 and C29. Additionally, some compounds, such as 12,18-diMeC32, 12,18-diMeC34, are unique to P. maculicollis. Copyright © 2014 Elsevier Ltd. All rights reserved.
Synthesis and preliminary biodistribution studies of [131I]SIB-PEG4-CHC in tumor-bearing mice
International Nuclear Information System (INIS)
Xiaobei Zheng; Jing Yang; Xiaojiang Duan; Tingting Niu; Wangsuo Wu; Jianjun Wang; Feng Dong
2011-01-01
This work reports the synthesis and preliminary biodistribution results of [ 131 I]SIB-PEG 4 -CHC in tumor-bearing mice. The tributylstannyl precursor ATE-PEG 4 -CHC was synthesized by conjugation of ATE to amino pegylated colchicine NH 2 -PEG 4 -CHC. [ 131 I]SIB-PEG 4 -CHC was radiosynthesized by electrophilic destannylation of the precursor with a yield of ∼44%. The radiochemical purity (RCP) appeared to be >95% by a Sep-Pak cartridge purification. [ 131 I]SIB-PEG 4 -CHC was lipophilic and was stable at room temperature. Biodistribution studies in tumor-bearing mice showed that [ 131 I]SIB-PEG 4 -CHC cleared from background rapidly, and didn't deiodinate in vivo. However, the poor tumor localization excluded it from further investigations as a tumor-targeted radiopharmaceuticals. (author)
Petroleum Hydrocarbons Contamination Profile of Ochani Stream in ...
African Journals Online (AJOL)
Michael Horsfall
ABSTRACT: Petroleum hydrocarbon contamination profile, heavy metals and .... potential conduits for oil and water migrating from the ... by Gas Chromatography: Soil / sediment / sludge ..... fractions contained in the dump pits) which have.
Petroleum Hydrocarbons Contamination Profile of Ochani Stream in ...
African Journals Online (AJOL)
Petroleum hydrocarbon contamination profile, heavy metals and some physicochemical parameters were investigated in Ochani Stream site in Ejamah Ebubu, Eleme Local Government Area of Rivers State. The results show that a major crude oil spillage occurred at Ejamah Ebubu, Rivers State, Nigeria approximately 30 ...
Diaz, Mireia; Lenoir, Alain; Ivon Paris, Carolina; Boulay, Raphaël; Gómez, Crisanto
2018-01-01
In insect societies, chemical communication plays an important role in colony reproduction and individual social status. Many studies have indicated that cuticular hydrocarbons (CHCs) are the main chemical compounds encoding reproductive status. However, these studies have largely focused on queenless or monogynous species whose workers are capable of egg laying and have mainly explored the mechanisms underlying queen-worker or worker-worker reproductive conflicts. Less is known about what occurs in highly polygynous ant species with permanently sterile workers. Here, we used the Argentine ant as a model to examine the role of CHCs in communicating reproductive information in such insect societies. The Argentine ant is unicolonial, highly polygynous, and polydomous. We identified several CHCs whose presence and levels were correlated with queen age, reproductive status, and fertility. Our results also provide new insights into queen executions in the Argentine ant, a distinctive feature displayed by this species in its introduced range. Each spring, just before new sexuals appear, workers eliminate up to 90% of the mated queens in their colonies. We discovered that queens that survived execution had different CHC profiles from queens present before and during execution. More specifically, levels of some CHCs were higher in the survivors, suggesting that workers could eliminate queens based on their chemical profiles. In addition, queen CHC profiles differed based on season and species range (native vs. introduced). Overall, the results of this study provide new evidence that CHCs serve as queen signals and do more than just regulate worker reproduction. PMID:29470506
[Study on the anti-Lewis lung carcinoma effect of metformin combined with MCT1 inhibitor CHC].
Guo, Fu-Chun; Wang, Li-Qiang; Zhang, Jing; Wang, Yong-Sheng
2013-05-01
To investigate the antitumor effect of the combination of metformin with alpha-cyano-4-hydroxycinnamic acid (CHC, a MCT1 inhibitor) in the treatment of Lewis lung cancer. In vitro, the utilization of lactate acid was measured by lactate assay in cultured medium and the inhibition of LL/2 cell proliferation of four groups [control group, metformin group (1 mmol/L and 5 mmol/L), CHC group (5 mmol/L) and the combination group (metformin 5 mmol/L and CHC 5 mmol/L)] was detected in 24 h, 48 h, and their apoptosis in 24 h was also detected. In vivo, twenty eight C57BL/6 mice bearing LL/2 (5 x 10(5)) subcutaneous Lewis lung cancer on the right flank was established and then randomly assigned into four groups: control, metformin (200 mg/kg body mass in 0.1 mL i. g. with NS 0.1 mL i. p.), CHC (100 mg/kg body mass in 0.1 mL i.p. with NS 0.1 mL i. g. ) and the combination (metformin 200 mg/kg body mass in 0.1 mL i.g. with CHC 100 mg/kg body mass in 0.1 mL i. p.). Tumor volume was measured. The pathologic observation and apoptotic analysis of tumors was assessed by TUNEL assay. Compared to the contorl, metformin or CHC alone, combination of two drugs leaded to a significant lactate acid production in cultured medium and the inhibition of LL/ 2 cell viability (P used alone in early stage (P metformin and CHC transformed the lactic acid metabolism in LL/2 cells and induced cell apoptosis and showed the antitumor effect.
Weddle, C B; Mitchell, C; Bay, S K; Sakaluk, S K; Hunt, J
2012-10-01
Phenotypic traits that convey information about individual identity or quality are important in animal social interactions, and the degree to which such traits are influenced by environmental variation can have profound effects on the reliability of these cues. Using inbred genetic lines of the decorated cricket, Gryllodes sigillatus, we manipulated diet quality to test how the cuticular hydrocarbon (CHC) profiles of males and females respond across two different nutritional rearing environments. There were significant differences between lines in the CHC profiles of females, but the effect of diet was not quite statistically significant. There was no significant genotype-by-environment interaction (GEI), suggesting that environmental effects on phenotypic variation in female CHCs are independent of genotype. There was, however, a significant effect of GEI for males, with changes in both signal quantity and content, suggesting that environmental effects on phenotypic expression of male CHCs are dependent on genotype. The differential response of male and female CHC expression to variation in the nutritional environment suggests that these chemical cues may be under sex-specific selection for signal reliability. Female CHCs show the characteristics of reliable cues of identity: high genetic variability, low condition dependence and a high degree of genetic determination. This supports earlier work showing that female CHCs are used in self-recognition to identify previous mates and facilitate polyandry. In contrast, male CHCs show the characteristics of reliable cues of quality: condition dependence and a relatively higher degree of environmental determination. This suggests that male CHCs are likely to function as cues of underlying quality during mate choice and/or male dominance interactions. © 2012 The Authors. Journal of Evolutionary Biology © 2012 European Society For Evolutionary Biology.
Hydrocarbon profiles throughout adult Calliphoridae aging: A promising tool for forensic entomology.
Pechal, Jennifer L; Moore, Hannah; Drijfhout, Falko; Benbow, M Eric
2014-12-01
Blow flies (Diptera: Calliphoridae) are typically the first insects to arrive at human remains and carrion. Predictable succession patterns and known larval development of necrophagous insects on vertebrate remains can assist a forensic entomologist with estimates of a minimum post-mortem interval (PMImin) range. However, adult blow flies are infrequently used to estimate the PMImin, but rather are used for a confirmation of larval species identification. Cuticular hydrocarbons have demonstrated potential for estimating adult blow fly age, as hydrocarbons are present throughout blow fly development, from egg to adult, and are stable structures. The goal of this study was to identify hydrocarbon profiles associated with the adults of a North American native blow fly species, Cochliomyia macellaria (Fabricius) and a North American invasive species, Chrysomya rufifacies (Macquart). Flies were reared at a constant temperature (25°C), a photoperiod of 14:10 (L:D) (h), and were provided water, sugar and powdered milk ad libitum. Ten adult females from each species were collected at day 1, 5, 10, 20, and 30 post-emergence. Hydrocarbon compounds were extracted and then identified using gas chromatography-mass spectrometry (GC-MS) analysis. A total of 37 and 35 compounds were detected from C. macellaria and Ch. rufifacies, respectively. There were 24 and 23 n-alkene and methyl-branched alkane hydrocarbons from C. macellaria and Ch. rufifacies, respectively (10 compounds were shared between species), used for statistical analysis. Non-metric multidimensional scaling analysis and permutational multivariate analysis of variance were used to analyze the hydrocarbon profiles with significant differences (Pforensic practitioners and potentially increase the use of adult insects during death investigations. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Application of solid phase micro extraction (SPME) in profiling hydrocarbons in oil spill cases
International Nuclear Information System (INIS)
Zuraidah Abdullah Munir; Norashikin Saim; Nurul Huda Mamat Ghani
2008-01-01
In environmental forensic, it is extremely important to have a fast and reliable method in identifying sources of spilled oil and petroleum products. In this study, solid phase micro extraction (SPME) method coupled to gas chromatography-mass spectrometry was developed for the analysis of hydrocarbons in diesel and petroleum contaminated soil samples. Optimization of SPME parameters such as extraction time, extraction temperature and desorption time, was performed using 100-μm poly dimethylsiloxane (PDMS) fiber. These parameters were studied at three levels by means of a central composite experimental design and the optimum experimental conditions were determined using response surface method. The developed SPME method was applied to determine the profiles of hydrocarbons in several oil contaminated soil sample. The SPME method was also used to study the effects of weathering on the profiles of hydrocarbons in unleaded gasoline, diesel and kerosene contaminated soil samples. After several days, significant losses of the lighter hydrocarbons were observed compared to the heavier ones. From these data, SPME method can be used to differentiate possible candidate sources in oil spill cases. (author)
Ferreira-Caliman, M J; Nascimento, F S; Turatti, I C; Mateus, S; Lopes, N P; Zucchi, R
2010-07-01
Members of social insect colonies employ a large variety of chemical signals during their life. Of these, cuticular hydrocarbons are of primary importance for social insects since they allow for the recognition of conspecifics, nestmates and even members of different castes. The objectives of this study were (1) to characterize the variation of the chemical profiles among workers of the stingless bee Melipona marginata, and (2) to investigate the dependence of the chemical profiles on the age and on the behavior of the studied individuals. The results showed that cuticular hydrocarbon profiles of workers were composed of alkanes, alkenes and alkadienes that varied quantitatively and qualitatively according to function of workers in the colony. Copyright 2010 Elsevier Ltd. All rights reserved.
Rapkin, J; Jensen, K; House, C M; Sakaluk, S K; Sakaluk, J K; Hunt, J
2017-04-01
The condition dependence of male sexual traits plays a central role in sexual selection theory. Relatively little, however, is known about the condition dependence of chemical signals used in mate choice and their subsequent effects on male mating success. Furthermore, few studies have isolated the specific nutrients responsible for condition-dependent variation in male sexual traits. Here, we used nutritional geometry to determine the effect of protein (P) and carbohydrate (C) intake on male cuticular hydrocarbon (CHC) expression and mating success in male decorated crickets (Gryllodes sigillatus). We show that both traits are maximized at a moderate-to-high intake of nutrients in a P:C ratio of 1 : 1.5. We also show that female precopulatory mate choice exerts a complex pattern of linear and quadratic sexual selection on this condition-dependent variation in male CHC expression. Structural equation modelling revealed that although the effect of nutrient intake on mating success is mediated through condition-dependent CHC expression, it is not exclusively so, suggesting that other traits must also play an important role. Collectively, our results suggest that the complex interplay between nutrient intake, CHC expression and mating success plays an important role in the operation of sexual selection in G. sigillatus. © 2016 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2016 European Society For Evolutionary Biology.
Chronic hepatitis C infection is associated with insulin resistance and lipid profiles.
Dai, Chia-Yen; Yeh, Ming-Lun; Huang, Chung-Feng; Hou, Chen-Hsiu; Hsieh, Ming-Yen; Huang, Jee-Fu; Lin, I-Ling; Lin, Zu-Yau; Chen, Shinn-Chern; Wang, Liang-Yen; Chuang, Wan-Long; Yu, Ming-Lung; Tung, Hung-Da
2015-05-01
Chronic hepatitis C virus (HCV) infection has been suggested to be associated with non-insulin-dependent diabetes mellitus and lipid profiles. This study aimed to investigate the possible relationships of insulin resistance (IR) and lipid profiles with chronic hepatitis C (CHC) patients in Taiwan. We enrolled 160 hospital-based CHC patients with liver biopsy and the 480 controlled individuals without CHC and chronic hepatitis B from communities without known history of non-insulin-dependent diabetes mellitus. Fasting plasma glucose, total cholesterol, high-density lipoprotein cholesterol (HDL-C), low-density lipoprotein cholesterol (LDL-C), triglycerides (TGs), alanine aminotransferase, and serum insulin levels, and homeostasis model assessment (HOMA-IR) were tested. When comparing factors between CHC patients, and sex- and age-matched controls who had no HCV infection, patients with HCV infection had a significantly higher alanine aminotransferase level, fasting plasma glucose level, insulin level, and HOMA-IR (P C and LDL-C levels (all P 2.5]), a high body mass index, TGs, and HCV RNA level are independent factors significantly associated with high HOMA-IR in multivariate logistic analyses. Chronic HCV infection was associated with metabolic characteristics including IR and lipid profile. IR was also associated with virological characteristics. © 2013 Journal of Gastroenterology and Hepatology Foundation and Wiley Publishing Asia Pty Ltd.
Effect of previous exposure to hbv on liver histology and treatment response in chc patients
International Nuclear Information System (INIS)
Khan, H.A.
2015-01-01
Objective: To analyze the influence of previous exposure to HBV on liver histology and treatment outcomes in chronic hepatitis C (CHC) patients. Study Design: Case control study. Place and Duration of Study: Rawalian Liver Clinic, Department of Medicine, Holy Family Hospital, Rawalpindi, from January 2011 to December 2012. Methodology: Medical records of CHC patients attending the Rawalian Liver Clinic were retrospectively analyzed. Virological and treatment responses along with histological changes were compared between cases (anti-HBc positive) and controls (anti-HBc negative). Significance was determined through chi-square test at p < 0.05. Results: Among the 592 CHC patients, 254 (42.9%) had serological evidence of a positive anti-HBc (cases) and 338 (57.1%), patients had negative anti-HBc (controls). No significant difference was found between ETR, SVR and treatment responses (n=220) between the two groups. Out of 65 patients whose liver biopsy data was available, cases were more likely to respond in the absence of fibrosis (63.2%, (n=24) vs. 36.8%, (n=14), p=0.001). The controls responded more in the presence of fibrosis (100% (n=9) vs. 0, p=0.001). There was no significant effect of anti-HBc positivity on grades of inflammation and consequent treatment response (p=0.14). Conclusion: There are a significant number of CHC patients with markers of previous HBV infection in Pakistani population. Previous HBV (anti-HBc positive) does not seem to have an adverse effect on liver histology and treatment responses in HBV infection. (author)
DEFF Research Database (Denmark)
van Zweden, Jelle Stijn; Vitikainen, Emma; D'Ettorre, Patrizia
2011-01-01
Split sex ratio theory predicts that when kin structure varies among colonies of social insects, in order to maximize the inclusive fitness, colonies with relatively high sister-sister relatedness should specialize in producing reproductive females, whereas in those with relatively low sister......-sister relatedness workers should bias their sex ratio towards males. However, in order to achieve this, workers need to be able to reliably assess the type of colony in which they live. The information on colony kin structure may be encoded in cuticular hydrocarbons (CHCs), assuming that genetic variability....... However, within-colony relatedness remains the key determinant of colony sex ratios. Based on our results, CHC variability cannot serve as accurate information on within-colony relatedness, kin structure, or full-sib affiliation, nor do workers seem to use colony CHC variability as a proxy for sex...
Lori J. Nelson; Laurence G. Cool; Christopher W. Solek; Michael I. Haverty
2008-01-01
Cuticular hydrocarbons (CHC) and soldier defense secretions (SDS) were characterized for collections of Reticulitermes from six counties (Los Angeles, Orange, Riverside, San Bernardino, San Diego, and Santa Barbara) in southern California. Collection sites included the type locality for R. hesperus, Lake Arrowhead (formerly known as Little Bear Lake) in the San...
Sexual Selection on male cuticular hydrocarbons via male-male competition and female choice.
Lane, S M; Dickinson, A W; Tregenza, T; House, C M
2016-07-01
Traditional views of sexual selection assumed that male-male competition and female mate choice work in harmony, selecting upon the same traits in the same direction. However, we now know that this is not always the case and that these two mechanisms often impose conflicting selection on male sexual traits. Cuticular hydrocarbons (CHCs) have been shown to be linked to both social dominance and male attractiveness in several insect species. However, although several studies have estimated the strength and form of sexual selection imposed on male CHCs by female mate choice, none have established whether these chemical traits are also subject to sexual selection via male-male competition. Using a multivariate selection analysis, we estimate and compare sexual selection exerted by male-male competition and female mate choice on male CHC composition in the broad-horned flour beetle Gnatocerus cornutus. We show that male-male competition exerts strong linear selection on both overall CHC abundance and body size in males, while female mate choice exerts a mixture of linear and nonlinear selection, targeting not just the overall amount of CHCs expressed but the relative abundance of specific hydrocarbons as well. We discuss the potential implications of this antagonistic selection with regard to male reproductive success. © 2016 The Authors. Journal of Evolutionary Biology published by John Wiley & Sons Ltd on behalf of European Society for Evolutionary Biology.
Synergistic degradation of chlorinated hydrocarbons with microorganisms and zero valent iron
Schöftner, Philipp; Summer, Dorothea; Leitner, Simon; Watzinger, Andrea; Wimmer, Bernhard; Reichenauer, Thomas
2016-04-01
Sites contaminated with chlorinated hydrocarbons (CHC) are located mainly within build-up regions. Therefore in most cases only in-situ technologies without excavation of soil material can be used for remediation. This project examines a novel in-situ remediation method, in which the biotic degradation via bacteria is combined with abiotic degradation via zero-valent iron particles (ZVI). ZVI particles are injected into the aquifer where CHC-molecules are reductively dechlorinated. However Fe0 is also oxidized by reaction with water leading to generation of H2 without any CHC degradation. To achieve biotic degradation often strictly anaerobic strains of the bacteria Dehalococcoides are used. These bacteria can dechlorinate CHC by utilizing H2. By combining these processes the H2, produced during the anaerobic corrosion of Fe0, could be used by bacteria for further CHC degradation. Therefore the amount of used Fe0 and as a consequence also remediation costs could be reduced. Additionally the continuous supply of H2 could make the bacterial degradation more controllable. Different Fe0 particles (nano- and micro-scale) were tested for their perchloroethene (PCE) degradation rate and H2 production rate in microcosms. PCE-degradation rate by different bacterial cultures was investigated in the same microcosm system. In course of these experiments the 13C enrichment factors of the PCE degradation of the different particles and cultures were determined to enable the differentiation of biotic and abiotic degradation. Preliminary results showed, that the nano-scale particles reacted faster with PCE and water than their micro-scaled counterparts. The PCE degradation via micro-scaled particles lead to 13C enrichment factors in the range of -3,6 ‰ ± 0,6 to -9,5 ‰ ± 0,2. With one of the examined bacterial cultures a fast reduction of PCE to ethene was observed. Although PCE and TCE were completely degraded by this culture the metabolites DCE and VC could still be detected
Directory of Open Access Journals (Sweden)
К. М. Ермохин
2017-10-01
Full Text Available Traditionally it is believed that the effect of induced polarization is an interfering factor for the measurement of electromagnetic fields and their interpretation during conducting works using magnetotelluric sounding and geomag-netic-variation profiling methods. A new method is proposed for isolating the effects of induced polarization during geomagnetic-variation profiling aimed at searching for hydrocarbon deposits on the basis of phase measurements during the conduct of geomagnetic-variation profiling. The phenomenon of induced polarization is proposed to be used as a special exploration mark for deep-lying hydrocarbon deposits. The traditional method of induced polarization uses artificial field sources, the powers of which are principally insufficient to reach depths of 3-5 km, which leads to the need to search for alternative - natural sources in the form of telluric and magnetotelluric fields. The proposed method makes it possible to detect and interpret the effects of induced polarization from deep-seated oil and gas reservoirs directly, without relying on indirect signs.
Moore, HE; Pechal, JL; Benbow, ME; Drijfhout, FP
2017-01-01
Creative Commons Attribution 4.0 International License Cuticular hydrocarbons (CHC) have been successfully used in the field of forensic entomology for identifying and ageing forensically important blowfly species, primarily in the larval stages. However in older scenes where all other entomological evidence is no longer present, Calliphoridae puparial cases can often be all that remains and therefore being able to establish the age could give an indication of the PMI. This paper examined ...
Chemical cues from females trigger male courtship behaviour in grasshoppers.
Finck, Jonas; Kuntze, Janine; Ronacher, Bernhard
2016-05-01
Gomphocerine grasshoppers use species-specific calling songs for sex recognition and mate attraction. In two closely related species, Chorthippus biguttulus and C. mollis, acoustic communication is the only experimentally characterized communication channel that elicits male courtship behaviour. However, courtship in these species involves extensive close-range interactions that are likely to be mediated by other signalling modalities, in particular chemical cues. We developed a bioassay to determine if female cuticular hydrocarbons (CHCs) act as chemical cues that induce courtship behaviour, and if males assess variation in CHCs to determine whether or not to court a female. The results of this approach provide evidence that grasshopper males use species- and sex-specific information from CHC signals and respond with a courtship song to the CHC profile of conspecific females but not to the CHC profile of heterospecific females and conspecific males. We conclude that males of C. biguttulus and C. mollis use multimodal channels for mating decisions, based on both acoustic and olfactory cues. We discuss various factors that might favour the evolution of male choosiness in grasshoppers.
Insulin signaling mediates sexual attractiveness in Drosophila.
Directory of Open Access Journals (Sweden)
Tsung-Han Kuo
Full Text Available Sexually attractive characteristics are often thought to reflect an individual's condition or reproductive potential, but the underlying molecular mechanisms through which they do so are generally unknown. Insulin/insulin-like growth factor signaling (IIS is known to modulate aging, reproduction, and stress resistance in several species and to contribute to variability of these traits in natural populations. Here we show that IIS determines sexual attractiveness in Drosophila through transcriptional regulation of genes involved in the production of cuticular hydrocarbons (CHC, many of which function as pheromones. Using traditional gas chromatography/mass spectrometry (GC/MS together with newly introduced laser desorption/ionization orthogonal time-of-flight mass spectrometry (LDI-MS we establish that CHC profiles are significantly affected by genetic manipulations that target IIS. Manipulations that reduce IIS also reduce attractiveness, while females with increased IIS are significantly more attractive than wild-type animals. IIS effects on attractiveness are mediated by changes in CHC profiles. Insulin signaling influences CHC through pathways that are likely independent of dFOXO and that may involve the nutrient-sensing Target of Rapamycin (TOR pathway. These results suggest that the activity of conserved molecular regulators of longevity and reproductive output may manifest in different species as external characteristics that are perceived as honest indicators of fitness potential.
Pask, Gregory M; Slone, Jesse D; Millar, Jocelyn G; Das, Prithwiraj; Moreira, Jardel A; Zhou, Xiaofan; Bello, Jan; Berger, Shelley L; Bonasio, Roberto; Desplan, Claude; Reinberg, Danny; Liebig, Jürgen; Zwiebel, Laurence J; Ray, Anandasankar
2017-08-17
Eusocial insects use cuticular hydrocarbons as components of pheromones that mediate social behaviours, such as caste and nestmate recognition, and regulation of reproduction. In ants such as Harpegnathos saltator, the queen produces a pheromone which suppresses the development of workers' ovaries and if she is removed, workers can transition to a reproductive state known as gamergate. Here we functionally characterize a subfamily of odorant receptors (Ors) with a nine-exon gene structure that have undergone a massive expansion in ants and other eusocial insects. We deorphanize 22 representative members and find they can detect cuticular hydrocarbons from different ant castes, with one (HsOr263) that responds strongly to gamergate extract and a candidate queen pheromone component. After systematic testing with a diverse panel of hydrocarbons, we find that most Harpegnathos saltator Ors are narrowly tuned, suggesting that several receptors must contribute to detection and discrimination of different cuticular hydrocarbons important in mediating eusocial behaviour.Cuticular hydrocarbons (CHC) mediate the interactions between individuals in eusocial insects, but the sensory receptors for CHCs are unclear. Here the authors show that in ants such as H. saltator, the 9-exon subfamily of odorant receptors (HsOrs) responds to CHCs, and ectopic expression of HsOrs in Drosophila neurons imparts responsiveness to CHCs.
Younossi, Zobair M; Afendy, Arian; Stepanova, Maria; Hossain, Noreen; Younossi, Issah; Ankrah, Kathy; Gramlich, Terry; Baranova, Ancha
2009-10-01
Hepatic steatosis occurs in 40-70% of patients chronically infected with hepatitis C virus [chronic hepatitis C (CH-C)]. Hepatic steatosis in CH-C is associated with progressive liver disease and a low response rate to antiviral therapy. Gene expression profiles were examined in CH-C patients with and without hepatic steatosis, non-alcoholic steatohepatitis (NASH) and fibrosis. This study included 65 CH-C patients who were not receiving antiviral treatment. Total RNA was extracted from peripheral blood mononuclear cells, quantified and used for one-step reverse transcriptase-polymerase chain reaction to profile 153 mRNAs that were normalized with six 'housekeeping' genes and a reference RNA. Multiple regression and stepwise selection assessed differences in gene expression and the models' performances were evaluated. Models predicting the grade of hepatic steatosis in patients with CH-C genotype 3 involved two genes: SOCS1 and IFITM1, which progressively changed their expression level with the increasing grade of steatosis. On the other hand, models predicting hepatic steatosis in non-genotype 3 patients highlighted MIP-1 cytokine encoding genes: CCL3 and CCL4 as well as IFNAR and PRKRIR. Expression levels of PRKRIR and SMAD3 differentiated patients with and without superimposed NASH only in the non-genotype 3 cohort (area under the receiver operating characteristic curve=0.822, P-value 0.006]. Gene expression signatures related to hepatic fibrosis were not genotype specific. Gene expression might predict moderate to severe hepatic steatosis, NASH and fibrosis in patients with CH-C, providing potential insights into the pathogenesis of hepatic steatosis and fibrosis in these patients.
Directory of Open Access Journals (Sweden)
Gonzálo Correa Arango
2001-04-01
Full Text Available
Por estudios epidemiológicos sabemos que el CHC es el octavo
cáncer más frecuente en el mundo; también que es 3 veces más
frecuente en hombres que en mujeres tanto en el mundo como en
Antioquia (1,2 y que se presentan 350.000 casos nuevos cada año.
Nuestro objetivo es describir el comportamiento clínico y epidemiológico del CHC en la población usuaria del HPTU entre enero de 1995 y julio del 2000.
Chen, Qiuxian; Liu, Yuan
2017-01-01
Informed by emergent learning theories and multiple evidenced benefits, cooperative learning has developed into a widely accepted organization mode of class in the Western context. For the same reason, cooperative learning is transferred, during the past decade, into classrooms of Confucian Heritage Culture (CHC) contexts. Concerns, however, are…
Petroleum Hydrocarbon Profiles of Water and Sediment of Algoa Bay, Eastern Cape, South Africa
Directory of Open Access Journals (Sweden)
Abiodun O. Adeniji
2017-10-01
Full Text Available Petroleum hydrocarbon profiles of water and sediment samples of Algoa Bay in the Eastern Cape Province of South Africa were assessed using standard analytical procedures. Water (from surface and bottom levels and sediment samples were collected from five locations in the bay from February to June 2016. Extraction of the petroleum hydrocarbons from the water and sediment samples collected was achieved using liquid-liquid and Soxhlet extraction techniques, respectively, followed by column clean up. Target compounds were analytically determined with gas chromatography–flame ionization detector (GC-FID and quantified by integrating the areas of both the resolved and unresolved components. Physicochemical properties of the water samples were also determined on site using a SeaBird 19plusV2 CTD SBE 55 device. Estimated limit of detection, limit of quantitation and relative standard deviation for the 35 n-alkane standards ranged from 0.06 to 0.13 μg/L, 0.30 to 0.69 μg/L and 3.61 to 8.32%, respectively. Results showed that total petroleum hydrocarbon (TPH varied from 45.07 to 307 μg/L in the water and 0.72 to 27.03 mg/kg in the sediments. The mean concentrations of TPH in both the water and sediment samples from Algoa Bay revealed a slight level of pollution. The diagnostic indices used showed that the hydrocarbons in the area were from both biogenic and anthropogenic sources. Hence, there is need for adequate regulation and control of all activities contributing to the levels of petroleum hydrocarbon in the marine environment for the safety of human, aquatic and wild lives in the area.
Petroleum Hydrocarbon Profiles of Water and Sediment of Algoa Bay, Eastern Cape, South Africa.
Adeniji, Abiodun O; Okoh, Omobola O; Okoh, Anthony I
2017-10-20
Petroleum hydrocarbon profiles of water and sediment samples of Algoa Bay in the Eastern Cape Province of South Africa were assessed using standard analytical procedures. Water (from surface and bottom levels) and sediment samples were collected from five locations in the bay from February to June 2016. Extraction of the petroleum hydrocarbons from the water and sediment samples collected was achieved using liquid-liquid and Soxhlet extraction techniques, respectively, followed by column clean up. Target compounds were analytically determined with gas chromatography-flame ionization detector (GC-FID) and quantified by integrating the areas of both the resolved and unresolved components. Physicochemical properties of the water samples were also determined on site using a SeaBird 19plusV2 CTD SBE 55 device. Estimated limit of detection, limit of quantitation and relative standard deviation for the 35 n -alkane standards ranged from 0.06 to 0.13 μg/L, 0.30 to 0.69 μg/L and 3.61 to 8.32%, respectively. Results showed that total petroleum hydrocarbon (TPH) varied from 45.07 to 307 μg/L in the water and 0.72 to 27.03 mg/kg in the sediments. The mean concentrations of TPH in both the water and sediment samples from Algoa Bay revealed a slight level of pollution. The diagnostic indices used showed that the hydrocarbons in the area were from both biogenic and anthropogenic sources. Hence, there is need for adequate regulation and control of all activities contributing to the levels of petroleum hydrocarbon in the marine environment for the safety of human, aquatic and wild lives in the area.
International Nuclear Information System (INIS)
Leshukov, A.Yu.; Kapyshev, V.K.; Kartashev, I.A.; Kovalenko, V.G.; Razmerov, A.V.; Sviridenko, M.N.; Strebkov, Yu.S.
2010-01-01
Russian Federation has adopted the strategy to participate in the TBM Program on the rights of 'Partner' in the development of ceramic helium-cooled (CHC) test blanket module (TBM) concept. In this connection one of the possible collaboration scenarios is to integrate the characteristic design element of RF concept in the structure of 'Leader's' TBM and to test it in ITER environment. According to the collaboration in the framework of Test Blanket Working Group (TBWG) the 'Leader' and 'Partner' should develop together the selected (DEMO-relevant) TBM concept which will not disturb the ITER operation. Because of the analogue in the design principles, testing objectives and parameters of the EU CHC TBM concept ('Leader') and of the RF one, the RF specialists have developed the design options of breeding zone sub-module (BZSM) to be integrated in one of the EU TBM cells for further testing in ITER. There are four BZSM design options (according to four types of TBM to be tested) have been developed. Brief explanation of RF strategy in the partnership for the development of CHC blanket concept is presented in this paper. This paper also contains the description of all the four BZSM designs and some technological features.
Cormier, Damien C.; Bulut, Okan; McGrew, Kevin S.; Frison, Jessica
2016-01-01
Writing is a complex academic task--it involves numerous mental processes. Given the necessity for developing writing skills from elementary to secondary school, this study aimed to investigate the role of broad cognitive abilities derived from the Cattell-Horn-Carroll (CHC) theory of intelligence in predicting skills associated with writing…
Directory of Open Access Journals (Sweden)
Stephan Kühbandner
2013-12-01
Full Text Available The exoskeletons of insects are covered by complex mixtures of cuticular hydrocarbons (CHCs which are involved in social and sexual communication. However, little is known about the relationship between the structures of CHCs and their behavioral activity. The key component of the contact sex pheromone of the parasitoid Lariophagus distinguendus is 3-methylheptacosane (3-MeC27, which is present in CHC profiles of both females and newly emerged males. The CHCs of females and young males elicit wing-fanning behavior in older males. However, as young males age, 3-MeC27 disappears from their CHC profiles and they no longer elicit wing-fanning responses from other males. We applied enantiopure 3-MeC27 and structurally related CHCs (with respect to chain length or methyl-branch position to the cuticle of aged male dummies and recorded the wing-fanning behavior of responding males. Only the two enantiomers of 3-MeC27 restored the dummies’ attractiveness. The addition of structurally related CHCs or various n-alkanes to bioactive dummies of young males and females significantly decreased wing-fanning by test males. Hence, L. distinguendus males respond specifically but not enantioselectively to 3-MeC27, and perceive the CHC profiles as a whole. Both removal (as is the case with 3-MeC27 in aging males and addition of individual compounds may disrupt the behavioral response.
Johnson, C A; Vander Meer, R K; Lavine, B
2001-09-01
Queens of the slave-maker ant, Polyergus breviceps, take over nests of their Formica host species by fatally attacking the resident queen. As workers only begin grooming the P. breviceps queen once she has ceased her attack, we investigated whether a change in parasite queen chemistry may account for the change in worker behavior. Cuticular hydrocarbon profiles of newly mated P. breviceps queens and of queens of their two Formica host species were found to be species-specific. Profiles of newly mated P. breviceps queens that had attacked a Formica queen, however, were virtually identical to the queen profile of the species killed. Mass spectral analysis revealed that the hydrocarbons on the cuticles of newly mated P. breviceps changed from primarily normal alkanes to methyl and di-methyl branched alkanes after attacks. The results suggest that cuticular compounds from the host queen were transferred to the parasite queen during their aggressive interaction.
Moore, Hannah E; Pechal, Jennifer L; Benbow, M Eric; Drijfhout, Falko P
2017-05-16
Cuticular hydrocarbons (CHC) have been successfully used in the field of forensic entomology for identifying and ageing forensically important blowfly species, primarily in the larval stages. However in older scenes where all other entomological evidence is no longer present, Calliphoridae puparial cases can often be all that remains and therefore being able to establish the age could give an indication of the PMI. This paper examined the CHCs present in the lipid wax layer of insects, to determine the age of the cases over a period of nine months. The two forensically important species examined were Calliphora vicina and Lucilia sericata. The hydrocarbons were chemically extracted and analysed using Gas Chromatography - Mass Spectrometry. Statistical analysis was then applied in the form of non-metric multidimensional scaling analysis (NMDS), permutational multivariate analysis of variance (PERMANOVA) and random forest models. This study was successful in determining age differences within the empty cases, which to date, has not been establish by any other technique.
Dlaczego Słowińcy nie chcą rozmawiać? O antropologicznym czytaniu historii
Filip, Mariusz
2015-01-01
Celem eseju jest oswojenie czytelnika ze sposobem antropologicznej/etnologicznej lektury przeszłości. Nie będzie to czynione poprzez prezentowanie czy formułowanie jakiego teoretycznego programu, lecz przez spojrzenie, jak wygląda to w praktyce. Przykładem będzie intrygująca grypa Słowińców. Pretekstem dla mojego antropologicznego czytania historii, jest postawienie na pozór banalnego, lecz świadomego i przemyślanego pytania: „Dlaczego Słowińcy nie chcą rozmawiać”? To pytanie stało się najważ...
Light hydrocarbons vertical profiles and fluxes in a french rural area
Kanakidou, M.; Bonsang, B.; Lambert, G.
By means of manned hot air balloon flights, in July 1986, an experiment was conducted in a rural area of southwest France in order to determine the production at ground level of non-methane hydrocarbons in the C 2-C 6 range. Flux determinations were based on vertical profiles before and after the development of a temperature inversion layer which allowed the measurement of the NMHC accumulation close to ground level. The main species produced in the late afternoon were acetylene, propane, ethene, propene and ethane with production rates of the order of 0.5 to 2 × 10 -4g of C m -2 h -1. Isoprene was found to be the main other unsaturated species also produced. The fluxes and the atmospheric content of the air column before the inversion are consistent with an average OH radical concentration of 2 × 10 6 cm -3.
Niileksela, Christopher R.; Reynolds, Matthew R.
2014-01-01
This study was designed to better understand the relations between learning disabilities and different levels of latent cognitive abilities, including general intelligence (g), broad cognitive abilities, and specific abilities based on the Cattell-Horn-Carroll theory of intelligence (CHC theory). Data from the "Differential Ability…
Proctor, Briley
2012-01-01
This study examined the relationship between cognitive abilities and math achievement within a sample of college students with learning disabilities (LD). The cognitive abilities were seven areas identified by Stratum II of the Cattell-Horn-Carroll (CHC) theory of cognitive abilities, in addition to the eighth area of Working Memory. Math…
Basnet, Pravesh; Noggle, Chad A; Dean, Raymond S
2015-01-01
Depression has been commonly associated with both subjective complaints and objectively measured problems in cognition. Most commonly discussed in relation to the adult population, growing evidence has supported the idea that children and adolescents experience cognitive problems in relation to depression. The purpose of this study was to further examine the negative influence of depression on the cognitive functioning of children and adolescents. Additionally, the present study evaluated the sensitivity of the Woodcock-Johnson III Test of Cognitive Abilities (WJ-III-COG) and, in turn, the Cattell-Horn-Carroll (CHC) theory in measuring cognitive problems related to depression in children and adolescents. Participants included 420 children and adolescents aged 8 to 18 years old (M = 13.09, SD = 2.95) with a clinical diagnosis of depression. Comparisons were made against the normative mean. All participants completed 11 subtests of the WJ-III-COG including Visual-Auditory Learning, Spatial Relations, Sound Blending, Concept Formations, Visual Matching, Numbers Reversed, Auditory-Working Memory, Picture Recognition, Analysis Synthesis, Decision Speed, and Memory for Words. Children and adolescents with depression demonstrated significantly lower performance on subtests related to learning and memory (long-term retrieval), attentional capacity, working memory, reasoning, and processing speed. No problems were noted on subtests related to visual-spatial thinking and auditory processing. Findings suggested sensitivity of the WJ-III-COG and CHC theory in identifying cognitive problems associated with depression in children and adolescents.
Selfish strategies and honest signalling: reproductive conflicts in ant queen associations
DEFF Research Database (Denmark)
Holman, Luke; Dreier, Stephanie; d'Ettorre, Patrizia
2010-01-01
Social insects offer unique opportunities to test predictions regarding the evolution of cooperation, life histories and communication. Colony founding by groups of unrelated queens, some of which are later killed, may select for selfish reproductive strategies, honest signalling and punishment....... Here, we use a brood transfer experiment to test whether cofounding queens of the ant Lasius niger 'selfishly' adjust their productivity when sharing the nest with future competitors. We simultaneously analysed queen cuticular hydrocarbon (CHC) profiles to investigate whether queens honestly signal...... correlated with reproductive maturation, and to a lesser extent with productivity; the same hydrocarbons were more abundant on queens that were not killed, suggesting that workers select productive queens using these chemical cues. Our results highlight the role of honest signalling in the evolution...
International Nuclear Information System (INIS)
Seech, A.; Burwell, S.; Marvan, I.
1994-01-01
Bench-scale treatability investigations, pilot-scale and full-scale bioremediation projects were conducted to evaluate Daramend trademark bioremediation of soils containing petroleum hydrocarbons, heavy oils, paraffins, chlorinated phenols and polycyclic aromatic hydrocarbons (PAHs). Bench-scale investigations were conducted using glass microcosms. Pilot-scale and full-scale demonstrations were conducted at industrial sites and included treatment of excavated soils and sediments in on-site cells constructed using synthetic liners and covered by steel/polyethylene structures as well as in-situ treatment. A total of approximately 5,000 tons of soil was treated. The soil treatment included organic soil amendments, specialized tillage/aeration apparatus, and strict control of soil moisture. The amendments are composed of naturally-occurring organic materials prepared to soil-specific particle size distributions, nutrient profiles, and nutrient-release kinetics. Bench-scale work indicated that in refinery soil containing high concentrations of heavy oils, extractable hydrocarbon concentrations could be rapidly reduced to industrial clean-up criteria, and that the hydrocarbons were fully mineralized with release of CO 2
Growth of hydrocarbon utilizing microorganisms
Digital Repository Service at National Institute of Oceanography (India)
Bhosle, N.B.; Mavinkurve, S.
Two isolates from marine mud having broad spectrum hydrocarbon utilizing profile were identified as Arthrobacter simplex and Candida tropicalis.Both the organisms grew exponentially on crude oil. The cell yield of the organisms was influenced...
Chemical cues mediate species recognition in field crickets
Directory of Open Access Journals (Sweden)
Frances eTyler
2015-05-01
Full Text Available Cuticular hydrocarbons (CHCs are important in mate choice in many insects, and may be used for species recognition if CHC profiles differ between potentially hybridizing species. In the sibling field cricket species Gryllus campestris and G. bimaculatus, females of G. bimaculatus are tolerant towards G. campestris males and can mate with them. However, G. campestris females are highly aggressive towards heterospecific G. bimaculatus males, and matings between them never happen. We examined whether cricket females might use CHCs to determine the species identity of their potential mates. We firstly analyzed the cuticular chemical profile by gas chromatography and mass spectrometry to assess the potential of CHCs to be used for species recognition in these crickets. We then manipulated females’ ability to detect chemical cues by carrying out chemical ablation of the antennae, and measured changes in aggressive responses to heterospecific males. We show that there are significant interspecies differences in CHC expression for both sexes, and that females with chemically ablated antennae reduce aggressive behavior towards heterospecific males. Our findings support the prediction that cuticular semiochemicals can play a key role in reproductive isolation between closely related insect species.
International Nuclear Information System (INIS)
Umezu, Toyoshi; Shibata, Yasuyuki
2014-01-01
The present study aimed to clarify whether dose–response profiles of acute behavioral effects of 1,2-dichloroethane (DCE), 1,1,1-trichloroethane (TCE), trichloroethylene (TRIC), and tetrachloroethylene (PERC) differ. A test battery involving 6 behavioral endpoints was applied to evaluate the effects of DCE, TCE, TRIC, and PERC in male ICR strain mice under the same experimental conditions. The behavioral effect dose–response profiles of these compounds differed. Regression analysis was used to evaluate the relationship between the dose–response profiles and structural and physical properties of the compounds. Dose–response profile differences correlated significantly with differences in specific structural and physical properties. These results suggest that differences in specific structural and physical properties of DCE, TCE, TRIC, and PERC are responsible for differences in behavioral effects that lead to a variety of dose–response profiles. - Highlights: • We examine effects of 4 chlorinated hydrocarbons on 6 behavioral endpoints in mice. • The behavioral effect dose–response profiles for the 4 compounds are different. • We utilize regression analysis to clarify probable causes of the different profiles. • The compound's physicochemical properties probably produce the different profiles
Energy Technology Data Exchange (ETDEWEB)
Umezu, Toyoshi, E-mail: umechan2@nies.go.jp; Shibata, Yasuyuki, E-mail: yshibata@nies.go.jp
2014-09-01
The present study aimed to clarify whether dose–response profiles of acute behavioral effects of 1,2-dichloroethane (DCE), 1,1,1-trichloroethane (TCE), trichloroethylene (TRIC), and tetrachloroethylene (PERC) differ. A test battery involving 6 behavioral endpoints was applied to evaluate the effects of DCE, TCE, TRIC, and PERC in male ICR strain mice under the same experimental conditions. The behavioral effect dose–response profiles of these compounds differed. Regression analysis was used to evaluate the relationship between the dose–response profiles and structural and physical properties of the compounds. Dose–response profile differences correlated significantly with differences in specific structural and physical properties. These results suggest that differences in specific structural and physical properties of DCE, TCE, TRIC, and PERC are responsible for differences in behavioral effects that lead to a variety of dose–response profiles. - Highlights: • We examine effects of 4 chlorinated hydrocarbons on 6 behavioral endpoints in mice. • The behavioral effect dose–response profiles for the 4 compounds are different. • We utilize regression analysis to clarify probable causes of the different profiles. • The compound's physicochemical properties probably produce the different profiles.
Composite liners protect ground water
Energy Technology Data Exchange (ETDEWEB)
Tatzky, R; August, H
1987-12-01
For about 10 years flexible membrane liners (FMLs) have been used as bottom liners to protect ground water in the vicinity of waste sites. But a permeation (absorption, diffusion, desorption) of chemical liquids, e.g. hydrocarbons (HC) and chlorinated hydrocarbons (CHC) will generally occur. The rates of permeation depend, first of all, on the chemical affinity, the thickness of the FML and the boundary conditions. In order to improve the barrier quality of polymeric membranes, it is necessary to study the transport processes of HC and CHC through the polymeric materials. Long-term tests with composite liners are additionally carried out. These are liners which consist of two components, flexible membrane and natural soil liner (recompacted clay, bentonite-soil mixtures). Laboratory studies show that with composite liners a perfect sealing of waste sites may be possible. Test methods for measuring permeation rates of HC and CHC through polymeric membranes and methods of testing for the development of composite liner systems are presented. (orig.)
Nishimura, Chiya; Horii, Yuichi; Tanaka, Shuhei; Asante, Kwadwo Ansong; Ballesteros, Florencio; Viet, Pham Hung; Itai, Takaaki; Takigami, Hidetaka; Tanabe, Shinsuke; Fujimori, Takashi
2017-06-01
We conducted this study to assess the occurrence, profiles, and toxicity of chlorinated polycyclic aromatic hydrocarbons (Cl-PAHs) and brominated polycyclic aromatic hydrocarbons (Br-PAHs) in e-waste open burning soils (EOBS). In this study, concentrations of 15 PAHs, 26 Cl-PAHs and 14 Br-PAHs were analyzed in EOBS samples. We found that e-waste open burning is an important emission source of Cl-PAHs and Br-PAHs as well as PAHs. Concentrations of total Cl-PAHs and Br-PAHs in e-waste open burning soil samples ranged from 21 to 2800 ng/g and from 5.8 to 520 ng/g, respectively. Compared with previous studies, the mean of total Cl-PAH concentrations of the EOBS samples in this study was higher than that of electronic shredder waste, that of bottom ash, and comparable to fly ash from waste incinerators in Korea and Japan. The mean of total Br-PAH concentrations of the EOBS samples was generally three to four orders of magnitude higher than those in incinerator bottom ash and comparable to incinerator fly ash, although the number of Br-PAH congeners measured differed among studies. We also found that the Cl-PAH and Br-PAH profiles were similar among all e-waste open burning soil samples but differed from those in waste incinerator fly ash. The profiles and principal component analysis results suggested a unique mechanism of Cl-PAH and Br-PAH formation in EOBS. In addition, the Cl-PAHs and Br-PAHs showed high toxicities equivalent to PCDD/Fs measured in same EOBS samples when calculated based on their relative potencies to benzo[a]pyrene. Along with chlorinated and brominated dioxins and PAHs, Cl-PAHs and Br-PAHs are important environmental pollutants to investigate in EOBS. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Daniel Antonio Molina
2015-09-01
Full Text Available In this paper we apply to solve the Radio Network Design problem (RND a series of the non-conventional genetic algorithms called Cross generational elitist selection Heterogeneous recombination Cataclysmic mutation (CHC. A set of genetic algorithms is used to perform a comparative performance of the proposed algorithms. An objective function based on signal coverage efficiency is used. Genetic variability of the population is used for both, as a parameter of convergence and detection of incest. Furthermore the variability of the best individual is proposed as a shaking mechanism. This allows generating dynamic populations according to the most promising solutions generating different search spaces. The results obtained by the proposed algorithms are satisfactory.
Pavković-Lučić, Sofija; Todosijević, Marina; Savić, Tatjana; Vajs, Vlatka; Trajković, Jelena; Anđelković, Boban; Lučić, Luka; Krstić, Gordana; Makarov, Slobodan; Tomić, Vladimir; Miličić, Dragana; Vujisić, Ljubodrag
2016-02-01
Cuticular hydrocarbons (CHCs) in Drosophila melanogaster represent the basis of chemical communication being involved in many important biological functions. The aim of this study was to characterize chemical composition and variation of cuticular profiles in five D. melanogaster strains. These strains were reared for approximately 300 generations on five diets: standard cornmeal medium and substrates prepared with apple, banana, tomato, and carrot. Differences in quantity and/or quality in CHCs were assumed as a result of activation of different metabolic pathways involved in food digestion and adaptations to the particular diet type. In total, independently of sex and strain, 66 chemical compounds were identified. In females of all strains, 60 compounds were identified, while, in males, 47 compounds were extracted. Certain new chemical compounds for D. melanogaster were found. MANOVA confirmed that CHC amounts significantly depend on sex and substrates, as well as on their interactions. Discriminant analysis revealed that flies belonging to 'apple' and 'carrot' strains exhibited the most noticeable differences in CHC repertoires. A non-hydrocarbon pheromone, cis-vaccenyl acetate (cVA) also contributed to the variation in the pheromone bouquet among the strains. Variability detected in CHCs and cVA may be used in the explanation of differences in mating behaviour previously determined in analyzed fly strains. Copyright © 2016 Verlag Helvetica Chimica Acta AG, Zürich.
Experimental investigation of HFC407C/HC290/HC600a mixture in a window air conditioner
International Nuclear Information System (INIS)
Jabaraj, D.B.; Avinash, P.; Lal, D. Mohan; Renganarayan, S.
2006-01-01
HCFC22, one of the widely used refrigerants in window air conditioners must be phased out soon as per the Montreal protocol. Presently, HFC407C is considered as a potential drop in substitute for HCFC22, but retrofitting HCFC22 systems with HFC407C with polyol ester oil (POE) is a major issue as HFC407C is immiscible with mineral oil. The miscibility issue of HFC407C with mineral oil was overcome with the addition of a HC blend to it. The above technoeconomic feasibility issues to retrofit the existing HCFC22 systems with an ozone friendly refrigerant and retain the energy efficiency of the system are challenges in the air conditioning sector. In this present work, an experimental analysis has been conducted in a window air conditioner retrofitted with eco-friendly refrigerant mixtures of HFC407C/HC290/HC600a without changing the mineral oil. Its performance, as well as energy consumption, was compared with the conventional one. It is observed that the mixtures demand lengthening of the condenser in order to maintain the discharge pressure within acceptable limits. This also resulted in better heat transfer at the condenser. Therefore, in this study, the condenser tube length was increased by 19% to suit the mixtures as compared to HCFC22. Compared to HCFC22, the refrigeration capacity of the new mixture was 9.54-12.76% higher than that of HCFC22, while the actual COP was found to be 11.91-13.24% higher than that of HCFC22. The overall performance has proved that the HFC407C/HC blend refrigerant mixture could be an eco-friendly substitute to phase out HCFC22
International Nuclear Information System (INIS)
Zhang Yuzhong; Deng Shuxing; Liu Yanan; Shen Guofeng; Li Xiqing; Cao Jun; Wang Xilong; Reid, Brian; Tao Shu
2011-01-01
Air-soil exchange is an important process governing the fate of polycyclic aromatic hydrocarbons (PAHs). A novel passive air sampler was designed and tested for measuring the vertical concentration profile of 4 low molecular weight PAHs in gaseous phase (PAH LMW4 ) in near soil surface air. Air at various heights from 5 to 520 mm above the ground was sampled by polyurethane foam disks held in down-faced cartridges. The samplers were tested at three sites: A: an extremely contaminated site, B: a site near A, and C: a background site on a university campus. Vertical concentration gradients were revealed for PAH LMW4 within a thin layer close to soil surface at the three sites. PAH concentrations either decreased (Site A) or increased (Sites B and C) with height, suggesting either deposition to or evaporation from soils. The sampler is a useful tool for investigating air-soil exchange of gaseous phase semi-volatile organic chemicals. - Research highlights: → Design, field test and calibration of the novel passive air sampler, PAS-V-I. → Vertical concentration gradients of PAH LMW4 within a thin layer close to soil. → Comparison of results between PAS-V-I measurement and fugacity approach. → Potential application of PAS-V-I and further modifications. - A novel passive sampling device was developed and tested for measuring vertical concentration profile of gaseous phase polycyclic aromatic hydrocarbons in near soil surface air.
Moore, H E; Butcher, J B; Adam, C D; Day, C R; Falko, P D
2016-01-01
Cuticular hydrocarbons were extracted daily from the larvae of two closely related blowflies Calliphora vicina and Calliphora vomitoria (Diptera: Calliphoridae). The hydrocarbons were then analysed using Gas Chromatography–Mass Spectrometry (GC–MS), with the aim of observing changes within their chemical profiles in order to determine the larval age. The hydrocarbons were examined daily for each species from 1 day old larvae until pupariation. The results show significant chemical changes occ...
Bernhardt, Victoria; Pogoda, Werner; Verhoff, Marcel A; Toennes, Stefan W; Amendt, Jens
2017-09-01
Age estimation of insects like blow flies plays an important role in forensic entomology and can answer questions in regard to time of death. So far the focus is on the immature stages of these insects, but recently the adult fly became a target of interest. It has been established that the profile of specific cuticular hydrocarbons (CHCs) changes in a consistent pattern as adult insects age; thus, their analysis could be a promising tool for the age estimation of adult insects. We investigated the CHC n-pentacosane (nC25) on the legs of the adult blow flies Lucilia sericata and Calliphora vicina with gas chromatography-mass spectrometry. The flies were kept at room temperature (17°C±2°C) and 12:12 L:D from Day 1 to Day 20 post-emergence. For each of five flies per species, the amount of nC25 on all legs was determined daily. The amounts of nC25 on C. vicina increased linearly (R 2 =0.949). No significant difference between sexes could be detected. While L. sericata showed the same linear increase in general, we found significant (page is constructed from these data. Although the influence of various environmental factors, e.g., fluctuating temperatures, still needs to be tested, nC25 seems to be a promising tool for the age estimation of adult flies. Copyright © 2017 The Chartered Society of Forensic Sciences. Published by Elsevier B.V. All rights reserved.
Soil microbial communities: Influence of geographic location and hydrocarbon pollutants
CSIR Research Space (South Africa)
Maila, MP
2006-02-01
Full Text Available The importance and relevance of the geographical origin of the soil sample and the hydrocarbons in determining the functional or species diversity within different bacterial communities was evaluated using the community level physiological profiles...
Analysis of hydrocarbons generated in coalbeds
Butala, Steven John M.
This dissertation describes kinetic calculations using literature data to predict formation rates and product yields of oil and gas at typical low-temperature conditions in coalbeds. These data indicate that gas formation rates from hydrocarbon thermolysis are too low to have generated commercial quantities of natural gas, assuming bulk first-order kinetics. Acid-mineral-catalyzed cracking, transition-metal-catalyzed hydrogenolysis of liquid hydrocarbons, and catalyzed CO2 hydrogenation form gas at high rates. The gaseous product compositions for these reactions are nearly the same as those for typical natural coalbed gases, while those from thermal and catalytic cracking are more representative of atypical coalbed gases. Three Argonne Premium Coals (Upper-Freeport, Pittsburgh #8 and Lewiston-Stockton) were extracted with benzene in both Soxhlet and elevated pressure extraction (EPE) systems. The extracts were compared on the basis of dry mass yield and hydrocarbon profiles obtained by gas chromatography/mass spectrometry. The dry mass yields for the Upper-Freeport coal gave consistent results by both methods, while the yields from the Pittsburgh #8 and Lewiston-Stockton coals were greater by the EPE method. EPE required ˜90 vol. % less solvent compared to Soxhlet extraction. Single-ion-chromatograms of the Soxhlet extracts all exhibited bimodal distributions, while those of the EPE extracts did not. Hydrocarbons analyzed from Greater Green River Basin samples indicate that the natural oils in the basin originated from the coal seams. Analysis of artificially produced oil indicates that hydrous pyrolysis mimics generation of C15+ n-alkanes, but significant variations were found in the branched alkane, low-molecular-weight n-alkanes, and high-molecular-weight aromatic hydrocarbon distributions.
International Nuclear Information System (INIS)
Roder, M.
1985-01-01
Papers dealing with radiolysis of aromatic hydrocarbons of different composition (from benzene to terphenyls and hydrocarbons with condensed rings) as well as their mixtures (with alkanes, alkenes, other aromatic hydrocarbons) are reviewed. High radiation stability of aromatic hydrocarbons in condensed phases associated with peculiarities of molecular structure of compounds is underlined. Mechanisms of radiolytic processes, vaues of product yields are considered
An Alien in the Group: Eusocial Male Bees Sharing Nonspecific Reproductive Aggregations
dos Santos, C. F.; Ferreira-Caliman, M. J.; Nascimento, F. S.
2015-01-01
Sexual selection predicts that individuals competing for access to sexual partners should maximize their chances of mating by looking for sites where the chances of finding partners are more likely to occur. However, males of stingless bees have been observed sharing nonspecific reproductive aggregations. This uncommon behavior appears to confer no obvious increase of individual fitness. It has been suggested that this reproductive strategy is due to the similarity between male odors common to different stingless bee species. Cuticular hydrocarbons (CHCs) are candidate odors of interest because their nonvolatile pheromone nature allows them to play an important role in sexual behavior and species recognition. Here, we review the literature to evaluate whether any phylogenetic patterns exist among male stingless bees that aggregate with closely or distantly related species. We also compared the CHC profiles of males of Neotropical stingless bee species (Plebeia sp. Schwarz, Trigona spinipes (F.), Tetragona clavipes (F.), Nannotrigona testaceicornis (Lepeletier), Scaptotrigona aff. depilis (Moure), Tetragonisca angustula (Latreille), and Melipona subnitida (Ducke) to reveal any chemical similarities among their male odors. We found males of 21 stingless bee species involved in interspecific interactions mainly from Neotropical and Indo-Malayan/Australasian regions. Alien males did not necessarily visit host aggregations of closely related species. Furthermore, the CHC profiles of different studied species were very distinct from each other and do not overlapped at all. It is unclear yet why this apparently nonadaptive behavior carried out by some stingless bee males. PMID:26518220
A study of the microbiology and polycyclic aromatic hydrocarbons ...
African Journals Online (AJOL)
A study was carried out on the drill cuttings from three different oil and gas wells located at Ologbo Community at Edo State with respect to their microbiology and polycyclic aromatic hydrocarbons (PAHs) compositional profile and sources. Isolation and enumeration of heterotrophic bacteria and fungi was carried out using ...
Hypertension care at a Cape Town community health centre | Lunt ...
African Journals Online (AJOL)
Objectives. To describe the demographic profile of hypertensive patients and the quality of care for hypertension at a Cape Town community health centre (CHC). Design. Prospective, descriptive study. Setting and subjects. Medium-sized CHC, attended by 1098 hypertensive patients during a 1-year period from 1 January ...
Cruz-Landim, C; Ferreira-Caliman, M J; Gracioli-Vitti, L F; Zucchi, R
2012-04-19
We investigated whether Melipona quadrifasciata worker mandibular gland secretions contribute directly to their cuticular hydrocarbon profile. The mandibular gland secretion composition and cuticular surface compounds of newly emerged worker bees, nurse bees, and foragers were determined by gas chromatography and mass spectrometry and compared. Both the mandibular gland secretions and the cuticular surface compounds of all worker stages were found to be composed almost exclusively of hydrocarbons. Although the relative proportion of hydrocarbons from the cuticular surface and gland secretion was statistically different, there was a high similarity in the qualitative composition between these structures in all groups of bees.
Neff, Jerry M; Durell, Gregory S
2012-04-01
An objective of a multiyear monitoring program, sponsored by the US Department of the Interior, Bureau of Ocean Energy Management was to examine temporal and spatial changes in chemical and biological characteristics of the Arctic marine environment resulting from offshore oil exploration and development activities in the development area of the Alaskan Beaufort Sea. To determine if petroleum hydrocarbons from offshore oil operations are entering the Beaufort Sea food web, we measured concentrations of hydrocarbons in tissues of amphipods, Anonyx nugax, sediments, Northstar crude oil, and coastal peat, collected between 1999 and 2006 throughout the development area. Mean concentrations of polycyclic aromatic hydrocarbons (PAH), saturated hydrocarbons (SHC), and sterane and triterpane petroleum biomarkers (StTr) were not significantly different in amphipods near the Northstar oil production facility, before and after it came on line in 2001, and in amphipods from elsewhere in the study area. Forensic analysis of the profiles (relative composition and concentrations) of the 3 hydrocarbon classes revealed that hydrocarbon compositions were different in amphipods, surface sediments where the amphipods were collected, Northstar crude oil, and peat from the deltas of 4 North Slope rivers. Amphipods and sediments contained a mixture of petrogenic, pyrogenic, and biogenic PAH. The SHC in amphipods were dominated by pristane derived from zooplankton, indicating that the SHC were primarily from the amphipod diet of zooplankton detritus. The petroleum biomarker StTr profiles did not resemble those in Northstar crude oil. The forensic analysis revealed that hydrocarbons in amphipod tissues were not from oil production at Northstar. Hydrocarbons in amphipod tissues were primarily from their diet and from river runoff and coastal erosion of natural diagenic and fossil terrestrial materials, including seep oils, kerogens, and peat. Offshore oil and gas exploration and development
Enhanced characterization of reservoir hydrocarbon components using electromagnetic data attributes
Katterbauer, Klemens; Arango, Santiago; Sun, Shuyu; Hoteit, Ibrahim
2015-01-01
Advances in electromagnetic imaging techniques have led to the growing utilization of this technology for reservoir monitoring and exploration. These exploit the strong conductivity contrast between the hydrocarbon and water phases and have been used for mapping water front propagation in hydrocarbon reservoirs and enhancing the characterization of the reservoir formation. The conventional approach for the integration of electromagnetic data is to invert the data for saturation properties and then subsequently use the inverted properties as constraints in the history matching process. The non-uniqueness and measurement errors may however make this electromagnetic inversion problem strongly ill-posed, leading to potentially inaccurate saturation profiles. Another limitation of this approach is the uncertainty of Archie's parameters in relating rock conductivity to water saturation, which may vary in the reservoir and are generally poorly known. We present an Ensemble Kalman Filter framework for efficiently integrating electromagnetic data into the history matching process and for simultaneously estimating the Archie's parameters and the variance of the observation error of the electromagnetic data. We apply the proposed framework to a compositional reservoir model. We aim at assessing the relevance of EM data for estimating the different hydrocarbon components of the reservoir. The experimental results demonstrate that the individual hydrocarbon components are generally well matched, with nitrogen exhibiting the strongest improvement. The estimated observation error standard deviations are also within expected levels (between 5 and 10%), significantly contributing to the robustness of the proposed EM history matching framework. Archie's parameter estimates approximate well the reference profile and assist in the accurate description of the electrical conductivity properties of the reservoir formation, hence leading to estimation accuracy improvements of around 15%.
Enhanced characterization of reservoir hydrocarbon components using electromagnetic data attributes
Katterbauer, Klemens
2015-12-23
Advances in electromagnetic imaging techniques have led to the growing utilization of this technology for reservoir monitoring and exploration. These exploit the strong conductivity contrast between the hydrocarbon and water phases and have been used for mapping water front propagation in hydrocarbon reservoirs and enhancing the characterization of the reservoir formation. The conventional approach for the integration of electromagnetic data is to invert the data for saturation properties and then subsequently use the inverted properties as constraints in the history matching process. The non-uniqueness and measurement errors may however make this electromagnetic inversion problem strongly ill-posed, leading to potentially inaccurate saturation profiles. Another limitation of this approach is the uncertainty of Archie\\'s parameters in relating rock conductivity to water saturation, which may vary in the reservoir and are generally poorly known. We present an Ensemble Kalman Filter framework for efficiently integrating electromagnetic data into the history matching process and for simultaneously estimating the Archie\\'s parameters and the variance of the observation error of the electromagnetic data. We apply the proposed framework to a compositional reservoir model. We aim at assessing the relevance of EM data for estimating the different hydrocarbon components of the reservoir. The experimental results demonstrate that the individual hydrocarbon components are generally well matched, with nitrogen exhibiting the strongest improvement. The estimated observation error standard deviations are also within expected levels (between 5 and 10%), significantly contributing to the robustness of the proposed EM history matching framework. Archie\\'s parameter estimates approximate well the reference profile and assist in the accurate description of the electrical conductivity properties of the reservoir formation, hence leading to estimation accuracy improvements of around
Cues of maternal condition influence offspring selfishness.
Wong, Janine W Y; Lucas, Christophe; Kölliker, Mathias
2014-01-01
The evolution of parent-offspring communication was mostly studied from the perspective of parents responding to begging signals conveying information about offspring condition. Parents should respond to begging because of the differential fitness returns obtained from their investment in offspring that differ in condition. For analogous reasons, offspring should adjust their behavior to cues/signals of parental condition: parents that differ in condition pay differential costs of care and, hence, should provide different amounts of food. In this study, we experimentally tested in the European earwig (Forficula auricularia) if cues of maternal condition affect offspring behavior in terms of sibling cannibalism. We experimentally manipulated female condition by providing them with different amounts of food, kept nymph condition constant, allowed for nymph exposure to chemical maternal cues over extended time, quantified nymph survival (deaths being due to cannibalism) and extracted and analyzed the females' cuticular hydrocarbons (CHC). Nymph survival was significantly affected by chemical cues of maternal condition, and this effect depended on the timing of breeding. Cues of poor maternal condition enhanced nymph survival in early broods, but reduced nymph survival in late broods, and vice versa for cues of good condition. Furthermore, female condition affected the quantitative composition of their CHC profile which in turn predicted nymph survival patterns. Thus, earwig offspring are sensitive to chemical cues of maternal condition and nymphs from early and late broods show opposite reactions to the same chemical cues. Together with former evidence on maternal sensitivities to condition-dependent nymph chemical cues, our study shows context-dependent reciprocal information exchange about condition between earwig mothers and their offspring, potentially mediated by cuticular hydrocarbons.
Cues of maternal condition influence offspring selfishness.
Directory of Open Access Journals (Sweden)
Janine W Y Wong
Full Text Available The evolution of parent-offspring communication was mostly studied from the perspective of parents responding to begging signals conveying information about offspring condition. Parents should respond to begging because of the differential fitness returns obtained from their investment in offspring that differ in condition. For analogous reasons, offspring should adjust their behavior to cues/signals of parental condition: parents that differ in condition pay differential costs of care and, hence, should provide different amounts of food. In this study, we experimentally tested in the European earwig (Forficula auricularia if cues of maternal condition affect offspring behavior in terms of sibling cannibalism. We experimentally manipulated female condition by providing them with different amounts of food, kept nymph condition constant, allowed for nymph exposure to chemical maternal cues over extended time, quantified nymph survival (deaths being due to cannibalism and extracted and analyzed the females' cuticular hydrocarbons (CHC. Nymph survival was significantly affected by chemical cues of maternal condition, and this effect depended on the timing of breeding. Cues of poor maternal condition enhanced nymph survival in early broods, but reduced nymph survival in late broods, and vice versa for cues of good condition. Furthermore, female condition affected the quantitative composition of their CHC profile which in turn predicted nymph survival patterns. Thus, earwig offspring are sensitive to chemical cues of maternal condition and nymphs from early and late broods show opposite reactions to the same chemical cues. Together with former evidence on maternal sensitivities to condition-dependent nymph chemical cues, our study shows context-dependent reciprocal information exchange about condition between earwig mothers and their offspring, potentially mediated by cuticular hydrocarbons.
Biogeochemistry of Halogenated Hydrocarbons
Adriaens, P.; Gruden, C.; McCormick, M. L.
2003-12-01
Halogenated hydrocarbons originate from both natural and industrial sources. Whereas direct anthropogenic emissions to the atmosphere and biosphere are often easy to assess, particularly when they are tied to major industrial activities, the attribution of emissions to other human activities (e.g., biomass burning), diffuse sources (e.g., atmospheric discharge, run off), and natural production (e.g., soils, fungi, algae, microorganisms) are difficult to quantify. The widespread occurrence of both alkyl and aryl halides in groundwater, surface water, soils, and various trophic food chains, even those not affected by known point sources, suggests a substantial biogeochemical cycling of these compounds (Wania and Mackay, 1996; Adriaens et al., 1999; Gruden et al., 2003). The transport and reactive fate mechanisms controlling their reactivity are compounded by the differences in sources of alkyl-, aryl-, and complex organic halides, and the largely unknown impact of biogenic processes, such as enzymatically mediated halogenation of organic matter, fungal production of halogenated hydrocarbons, and microbial or abiotic transformation reactions (e.g., Asplund and Grimvall, 1991; Gribble, 1996; Watling and Harper, 1998; Oberg, 2002). The largest source may be the natural halogenation processes in the terrestrial environment, as the quantities detected often exceed the amount that can be explained by human activities in the surrounding areas ( Oberg, 1998). Since biogeochemical processes result in the distribution of a wide range of halogenated hydrocarbon profiles, altered chemical structures, and isomer distributions in natural systems, source apportionment (or environmental forensics) can often only be resolved using multivariate statistical methods (e.g., Goovaerts, 1998; Barabas et al., 2003; Murphy and Morrison, 2002).This chapter will describe the widespread occurrence of halogenated hydrocarbons, interpret their distribution and biogeochemical cycling in light of
Lubanga, Umar K; Drijfhout, Falko P; Farnier, Kevin; Steinbauer, Martin J
2016-02-01
Mating is preceded by a series of interdependent events that can be broadly categorized into searching and courtship. Long-range signals convey species- and sex-specific information during searching, while short-range signals provide information specific to individuals during courtship. Studies have shown that cuticular hydrocarbons (CHCs) can be used for mate recognition in addition to protecting insects from desiccation. In Psylloidea, four species rely on semiochemicals for long-range mate attraction. Psyllid mating research has focused on long-range mate attraction and has largely ignored the potential use of cuticular hydrocarbons (CHCs) as mate recognition cues. This study investigated whether CHCs of Aacanthocnema dobsoni have semiochemical activity for long- and short-range communication prior to mating. Using a solid sampler for solvent-less injection of whole psyllids into coupled gas chromatography/mass spectrometry, we found quantitative, sex- and age-related differences in CHC profiles. Males had higher proportions of 2-MeC28, 11,15-diMeC29, and n-C33 alkanes, while females had higher proportions of 5-MeC27, 3-MeC27, 5,15-diMeC27, n-C29 and n-C30 alkanes. In males and females, 84 and 68 % of CHCs varied with age, respectively. Y-tube olfactometer bioassays provided no evidence that males or females responded to odors emanating from groups of conspecifics of the opposite sex. Tests of male and female psyllids for attraction to branchlets previously occupied by conspecifics showed no evidence of attraction to possible semiochemical residues. Our short-range chemoreception bioassay showed that males were as indifferent to freshly killed individuals of either sex with intact CHC profiles as to those treated with hexane (to remove CHCs). Aacanthocnema dobsoni utilizes substrate-borne vibrations (SBVs) for communication. Therefore, our results indicate that SBVs are probably more important than semiochemicals for long-range mate attraction. Furthermore
Calculation of Interfacial Tensions of Hydrocarbon-water Systems under Reservoir Conditions
DEFF Research Database (Denmark)
Zuo, You-Xiang; Stenby, Erling Halfdan
1998-01-01
Assuming that the number densities of each component in a mixture are linearly distributed across the interface between the coexisting vapor-liquid or liquid-liquid phases, we developed in this research work a linear-gradient-theory (LGT) model for computing the interfacial tension of hydrocarbon......-brine systems. The new model was tested on a number of hydrocarbon-water/brine mixtures and two crude oil-water systems under reservoir conditions. The results show good agreement between the predicted and the experimental interfacial tension data.......Assuming that the number densities of each component in a mixture are linearly distributed across the interface between the coexisting vapor-liquid or liquid-liquid phases, we developed in this research work a linear-gradient-theory (LGT) model for computing the interfacial tension of hydrocarbon-water...... mixtures on the basis of the SRK equation of state. With this model, it is unnecessary to solve the time-consuming density-profile equations of the gradient-theory model. In addition, a correlation was developed for representing the effect of electrolytes on the interfacial tension of hydrocarbon...
Hydrocarbon-degrading sulfate-reducing bacteria in marine hydrocarbon seep sediments
Kleindienst, Sara
2012-01-01
Microorganisms are key players in our biosphere because of their ability to degrade various organic compounds including a wide range of hydrocarbons. At marine hydrocarbon seeps, more than 90% of sulfate reduction (SR) is potentially coupled to non-methane hydrocarbon oxidation. Several hydrocarbon-degrading sulfate-reducing bacteria (SRB) were enriched or isolated from marine sediments. However, in situ active SRB remained largely unknown. In the present thesis, the global distribution and a...
Getahun, M N; Cecchi, G; Seyoum, E
2014-10-01
Tsetse flies, like many insects, use pheromones for inter- and intra-specific communication. Several of their pheromones are cuticular hydrocarbons (CHCs) that are perceived by contact at close range. We hypothesized that for a successful implementation of the Sterile Insect Technique (SIT), along with proper identification of target area and target species, the target tsetse populations and the sterile flies must chemically communicate with each other. To study the population structuring of Glossina pallidipes in Ethiopia, CHCs were extracted and analyzed from three tsetse belts. As a comparative approach, wing morphometric analysis was performed. The analysis of the relative abundance of CHCs revealed that populations of G. pallidipes from the Rift Valley tsetse belt showed a distinct clustering compared to populations from the other two belts. The spatial pattern of CHC differences was complemented by the wing morphometric analysis. Our data suggest that CHCs of known biological and ecological role, when combined with wing morphometric data, will provide an alternative means for the study of population structuring of Glossina populations. This could aid the planning of area wide control strategies using SIT, which is dependent on sexual competence. Copyright © 2014 International Atomic Energy Agency 2014. Published by Elsevier B.V. All rights reserved.
Hydrocarbon phenotyping of algal species using pyrolysis-gas chromatography mass spectrometry
Directory of Open Access Journals (Sweden)
Kothari Shankar L
2010-05-01
Full Text Available Abstract Background Biofuels derived from algae biomass and algae lipids might reduce dependence on fossil fuels. Existing analytical techniques need to facilitate rapid characterization of algal species by phenotyping hydrocarbon-related constituents. Results In this study, we compared the hydrocarbon rich algae Botryococcus braunii against the photoautotrophic model algae Chlamydomonas reinhardtii using pyrolysis-gas chromatography quadrupole mass spectrometry (pyGC-MS. Sequences of up to 48 dried samples can be analyzed using pyGC-MS in an automated manner without any sample preparation. Chromatograms of 30-min run times are sufficient to profile pyrolysis products from C8 to C40 carbon chain length. The freely available software tools AMDIS and SpectConnect enables straightforward data processing. In Botryococcus samples, we identified fatty acids, vitamins, sterols and fatty acid esters and several long chain hydrocarbons. The algae species C. reinhardtii, B. braunii race A and B. braunii race B were readily discriminated using their hydrocarbon phenotypes. Substructure annotation and spectral clustering yielded network graphs of similar components for visual overviews of abundant and minor constituents. Conclusion Pyrolysis-GC-MS facilitates large scale screening of hydrocarbon phenotypes for comparisons of strain differences in algae or impact of altered growth and nutrient conditions.
Directory of Open Access Journals (Sweden)
S. Reimann
2008-05-01
Full Text Available Hourly measurements of 13 volatile hydrocarbons (C2–C7 were performed at an urban background site in Zurich (Switzerland in the years 1993–1994 and again in 2005–2006. For the separation of the volatile organic compounds by gas-chromatography (GC, an identical chromatographic column was used in both campaigns. Changes in hydrocarbon profiles and source strengths were recovered by positive matrix factorization (PMF. Eight and six factors could be related to hydrocarbon sources in 1993–1994 and in 2005–2006, respectively. The modeled source profiles were verified by hydrocarbon profiles reported in the literature. The source strengths were validated by independent measurements, such as inorganic trace gases (NOx, CO, SO2, methane (CH4, oxidized hydrocarbons (OVOCs and meteorological data (temperature, wind speed etc.. Our analysis suggests that the contribution of most hydrocarbon sources (i.e. road traffic, solvents use and wood burning decreased by a factor of about two to three between the early 1990s and 2005–2006. On the other hand, hydrocarbon losses from natural gas leakage remained at relatively constant levels (−20%. The estimated emission trends are in line with the results from different receptor-based approaches reported for other European cities. Their differences to national emission inventories are discussed.
Obp56h Modulates Mating Behavior in Drosophila melanogaster
Directory of Open Access Journals (Sweden)
John R. Shorter
2016-10-01
Full Text Available Social interactions in insects are driven by conspecific chemical signals that are detected via olfactory and gustatory neurons. Odorant binding proteins (Obps transport volatile odorants to chemosensory receptors, but their effects on behaviors remain poorly characterized. Here, we report that RNAi knockdown of Obp56h gene expression in Drosophila melanogaster enhances mating behavior by reducing courtship latency. The change in mating behavior that results from inhibition of Obp56h expression is accompanied by significant alterations in cuticular hydrocarbon (CHC composition, including reduction in 5-tricosene (5-T, an inhibitory sex pheromone produced by males that increases copulation latency during courtship. Whole genome RNA sequencing confirms that expression of Obp56h is virtually abolished in Drosophila heads. Inhibition of Obp56h expression also affects expression of other chemoreception genes, including upregulation of lush in both sexes and Obp83ef in females, and reduction in expression of Obp19b and Or19b in males. In addition, several genes associated with lipid metabolism, which underlies the production of cuticular hydrocarbons, show altered transcript abundances. Our data show that modulation of mating behavior through reduction of Obp56h is accompanied by altered cuticular hydrocarbon profiles and implicate 5-T as a possible ligand for Obp56h.
Hydrocarbons, PCBs and DDT in the NW Mediterranean deep-sea fish Mora moro
Solé, Montserrat; Porte, Cinta; Albaigés, Joan
2001-02-01
Data on aliphatic and polycyclic aromatic hydrocarbons (PAHs), polychlorinated biphenyls (PCBs) and DDTs in the deep-sea fish Mora moro are reported in relation to the animal's weight/size and tissues (muscle, liver, digestive tube and gills). Fish samples were collected in the Gulf of Lions (NW Mediterranean) at an approximate depth of 1000 m. The concentrations of these organic pollutants followed the trend musclelipid content of the organs. No clear bioaccumulation dependence on fish weight/size was observed for gills, digestive tube and liver when the fat contents of these tissues were taken into account. However, the concentrations in muscle decreased with size, possibly implying a simple dilution effect by the increase of body weight. Hydrocarbons, and particularly PAHs, were strongly depleted in all tissues with respect to organochlorinated compounds if compared with the amounts present in bottom waters and sediment. Smaller specimens displayed for most pollutants qualitatively different patterns than larger fish, which could be attributed to their particular habitat/diet. The aliphatic hydrocarbon profiles suggested that Mora moro was exposed to a more predominant intake of biogenic rather than petrogenic hydrocarbons. The entrance and storage organs exhibited characteristic PAH and PCB distributions, reflecting different bioaccumulation and metabolic pathways. Compared with the profiles currently found in surface fish species, a relatively higher contribution of heavier components, namely hepta- and octochlorinated PCBs, and 4-6-ringed PAHs, was found in the deep-sea fish.
MODELING GALACTIC EXTINCTION WITH DUST AND 'REAL' POLYCYCLIC AROMATIC HYDROCARBONS
International Nuclear Information System (INIS)
Mulas, Giacomo; Casu, Silvia; Cecchi-Pestellini, Cesare; Zonca, Alberto
2013-01-01
We investigate the remarkable apparent variety of galactic extinction curves by modeling extinction profiles with core-mantle grains and a collection of single polycyclic aromatic hydrocarbons. Our aim is to translate a synthetic description of dust into physically well-grounded building blocks through the analysis of a statistically relevant sample of different extinction curves. All different flavors of observed extinction curves, ranging from the average galactic extinction curve to virtually 'bumpless' profiles, can be described by the present model. We prove that a mixture of a relatively small number (54 species in 4 charge states each) of polycyclic aromatic hydrocarbons can reproduce the features of the extinction curve in the ultraviolet, dismissing an old objection to the contribution of polycyclic aromatic hydrocarbons to the interstellar extinction curve. Despite the large number of free parameters (at most the 54 × 4 column densities of each species in each ionization state included in the molecular ensemble plus the 9 parameters defining the physical properties of classical particles), we can strongly constrain some physically relevant properties such as the total number of C atoms in all species and the mean charge of the mixture. Such properties are found to be largely independent of the adopted dust model whose variation provides effects that are orthogonal to those brought about by the molecular component. Finally, the fitting procedure, together with some physical sense, suggests (but does not require) the presence of an additional component of chemically different very small carbonaceous grains.
Inhalation of Hydrocarbon Jet Fuel Suppress Central Auditory Nervous System Function.
Guthrie, O'neil W; Wong, Brian A; McInturf, Shawn M; Reboulet, James E; Ortiz, Pedro A; Mattie, David R
2015-01-01
More than 800 million L/d of hydrocarbon fuels is used to power cars, boats, and jet airplanes. The weekly consumption of these fuels necessarily puts the public at risk for repeated inhalation exposure. Recent studies showed that exposure to hydrocarbon jet fuel produces lethality in presynaptic sensory cells, leading to hearing loss, especially in the presence of noise. However, the effects of hydrocarbon jet fuel on the central auditory nervous system (CANS) have not received much attention. It is important to investigate the effects of hydrocarbons on the CANS in order to complete current knowledge regarding the ototoxic profile of such exposures. The objective of the current study was to determine whether inhalation exposure to hydrocarbon jet fuel might affect the functions of the CANS. Male Fischer 344 rats were randomly divided into four groups (control, noise, fuel, and fuel + noise). The structural and functional integrity of presynaptic sensory cells was determined in each group. Neurotransmission in both peripheral and central auditory pathways was simultaneously evaluated in order to identify and differentiate between peripheral and central dysfunctions. There were no detectable effects on pre- and postsynaptic peripheral functions. However, the responsiveness of the brain was significantly depressed and neural transmission time was markedly delayed. The development of CANS dysfunctions in the general public and the military due to cumulative exposure to hydrocarbon fuels may represent a significant but currently unrecognized public health issue.
Are Isomeric Alkenes Used in Species Recognition among Neo-Tropical Stingless Bees (Melipona Spp).
Martin, Stephen J; Shemilt, Sue; da S Lima, Cândida B; de Carvalho, Carlos A L
2017-12-01
Our understanding of the role of cuticular hydrocarbons (CHC) in recognition is based largely on temperate ant species and honey bees. The stingless bees remain relatively poorly studied, despite being the largest group of eusocial bees, comprising more than 400 species in some 60 genera. The Meliponini and Apini diverged between 80-130 Myr B.P. so the evolutionary trajectories that shaped the chemical communication systems in ants, honeybees and stingless bees may be very different. The aim of this study was to study if a unique species CHC signal existed in Neotropical stingless bees, as has been shown for many temperate species, and what compounds are involved. This was achieved by collecting CHC data from 24 colonies belonging to six species of Melipona from North-Eastern Brazil and comparing the results with previously published CHC studies on Melipona. We found that each of the eleven Melipona species studied so far each produced a unique species CHC signal based around their alkene isomer production. A remarkable number of alkene isomers, up to 25 in M. asilvai, indicated the diversification of alkene positional isomers among the stingless bees. The only other group to have really diversified in alkene isomer production are the primitively eusocial Bumblebees (Bombus spp), which are the sister group of the stingless bees. Furthermore, among the eleven Neotropical Melipona species we could detect no effect of the environment on the proportion of alkane production as has been suggested for some other species.
International Nuclear Information System (INIS)
Ping, L.F.; Luo, Y.M.; Zhang, H.B.; Li, Q.B.; Wu, L.H.
2007-01-01
Polycyclic aromatic hydrocarbons (PAHs) were quantified in 30 soil profiles from the Yangtze River Delta Region, in east China. Relative concentrations of PAH compounds with different benzene rings and ratios of fluoranthene to fluoranthene plus pyrene and benz(a)anthracene to benz(a)anthracene plus chrysene were used to identify the possible sources of soil PAHs. Total concentrations of 15 PAHs in topsoils ranged from 8.6 to 3881 μg kg -1 with an average of 397 μg kg -1 . Half of the soil samples were considered to be contaminated with PAHs (>200 μg kg -1 ) and two sampling sites were heavily polluted by PAHs with concentrations >1000 μg kg -1 . Phenanthrene was found in soils below a depth of 100 cm in half of the sampling sites, but the detectable ratio of benzo(a)pyrene decreased sharply from 100% in topsoil to 0 in the 4th horizon. - The information was provided on levels, distributions, and possible sources of PAHs in the soils of Yangtze River Delta area
International Nuclear Information System (INIS)
Roubal, G.; Atlas, R.M.
1978-01-01
Hydrocarbon-utilizing microogranisms were enumerated from Alaskan continental shelf areas by using plate counts and a new most-probable-number procedure based on mineralization of 14 C-labeled hydrocarbons. Hydrocarbon utilizers were ubiquitously distributed, with no significant overall concentration differences between sampling regions or between surface water and sediment samples. There were, however, significant seasonal differences in numbers of hydrocarbon utilizers. Distribution of hydrocarbon utilizers within Cook Inlet was positively correlated with occurrence of hydrocarbons in the environment. Hydrocarbon biodegradation potentials were measured by using 14 C-radiolabeled hydrocarbon-spiked crude oil. There was no significant correlation between numbers of hydrocarbon utilizers and hydrocarbon biodegradation potentials. The biodegradation potentials showed large seasonal variations in the Beaufort Sea, probably due to seasonal depletion of available nutrients. Non-nutrient-limited biodegradation potentials followed the order hexadecane > naphthalene >> pristane > benzanthracene. In Cook Inlet, biodegradation potentials for hexadecane and naphthalene were dependent on availability of inorganic nutrients. Biodegradation potentials for pristane and benzanthracene were restricted, probably by resistance to attack by available enzymes in the indigenous population
Plasma devices for hydrocarbon reformation
Cha, Min Suk
2017-02-16
Plasma devices for hydrocarbon reformation are provided. Methods of using the devices for hydrocarbon reformation are also provided. The devices can include a liquid container to receive a hydrocarbon source, and a plasma torch configured to be submerged in the liquid. The plasma plume from the plasma torch can cause reformation of the hydrocarbon. The device can use a variety of plasma torches that can be arranged in a variety of positions in the liquid container. The devices can be used for the reformation of gaseous hydrocarbons and/or liquid hydrocarbons. The reformation can produce methane, lower hydrocarbons, higher hydrocarbons, hydrogen gas, water, carbon dioxide, carbon monoxide, or a combination thereof.
Polycyclic aromatic hydrocarbons (PAHs) in Austin sediments after a ban on pavement sealers
Energy Technology Data Exchange (ETDEWEB)
DeMott, R.P.; Gauthier, T.D.; Wiersema, J.M.; Crenson, G. [ENVIRON International, Tampa, FL (USA)
2010-07-01
Polycyclic aromatic hydrocarbon (PAH) concentrations were measured in stream sediments collected before and after a municipal ban on the use of coal-tar-based pavement sealers in Austin, Texas. Samples were collected in October 2005, prior to the ban, and again in April, 2008, approximately 2 years after the ban. Differences in total PAH concentrations between samples collected before and after the ban show no net change in PAH levels in Austin stream sediments. Results of hydrocarbon fingerprinting reveal subtle differences in PAH profiles that appear to reflect the effects of weathering rather than a change in PAH sources.
International Nuclear Information System (INIS)
Farrington, J.W.; Teal, J.M.; Parker, P.L.
1976-01-01
Methods for analysis of petroleum hydrocarbons in marine samples are presented. Types of hydrocarbons present and their origins are discussed. Principles and methods of analysis are outlined. Infrared spectrometry, uv spectrometry, gas chromatography, mass spectroscopy, and carbon 14 measurements are described
Converting high boiling hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Terrisse, H; DuFour, L
1929-02-12
A process is given for converting high boiling hydrocarbons into low boiling hydrocarbons, characterized in that the high boiling hydrocarbons are heated to 200 to 500/sup 0/C in the presence of ferrous chloride and of such gases as hydrogen, water gas, and the like gases under a pressure of from 5 to 40 kilograms per square centimeter. The desulfurization of the hydrocarbons occurs simultaneously.
Riveroll-Larios, Jessica; Escalante-Espinosa, Erika; Fócil-Monterrubio, Reyna L.; Díaz-Ramírez, Ildefonso J.
2015-01-01
The use of soil health indicators linked to microbial activities, such as key enzymes and respirometric profiles, helps assess the natural attenuation potential of soils contaminated with hydrocarbons. In this study, the intrinsic physicochemical characteristics, biological activity and biodegradation potential were recorded for two soils with different contamination histories (>5 years and
Aleer, Sam; Adetutu, Eric M; Weber, John; Ball, Andrew S; Juhasz, Albert L
2014-04-01
In situ bioremediation is potentially a cost effective treatment strategy for subsurface soils contaminated with petroleum hydrocarbons, however, limited information is available regarding the impact of soil spatial heterogeneity on bioremediation efficacy. In this study, we assessed issues associated with hydrocarbon biodegradation and soil spatial heterogeneity (samples designated as FTF 1, 5 and 8) from a site in which in situ bioremediation was proposed for hydrocarbon removal. Test pit activities showed similarities in FTF soil profiles with elevated hydrocarbon concentrations detected in all soils at 2 m below ground surface. However, PCR-DGGE-based cluster analysis showed that the bacterial community in FTF 5 (at 2 m) was substantially different (53% dissimilar) and 2-3 fold more diverse than communities in FTF 1 and 8 (with 80% similarity). When hydrocarbon degrading potential was assessed, differences were observed in the extent of (14)C-benzene mineralisation under aerobic conditions with FTF 5 exhibiting the highest hydrocarbon removal potential compared to FTF 1 and 8. Further analysis indicated that the FTF 5 microbial community was substantially different from other FTF samples and dominated by putative hydrocarbon degraders belonging to Pseudomonads, Xanthomonads and Enterobacteria. However, hydrocarbon removal in FTF 5 under anaerobic conditions with nitrate and sulphate electron acceptors was limited suggesting that aerobic conditions were crucial for hydrocarbon removal. This study highlights the importance of assessing available microbial capacity prior to bioremediation and shows that the site's spatial heterogeneity can adversely affect the success of in situ bioremediation unless area-specific optimizations are performed. Copyright © 2014 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Mourey, T.H.; Siggia, S.; Uden, P.C.; Crowley, R.J.
1980-01-01
A chemically bonded pyrrolidone substrate is used for the high performance liquid chromatographic separation of polycyclic aromatic hydrocarbons. The cyclic amide phase interacts electronically with the polycyclic aromatic hydrocarbons in both the normal and reversed phase modes. Separation is effected according to the number of aromatic rings and the type of ring condensation. Information obtained is very different from that observed on hydrocarbon substrates, and thus these phases can be used in a complementary fashion to give a profile of polycyclic aromatics in shale oil samples. 7 figures, 1 table
Nascimento, D L; Nascimento, F S
2012-11-01
The ability to discriminate nestmates from non-nestmates in insect societies is essential to protect colonies from conspecific invaders. The acceptance threshold hypothesis predicts that organisms whose recognition systems classify recipients without errors should optimize the balance between acceptance and rejection. In this process, cuticular hydrocarbons play an important role as cues of recognition in social insects. The aims of this study were to determine whether guards exhibit a restrictive level of rejection towards chemically distinct individuals, becoming more permissive during the encounters with either nestmate or non-nestmate individuals bearing chemically similar profiles. The study demonstrates that Melipona asilvai (Hymenoptera: Apidae: Meliponini) guards exhibit a flexible system of nestmate recognition according to the degree of chemical similarity between the incoming forager and its own cuticular hydrocarbons profile. Guards became less restrictive in their acceptance rates when they encounter non-nestmates with highly similar chemical profiles, which they probably mistake for nestmates, hence broadening their acceptance level.
Degradation of polynuclear aromatic hydrocarbons by two strains of Pseudomonas.
Nwinyi, Obinna C; Ajayi, Oluseyi O; Amund, Olukayode O
2016-01-01
The goal of this investigation was to isolate competent polynuclear aromatic hydrocarbons degraders that can utilize polynuclear aromatic hydrocarbons of former industrial sites at McDoel Switchyard in Bloomington, Indiana. Using conventional enrichment method based on soil slurry, we isolated, screened and purified two bacterial species strains PB1 and PB2. Applying the ribotyping technique using the 16S rRNA gene analysis, the strains were assigned to the genus Pseudomonas (Pseudomonas plecoglossicida strain PB1 and Pseudomonas sp. PB2). Both isolates showed promising metabolic capacity on pyrene sprayed MS agar plates during the preliminary investigations. Using time course studies in the liquid cultures at calculated concentrations 123, 64, 97 and 94ppm for naphthalene, chrysene, fluroanthene and pyrene, P. plecoglossicida strain PB1 and Pseudomonas sp. PB2 showed partial utilization of the polynuclear aromatic hydrocarbons. Naphthalene was degraded between 26% and 40%, chrysene 14% and 16%, fluroanthene 5% and 7%; pyrene 8% and 13% by P. plecoglossicida strain PB1 and Pseudomonas sp. PB2 respectively. Based on their growth profile, we developed a model R(2)=1 to predict the degradation rate of slow polynuclear aromatic hydrocarbon-degraders where all the necessary parameters are constant. From this investigation, we confirm that the former industrial site soil microbial communities may be explored for the biorestoration of the industrial site. Copyright © 2016. Published by Elsevier Editora Ltda.
Moore, Hannah E; Adam, Craig D; Drijfhout, Falko P
2013-03-01
Previous studies on Diptera have shown the potential for the use of cuticular hydrocarbons' analysis in the determination of larval age and hence the postmortem interval (PMI) for an associated cadaver. In this work, hydrocarbon compounds, extracted daily until pupation from the cuticle of the blowfly Lucilia sericata (Diptera: Calliphoridae), have been analyzed using gas chromatography-mass spectrometry (GC-MS). The results show distinguishing features within the hydrocarbon profile over the period of the larvae life cycle, with significant chemical changes occurring from the younger larvae to the postfeeding larvae. Further interpretation of the chromatograms using principal component analysis revealed a strong correlation between the magnitudes of particular principal components and time. This outcome suggests that, under the conditions of this study, the cuticular hydrocarbons evolve in a systematic fashion with time, thus supporting the potential for GC-MS analysis as a tool for establishing PMI where such a species is present. © 2012 American Academy of Forensic Sciences.
Energy Technology Data Exchange (ETDEWEB)
Day, D T; Day, R E
1920-04-27
A process is disclosed of converting hydro-carbon oils having high boiling points to hydro-carbon oils having low boiling points, which process comprises adding the oil to be treated to a mass of hydro-carbon oil bearing shale, passing the shale with the oil through a conveyor retort and subjecting the material while in the retort to a heat treatment involving a temperature of at least 500/sup 0/F.
REGIONAL MAGNETOTELLURIC SURVEYS IN HYDROCARBON EXPLORATION, PARANA BASIN, BRAZIL.
Stanley, William D.; Saad, Antonio; Ohofugi, Walter
1985-01-01
The mangetotelluric geophysical method has been used effectively as a hydrocarbon exploration tool in the intracratonic Parana basin of South America. The 1-2 km thick surface basalts and buried diabase sills pose no problem for the magnetotelluric method because the natural electromagnetic fields used as the energy source pass easily through the basalt. Data for the regional study were taken on six profiles with sounding spaced 8 to 15 km apart. The magnetotelluric sounding data outline a linear uplift known as the Ponta Grossa arch. This major structural feature cuts across the northeast-trending intracratonic basin almost perpendicularly, and is injected with numerous diabase dikes. Significant electrical contrasts occur between the Permian sediments and older units, so that magnetotelluric measurements can give an indication of the regional thickness of the Permian and younger sediments to aid in interpreting hydrocarbon migration patterns and possible trap areas. Refs.
Venkatarathnam, G.; Senthil Kumar, P.; Srinivasa Murthy, S.
2004-06-01
Throttle cycle refrigerators are a class of vapor compression refrigerators that can provide refrigeration at cryogenic temperatures and operate with refrigerant mixtures. The performance of our prototype refrigerators with nitrogen-hydrocarbon, nitrogen-hydrocarbon-helium and argon-hydrocarbon refrigerant mixtures is presented in this paper.
Petroleum hydrocarbons and polycyclic aromatic hydrocarbons (PAHs) in Hong Kong marine sediments
International Nuclear Information System (INIS)
Zheng, G.J.; Richardson, B.J.
1999-01-01
A total of 20 surficial sediment samples, obtained from Hong Kong coastal waters, were analysed for petroleum hydrocarbons (PHCs) and a suite of 15 polycyclic aromatic hydrocarbons (PAHs). The results indicate that Hong Kong coastal sediments are often seriously polluted with petroleum related hydrocarbons. This is especially so in heavily urbanised or industrialized localities, such as Kowloon Bay (Victoria Harbour), Tsing Yi North and Tolo Harbour. Petroleum hydrocarbon pollutants in marine sediments are believed to be mainly derived from the transportation of oil, shipping activities, spillages, and industrial, stormwater and waste wastewater discharge. The ratio of unresolved complex mixture (UCM) to n-alkanes, carbon preference index (CPI), and n-C 16 values indicate that the main contribution to petroleum hydrocarbon contamination is via oil and its products. Pollutant sources appear to be stable and continuing when compared with previous data. (author)
Energy Technology Data Exchange (ETDEWEB)
Demoulins, H D; Garner, F H
1923-02-07
Hydrocarbon distillates, including natural gases and vapors produced by cracking hydrocarbon oils, are desulfurized etc. by treating the vapor with an aqueous alkaline solution of an oxidizing agent. The hydrocarbons may be previously purified by sulfuric acid. In examples aqueous solutions of sodium or calcium hydrochlorite containing 1.5 to 5.0 grams per liter of available chlorine and sufficient alkali to give an excess of 0.1 percent in the spent reagent are preheated to the temperature of the vapor, and either sprayed or atomized into the vapors near the outlet of the dephlegmator or fractionating tower, or passed in countercurrent to the vapors through one or a series of scrubbers.
International Nuclear Information System (INIS)
Bieche, Ivan; Asselah, Tarik; Laurendeau, Ingrid; Vidaud, Dominique; Degot, Claude; Paradis, Valerie; Bedossa, Pierre; Valla, Dominique-Charles; Marcellin, Patrick; Vidaud, Michel
2005-01-01
The molecular mechanisms of acute hepatitis C virus (HCV) infection, end-stage hepatitis (cirrhosis), and hepatocellular carcinoma have been extensively studied, but little is known of the changes in liver gene expression during the early stages of liver fibrosis associated with chronic HCV infection, that is, the transition from normal liver (NL) of uninfected patients to the first stage of liver fibrosis (F1-CH-C). To obtain insight into the molecular pathogenesis of F1-CH-C, we used real-time quantitative reverse transcriptase-polymerase chain reaction (RT-PCR) to study the mRNA expression of 240 selected genes in liver tissue with F1-CH-C, in comparison with NL. The expression of 54 (22.5%) of the 240 genes was significantly different between F1-CH-C and NL; 46 genes were upregulated and 8 were downregulated in F1-CH-C. The most noteworthy changes in gene expression mainly affected the transcriptional network regulated by interferons (IFNs), including both IFN-α/β-inducible genes (STAT1, STAT2, ISGF3G/IRF9, IFI27, G1P3, G1P2, OAS2, MX1) and IFN-γ-inducible genes (CXCL9, CXCL10, CXCL11). Interesting, upregulation of IFN-α/β-inducible genes (but not IFN-γ-inducible genes) was independent of histological scores (grade and stage of fibrosis) and HCV characteristics (hepatic HCV mRNA levels and the HCV genotype), and was specific to HCV (as compared to hepatitis B virus (HBV)). Other genes dysregulated in F1-CH-C, albeit less markedly than IFN-α/β- and IFN-γ-inducible genes, were mainly involved in the activation of lymphocytes infiltrating the liver (IFNG, TNF, CXCL6, IL6, CCL8, CXCR3, CXCR4, CCR2), cell proliferation (p16/CDKN2A, MKI67, p14/ARF), extracellular matrix remodeling (MMP9, ITGA2), lymphangiogenesis (XLKD1/LYVE), oxidative stress (CYP2E1), and cytoskeleton microtubule organization (STMN2/SCG10). Thus, a limited number of signaling pathways, and particularly the transcriptional network regulated by interferons, are dysregulated in the first
Zhang, Yuzhong; Deng, Shuxing; Liu, Yanan; Shen, Guofeng; Li, Xiqing; Cao, Jun; Wang, Xilong; Reid, Brian; Tao, Shu
2011-03-01
Air-soil exchange is an important process governing the fate of polycyclic aromatic hydrocarbons (PAHs). A novel passive air sampler was designed and tested for measuring the vertical concentration profile of 4 low molecular weight PAHs in gaseous phase (PAH(LMW4)) in near soil surface air. Air at various heights from 5 to 520 mm above the ground was sampled by polyurethane foam disks held in down-faced cartridges. The samplers were tested at three sites: A: an extremely contaminated site, B: a site near A, and C: a background site on a university campus. Vertical concentration gradients were revealed for PAH(LMW4) within a thin layer close to soil surface at the three sites. PAH concentrations either decreased (Site A) or increased (Sites B and C) with height, suggesting either deposition to or evaporation from soils. The sampler is a useful tool for investigating air-soil exchange of gaseous phase semi-volatile organic chemicals. Copyright © 2010 Elsevier Ltd. All rights reserved.
Cuticular hydrocarbons as potential kin recognition cues in a subsocial spider
DEFF Research Database (Denmark)
Grinsted, Lena; Bilde, Trine; D'Ettorre, Patrizia
2011-01-01
of recognition cues in subsocial species can provide insights into evolutionary pathways leading to permanent sociality and kin-selected benefits of cooperation. In subsocial spiders, empirical evidence suggests the existence of both kin recognition and benefits of cooperating with kin, whereas the cues for kin...... recognition have yet to be identified. However, cuticular hydrocarbons have been proposed to be involved in regulation of tolerance and interattraction in spider sociality. Here, we show that subsocial Stegodyphus lineatus spiderlings have cuticular hydrocarbon profiles that are sibling-group specific, making...... be branched alkanes that are influenced very little by rearing conditions and may be genetically determined. This indicates that a specific group of cuticular chemicals, namely branched alkanes, could have evolved to act as social recognition cues in both insects and spiders....
International Nuclear Information System (INIS)
Lu, Zhe; Zeng, Fangang; Xue, Nandong; Li, Fasheng
2012-01-01
The occurrence and the distribution of 16 USEPA priority pollutants polycyclic aromatic hydrocarbons (PAHs) were investigated in two alluvial sandy soil profiles and in their four sizes of organo-mineral particles ( 200 μm coarse sand) beside a typical oil sludge storage site in eastern China. PAHs were mainly enriched in the surface soil (0–20 cm) and the concentrations declined in deeper soils, from 3.68 to 0.128 μg/g in profile 1 and 10.8 to 0.143 μg/g in profile 2 (dry wt.). The PAHs in the upper soil layers of this study site mainly came from combustion pollution, whereas in the lower soil layers petroleum contamination became the major source of PAHs. The content of different sized organo-mineral particles of this alluvial sandy soil decreased in the following order: fine sand > coarse sand > silt > clay. X-ray diffraction (XRD) results showed that all the different sized soil fractions of this study site were dominated by quartz, calcite and feldspar. The particle surface became smoother with size increasing as shown by scanning electron microscope (SEM) images. PAH concentrations varied largely in different sized soil fractions. The highest PAH concentration was associated with clay and decreased in the order: clay > silt > coarse sand > fine sand. Soil organic matter (SOM) content, mineral composition and particle surface characteristics were suggested as three main factors affecting the distribution of PAHs in different sized organo-mineral particles. This study will help to understand the distribution and transport characteristics of PAHs in soil profiles at petroleum-contaminated sites. -- Highlights: ► PAH concentrations varied largely in different sized fractions. ► The highest PAH concentrations were associated with clay and decreased in the order: clay > silt > coarse sand > fine sand. ► Soil organic matter (SOM) is an important factor to dominate the distribution of PAHs in this study site.
Energy Technology Data Exchange (ETDEWEB)
Lu, Zhe [State Key Laboratory of Environmental Criteria and Risk Assessment, Chinese Research Academy of Environmental Sciences, Anwai, Dayangfang 8, Beijing 100012 (China); Department of Chemistry, University of Manitoba, Winnipeg, Manitoba, Canada R3T 2N2 (Canada); School of Environment, Renmin University of China, Zhongguancun Street 59, Beijing 100872 (China); Zeng, Fangang [School of Environment, Renmin University of China, Zhongguancun Street 59, Beijing 100872 (China); Xue, Nandong [State Key Laboratory of Environmental Criteria and Risk Assessment, Chinese Research Academy of Environmental Sciences, Anwai, Dayangfang 8, Beijing 100012 (China); Li, Fasheng, E-mail: ligulax@vip.sina.com [State Key Laboratory of Environmental Criteria and Risk Assessment, Chinese Research Academy of Environmental Sciences, Anwai, Dayangfang 8, Beijing 100012 (China)
2012-09-01
The occurrence and the distribution of 16 USEPA priority pollutants polycyclic aromatic hydrocarbons (PAHs) were investigated in two alluvial sandy soil profiles and in their four sizes of organo-mineral particles (< 2 {mu}m clay, 2-20 {mu}m silt, 20-200 {mu}m fine sand, and > 200 {mu}m coarse sand) beside a typical oil sludge storage site in eastern China. PAHs were mainly enriched in the surface soil (0-20 cm) and the concentrations declined in deeper soils, from 3.68 to 0.128 {mu}g/g in profile 1 and 10.8 to 0.143 {mu}g/g in profile 2 (dry wt.). The PAHs in the upper soil layers of this study site mainly came from combustion pollution, whereas in the lower soil layers petroleum contamination became the major source of PAHs. The content of different sized organo-mineral particles of this alluvial sandy soil decreased in the following order: fine sand > coarse sand > silt > clay. X-ray diffraction (XRD) results showed that all the different sized soil fractions of this study site were dominated by quartz, calcite and feldspar. The particle surface became smoother with size increasing as shown by scanning electron microscope (SEM) images. PAH concentrations varied largely in different sized soil fractions. The highest PAH concentration was associated with clay and decreased in the order: clay > silt > coarse sand > fine sand. Soil organic matter (SOM) content, mineral composition and particle surface characteristics were suggested as three main factors affecting the distribution of PAHs in different sized organo-mineral particles. This study will help to understand the distribution and transport characteristics of PAHs in soil profiles at petroleum-contaminated sites. -- Highlights: Black-Right-Pointing-Pointer PAH concentrations varied largely in different sized fractions. Black-Right-Pointing-Pointer The highest PAH concentrations were associated with clay and decreased in the order: clay > silt > coarse sand > fine sand. Black-Right-Pointing-Pointer Soil organic
MODELING GALACTIC EXTINCTION WITH DUST AND 'REAL' POLYCYCLIC AROMATIC HYDROCARBONS
Energy Technology Data Exchange (ETDEWEB)
Mulas, Giacomo; Casu, Silvia; Cecchi-Pestellini, Cesare [INAF-Osservatorio Astronomico di Cagliari, Strada n.54, Loc. Poggio dei Pini, I-09012 Capoterra (Italy); Zonca, Alberto, E-mail: gmulas@oa-cagliari.inaf.it, E-mail: silvia@oa-cagliari.inaf.it, E-mail: ccp@oa-cagliari.inaf.it, E-mail: azonca@oa-cagliari.inaf.it [Dipartimento di Fisica, Universita di Cagliari, Strada Prov.le Monserrato-Sestu Km 0.700, I-09042 Monserrato (Italy)
2013-07-01
We investigate the remarkable apparent variety of galactic extinction curves by modeling extinction profiles with core-mantle grains and a collection of single polycyclic aromatic hydrocarbons. Our aim is to translate a synthetic description of dust into physically well-grounded building blocks through the analysis of a statistically relevant sample of different extinction curves. All different flavors of observed extinction curves, ranging from the average galactic extinction curve to virtually 'bumpless' profiles, can be described by the present model. We prove that a mixture of a relatively small number (54 species in 4 charge states each) of polycyclic aromatic hydrocarbons can reproduce the features of the extinction curve in the ultraviolet, dismissing an old objection to the contribution of polycyclic aromatic hydrocarbons to the interstellar extinction curve. Despite the large number of free parameters (at most the 54 Multiplication-Sign 4 column densities of each species in each ionization state included in the molecular ensemble plus the 9 parameters defining the physical properties of classical particles), we can strongly constrain some physically relevant properties such as the total number of C atoms in all species and the mean charge of the mixture. Such properties are found to be largely independent of the adopted dust model whose variation provides effects that are orthogonal to those brought about by the molecular component. Finally, the fitting procedure, together with some physical sense, suggests (but does not require) the presence of an additional component of chemically different very small carbonaceous grains.
Plasma devices for hydrocarbon reformation
Cha, Min
2017-01-01
Plasma devices for hydrocarbon reformation are provided. Methods of using the devices for hydrocarbon reformation are also provided. The devices can include a liquid container to receive a hydrocarbon source, and a plasma torch configured
Polycyclic Aromatic Hydrocarbon and Metal Concentrations in Imported Canned Maize
Embbey K Ossai; Chukwujindu Maxwell Iwegbue; Elizabeth E. Ajogungbe; Godswill O Tesi
2014-01-01
Concentrations and profile of polycyclic aromatic hydrocarbons(PAHs) and metals (Cd, Pb, Ni, Cr, Fe and Mn) were determined in selected brands of canned maize in the Nigeria market with a view to providing information on the hazards associated with the consumption of these products. The measurement of the concentrations of PAHs was carried out by using a gas chromatography equipped with flame ionization detector (GC-FID) after extraction by ultra-sonication with acetone/dichloromethane and cl...
Desiccation tolerance in Anopheles coluzzii: the effects of spiracle size and cuticular hydrocarbons
Arcaz, Arthur C.; Huestis, Diana L.; Dao, Adama; Yaro, Alpha S.; Diallo, Moussa; Andersen, John; Blomquist, Gary J.; Lehmann, Tovi
2016-01-01
ABSTRACT The African malaria mosquitoes Anopheles gambiae and Anopheles coluzzii range over forests and arid areas, where they withstand dry spells and months-long dry seasons, suggesting variation in their desiccation tolerance. We subjected a laboratory colony (G3) and wild Sahelian mosquitoes during the rainy and dry seasons to desiccation assays. The thoracic spiracles and amount and composition of cuticular hydrocarbons (CHCs) of individual mosquitoes were measured to determine the effects of these traits on desiccation tolerance. The relative humidity of the assay, body water available, rate of water loss and water content at death accounted for 88% of the variation in desiccation tolerance. Spiracle size did not affect the rate of water loss or desiccation tolerance of the colony mosquitoes, as was the case for the total CHCs. However, six CHCs accounted for 71% of the variation in desiccation tolerance and three accounted for 72% of the variation in the rate of water loss. Wild A. coluzzii exhibited elevated desiccation tolerance during the dry season. During that time, relative thorax and spiracle sizes were smaller than during the rainy season. A smaller spiracle size appeared to increase A. coluzzii's desiccation tolerance, but was not statistically significant. Seasonal changes in CHC composition were detected in Sahelian A. coluzzii. Stepwise regression models suggested the effect of particular CHCs on desiccation tolerance. In conclusion, the combination of particular CHCs along with the total amount of CHCs is a primary mechanism conferring desiccation tolerance in A. coluzzii, while variation in spiracle size might be a secondary mechanism. PMID:27207644
Directory of Open Access Journals (Sweden)
Piyush Jain
2014-01-01
Full Text Available Objectives: This is a recent study conducted during 15th September 2013 to 15th December 2013 at the community health centre (CHC, Muradnagar, distt Ghaziabad, among the victims of dog/animal bite attending the daily OPD services of CHC. To identify the level of general awareness and knowledge of wound management and rabies among the cases of dog bite and to study the awareness of people about antirabies vaccines and health service utilization. Methods: The study population composed of 250 victims of dog or animal bite, Patients were selected and approached after proper briefing, with well-prepared two page structured questionnaire designed in local language to assess their knowledge about the wound management, information about the epidemiology of dog bite. Results and conclusion: The result of the study reflect the very low level of awareness about the postdog bite management of wounds as well as about the disease rabies group of people questioned and also reveals serious gaps in understanding of wound severity ,classification and correct application of PEP with ARV vaccine and RIG. There is definitely a gap in people′s knowledge, attitude, and practices about dog bite and its management and there is need of taking serious measures for the control of stray dog population at the block level.
Hydrocarbons and air pollution
International Nuclear Information System (INIS)
Herz, O.
1992-01-01
This paper shows the influence of hydrocarbons vapors, emitted by transports or by volatile solvents using, on air pollution. Hydrocarbons are the principal precursors of photochemical pollution. After a brief introduction on atmospheric chemistry and photochemical reactions, the author describes the french prevention program against hydrocarbons emissions. In the last chapter, informations on international or european community programs for photochemical pollution study are given. 5 figs., 10 tabs
Talukdar, Karabi; Behera, Laxmidhar
2018-03-01
Imaging below the basalt for hydrocarbon exploration is a global problem because of poor penetration and significant loss of seismic energy due to scattering, attenuation, absorption and mode-conversion when the seismic waves encounter a highly heterogeneous and rugose basalt layer. The conventional (short offset) seismic data acquisition, processing and modeling techniques adopted by the oil industry generally fails to image hydrocarbon-bearing sub-trappean Mesozoic sediments hidden below the basalt and is considered as a serious problem for hydrocarbon exploration in the world. To overcome this difficulty of sub-basalt imaging, we have generated dense synthetic seismic data with the help of elastic finite-difference full-wave modeling using staggered-grid scheme for the model derived from ray-trace inversion using sparse wide-angle seismic data acquired along Sinor-Valod profile in the Deccan Volcanic Province of India. The full-wave synthetic seismic data generated have been processed and imaged using conventional seismic data processing technique with Kirchhoff pre-stack time and depth migrations. The seismic image obtained correlates with all the structural features of the model obtained through ray-trace inversion of wide-angle seismic data, validating the effectiveness of robust elastic finite-difference full-wave modeling approach for imaging below thick basalts. Using the full-wave modeling also allows us to decipher small-scale heterogeneities imposed in the model as a measure of the rugose basalt interfaces, which could not be dealt with ray-trace inversion. Furthermore, we were able to accurately image thin low-velocity hydrocarbon-bearing Mesozoic sediments sandwiched between and hidden below two thick sequences of high-velocity basalt layers lying above the basement.
Steiner, S.; Mumm, R.; Ruther, J.
2007-01-01
Cuticular hydrocarbons play a significant role in the regulation of cuticular permeability and also in the chemical communication of insects. In the parasitoid Lariophagus distinguendus (Hymenoptera: Pteromalidae), male courtship behavior is mediated by a female-produced sex pheromone. Previous
Regionalization of surface lipids in insects.
Wang, Yiwen; Yu, Zhitao; Zhang, Jianzhen; Moussian, Bernard
2016-05-11
Cuticular hydrocarbons (CHCs) play a critical role in the establishment of the waterproof barrier that prevents dehydration and wetting in insects. While rich data are available on CHC composition in different species, we know little about their distribution and organization. Here, we report on our studies of the surface barrier of the fruit fly Drosophila melanogaster applying a newly developed Eosin Y staining method. The inert Eosin Y penetrates different regions of the adult body at distinct temperatures. By contrast, the larval body takes up the dye rather uniformly and gradually with increasing temperature. Cooling down specimens to 25°C after incubation at higher temperatures restores impermeability. Eosin Y penetration is also sensitive to lipid solvents such as chloroform indicating that permeability depends on CHCs. As in D. melanogaster adult flies, Eosin Y penetration is regionalized in Tenebrio molitor larvae, whereas it is not in Locusta migratoria nymphs. Regionalization of the fly surface implies tissue-specific variation of the genetic or biochemical programmes of CHC production and deposition. The Eosin Y-based map of CHC distribution may serve to identify the respective factors that are activated to accommodate ecological needs. © 2016 The Author(s).
Kent, Clement; Azanchi, Reza; Smith, Ben; Chu, Adrienne; Levine, Joel
2007-01-01
Drosophila Cuticular Hydrocarbons (CH) influence courtship behaviour, mating, aggregation, oviposition, and resistance to desiccation. We measured levels of 24 different CH compounds of individual male D. melanogaster hourly under a variety of environmental (LD/DD) conditions. Using a model-based analysis of CH variation, we developed an improved normalization method for CH data, and show that CH compounds have reproducible cyclic within-day temporal patterns of expression which differ between LD and DD conditions. Multivariate clustering of expression patterns identified 5 clusters of co-expressed compounds with common chemical characteristics. Turnover rate estimates suggest CH production may be a significant metabolic cost. Male cuticular hydrocarbon expression is a dynamic trait influenced by light and time of day; since abundant hydrocarbons affect male sexual behavior, males may present different pheromonal profiles at different times and under different conditions. PMID:17896002
Directory of Open Access Journals (Sweden)
Clement Kent
Full Text Available Drosophila Cuticular Hydrocarbons (CH influence courtship behaviour, mating, aggregation, oviposition, and resistance to desiccation. We measured levels of 24 different CH compounds of individual male D. melanogaster hourly under a variety of environmental (LD/DD conditions. Using a model-based analysis of CH variation, we developed an improved normalization method for CH data, and show that CH compounds have reproducible cyclic within-day temporal patterns of expression which differ between LD and DD conditions. Multivariate clustering of expression patterns identified 5 clusters of co-expressed compounds with common chemical characteristics. Turnover rate estimates suggest CH production may be a significant metabolic cost. Male cuticular hydrocarbon expression is a dynamic trait influenced by light and time of day; since abundant hydrocarbons affect male sexual behavior, males may present different pheromonal profiles at different times and under different conditions.
Directory of Open Access Journals (Sweden)
Eduardo Gonçalves Paterson Fox
2012-01-01
Full Text Available Fire ants are aggressive Neotropical ants that are extensively similar in general biology and morphology, making species identification difficult. Some fire ant species are top-rated pests spreading throughout the world by trade vessels. Many researchers attempted to sort between invasive and native species by using chemical characters, including patterns of venom alkaloids. The present study is the first to report intraspecific variation in some chemical characters, namely, cuticular hydrocarbons and venom alkaloids, within the Brazilian fire ant species Solenopsis saevissima and also reports on within-nest variations among members of different castes. Two different haplotypes (cryptic species of S. saevissima were clearly identified, one presenting a predominant combination of the venom alkaloids cis- and trans-2-methyl-6-undecylpiperidine with the cuticular hydrocarbons C23, 3-Me-C23, 10-C25 : 1, C25, and 3-Me-C25, and the other a predominant combination of cis- and trans-2-methyl-6-tridecenylpiperidine with predominance of 12-C25 : 1, C25, 11-Me-C25, 3-Me-C25, 13-C27 : 1, C27, and 13-Me-C27. Intranest variations revealed that the proportions among these compounds varied sensibly among workers of different sizes, gynes, and males (no alkaloids were detected in the latter. Larva contained vestiges of the same compounds. The recorded chemical profiles are quite different from previous reports with S. saevissima samples from São Paulo. The finds thus support other recent claims that S. saevissima includes cryptic species; the study, moreover, adds the find that they can occur in the same geographical location.
Detection of hydrocarbons in irradiated foods
International Nuclear Information System (INIS)
Miyahara, Makoto; Maitani, Tamio; Saito, Akiko; Kamimura, Tomomi; Nagasawa, Taeko; Kobayashi, Yasuo; Ito, Hitoshi
2003-01-01
The hydrocarbon method for the detection of irradiated foods is now recognized as the international technique. This method is based on radiolysis of fatty acids in food to give hydrocarbons. In order to expand this technique's application, ten foods (butter, cheese, chicken, pork, beef, tuna, dry shrimp, avocado, papaya, and mango) were irradiated in the range from 0.5 to 10 kGy and the hydrocarbons in them were detected. Recoveries of the hydrocarbons from most foods were acceptable (38-128%). Some hydrocarbons were found in non-irradiated foods, particularly, in butter, cheese, tuna, and shrimp. Seven irradiated foods, butter, cheese, chicken, beef, pork, tuna, dry shrimp, and avocado were detectable at their practical doses by measuring the appropriate marker hydrocarbons. In most case, marker hydrocarbon will be 1,7-hexadecadiene. However, the marker hydrocarbons produced only in irradiated foods varied from food to food; therefore, it is necessary to check a specific irradiated food for marker hydrocarbons. On the other hand, two irradiated foods (papaya and mango which were irradiated at their practical doses) were difficult to distinguish from non-irradiated foods using this method. (author)
Detection of hydrocarbons in irradiated foods
Energy Technology Data Exchange (ETDEWEB)
Miyahara, Makoto; Maitani, Tamio [National Inst. of Health Sciences, Tokyo (Japan); Saito, Akiko; Kamimura, Tomomi; Nagasawa, Taeko [Kitasato Univ., Sagamihara, Kanagawa (Japan). School of Allied Health Sciences; Kobayashi, Yasuo; Ito, Hitoshi [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Establishment
2003-06-01
The hydrocarbon method for the detection of irradiated foods is now recognized as the international technique. This method is based on radiolysis of fatty acids in food to give hydrocarbons. In order to expand this technique's application, ten foods (butter, cheese, chicken, pork, beef, tuna, dry shrimp, avocado, papaya, and mango) were irradiated in the range from 0.5 to 10 kGy and the hydrocarbons in them were detected. Recoveries of the hydrocarbons from most foods were acceptable (38-128%). Some hydrocarbons were found in non-irradiated foods, particularly, in butter, cheese, tuna, and shrimp. Seven irradiated foods, butter, cheese, chicken, beef, pork, tuna, dry shrimp, and avocado were detectable at their practical doses by measuring the appropriate marker hydrocarbons. In most case, marker hydrocarbon will be 1,7-hexadecadiene. However, the marker hydrocarbons produced only in irradiated foods varied from food to food; therefore, it is necessary to check a specific irradiated food for marker hydrocarbons. On the other hand, two irradiated foods (papaya and mango which were irradiated at their practical doses) were difficult to distinguish from non-irradiated foods using this method. (author)
Tolerance of Antarctic soil fungi to hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Hughes, Kevin A.; Bridge, Paul; Clark, Melody S. [British Antarctic Survey, Natural Environment Research Council, High Cross, Madingley Road, Cambridge CB3 0ET (United Kingdom)
2007-01-01
Little is known about the effects of hydrocarbons and fuel oil on Antarctic filamentous fungi in the terrestrial Antarctic environment. Growth of fungi and bacteria from soils around Rothera Research Station (Adelaide Island, Antarctic Peninsula) was assessed in the presence of ten separate aromatic and aliphatic hydrocarbons [marine gas oil (MGO), dodecane, hexadecane, benzoic acid, p-hydroxybenzoic acid, toluene, phenol, biphenyl, naphthalene and m- and p-xylenes with ethylbenzene]. Aromatic hydrocarbons inhibited soil microbial growth more than aliphatic hydrocarbons. Soil microorganisms from a moss patch, where little previous impact or hydrocarbon contamination had occurred, were less tolerant of hydrocarbons than those from high impact sites. Fungal growth rates of Mollisia sp., Penicillium commune, Mortierella sp., Trichoderma koningii, Trichoderma sp. and Phoma herbarum were assessed in the presence of hydrocarbons. Generally, aromatic hydrocarbons inhibited or stopped hyphal extension, though growth rates increased with some aliphatic hydrocarbons. Hyphal dry weight measurements suggested that Mortierella sp. may be able to use dodecane as sole carbon and energy source. Hydrocarbon-degrading Antarctic fungi may have use in future hydrocarbon spill bioremediation. (author)
Cerebrospinal fluid biomarkers of infantile congenital hydrocephalus
Limbrick, David D.; Baksh, Brandon; Morgan, Clinton D.; Habiyaremye, Gakwaya; McAllister, James P.; Inder, Terrie E.; Mercer, Deanna; Holtzman, David M.; Strahle, Jennifer; Wallendorf, Michael J.; Morales, Diego M.
2017-01-01
Introduction Hydrocephalus is a complex neurological disorder with a pervasive impact on the central nervous system. Previous work has demonstrated derangements in the biochemical profile of cerebrospinal fluid (CSF) in hydrocephalus, particularly in infants and children, in whom neurodevelopment is progressing in parallel with concomitant neurological injury. The objective of this study was to examine the CSF of children with congenital hydrocephalus (CHC) to gain insight into the pathophysiology of hydrocephalus and identify candidate biomarkers of CHC with potential diagnostic and therapeutic value. Methods CSF levels of amyloid precursor protein (APP) and derivative isoforms (sAPPα, sAPPβ, Aβ42), tau, phosphorylated tau (pTau), L1CAM, NCAM-1, aquaporin 4 (AQP4), and total protein (TP) were measured by ELISA in 20 children with CHC. Two comparative groups were included: age-matched controls and children with other neurological diseases. Demographic parameters, ventricular frontal-occipital horn ratio, associated brain malformations, genetic alterations, and surgical treatments were recorded. Logistic regression analysis and receiver operating characteristic curves were used to examine the association of each CSF protein with CHC. Results CSF levels of APP, sAPPα, sAPPβ, Aβ42, tau, pTau, L1CAM, and NCAM-1 but not AQP4 or TP were increased in untreated CHC. CSF TP and normalized L1CAM levels were associated with FOR in CHC subjects, while normalized CSF tau levels were associated with FOR in control subjects. Predictive ability for CHC was strongest for sAPPα, especially in subjects ≤12 months of age (p<0.0001 and AUC = 0.99), followed by normalized sAPPβ (p = 0.0001, AUC = 0.95), tau, APP, and L1CAM. Among subjects ≤12 months, a normalized CSF sAPPα cut-point of 0.41 provided the best prediction of CHC (odds ratio = 528, sensitivity = 0.94, specificity = 0.97); these infants were 32 times more likely to have CHC. Conclusions CSF proteins such as s
Production of light hydrocarbons, etc. [from heavy hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
1937-10-07
A process is given for the production of light hydrocarbons of the gasoline type and, if desired, of the middle-oil type, from liquid or fusible heavy or medium heavy hydrocarbon materials. The process comprises subjecting the said initial materials in the first stage to catalytic hydrofining, separating the lower boiling constituents and the hydrogenating gas from the resulting products and then subjecting the higher boiling constituents in a second stage to a splitting destructive hydrogenation and then recycling substantially the entire reaction mixture obtained in the second stage to the frst stage.
von Beeren, Christoph; Brückner, Adrian; Maruyama, Munetoshi; Burke, Griffin; Wieschollek, Jana; Kronauer, Daniel J C
2018-01-01
Host-symbiont interactions are embedded in ecological communities and range from unspecific to highly specific relationships. Army ants and their arthropod guests represent a fascinating example of species-rich host-symbiont associations where host specificity ranges across the entire generalist - specialist continuum. In the present study, we compared the behavioral and chemical integration mechanisms of two extremes of the generalist - specialist continuum: generalist ant-predators in the genus Tetradonia (Staphylinidae: Aleocharinae: Athetini), and specialist ant-mimics in the genera Ecitomorpha and Ecitophya (Staphylinidae: Aleocharinae: Ecitocharini). Similar to a previous study of Tetradonia beetles, we combined DNA barcoding with morphological studies to define species boundaries in ant-mimicking beetles. This approach found four ant-mimicking species at our study site at La Selva Biological Station in Costa Rica. Community sampling of Eciton army ant parasites revealed that ant-mimicking beetles were perfect host specialists, each beetle species being associated with a single Eciton species. These specialists were seamlessly integrated into the host colony, while generalists avoided physical contact to host ants in behavioral assays. Analysis of the ants' nestmate recognition cues, i.e. cuticular hydrocarbons (CHCs), showed close similarity in CHC composition and CHC concentration between specialists and Eciton burchellii foreli host ants. On the contrary, the chemical profiles of generalists matched host profiles less well, indicating that high accuracy in chemical host resemblance is only accomplished by socially integrated species. Considering the interplay between behavior, morphology, and cuticular chemistry, specialists but not generalists have cracked the ants' social code with respect to various sensory modalities. Our results support the long-standing idea that the evolution of host-specialization in parasites is a trade-off between the range of
Narváez-Rivas, Mónica; Vicario, Isabel M; Alcalde, M Jesús; León-Camacho, Manuel
2010-06-15
The aims of this work were to carry out a comprehensive study of the volatile hydrocarbons of 34 Iberian dry-cured hams and to evaluate the efficiency of these compounds for discriminating hams according to the fattening system: "Montanera" (B) and "Cebo" (C). The samples of hams were obtained by mincing the semimembranosus and semitendinosus muscles from slices of dry-cured ham. The analyses were carried out by gas chromatography-mass spectrometry with a polar capillary column and after a previous extraction by Purge and Trap method. Forty-three volatile hydrocarbons were identified, 26 of them for the first time in Iberian dry-cured ham. Only five compounds showed significant differences between the two types of hams. Among the 33 volatile hydrocarbons, 22 of them allowed a complete discrimination of the two groups of hams according the fattening system.
Functional pathway analysis of genes associated with response to treatment for chronic hepatitis C.
Birerdinc, A; Afendy, A; Stepanova, M; Younossi, I; Manyam, G; Baranova, A; Younossi, Z M
2010-10-01
Chronic hepatitis C (CH-C) is among the most common causes of chronic liver disease. Approximately 50% of patients with CH-C treated with pegylated interferon-α and ribavirin (PEG-IFN-α + RBV) achieve a sustained virological response (SVR). Several factors such as genotype 1, African American (AA) race, obesity and the absence of an early virological response (EVR) are associated with low SVR. This study elucidates molecular pathways deregulated in patients with CH-C with negative predictors of response to antiviral therapy. Sixty-eight patients with CH-C who underwent a full course of treatment with PEG-IFN-α + RBV were included in the study. Pretreatment blood samples were collected in PAXgene™ RNA tubes. EVR, complete EVR (cEVR), and SVR rates were 76%, 57% and 41%, respectively. Total RNA was extracted from pretreatment peripheral blood mononuclear cells, quantified and used for one-step RT-PCR to profile 154 mRNAs. The expression of mRNAs was normalized with six 'housekeeping' genes. Differentially expressed genes were separated into up and downregulated gene lists according to the presence or absence of a risk factor and subjected to KEGG Pathway Painter which allows high-throughput visualization of the pathway-specific changes in expression profiles. The genes were consolidated into the networks associated with known predictors of response. Before treatment, various genes associated with core components of the JAK/STAT pathway were activated in the cohorts least likely to achieve SVR. Genes related to focal adhesion and TGF-β pathways were activated in some patients with negative predictors of response. Pathway-centred analysis of gene expression profiles from treated patients with CH-C points to the Janus kinase-signal transducers and activators of transcription signalling cascade as the major pathogenetic component responsible for not achieving SVR. In addition, focal adhesion and TGF-β pathways are associated with some predictors of response.
Directory of Open Access Journals (Sweden)
Younossi Zobair M
2012-02-01
Full Text Available Abstract Background Recent studies of CH-C patients have demonstrated a strong association between IL28B CC genotype and sustained virologic response (SVR after PEG-IFN/RBV treatment. We aimed to assess whether IL28B alleles rs12979860 genotype influences gene expression in response to PEG-IFN/RBV in CH-C patients. Methods Clinical data and gene expression data were available for 56 patients treated with PEG-IFN/RBV. Whole blood was used to determine IL28B genotypes. Differential expression of 153 human genes was assessed for each treatment time point (Days: 0, 1, 7, 28, 56 and was correlated with IL28B genotype (IL28B C/C or non-C/C over the course of the PEG-IFN/RBV treatment. Genes with statistically significant changes in their expression at each time point were used as an input for pathway analysis using KEGG Pathway Painter (KPP. Pathways were ranked based on number of gene involved separately per each study cohort. Results The most striking difference between the response patterns of patients with IL28B C/C and T* genotypes during treatment, across all pathways, is a sustained pattern of treatment-induced gene expression in patients carrying IL28B C/C. In the case of IL28B T* genotype, pre-activation of genes, the lack of sustained pattern of gene expression or a combination of both were observed. This observation could potentially provide an explanation for the lower rate of SVR observed in these patients. Additionally, when the lists of IL28B genotype-specific genes which were differentially expressed in patients without SVR were compared at their baseline, IRF2 and SOCS1 genes were down-regulated regardless of patients' IL28B genotype. Furthermore, our data suggest that CH-C patients who do not have the SOCS1 gene silenced have a better chance of achieving SVR. Our observations suggest that the action of SOCS1 is independent of IL28B genotype. Conclusions IL28B CC genotype patients with CH-C show a sustained treatment-induced gene
Younossi, Zobair M; Birerdinc, Aybike; Estep, Mike; Stepanova, Maria; Afendy, Arian; Baranova, Ancha
2012-02-07
Recent studies of CH-C patients have demonstrated a strong association between IL28B CC genotype and sustained virologic response (SVR) after PEG-IFN/RBV treatment. We aimed to assess whether IL28B alleles rs12979860 genotype influences gene expression in response to PEG-IFN/RBV in CH-C patients. Clinical data and gene expression data were available for 56 patients treated with PEG-IFN/RBV. Whole blood was used to determine IL28B genotypes. Differential expression of 153 human genes was assessed for each treatment time point (Days: 0, 1, 7, 28, 56) and was correlated with IL28B genotype (IL28B C/C or non-C/C) over the course of the PEG-IFN/RBV treatment. Genes with statistically significant changes in their expression at each time point were used as an input for pathway analysis using KEGG Pathway Painter (KPP). Pathways were ranked based on number of gene involved separately per each study cohort. The most striking difference between the response patterns of patients with IL28B C/C and T* genotypes during treatment, across all pathways, is a sustained pattern of treatment-induced gene expression in patients carrying IL28B C/C. In the case of IL28B T* genotype, pre-activation of genes, the lack of sustained pattern of gene expression or a combination of both were observed. This observation could potentially provide an explanation for the lower rate of SVR observed in these patients. Additionally, when the lists of IL28B genotype-specific genes which were differentially expressed in patients without SVR were compared at their baseline, IRF2 and SOCS1 genes were down-regulated regardless of patients' IL28B genotype. Furthermore, our data suggest that CH-C patients who do not have the SOCS1 gene silenced have a better chance of achieving SVR. Our observations suggest that the action of SOCS1 is independent of IL28B genotype. IL28B CC genotype patients with CH-C show a sustained treatment-induced gene expression profile which is not seen in non-CC genotype patients
Subduction zone earthquake probably triggered submarine hydrocarbon seepage offshore Pakistan
Fischer, David; José M., Mogollón; Michael, Strasser; Thomas, Pape; Gerhard, Bohrmann; Noemi, Fekete; Volkhard, Spiess; Sabine, Kasten
2014-05-01
Seepage of methane-dominated hydrocarbons is heterogeneous in space and time, and trigger mechanisms of episodic seep events are not well constrained. It is generally found that free hydrocarbon gas entering the local gas hydrate stability field in marine sediments is sequestered in gas hydrates. In this manner, gas hydrates can act as a buffer for carbon transport from the sediment into the ocean. However, the efficiency of gas hydrate-bearing sediments for retaining hydrocarbons may be corrupted: Hypothesized mechanisms include critical gas/fluid pressures beneath gas hydrate-bearing sediments, implying that these are susceptible to mechanical failure and subsequent gas release. Although gas hydrates often occur in seismically active regions, e.g., subduction zones, the role of earthquakes as potential triggers of hydrocarbon transport through gas hydrate-bearing sediments has hardly been explored. Based on a recent publication (Fischer et al., 2013), we present geochemical and transport/reaction-modelling data suggesting a substantial increase in upward gas flux and hydrocarbon emission into the water column following a major earthquake that occurred near the study sites in 1945. Calculating the formation time of authigenic barite enrichments identified in two sediment cores obtained from an anticlinal structure called "Nascent Ridge", we find they formed 38-91 years before sampling, which corresponds well to the time elapsed since the earthquake (62 years). Furthermore, applying a numerical model, we show that the local sulfate/methane transition zone shifted upward by several meters due to the increased methane flux and simulated sulfate profiles very closely match measured ones in a comparable time frame of 50-70 years. We thus propose a causal relation between the earthquake and the amplified gas flux and present reflection seismic data supporting our hypothesis that co-seismic ground shaking induced mechanical fracturing of gas hydrate-bearing sediments
Versatility of hydrocarbon production in cyanobacteria.
Xie, Min; Wang, Weihua; Zhang, Weiwen; Chen, Lei; Lu, Xuefeng
2017-02-01
Cyanobacteria are photosynthetic microorganisms using solar energy, H 2 O, and CO 2 as the primary inputs. Compared to plants and eukaryotic microalgae, cyanobacteria are easier to be genetically engineered and possess higher growth rate. Extensive genomic information and well-established genetic platform make cyanobacteria good candidates to build efficient biosynthetic pathways for biofuels and chemicals by genetic engineering. Hydrocarbons are a family of compounds consisting entirely of hydrogen and carbon. Structural diversity of the hydrocarbon family is enabled by variation in chain length, degree of saturation, and rearrangements of the carbon skeleton. The diversified hydrocarbons can be used as valuable chemicals in the field of food, fuels, pharmaceuticals, nutrition, and cosmetics. Hydrocarbon biosynthesis is ubiquitous in bacteria, yeasts, fungi, plants, and insects. A wide variety of pathways for the hydrocarbon biosynthesis have been identified in recent years. Cyanobacteria may be superior chassis for hydrocabon production in a photosynthetic manner. A diversity of hydrocarbons including ethylene, alkanes, alkenes, and terpenes can be produced by cyanobacteria. Metabolic engineering and synthetic biology strategies can be employed to improve hydrocarbon production in cyanobacteria. This review mainly summarizes versatility and perspectives of hydrocarbon production in cyanobacteria.
Use of biolog methodology for optimizing the degradation of hydrocarbons by bacterial consortia.
Ambrosoli, R; Bardi, L; Minati, J L; Belviso, S; Ricci, R; Marzona, M
2003-01-01
Biolog methodology was used for the preliminary screening of different cultural conditions in order to detect the best combination/s of factors influencing the metabolic performance of bacterial consortia active in the degradation of hydrocarbons. Two microbial consortia were tested for their activity on 2 hydrocarbons (nonadecane and eicosane) in presence of the following cultural coadjuvants: vegetal oil, beta-cyclodextrine, sodium acetate, mineral solution. Tests were conducted in Biolog MT plates, where only the redox indicator of microbial growth (tetrazolium violet) and no carbon sources are provided. The microwells were filled with various combinations of hydrocarbons, microbial inoculum and coadjuvants. Blanks were prepared with the same combinations but without hydrocarbons. The results obtained show the suitability of the methodology developed to identify the most active consortium and the conditions for its best degradation performance. The efficacy of Biolog methodology (Biolog Inc., USA) for the characterization of microbial communities on the basis of the metabolic profiles obtained on specific carbon sources in the microwells of Elisa-type plates, is widely acknowledged (Garland, 1997; Pietikäinen et al., 2000; Dauber and Wolters, 2000). Due to its aptitude to simultaneously evaluate multiple microbial responses and directly organize the results, it can be adapted to meet specific study purposes (Gamo and Shji, 1999). In the present research Biolog methodology was fitted for the preliminary screening of different cultural conditions, in order to detect the best combination/s of factors influencing the metabolic performance of bacterial consortia active in the degradation of aliphatic hydrocarbons, in view of their utilization for the bioremediation of polluted sites.
Mau, S.; Reed, J.; Clark, J.; Valentine, D.
2006-12-01
Large quantities of natural gas are emitted from the seafloor into the coastal ocean near Coal Oil Point, Santa Barbara Channel (SBC), California. Methane, ethane, and propane were quantified in the surface water at 79 stations in a 270 km2 area in order to map the surficial hydrocarbon plume and to quantify air-sea exchange of these gases. A time series was initiated for 14 stations to identify the variability of the mapped plume, and biologically-mediated oxidation rates of methane were measured to quantify the loss of methane in surface water. The hydrocarbon plume was found to comprise ~70 km2 and extended beyond study area. The plume width narrowed from 3 km near the source to 0.7 km further from the source, and then expanded to 6.7 km at the edge of the study area. This pattern matches the cyclonic gyre which is the normal current flow in this part of the Santa Barbara Channel - pushing water to the shore near the seep field and then broadening the plume while the water turns offshore further from the source. Concentrations of gaseous hydrocarbons decrease as the plume migrates. Time series sampling shows similar plume width and hydrocarbon concentrations when normal current conditions prevail. In contrast, smaller plume width and low hydrocarbon concentrations were observed when an additional anticyclonic eddy reversed the normal current flow, and a much broader plume with higher hydrocarbon concentrations was observed during a time of diminished speed within the current gyre. These results demonstrate that surface currents control hydrocarbon plume dynamics in the SBC, though hydrocarbon flux to the atmosphere is likely less dependent on currents. Estimates of air- sea hydrocarbon flux and biological oxidation rates will also be presented.
Directory of Open Access Journals (Sweden)
Jian Li
2015-12-01
Full Text Available Oil-cracked gas, as the main type of high-over mature marine natural gas in China, is mainly derived from occluded hydrocarbon. So it is significant to carry out quantitative study on occluded hydrocarbon. In this paper, the occluded hydrocarbon volume of the main basins in China was calculated depending on their types, abundances and evolution stages by means of the forward method (experimental simulation and the inversion method (geologic profile dissection. And then, occluded hydrocarbon evolution models were established for five types of source rocks (sapropelic, sapropelic prone hybrid, humic prone hybrid, humic and coal. It is shown that the hydrocarbon expulsion efficiency of sapropelic and sapropelic prone hybrid excellent source rocks is lower than 30% at the low-maturity stage, 30%–60% at the principal oil generation stage, and 50%–80% at the high-maturity stage, which are all about 10% higher than that of humic prone hybrid and humic source rocks at the corresponding stages. The resource distribution and cracked gas expulsion of occluded hydrocarbon since the high-maturity stage of marine source rocks in the Sichuan Basin were preliminarily calculated on the basis of the evolution models. The cracked gas expulsion is 230.4 × 1012 m3 at the high evolution stage of occluded hydrocarbon of the Lower Cambrian Qiongzhusi Fm in this basin, and 12.3 × 1012 m3 from the source rocks of Sinian Doushantuo Fm, indicating good potential for natural gas resources. It is indicated that the favorable areas of occluded hydrocarbon cracked gas in the Qiongzhusi Fm source rocks in the Sichuan Basin include Gaoshiti–Moxi, Ziyang and Weiyuan, covering a favorable area of 4.3 × 104 km2.
Predicting hydrocarbon release from soil
International Nuclear Information System (INIS)
Poppendieck, D.; Loehr, R.C.
2002-01-01
'Full text:' The remediation of hazardous chemicals from soils can be a lengthy and costly process. As a result, recent regulatory initiatives have focused on risk-based corrective action (RBCA) approaches. Such approaches attempt to identify the amount of chemical that can be left at a site with contaminated soil and still be protective of human health and the environment. For hydrocarbons in soils to pose risk to human heath and the environment, the hydrocarbons must be released from the soil and accessible to microorganisms, earthworms, or other higher level organisms. The sorption of hydrocarbons to soil can reduce the availability of the hydrocarbon to receptors. Typically in soils and sediments, there is an initial fast release of a hydrocarbon from the soil to the aqueous phase followed by a slower release of the remaining hydrocarbon to the aqueous phase. The rate and extent of slow release can influence aqueous hydrocarbon concentrations and the fate and transport of hydrocarbons in the subsurface. Once the fast fraction of the chemical has been removed from the soil, the remaining fraction of a chemical may desorb at a rate that natural mechanisms can attenuate the released hydrocarbon. Hence, active remediation may be needed only until the fast fraction has been removed. However, the fast fraction is a soil and chemical specific parameter. This presentation will present a tier I type protocol that has been developed to quickly estimate the fraction of hydrocarbons that are readily released from the soil matrix to the aqueous phase. Previous research in our laboratory and elsewhere has used long-term desorption (four months) studies to determine the readily released fraction. This research shows that a single short-term (less than two weeks) batch extraction procedure provides a good estimate of the fast released fraction derived from long-term experiments. This procedure can be used as a tool to rapidly evaluate the release and bioavailability of
Energy Technology Data Exchange (ETDEWEB)
1927-02-22
Coal tar, mineral oils, bitumens, coal extraction products, hydrogenation products of coal, oil schists can be atomized and heated with steam to decompose pyrogenetically and form gases rich in olefins which may be heated with or without pressure and with or without catalysts to produce liquid hydrocarbons of low boiling point, some of which may be aromatic. The apparatus should be lined with copper, silica, or ferrosilicon to prevent contact of the bases with iron which causes deposition of soot. Catalysts used may be metal oxides, silica, graphite, active charcoal, mica, pumice, porcelain, barium carbonate, copper, silver, gold, chromium, boron, or their compounds. At temperatures from 300 to 400/sup 0/C, olefins are produced. At higher temperatures, naphthenes and benzene hydrocarbons are produced.
AbstractThe formation of polycyclic aromatic hydrocarbons (PAH) and soot has been investigated in atmospheric-pressure, laminar, ethane/oxygen/argon premixed flames as a function of mixture equivalence ratio. Mole fraction profiles of major products, trace aromatics, ...
Fractional separation of hydrocarbon vapours
Energy Technology Data Exchange (ETDEWEB)
1937-07-10
A process is described for converting higher boiling hydrocarbons to lower boiling hydrocarbons by subjecting them at elevated temperatures to a conversion operation, then separating the higher and lower boiling fractions. The separation takes place while the reaction products are maintained in the vapor phase by contact with a mass of solid porous material which has little or no catalytic activity but does have a preferential absorption property for higher boiling hydrocarbons so that the lower boiling part of the reaction products pass through the separation zone while the heavier hydrocarbons are retained. The separation is accomplished without substantial loss of heat of these reaction products.
Witjes, Sebastian; Witsch, Kristian; Eltz, Thomas
2011-05-01
The measurement of insect visits to flowers is essential in basic and applied pollination ecology studies but often fraught with difficulty. Floral visitation is highly variable, and observational studies are limited in scope due to the considerable time necessary to acquire reliable data. The aim of our study was to investigate whether the analysis of hydrocarbon residues (footprints) deposited by insects during flower visits would allow reconstruction of the visitor community and prediction of seed set for large numbers of plants. In 3 consecutive years, we recorded bumblebee visitation to wild plants of comfrey, Symphytum officinale, and later used gas chromatography/mass spectrometry (GC/MS) to quantify bumblebee-derived unsaturated hydrocarbons (UHCs) extracted from flowers. We found that the UHCs washed from corollas were most similar to the tarsal UHC profile of the most abundant bumblebee species, Bombus pascuorum, in all 3 years. The species composition of the bumblebee communities estimated from UHCs on flowers were also similar to those actually observed. There was a significant positive correlation between the observed number of visits by each of three bumblebee species (contributing 3-68% of flower visits) and the estimated number of visits based on UHC profiles. Furthermore, significant correlations were obtained separately for workers and drones of two of the study species. Seed set of comfrey plants was positively correlated to overall bumblebee visitation and the total amount of UHCs on flowers, suggesting the potential for pollen limitation. We suggest that quantifying cumulative footprint hydrocarbons provides a novel way to assess floral visitation by insects and can be used to predict seed set in pollen-limited plants.
Energy Technology Data Exchange (ETDEWEB)
Greenberg, B.M.; Huang, X.D.; Gurska, Y.; Gerhardt, K.E.; Wang, W.; Lampi, M.A.; Zhang, C.; Khalid, A.; Isherwood, D.; Chang, P.; Wang, H.; Dixon, D.G.; Glick, B.R. [Waterloo Univ., ON (Canada)
2006-07-01
A large number of aquatic and terrestrial environments are polluted with various levels of toxicants. Metals, organics and total petroleum hydrocarbons from anthropogenic sources pose a risk to both human health and the health of ecosystems. Although these persistent contaminants are difficult to remediate, several industrial sites throughout North America are being remediated as part of land reclamation and restoration programs. This paper addressed the issue of phytoremediation for removing contaminants from soils. Phytoremediation is considered to be a viable remediation strategy because the increased biomass of plants, relative to the biomass of soil microbes in the absence of plants, allows for higher throughput. Extensive root systems can infiltrate large volumes of soil, thus promoting degradation of contaminants over a wide area. This paper described a newly developed multi-process phytoremediation system with accelerated remediation kinetics to effectively remove polycyclic aromatic hydrocarbons (PAH), total petroleum hydrocarbons (TPH) and chlorinated hydrocarbons (CHC) from soils. The system combines land farming/sunlight exposure; inoculation of contaminant degrading bacteria; and, plant growth with plant growth promoting rhizobacteria which mitigates the effects of stress ethylene in plants. The primary factor for success was the interaction between the plant and the plant growth promoting rhizobacteria. Several field tests were conducted following successful greenhouse tests. Results at a TPH contaminated site in Sarnia, Ontario showed that over a 2 year period, 60 to 70 per cent remediation of 15 per cent TPH was achieved. At a site in Turner Valley, Alberta, 35 per cent remediation of 1 per cent recalcitrant TPH was achieved, while a DDT contaminated site near Simcoe, Ontario had nearly 30 per cent of CHC removed in a 3 month period. 34 refs., 2 tabs., 2 figs.
International Nuclear Information System (INIS)
Greenberg, B.M.; Huang, X.D.; Gurska, Y.; Gerhardt, K.E.; Wang, W.; Lampi, M.A.; Zhang, C.; Khalid, A.; Isherwood, D.; Chang, P.; Wang, H.; Dixon, D.G.; Glick, B.R.
2006-01-01
A large number of aquatic and terrestrial environments are polluted with various levels of toxicants. Metals, organics and total petroleum hydrocarbons from anthropogenic sources pose a risk to both human health and the health of ecosystems. Although these persistent contaminants are difficult to remediate, several industrial sites throughout North America are being remediated as part of land reclamation and restoration programs. This paper addressed the issue of phytoremediation for removing contaminants from soils. Phytoremediation is considered to be a viable remediation strategy because the increased biomass of plants, relative to the biomass of soil microbes in the absence of plants, allows for higher throughput. Extensive root systems can infiltrate large volumes of soil, thus promoting degradation of contaminants over a wide area. This paper described a newly developed multi-process phytoremediation system with accelerated remediation kinetics to effectively remove polycyclic aromatic hydrocarbons (PAH), total petroleum hydrocarbons (TPH) and chlorinated hydrocarbons (CHC) from soils. The system combines land farming/sunlight exposure; inoculation of contaminant degrading bacteria; and, plant growth with plant growth promoting rhizobacteria which mitigates the effects of stress ethylene in plants. The primary factor for success was the interaction between the plant and the plant growth promoting rhizobacteria. Several field tests were conducted following successful greenhouse tests. Results at a TPH contaminated site in Sarnia, Ontario showed that over a 2 year period, 60 to 70 per cent remediation of 15 per cent TPH was achieved. At a site in Turner Valley, Alberta, 35 per cent remediation of 1 per cent recalcitrant TPH was achieved, while a DDT contaminated site near Simcoe, Ontario had nearly 30 per cent of CHC removed in a 3 month period. 34 refs., 2 tabs., 2 figs
Characterization of hydrocarbon utilizing fungi from hydrocarbon ...
African Journals Online (AJOL)
Prof. Ogunji
isolated fungi could be useful in the bioremediation of hydrocarbon polluted sites. Keywords: ... Technologies such as mechanical force, burying, evaporation, dispersant application, and ..... The effects of drilling fluids on marine bacteria from a.
Measuring Trace Hydrocarbons in Silanes
Lesser, L. A.
1984-01-01
Technique rapid and uses standard analytical equipment. Silane gas containing traces of hydrocarbons injected into carrier gas of moist nitrogen having about 0.2 percent water vapor. Carrier, water and silane pass through short column packed with powdered sodium hydroxide which combines moisture and silane to form nonvolatile sodium silicate. Carrier gas free of silane but containing nonreactive hydrocarbons, pass to silica-gel column where chromatographic separation takes place. Hydrocarbons measured by FID.
Energy Technology Data Exchange (ETDEWEB)
Rostin, H
1938-08-11
A process is described for continuously purifying hydrocarbon oils consisting in conducting the vapors of the same at a temperature of 300 to 400/sup 0/C over the oelitic ore minette together with reducing gases in presence of steam the proportion of the reducing gases and steam being such that the sulfur of the hydrocarbons escapes from the reaction chamber in the form of sulfuretted hydrogen without permanent sulfide of iron being formed.
Recovering low-boiling hydrocarbons, etc
Energy Technology Data Exchange (ETDEWEB)
Pier, M
1934-10-03
A process is described for the recovery of low-boiling hydrocarbons of the nature of benzine through treatment of liquid carbonaceous materials with hydrogen under pressure at raised temperature, suitably in the presence of catalysts. Middle oils (practically saturated with hydrogen) or higher boiling oils at a temperature above 500/sup 0/ (with or without the addition of hydrogen) containing cyclic hydrocarbons not saturated with hydrogen are changed into low boiling hydrocarbons of the nature of benzine. The cracking takes place under strongly hydrogenating conditions (with the use of a strongly active hydrogenating catalyst or high pressure) at temperatures below 500/sup 0/. If necessary, the constituents boiling below 200/sup 0/ can be reconverted into cyclic hydrocarbons partially saturated with hydrogen. (BLM)
Knauss, Kevin G.; Copenhaver, Sally C.; Aines, Roger D.
2000-01-01
In situ hydrous pyrolysis/oxidation process is useful for in situ degradation of hydrocarbon water and soil contaminants. Fuel hydrocarbons, chlorinated hydrocarbons, polycyclic aromatic hydrocarbons, petroleum distillates and other organic contaminants present in the soil and water are degraded by the process involving hydrous pyrolysis/oxidation into non-toxic products of the degradation. The process uses heat which is distributed through soils and water, optionally combined with oxygen and/or hydrocarbon degradation catalysts, and is particularly useful for remediation of solvent, fuel or other industrially contaminated sites.
Directory of Open Access Journals (Sweden)
Luis J. Perez Calderon
2018-05-01
Full Text Available Deep sea oil exploration is increasing and presents environmental challenges for deep ocean ecosystems. Marine oil spills often result in contamination of sediments with oil; following the Deepwater Horizon (DwH disaster up to 31% of the released oil entrained in the water column was deposited as oily residues on the seabed. Although the aftermath of DwH was studied intensely, lessons learned may not be directly transferable to other deep-sea hydrocarbon exploration areas, such as the Faroe-Shetland Channel (FSC which comprises cold temperatures and a unique hydrodynamic regime. Here, transport of hydrocarbons into deep FSC sediments, subsequent responses in benthic microbial populations and effects of dispersant application on hydrocarbon fate and microbial communities were investigated. Sediments from 1,000 m in the FSC were incubated at 0°C for 71 days after addition of a 20-hydrocarbon component oil-sediment aggregate. Dispersant was added periodically from day 4. An additional set of cores using sterilized and homogenized sediment was analyzed to evaluate the effects of sediment matrix modification on hydrocarbon entrainment. Sediment layers were independently analyzed for hydrocarbon content by gas chromatography with flame ionization detection and modeled with linear mixed effects models. Oil was entrained over 4 cm deep into FSC sediments after 42 days and dispersant effectiveness on hydrocarbon removal from sediment to the water column decreased with time. Sterilizing and homogenizing sediment resulted in hydrocarbon transport over 4 cm into sediments after 7 days. Significant shifts in bacterial populations were observed (DGGE profiling in response to hydrocarbon exposure after 42 days and below 2 cm deep. Dispersant application resulted in an accelerated and modified shift in bacterial communities. Bacterial 16S rRNA gene sequencing of oiled sediments revealed dominance of Colwellia and of Fusibacter when dispersant was applied over
Are Microbial Nanowires Responsible for Geoelectrical Changes at Hydrocarbon Contaminated Sites?
Hager, C.; Atekwana, E. A.; Gorby, Y. A.; Duris, J. W.; Allen, J. P.; Atekwana, E. A.; Ownby, C.; Rossbach, S.
2007-05-01
Significant advances in near-surface geophysics and biogeophysics in particular, have clearly established a link between geoelectrical response and the growth and enzymatic activities of microbes in geologic media. Recent studies from hydrocarbon contaminated sites suggest that the activities of distinct microbial populations, specifically syntrophic, sulfate reducing, and dissimilatory iron reducing microbial populations are a contributing factor to elevated sediment conductivity. However, a fundamental mechanistic understanding of the processes and sources resulting in the measured electrical response remains uncertain. The recent discovery of bacterial nanowires and their electron transport capabilities suggest that if bacterial nanowires permeate the subsurface, they may in part be responsible for the anomalous conductivity response. In this study we investigated the microbial population structure, the presence of nanowires, and microbial-induced alterations of a hydrocarbon contaminated environment and relate them to the sediments' geoelectrical response. Our results show that microbial communities varied substantially along the vertical gradient and at depths where hydrocarbons saturated the sediments, ribosomal intergenic spacer analysis (RISA) revealed signatures of microbial communities adapted to hydrocarbon impact. In contrast, RISA profiles from a background location showed little community variations with depth. While all sites showed evidence of microbial activity, a scanning electron microscope (SEM) study of sediment from the contaminated location showed pervasive development of "nanowire-like structures" with morphologies consistent with nanowires from laboratory experiments. SEM analysis suggests extensive alteration of the sediments by microbial Activity. We conclude that, excess organic carbon (electron donor) but limited electron acceptors in these environments cause microorganisms to produce nanowires to shuttle the electrons as they seek for
Syntrophic biodegradation of hydrocarbon contaminants.
Gieg, Lisa M; Fowler, S Jane; Berdugo-Clavijo, Carolina
2014-06-01
Anaerobic environments are crucial to global carbon cycling wherein the microbial metabolism of organic matter occurs under a variety of redox conditions. In many anaerobic ecosystems, syntrophy plays a key role wherein microbial species must cooperate, essentially as a single catalytic unit, to metabolize substrates in a mutually beneficial manner. Hydrocarbon-contaminated environments such as groundwater aquifers are typically anaerobic, and often methanogenic. Syntrophic processes are needed to biodegrade hydrocarbons to methane, and recent studies suggest that syntrophic hydrocarbon metabolism can also occur in the presence of electron acceptors. The elucidation of key features of syntrophic processes in defined co-cultures has benefited greatly from advances in 'omics' based tools. Such tools, along with approaches like stable isotope probing, are now being used to monitor carbon flow within an increasing number of hydrocarbon-degrading consortia to pinpoint the key microbial players involved in the degradative pathways. The metagenomic sequencing of hydrocarbon-utilizing consortia should help to further identify key syntrophic features and define microbial interactions in these complex communities. Copyright © 2013 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Perez, M.; Gonzalez, D.
1988-01-01
A study of the analysis by gas chromatography of aromatic polycyclic hydrocarbons and aliphatic hydrocarbons is presented. The separation has been carried out by glass and fused silica capillary column in two different polar stationary phases OV-1 and SE-54. The limitation and the advantages of the procedure are discussed in terms of separation, sensitivity and precision. (Author) 20 refs
Properties of plasma flames sustained by microwaves and burning hydrocarbon fuels
International Nuclear Information System (INIS)
Hong, Yong Cheol; Uhm, Han Sup
2006-01-01
Plasma flames made of atmospheric microwave plasma and a fuel-burning flame were presented and their properties were investigated experimentally. The plasma flame generator consists of a fuel injector and a plasma flame exit connected in series to a microwave plasma torch. The plasma flames are sustained by injecting hydrocarbon fuels into a microwave plasma torch in air discharge. The microwave plasma torch in the plasma flame system can burn a hydrocarbon fuel by high-temperature plasma and high atomic oxygen density, decomposing the hydrogen and carbon containing fuel. We present the visual observations of the sustained plasma flames and measure the gas temperature using a thermocouple device in terms of the gas-fuel mixture and flow rate. The plasma flame volume of the hydrocarbon fuel burners was more than approximately 30-50 times that of the torch plasma. While the temperature of the torch plasma flame was only 868 K at a measurement point, that of the diesel microwave plasma flame with the addition of 0.019 lpm diesel and 30 lpm oxygen increased drastically to about 2280 K. Preliminary experiments for methane plasma flame were also carried out, measuring the temperature profiles of flames along the radial and axial directions. Finally, we investigated the influence of the microwave plasma on combustion flame by observing and comparing OH molecular spectra for the methane plasma flame and methane flame only
Hydrocarbon pollution from marinas in estuarine sediments
Voudrias, Evangelos A.; Smith, Craig L.
1986-03-01
A measure of the impact of marinas on three Eastern Virginia estuarine creeks was obtained by a study of hydrocarbons in their sediments. Two of the creeks support considerable marine activity, including pleasure boat marinas, boat repair facilities, and commercial fishing operations. The third creek, which served as a control, is seldom used by boats, and is surrounded by marsh and woodland. Sediments from the creeks with marinas contained significantly higher levels of both aromatic and aliphatic hydrocarbons than did the control. Differences in the concentrations of certain oil-pollution indicators, such as the 17α,21β-hopane homologs and phytane, and low molecular weight aromatic hydrocarbons, are indicative of light petroleum fractions. Most of the aromatic hydrocarbons from all creeks, however, appear to have a pyrogenic origin. Although hydrocarbons from three probable origins (petroleum, pyrogenesis, and recent biosynthesis) were detected in all locations, the petroleum-derived and pyrogenic hydrocarbons were of only minor importance relative to the biogenic hydrocarbons in the control creek.
BIOREMEDIATION OF A PETROLEUM-HYDROCARBON
African Journals Online (AJOL)
ES OBE
under field conditions in the bioremediation of a petroleum- hydrocarbon polluted ... an accelerated biodegradation of petroleum hydrocarbons in a polluted agricultural soil ..... 12) Jackson, M.L. Soil chemical analysis. ... biological assay. 3 rd.
Pérez-de-Mora, Alfredo; Engel, Marion; Schloter, Michael
2011-11-01
Unraveling functional genes related to biodegradation of organic compounds has profoundly improved our understanding of biological remediation processes, yet the ecology of such genes is only poorly understood. We used a culture-independent approach to assess the abundance and diversity of bacteria catalyzing the degradation of n-alkanes with a chain length between C(5) and C(16) at a forest site co-contaminated with mineral oil hydrocarbons and metals for nearly 60 years. The alkB gene coding for a rubredoxin-dependent alkane monooxygenase enzyme involved in the initial activation step of aerobic aliphatic hydrocarbon metabolism was used as biomarker. Within the area of study, four different zones were evaluated: one highly contaminated, two intermediately contaminated, and a noncontaminated zone. Contaminant concentrations, hydrocarbon profiles, and soil microbial respiration and biomass were studied. Abundance of n-alkane-degrading bacteria was quantified via real-time PCR of alkB, whereas genetic diversity was examined using molecular fingerprints (T-RFLP) and clone libraries. Along the contamination plume, hydrocarbon profiles and increased respiration rates suggested on-going natural attenuation at the site. Gene copy numbers of alkB were similar in contaminated and control areas. However, T-RFLP-based fingerprints suggested lower diversity and evenness of the n-alkane-degrading bacterial community in the highly contaminated zone compared to the other areas; both diversity and evenness were negatively correlated with metal and hydrocarbon concentrations. Phylogenetic analysis of alkB denoted a shift of the hydrocarbon-degrading bacterial community from Gram-positive bacteria in the control zone (most similar to Mycobacterium and Nocardia types) to Gram-negative genotypes in the contaminated zones (Acinetobacter and alkB sequences with little similarity to those of known bacteria). Our results underscore a qualitative rather than a quantitative response of
International Nuclear Information System (INIS)
Backus, S.; Swyripa, M.; Peddle, J.; Jeffries, D.S.
1995-01-01
Suspended sediment and water samples collected from twelve major rivers in the Northwest Territories were analyzed for aliphatic hydrocarbons and polycyclic aromatic hydrocarbons (PAHs) to assess the sources and transport of hydrocarbons entering the Arctic Ocean. Three stations on the Mackenzie River and one station near the mouth of eleven other northern rivers were selected for sampling. Samples were collected on the Mackenzie River on four occasions to characterize spring, summer and fall flow conditions and once on the remaining eleven rivers during high flow conditions. The Mackenzie River is distinctively different then the other eleven rivers. Naturally occurring hydrocarbons predominate in the river. These hydrocarbons include biogenic alkanes, diagenic PAHs, petrogenic alkanes, and PAHs from oil seeps and/or bitumens. Anthropogenic inputs of PAHs are low as indicated by low concentrations of combustion PAHs. Alkyl PAH distributions indicate that a significant component of the lower molecular weight PAH fraction is petrogenic. The majority of the high molecular weight PAHs, together with the petrogenic PAHs have a principal source in the Mackenzie River
Optrode for sensing hydrocarbons
Miller, H.; Milanovich, F.P.; Hirschfeld, T.B.; Miller, F.S.
1988-09-13
A two-phase system employing the Fujiwara reaction is provided for the fluorometric detection of halogenated hydrocarbons. A fiber optic is utilized to illuminate a column of pyridine trapped in a capillary tube coaxially attached at one end to the illuminating end of the fiber optic. A strongly alkaline condition necessary for the reaction is maintained by providing a reservoir of alkali in contact with the column of pyridine, the surface of contact being adjacent to the illuminating end of the fiber optic. A semipermeable membrane caps the other end of the capillary tube, the membrane being preferentially permeable to the halogenated hydrocarbon and but preferentially impermeable to water and pyridine. As the halogenated hydrocarbon diffuses through the membrane and into the column of pyridine, fluorescent reaction products are formed. Light propagated by the fiber optic from a light source, excites the fluorescent products. Light from the fluorescence emission is also collected by the same fiber optic and transmitted to a detector. The intensity of the fluorescence gives a measure of the concentration of the halogenated hydrocarbons. 5 figs.
Biodegradation of petroleum hydrocarbons in hypersaline environments
Directory of Open Access Journals (Sweden)
Luiz Fernando Martins
2012-09-01
Full Text Available Literature on hydrocarbon degradation in extreme hypersaline media presents studies that point to a negative effect of salinity increase on hydrocarbonoclastic activity, while several others report an opposite tendency. Based on information available in the literature, we present a discussion on the reasons that justify these contrary results. Despite the fact that microbial ability to metabolize hydrocarbons is found in extreme hypersaline media, indeed some factors are critical for the occurrence of hydrocarbon degradation in such environments. How these factors affect hydrocarbon degradation and their implications for the assessment of hydrocarbon biodegradation in hypersaline environments are presented in this review.
Niileksela, Christopher R; Reynolds, Matthew R
2014-01-01
This study was designed to better understand the relations between learning disabilities and different levels of latent cognitive abilities, including general intelligence (g), broad cognitive abilities, and specific abilities based on the Cattell-Horn-Carroll theory of intelligence (CHC theory). Data from the Differential Ability Scales-Second Edition (DAS-II) were used to create a multiple-indicator multiple cause model to examine the latent mean differences in cognitive abilities between children with and without learning disabilities in reading (LD reading), math (LD math), and reading and writing(LD reading and writing). Statistically significant differences were found in the g factor between the norm group and the LD groups. After controlling for differences in g, the LD reading and LD reading and writing groups showed relatively lower latent processing speed, and the LD math group showed relatively higher latent comprehension-knowledge. There were also some differences in some specific cognitive abilities, including lower scores in spatial relations and numerical facility for the LD math group, and lower scores in visual memory for the LD reading and writing group. These specific mean differences were above and beyond any differences in the latent cognitive factor means.
International Nuclear Information System (INIS)
Manab Sarma, P.; Bhattacharya, D.; Krishnan, S.; Lal, B.
2004-01-01
Intra-species diversity among Acinetobacter baumannii strains isolated from crude oil-contaminated soils from different geographic regions in India was assessed, including their capability to degrade different fractions of total petroleum hydrocarbons. A total of 96 strains were isolated from five different sites. Of the 96 isolates, 25 strains were identified as Acinetobacter baumannii; all of these strains were biochemically profiled and grouped into eight phenovars on the basis of multivariate analysis of their substrate utilization profiles. All strains were able to degrade the total petroleum hydrocarbon fractions of crude oil. Intraspecies relatedness among the 25 strains was determined using tRNA intergenic spacer length polymorphism. Specific variants among the strains with different degradation capacities for different fractions of crude oil were detected. Environmental influences that cause intra-species diversity, such as functional resilience, within the selected strains of A. baumannii were also noted. It is suggested that such diversities may make it possible to select contaminant-specific strains for efficient biotechnological strategies in environmental remediation. 19 refs., 4 tabs., 3 figs
Energy Technology Data Exchange (ETDEWEB)
Manab Sarma, P.; Bhattacharya, D.; Krishnan, S. [TERI School of Advanced Studies, Center of Bioresources and Biotechnology, New Delhi (India); Lal, B. [TERI School of Advanced Studies, Microbial Biotechnology Division, New Delhi (India)
2004-06-01
Intra-species diversity among Acinetobacter baumannii strains isolated from crude oil-contaminated soils from different geographic regions in India was assessed, including their capability to degrade different fractions of total petroleum hydrocarbons. A total of 96 strains were isolated from five different sites. Of the 96 isolates, 25 strains were identified as Acinetobacter baumannii; all of these strains were biochemically profiled and grouped into eight phenovars on the basis of multivariate analysis of their substrate utilization profiles. All strains were able to degrade the total petroleum hydrocarbon fractions of crude oil. Intraspecies relatedness among the 25 strains was determined using tRNA intergenic spacer length polymorphism. Specific variants among the strains with different degradation capacities for different fractions of crude oil were detected. Environmental influences that cause intra-species diversity, such as functional resilience, within the selected strains of A. baumannii were also noted. It is suggested that such diversities may make it possible to select contaminant-specific strains for efficient biotechnological strategies in environmental remediation. 19 refs., 4 tabs., 3 figs.
Darrah, T.; Moortgat, J.; Poreda, R. J.; Muehlenbachs, K.; Whyte, C. J.
2015-12-01
Although hydrocarbon production from unconventional energy resources has increased dramatically in the last decade, total unconventional oil and gas recovery from black shales is still less than 25% and 9% of the totals in place, respectively. Further, the majority of increased hydrocarbon production results from increasing the lengths of laterals, the number of hydraulic fracturing stages, and the volume of consumptive water usage. These strategies all reduce the economic efficiency of hydrocarbon extraction. The poor recovery statistics result from an insufficient understanding of some of the key physical processes in complex, organic-rich, low porosity formations (e.g., phase behavior, fluid-rock interactions, and flow mechanisms at nano-scale confinement and the role of natural fractures and faults as conduits for flow). Noble gases and other hydrocarbon tracers are capably of recording subsurface fluid-rock interactions on a variety of geological scales (micro-, meso-, to macro-scale) and provide analogs for the movement of hydrocarbons in the subsurface. As such geochemical data enrich the input for the numerical modeling of multi-phase (e.g., oil, gas, and brine) fluid flow in highly heterogeneous, low permeability formations Herein we will present a combination of noble gas (He, Ne, Ar, Kr, and Xe abundances and isotope ratios) and molecular and isotopic hydrocarbon data from a geographically and geologically diverse set of unconventional hydrocarbon reservoirs in North America. Specifically, we will include data from the Marcellus, Utica, Barnett, Eagle Ford, formations and the Illinois basin. Our presentation will include geochemical and geological interpretation and our perspective on the first steps toward building an advanced reservoir simulator for tracer transport in multicomponent multiphase compositional flow (presented separately, in Moortgat et al., 2015).
Peripheral blood monocyte subsets predict antiviral response in chronic hepatitis C.
Rodríguez-Muñoz, Y; Martín-Vílchez, S; López-Rodríguez, R; Hernández-Bartolomé, A; Trapero-Marugán, M; Borque, M J; Moreno-Otero, R; Sanz-Cameno, P
2011-10-01
Hepatitis C virus infection evolves into chronic progressive liver disease in a significant percentage of patients. Monocytes constitute a diverse group of myeloid cells that mediate innate and adaptive immune response. In addition to proinflammatory CD16+ monocytes, a Tie-2+ subgroup - Tie-2 expressing monocytes (TEMs) - that has robust proangiogenic potential has been recently defined. To study the heterogeneity of peripheral blood monocytes in chronic hepatitis C (CHC) patients and to examine their proposed pathophysiological roles on disease progression and response to antiviral therapy. We studied CD16+ and Tie-2+ peripheral monocyte subpopulations in 21 healthy subjects and 39 CHC patients in various stages of disease and responses to antiviral treatment using flow cytometry. Expression profiles of proangiogenic and tissue remodelling factors in monocyte supernatants were measured using ELISA and protein arrays. Intrahepatic expression of CD14, CD31 and Tie-2 was analysed using immunofluorescence. Increases of certain peripheral monocyte subsets were observed in the blood of CHC patients, wherein those cells with proinflammatory (CD16+) or proangiogenic (TEMs) potential expanded (P TEMs were significantly increased in nonresponders, particularly those with lower CD16 expression. In addition, many angiogenic factors were differentially expressed by peripheral monocytes from control or CHC patients, such as angiopoietin-1 and angiogenin (P TEMs were distinguished within portal infiltrates of CHC patients. These findings suggest for the first time the relevance of peripheral monocytes phenotypes for the achievement of response to treatment. Hence, the study of monocyte subset regulation might effect improved CHC prognoses and adjuvant therapies. © 2011 Blackwell Publishing Ltd.
The prokarotic, endogenous storage polymer poly--hydroxybutyrate (PHB) accumulated in soil from a methane-enriched, halogenated hydrocarbon-degrading soil column. Based on phospholipid ester-linked fatty acid (PLFA) profiles, this mocrocosm has been previously reported to be sign...
Czech Academy of Sciences Publication Activity Database
Vaníčková, Lucie; Virgilio, M.; Tomčala, Aleš; Břízová, Radka; Ekesi, S.; Hoskovec, Michal; Kalinová, Blanka; do Nascimento, R. R.; De Meyer, M.
2014-01-01
Roč. 104, č. 5 (2014), s. 631-638 ISSN 0007-4853 Institutional support: RVO:61388963 Keywords : cryptic species complex * genus Ceratitis * cuticular hydrocarbons * polymorphic microsatellite loci * chemotaxonomy Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.910, year: 2014
Process for separating liquid hydrocarbons from waxes
Energy Technology Data Exchange (ETDEWEB)
Sowa, F J
1948-03-08
A process is described for the separation of liquid hydrocarbons from waxes comprising adding to a mixture of liquid hydrocarbons and waxes a sufficient quantity of an organo-silicon compound to cause the separation of the hydrocarbon and wax. The organo-silicon compounds are selected from the class of organic silicanes and their hydrolysis products and polymers. The silicanes have the formula R/sub y/SiX/sub z/, in which R is a saturated or unsaturated hydrocarbon radical, X is a halogen or another hydrocarbon radical or an -OR group, y has a value 1, 2, or 3 and z has a value 1, 2, or 3.
Process for treating hydrocarbons, etc
Energy Technology Data Exchange (ETDEWEB)
1933-09-15
A process is described for treating simultaneously bituminous substances and hydrocarbon oils for the production of low-boiling hydrocarbons and volatilization of the bituminous substances, characterized by the fact that it consists of heating a current of charge constituted by a mixture of the bituminous substances and hydrocarbon oils, to a high temperature, passing the heated current into a zone of extended reaction where the vapors are separated from the liquid or solid residue to favor transformation of the liquid hydrocarbons and volatilization of the bituminous substances, owing to the utilization of a heating agent carried to a high temperature being brought in contact with the heated charge in order to communicate its heat to the charge, while this later presents itself as relatively fine pellet or in the condition of distinct particles, particularly separated from one another.
Measurements of atmospheric hydrocarbons and biogenic emission fluxes in the Amazon boundary layer
Zimmerman, P. R.; Greenberg, J. P.; Westberg, C. E.
1988-01-01
Tropospheric mixing ratios of methane, C2-C10 hydrocarbons, and carbon monoxide were measured over the Amazon tropical forest near Manaus, Amazonas, Brazil, in July and August 1985. The measurements, consisting mostly of altitude profiles of these gases, were all made within the atmospheric boundary layer up to an altitude of 1000 m above ground level. Data characterize the diurnal hydrocarbon composition of the boundary layer. Biogenic emissions of isoprene control hydroxyl radical concentrations over the forest. Biogenic emission fluxes of isoprene and terpenes are estimated to be 25,000 micrograms/sq m per day and 5600 micrograms/sq m per day, respectively. This isoprene emission is equivalent to 2 percent of the net primary productivity of the tropical forest. Atmospheric oxidation of biogenic isoprene and terpenes emissions from the Amazon forest may account for daily increases of 8-13 ppb for carbon monoxide in the planetary boundary layer.
International Nuclear Information System (INIS)
Mohan, H.; Iyer, R.M.
1989-01-01
On γ-radiolysis, the rate of polymerization of methyl methacrylate in hydrocarbon solvents is observed to decrease. It is explained by hydrocarbon entry into the polymer chains. The hydrocarbon entry into the polymer chains is observed to take place at later stages of polymerization and increases with hydrocarbon chain length. The extent of hydrocarbon entry into the polymer chains is estimated by NMR and GLC analysis. It is observed to be equal to ∼ 12% corresponding to ∼ 97 hexadecane molecules in each polymer chain. The IR, DSC, MW determination and radiation effects on the polymer showed evidences for hydrocarbon entry into the polymer. It is explained by chain transfer from the growing polymer radical to the hydrocarbon molecules. The chain transfer constant is determined to be equal to 1 x 10 -2 . (author)
Steam hydrocarbon cracking and reforming
Golombok, M.
2004-01-01
Many industrial chemical processes are taught as distinct contrasting reactions when in fact the unifying comparisons are greater than the contrasts. We examine steam hydrocarbon reforming and steam hydrocarbon cracking as an example of two processes that operate under different chemical reactivity
International Nuclear Information System (INIS)
Locatelli, Catherine; Abbas, Mehdi; Rossiaud, Sylvain
2015-12-01
This article is a first step of a research agenda on international hydrocarbon regulations. With regards to both: i) the new wealth and power equilibrium in the international political economy and ii) the new political economy of carbon that is emerging from The Paris agreement on Climate changes, this research agenda aims at analysing the changing national structures of governance and the ways these changes lead to international, bilateral, pluri-lateral or multilateral hydrocarbon regulation
27 CFR 21.125 - Rubber hydrocarbon solvent.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Rubber hydrocarbon solvent. 21.125 Section 21.125 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU....125 Rubber hydrocarbon solvent. (a) Rubber hydrocarbon solvent is a petroleum derivative. (b...
Collision data involving hydro-carbon molecules
International Nuclear Information System (INIS)
Tawara, H.; Itikawa, Y.; Nishimura, H.; Tanaka, H.; Nakamura, Y.
1990-07-01
Hydro-carbon molecules are abundantly produced when graphites are used as internal wall materials of hydrogen plasmas and strongly influence properties of low temperature plasmas near the edges as well as those of high temperature plasmas at the center. In this report, following simple description of the production mechanisms of hydro-carbon molecules under the interactions between graphite and hydrogen plasma, the present status of collision data for hydro-carbon molecules by electron impact is discussed and the relevant data are summarized in a series of figures and tables. It should also be noted that, in addition to fusion plasmas, these hydrocarbon data compiled here are quite useful in other applications such as plasma chemistry and material processing. (author)
Process for desulfurizing hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
1937-04-12
A process is described for the desulfurization of a mixture of hydrocarbons, and in particular hydrocarbons containing less than 7 atoms of carbon and sulfur compounds of the type of sulfur carbonyl, characterized by the fact that the mixture, preferably in the liquid phase, is brought in contact with a solution of caustic alkali, essentially anhydrous or preferably with a solution of alkali hydroxide in an organic hydroxy nonacid solvent, for example, an alcohol, or with an alkaline alcoholate, under conditions suitable to the formation of hydrogen sulfide which produces a hydrocarbon mixture free from sulfur compounds of the sulfur carbonyl type but containing hydrogen sulfide, and that it is treated, following mixing, having beem submitted to the first treatment, by means of aqueous alkaline hydroxide to eliminate the hydrogen sulfide.
Hydrocarbon-degrading bacteria isolation and surfactant influence ...
African Journals Online (AJOL)
Hydrocarbons are substantially insoluble in water, often remaining partitioned in the non-aqueous phase liquid (NAPL). However, there had been little or no attempts to advance the bioavailability of hydrocarbons through the use of surfactants. This study was conducted based on the need to isolate hydrocarbon degrading ...
Sensitivity ranking for freshwater invertebrates towards hydrocarbon contaminants.
Gerner, Nadine V; Cailleaud, Kevin; Bassères, Anne; Liess, Matthias; Beketov, Mikhail A
2017-11-01
Hydrocarbons have an utmost economical importance but may also cause substantial ecological impacts due to accidents or inadequate transportation and use. Currently, freshwater biomonitoring methods lack an indicator that can unequivocally reflect the impacts caused by hydrocarbons while being independent from effects of other stressors. The aim of the present study was to develop a sensitivity ranking for freshwater invertebrates towards hydrocarbon contaminants, which can be used in hydrocarbon-specific bioindicators. We employed the Relative Sensitivity method and developed the sensitivity ranking S hydrocarbons based on literature ecotoxicological data supplemented with rapid and mesocosm test results. A first validation of the sensitivity ranking based on an earlier field study has been conducted and revealed the S hydrocarbons ranking to be promising for application in sensitivity based indicators. Thus, the first results indicate that the ranking can serve as the core component of future hydrocarbon-specific and sensitivity trait based bioindicators.
Enhanced biodegradation of hydrocarbons in-situ via bioventing
International Nuclear Information System (INIS)
Newman, B.; Martinson, M.; Smith, G.; McCain, L.
1993-01-01
This case study discusses the remediation of soils beneath a former service station impacted with volatile and semi-volatile petroleum compounds. Subsurface investigation revealed hydrocarbon contamination representative of weathered gasoline and diesel fuel in a stratified soil profile consisting of sand and silts. Only unsaturated soils were contaminated with no impact to ground water. A bioventing corrective action approach was selected which included excavation of 6,100 cubic yards of impacted soils with soil mixing to add inorganic nutrients and eliminate soil heterogeneities. Soils were then returned to the excavation after forced-air ventilation lateral lines were installed at the floor of the excavation. Soil vapor concentrations of benzene, toluene, ethylbenzene, xylenes (BTEX) rapidly declined within the first three months of system operation to nondetectable levels
Birerdinc, A; Estep, M; Afendy, A; Stepanova, M; Younossi, I; Baranova, A; Younossi, Z M
2012-06-01
Anaemia is a common side effect of ribavirin (RBV) which is used for the treatment of hepatitis C. Inosine triphosphatase gene polymorphism (C to A) protects against RBV-induced anaemia. The aim of our study was to genotype patients for inosine triphosphatase gene polymorphism rs1127354 SNP (CC or CA) and associate treatment-induced anaemia with gene expression profile and genotypes. We used 67 hepatitis C patients with available gene expression, clinical, laboratory data and whole-blood samples. Whole blood was used to determine inosine triphosphatase gene polymorphism rs1127354 genotypes (CC or CA). The cohort with inosine triphosphatase gene polymorphism CA genotype revealed a distinct pattern of protection against anaemia and a lower drop in haemoglobin. A variation in the propensity of CC carriers to develop anaemia prompted us to look for additional predictors of anaemia during pegylated interferon (PEG-IFN) and RBV. Pretreatment blood samples of patients receiving a full course of PEG-IFN and RBV were used to assess expression of 153 genes previously implicated in host response to viral infections. The gene expression data were analysed according to presence of anaemia and inosine triphosphatase gene polymorphism genotypes. Thirty-six genes were associated with treatment-related anaemia, six of which are involved in the response to hypoxia pathway (HIF1A, AIF1, RHOC, PTEN, LCK and PDGFB). There was a substantial overlap between sustained virological response (SVR)-predicting and anaemia-related genes; however, of the nine JAK-STAT pathway-related genes associated with SVR, none were implicated in anaemia. These observations exclude the direct involvement of antiviral response in the development of anaemia associated with PEG-IFN and RBV treatment, whereas another, distinct component within the SVR-associated gene expression response may predict anaemia. We have identified baseline gene expression signatures associated with RBV-induced anaemia and identified
High Pressure Preignition Chemistry of Hydrocarbons and Hydrocarbon Mixtures
National Research Council Canada - National Science Library
Cernansky, N.P
1998-01-01
.... The research program entailed mechanistic studies examining the oxidation chemistry of single-component hydrocarbons and ignition studies examining the overall ignition of pure single component fuels and fuel blends...
Process for refining hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Risenfeld, E H
1924-11-26
A process is disclosed for the refining of hydrocarbons or other mixtures through treatment in vapor form with metal catalysts, characterized by such metals being used as catalysts, which are obtained by reduction of the oxide of minerals containing the iron group, and by the vapors of the hydrocarbons, in the presence of the water vapor, being led over these catalysts at temperatures from 200 to 300/sup 0/C.
32. Boop - experiência do serviço de pneumologia do C.H.C
Directory of Open Access Journals (Sweden)
Ana Luisa Fonseca
2003-11-01
Full Text Available A BOOP (Bronquiolite Obliterante com Pneumonia Organizada é uma entidade clinicopatológica que associa uma clínica e imagiologia sugestiva à evidência de cilindros de tecido conjuntivo no lúmen nos espaços aéreos distais.O objectivo do trabalho é uma análise retrospectiva dos doentes com diagnóstico de BOOP no Serviço de Pneumologia do CHC entre Junho de 2000 e Junho de 2003.No período em análise, foram diagnosticados 9 casos (6 do sexo feminino e 3 do masculino; média de idades de 58,6 anos; 8 doentes sem história de tabagismo e 1 ex-fumador; 5 doentes eram portadores de co-morbilidades; tempo médio de evolução das queixas de 68,5 dias; as queixas referidas eram dispneia (7, tosse (6, febre (5 e emagrecimento (2; 8 doentes cumpriram antibioterapia prévia; as principais alterações do exame físico eram: crepitações à auscultação do tórax (6, febre (2 e cianose (1; as alterações da telerradiografia do tórax foram opacidades alveolares bilaterais (6, padrão intersticial (1 e pneumonia focal (3; a TAC foi realizada em 6 doentes: em 5 doentes havia opacidades alveolares bilaterais, em 2 doentes vidro despolido e em 2 doentes pneumonia focal; o EFR foi realizado em 5 doentes, apresentando diminuição da difusão (DLCO/ VA em todos os doentes (média de 59%; o LBA foi realizado em 6 doentes, apresentando todos alveolite linfocitária (média de linfócitos=47% e CD4/CD8 com média de 1.6; em 8 casos foi feito o diagnóstico por exame anatomo-patológico de biópsia pulmonar e 1 caso com base em critérios clínicos e radiológicos; a todos os doentes foi instituída corticoterapia; a resposta foi favorável em oito casos; 1 doente faleceu.Dos dados analisados, os autores destacam: o tempo de evolução dos sintomas até ao diagnóstico; a falência de múltiplas terapêuticas antibióticas; a concordância das alterações radiológicas com as habitualmente descritas na literatura; a alveolite linfocitária no LBA
Removal of Chlorinated Chemicals in H2 Feedstock Using Modified Activated Carbon
Directory of Open Access Journals (Sweden)
Prapaporn Luekittisup
2015-01-01
Full Text Available Activated carbon (GAC was impregnated by sodium and used as adsorbent to remove chlorinated hydrocarbon (CHC gases contaminated in H2 feedstock. The adsorption was carried out in a continuous packed-bed column under the weight hourly space velocity range of 0.8–1.0 hr−1. The adsorption capacity was evaluated via the breakthrough curves. This modified GAC potentially adsorbed HCl and VCM of 0.0681 gHCl/gadsorbent and 0.0026 gVCM/gadsorbent, respectively. It showed higher adsorption capacity than SiO2 and Al2O3 balls for both organic and inorganic CHCs removal. In addition, the kinetic adsorption of chlorinated hydrocarbons on modified GAC fit well with Yoon-Nelson model.
DEFF Research Database (Denmark)
Sele, Veronika; Sloth, Jens Jørgen; Holmelid, Bjarte
2014-01-01
; dimethylarsinate (DMA), triphenylarsinoxide (Ph3AsO) and a synthesized arsenic-containing hydrocarbon (AsHC) (dimethylarsinoyl nonadecane; C21H43AsO). The observed variation in signal intensity for arsenic during the gradient elution profile in reversed-phase HPLC was compensated for by determining the time...
Chemical fingerprinting of hydrocarbon-contamination in soil
DEFF Research Database (Denmark)
Boll, Esther Sørensen; Nejrup, Jens; Jensen, Julie K.
2015-01-01
Chemical fingerprinting analyses of 29 hydrocarbon-contaminated soils were performed to assess the soil quality and determine the main contaminant sources. The results were compared to an assessment based on concentrations of the 16 priority polycyclic aromatic hydrocarbons pointed out by the U...... and in assessing weathering trends of hydrocarbon contamination in the soils. Multivariate data analysis of sum-normalized concentrations could as a stand-alone tool distinguish between hydrocarbon sources of petrogenic and pyrogenic origin, differentiate within petrogenic sources, and detect weathering trends....... Diagnostic ratios of PACs were not successful for source identification of the heavily weathered hydrocarbon sources in the soils. The fingerprinting of contaminated soils revealed an underestimation of PACs in petrogenic contaminated soils when the assessment was based solely on EPAPAH16. As alkyl...
Al-Bader, Dhia; Eliyas, Mohamed; Rayan, Rihab; Radwan, Samir
2012-11-01
Aquatic and terrestrial associations of phototrophic and heterotrophic microorganisms active in hydrocarbon bioremediation have been described earlier. The question arises: do similar consortia also occur in the atmosphere? Dust samples at the height of 15 m were collected from Kuwait City air, and analyzed microbiologically for phototrophic and heterotrophic hydrocarbon-utilizing microorganisms, which were subsequently characterized according to their 16S rRNA gene sequences. The hydrocarbon utilization potential of the heterotrophs alone, and in association with the phototrophic partners, was measured quantitatively. The chlorophyte Gloeotila sp. and the two cyanobacteria Nostoc commune and Leptolyngbya thermalis were found associated with dust, and (for comparison) the cynobacteria Leptolyngbya sp. and Acaryochloris sp. were isolated from coastal water. All phototrophic cultures harbored oil vapor-utilizing bacteria in the magnitude of 10(5) g(-1). Each phototrophic culture had its unique oil-utilizing bacteria; however, the bacterial composition in Leptolyngbya cultures from air and water was similar. The hydrocarbon-utilizing bacteria were affiliated with Acinetobacter sp., Aeromonas caviae, Alcanivorax jadensis, Bacillus asahii, Bacillus pumilus, Marinobacter aquaeolei, Paenibacillus sp., and Stenotrophomonas maltophilia. The nonaxenic cultures, when used as inocula in batch cultures, attenuated crude oil in light and dark, and in the presence of antibiotics and absence of nitrogenous compounds. Aqueous and diethyl ether extracts from the phototrophic cultures enhanced the growth of the pertinent oil-utilizing bacteria in batch cultures, with oil vapor as a sole carbon source. It was concluded that the airborne microbial associations may be effective in bioremediating atmospheric hydrocarbon pollutants in situ. Like the aquatic and terrestrial habitats, the atmosphere contains dust-borne associations of phototrophic and heterotrophic hydrocarbon
International Nuclear Information System (INIS)
Westbrook, S.J.; Commonwealth Scientific and Industrial Research Organisation Land and Water, Wembley, WA; Davis, G.B.; Rayner, J.L.; Fisher, S.J.; Clement, T.P.
2000-01-01
Preliminary characterisation of a dissolved hydrocarbon groundwater plume flowing towards a tidally- and seasonally-forced estuarine system has been completed at a site in Perth, Western Australia. Installation and sampling of multiport boreholes enabled fine scale (0.5-m) vertical definition of hydrocarbon concentrations. Vertical electrical conductivity profiles from multiport and spear probe sampling into the river sediments indicated that two groundwater/river water interfaces or dispersion zones are present: (a) an upper dispersion zone between brackish river water and groundwater, and (b) a lower interface between groundwater and deeper saline water. On-line water level loggers show that near-shore groundwater levels are also strongly influence by tidal oscillation. Results from the initial site characterisation will be used to plan further investigations of contaminated groundwater/surface water interactions and the biodegradation processes occurring at the site
Bioremediation: Technology for treating hydrocarbon-contaminated wastewater
Energy Technology Data Exchange (ETDEWEB)
Towprayoon, S.; Kuntrangwattana, S. [King Mongkut`s Institute of Technology, Bangkok (Thailand)
1996-12-31
Cutting oil wastewater from an iron and steel factory was applied to the soil windrow. Self-remediation was then compared with remediation with acclimatized indigenous microbes. The incremental reduction rate of the microorganisms and hydrocarbon-degradable microbes was slower in self-remediation than in the latter treatment. Within 30 days, when the acclimatized indigenous microbes were used, there was a significant reduction of the contaminated hydrocarbons, while self-remediation took longer to reduce to the same concentration. Various nitrogen sources were applied to the soil pile, namely, organic compost, chemical fertilizer, ammonium sulfate, and urea. The organic compost induced a high yield of hydrocarbon-degradable microorganisms, but the rate at which the cutting oil in the soil decreased was slower than when other nitrogen sources were used. The results of cutting oil degradation studied by gas chromatography showed the absence of some important hydrocarbons. The increment of the hydrocarbon-degradable microbes in the land treatment ecosystem does not necessarily correspond to the hydrocarbon reduction efficiency. 3 refs., 3 figs.
Biodegradation of petroleum hydrocarbons at low temperatures
International Nuclear Information System (INIS)
Whyte, L. G.; Greer, C W.
1999-01-01
Bioremediation of contaminated Arctic sites has been proposed as the logistically and economically most favorable solution despite the known technical difficulties. The difficulties involve the inhibition of pollutants removal by biodegradation below freezing temperatures and the relative slowness of the process to remove enough hydrocarbon pollutants during the above-freezing summer months. Despite these formidable drawbacks, biodegradation of hydrocarbon contaminants is possible even in below-zero temperatures, especially if indigenous psychrophilic and psychrotropic micro-organism are used. This paper reports results of a study involving several hydrocarbon-degrading psychrotropic bacteria and suggests bioaugmentation with specific cold-adapted organisms and/or biostimulation with commercial fertilizers for enhancing degradation of specific contaminants in soils from northern Canada. An evaluation of the biodegradation potential of hydrocarbon contaminated soils in the high Arctic suggested that the contaminated soils contained sufficient numbers of cold-adapted hydrocarbon-degrading bacteria and that the addition of fertilizer was sufficient to enhance the level of hydrocarbon degradation at low ambient summer temperatures. 9 refs., 2 tabs., 3 figs
Preliminary Geospatial Analysis of Arctic Ocean Hydrocarbon Resources
Energy Technology Data Exchange (ETDEWEB)
Long, Philip E.; Wurstner, Signe K.; Sullivan, E. C.; Schaef, Herbert T.; Bradley, Donald J.
2008-10-01
Ice coverage of the Arctic Ocean is predicted to become thinner and to cover less area with time. The combination of more ice-free waters for exploration and navigation, along with increasing demand for hydrocarbons and improvements in technologies for the discovery and exploitation of new hydrocarbon resources have focused attention on the hydrocarbon potential of the Arctic Basin and its margins. The purpose of this document is to 1) summarize results of a review of published hydrocarbon resources in the Arctic, including both conventional oil and gas and methane hydrates and 2) develop a set of digital maps of the hydrocarbon potential of the Arctic Ocean. These maps can be combined with predictions of ice-free areas to enable estimates of the likely regions and sequence of hydrocarbon production development in the Arctic. In this report, conventional oil and gas resources are explicitly linked with potential gas hydrate resources. This has not been attempted previously and is particularly powerful as the likelihood of gas production from marine gas hydrates increases. Available or planned infrastructure, such as pipelines, combined with the geospatial distribution of hydrocarbons is a very strong determinant of the temporal-spatial development of Arctic hydrocarbon resources. Significant unknowns decrease the certainty of predictions for development of hydrocarbon resources. These include: 1) Areas in the Russian Arctic that are poorly mapped, 2) Disputed ownership: primarily the Lomonosov Ridge, 3) Lack of detailed information on gas hydrate distribution, and 4) Technical risk associated with the ability to extract methane gas from gas hydrates. Logistics may control areas of exploration more than hydrocarbon potential. Accessibility, established ownership, and leasing of exploration blocks may trump quality of source rock, reservoir, and size of target. With this in mind, the main areas that are likely to be explored first are the Bering Strait and Chukchi
Freitas, Juliana G; Rivett, Michael O; Roche, Rachel S; Durrant Neé Cleverly, Megan; Walker, Caroline; Tellam, John H
2015-02-01
The typically elevated natural attenuation capacity of riverbed-hyporheic zones is expected to decrease chlorinated hydrocarbon (CHC) groundwater plume discharges to river receptors through dechlorination reactions. The aim of this study was to assess physico-chemical processes controlling field-scale variation in riverbed-hyporheic zone dechlorination of a TCE groundwater plume discharge to an urban river reach. The 50-m long pool-riffle-glide reach of the River Tame in Birmingham (UK) studied is a heterogeneous high energy river environment. The shallow riverbed was instrumented with a detailed network of multilevel samplers. Freeze coring revealed a geologically heterogeneous and poorly sorted riverbed. A chlorine number reduction approach provided a quantitative indicator of CHC dechlorination. Three sub-reaches of contrasting behaviour were identified. Greatest dechlorination occurred in the riffle sub-reach that was characterised by hyporheic zone flows, moderate sulphate concentrations and pH, anaerobic conditions, low iron, but elevated manganese concentrations with evidence of sulphate reduction. Transient hyporheic zone flows allowing input to varying riverbed depths of organic matter are anticipated to be a key control. The glide sub-reach displayed negligible dechlorination attributed to the predominant groundwater baseflow discharge condition, absence of hyporheic zone, transition to more oxic conditions and elevated sulphate concentrations expected to locally inhibit dechlorination. The tail-of-pool-riffle sub-reach exhibited patchy dechlorination that was attributed to sub-reach complexities including significant flow bypass of a low permeability, high organic matter, silty unit of high dechlorination potential. A process-based conceptual model of reach-scale dechlorination variability was developed. Key findings of practitioner relevance were: riverbed-hyporheic zone CHC dechlorination may provide only a partial, somewhat patchy barrier to CHC
Process for in-situ biodegradation of hydrocarbon contaminated soil
International Nuclear Information System (INIS)
Ely, D.L.; Heffner, D.A.
1991-01-01
This patent describes an in situ process for biodegrading hydrocarbons by drawing oxygen into an undisturbed hydrocarbon contaminated zone in a fluid permeable soil. It comprises: establishing a borehole extending from the earth's surface through a hydrocarbon contaminated zone having hydrocarbon degrading microbes therein; lining the borehole with a fluid impermeable liner coaxially spaced and sealingly connected to the inside surface of the borehole and extending from the earth's surface to the hydrocarbon-contaminated zone; the liner including a fluid permeable portion extending from the lower end thereof and through at least a portion of the hydrocarbon contaminated zone, fluidly connecting a source of negative pressure to the fluid impermeable line; evacuating gas from the borehole through the fluid permeable portion of the liner at a rate sufficient to draw air from the earth's surface into the hydrocarbon containing zone; and adjusting the flow rate of the evacuated gas so that the amount of hydrocarbon biodegradation therein is within 50% of the maximum hydrocarbon biodegradation rate as detected by the volume of carbon dioxide in the evacuated gas
Effect of Roasting on Fatty Acid Profile of Brown and Yellow ...
African Journals Online (AJOL)
Purpose: To monitor changes in fatty acid profiles of brown and yellow varieties of flaxseeds in the raw and roasted states using gas chromatography .... The ratio of SFAs to USFAs is a useful index to measure edible oil quality. ..... roasting, powdering and storing irradiated soybeans on hydrocarbon detection for identifying ...
Assessing impediments to hydrocarbon biodegradation in weathered contaminated soils.
Adetutu, Eric; Weber, John; Aleer, Sam; Dandie, Catherine E; Aburto-Medina, Arturo; Ball, Andrew S; Juhasz, Albert L
2013-10-15
In this study, impediments to hydrocarbon biodegradation in contaminated soils were assessed using chemical and molecular methodologies. Two long-term hydrocarbon contaminated soils were utilised which were similar in physico-chemical properties but differed in the extent of hydrocarbon (C10-C40) contamination (S1: 16.5 g kg(-1); S2: 68.9 g kg(-1)). Under enhanced natural attenuation (ENA) conditions, hydrocarbon biodegradation was observed in S1 microcosms (26.4% reduction in C10-C40 hydrocarbons), however, ENA was unable to stimulate degradation in S2. Although eubacterial communities (PCR-DGGE analysis) were similar for both soils, the alkB bacterial community was less diverse in S2 presumably due to impacts associated with elevated hydrocarbons. When hydrocarbon bioaccessibility was assessed using HP-β-CD extraction, large residual concentrations remained in the soil following the extraction procedure. However, when linear regression models were used to predict the endpoints of hydrocarbon degradation, there was no significant difference (P>0.05) between HP-β-CD predicted and microcosm measured biodegradation endpoints. This data suggested that the lack of hydrocarbon degradation in S2 resulted primarily from limited hydrocarbon bioavailability. Copyright © 2013 Elsevier B.V. All rights reserved.
Rao, P. Lakshmi Srinivasa; Madhavi, T.; Srinu, D.; Kalpana, M. S.; Patil, D. J.; Dayal, A. M.
2013-02-01
Light hydrocarbons in soil have been used as direct indicators in geochemical hydrocarbon exploration, which remains an unconventional path in the petroleum industry. The occurrence of adsorbed soil gases, methane and heavier homologues were recorded in the near-surface soil samples collected from Kutch-Saurashtra, India. Soil gas alkanes were interpreted to be derived from deep-seated hydrocarbon sources and have migrated to the surface through structural discontinuities. The source of hydrocarbons is assessed to be thermogenic and could have been primarily derived from humic organic matter with partial contribution from sapropelic matter. Gas chromatographic analyses of hydrocarbons desorbed from soil samples through acid extraction technique showed the presence of methane through n-butane and the observed concentrations (in ppb) vary from: methane (C1) from 4-291, ethane (C2) from 0-84, propane (C3) from 0-37, i-butane (iC4) from 0-5 and n-butane (nC4) from 0-4. Carbon isotopes measured for methane and ethane by GC-C-IRMS, range between -42.9‰ to -13.3‰ (Pee Dee Belemnite - PDB) and -21.2‰ to -12.4‰ (PDB), respectively. The increased occurrence of hydrocarbons in the areas near Anjar of Kutch and the area south to Rajkot of Saurashtra signifies the area potential for oil and gas.
In-situ hydrocarbon delineation using laser-induced fluorescence
International Nuclear Information System (INIS)
Taer, A.D.; Hastings, R.W.; Brown, A.Y.; Frend, R.
1996-01-01
An investigation of hydrocarbons in soils was conducted at an active Shell Oil Company petroleum products terminal, located in Carson, California. An investigation approach involving Laser-Induced Fluorescence (LIF) and Cone Penetrometer Testing (CPT) technologies was implemented to provide real-time, in-situ characterization of site stratigraphy, hydrocarbon distribution and importantly, hydrocarbon product differentiation. The area of investigation is located along a property boundary, where a plume of separate phase hydrocarbons has been actively recovered for several years. CPT/LIF technology was selected for the investigation since previous delineation efforts using hydrocarbon fingerprinting methods proved inconclusive. Additionally, the CPT/LIF technology had the potential to provide a cost effective solution to accomplish project objectives. Based on the information obtained during this investigation, it was determined that the plume of separate phase hydrocarbons along the northern property boundary is from a source distinctly different than any identified hydrocarbons known to be from on-site sources. In addition, the plume was determined to not be connected with any other known on-site hydrocarbon plumes. The results of this CPT/LIF investigation were consistent with the known hydrogeologic conditions. This evaluation determined that CPT/LIF technology was very effective in addressing project objectives and resulted in a significant cost savings
Constructed wetlands for treatment of dissolved phase hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Moore, B J; Ross, S D [Komex International, Calgary, AB (Canada); Gibson, D [Calgary Univ., AB (Canada); Hardisty, P E [Komex Clarke Bond, Bristol (United Kingdom)
1999-01-01
The use of constructed wetlands as an alternative to conventional treatment of condensate-contaminated groundwater was studied. In 1997 a pilot scale wetland was constructed and implemented at the Gulf Strachan Gas Processing Plant to determine its ability in treating extracted groundwater contaminated with natural gas condensates. This paper presented the results of hydrocarbon removal efficiency, hydrocarbon removal mechanisms, winter operation, and the effect of hydrocarbons on vegetation health. The inflow water to the wetland contains 15 to 20 mg/L of C[sub 5]-C[sub 10] hydrocarbons, including 50 per cent BTEX compounds. During the summer months, hydrocarbon removal efficiency was 100 per cent, but decreased to 60 and 30 per cent in the spring and late fall, respectively. The hydrocarbons not removed in the wetland were eventually removed along the outflow channel. Temperature was determined to be an important factor in the variable removal rates, particularly when there is no aeration. The main hydrocarbon removal mechanisms appear to be volatilization, biodegradation and dilution. At present, plant uptake is not a factor. 12 refs., 1 tab., 3 figs.
Constructed wetlands for treatment of dissolved phase hydrocarbons
International Nuclear Information System (INIS)
Moore, B.J.; Ross, S.D.; Gibson, D.; Hardisty, P.E.
1999-01-01
The use of constructed wetlands as an alternative to conventional treatment of condensate-contaminated groundwater was studied. In 1997 a pilot scale wetland was constructed and implemented at the Gulf Strachan Gas Processing Plant to determine its ability in treating extracted groundwater contaminated with natural gas condensates. This paper presented the results of hydrocarbon removal efficiency, hydrocarbon removal mechanisms, winter operation, and the effect of hydrocarbons on vegetation health. The inflow water to the wetland contains 15 to 20 mg/L of C 5 -C 10 hydrocarbons, including 50 per cent BTEX compounds. During the summer months, hydrocarbon removal efficiency was 100 per cent, but decreased to 60 and 30 per cent in the spring and late fall, respectively. The hydrocarbons not removed in the wetland were eventually removed along the outflow channel. Temperature was determined to be an important factor in the variable removal rates, particularly when there is no aeration. The main hydrocarbon removal mechanisms appear to be volatilization, biodegradation and dilution. At present, plant uptake is not a factor. 12 refs., 1 tab., 3 figs
Saturated versus unsaturated hydrocarbon interactions with carbon nanostructures
Directory of Open Access Journals (Sweden)
Deivasigamani eUmadevi
2014-09-01
Full Text Available The interactions of various acyclic and cyclic hydrocarbons in both saturated and unsaturated forms with the carbon nanostructures (CNSs have been explored by using density functional theory (DFT calculations. Model systems representing armchair and zigzag carbon nanotubes (CNTs and graphene have been considered to investigate the effect of chirality and curvature of the CNSs towards these interactions. Results of this study reveal contrasting binding nature of the acyclic and cyclic hydrocarbons towards CNSs. While the saturated molecules show stronger binding affinity in acyclic hydrocarbons; the unsaturated molecules exhibit higher binding affinity in cyclic hydrocarbons. In addition, acyclic hydrocarbons exhibit stronger binding affinity towards the CNSs when compared to their corresponding cyclic counterparts. The computed results excellently corroborate the experimental observations. The interaction of hydrocarbons with graphene is more favourable when compared with CNTs. Bader’s theory of atoms in molecules has been invoked to characterize the noncovalent interactions of saturated and unsaturated hydrocarbons. Our results are expected to provide useful insights towards the development of rational strategies for designing complexes with desired noncovalent interaction involving CNSs.
Radiolysis of hydrocarbons in liquid phase (Modern state of problem)
International Nuclear Information System (INIS)
Saraeva, V.V.
1986-01-01
Problems of ionizing radiation effect on hydrocarbons and hydrocarbon systems in a liquid phase are considered. Modern representations on the mechanism of hydrocarbon radiolysis are presented. Electron moderation and ion-electron pair formation, behaviour of charged particles, excited states, radical formation and their reactions are discussed. Behaviour of certain hydrocarbon classes: alkanes, cyclic hydrocarbons, olefines, aromatic hydrocarbons as well as different hydrocarbon mixtures is considered in detail. Radiation-chemical changes in organic coolants and ways of increasing radiation resistance are considered. Polyphenyl compounds are noted to be most perspective here
Directory of Open Access Journals (Sweden)
Yonathan Asikin
2018-01-01
Full Text Available Shiikuwasha pulp is an important raw material for producing citrus essential oils. The volatile aroma composition of pulp essential oil was evaluated using gas chromatography (GC methods, and its aroma profile was assessed using GC-olfactometry with an extended aroma extract dilution analysis (AEDA technique in regard to alterations of odor strength and sensorial perception throughout serial dilution steps. The essential oil comprised a mixture of 55 aroma compounds, including monoterpene hydrocarbon, sesquiterpene hydrocarbon, alcohol, aldehyde, ester, and oxide compounds. The predominant compounds were limonene [57.36% (4462.80 mg/100 g of pulp] and γ-terpinene [25.14% (1956.21 mg/100 g of pulp]. However, linalool was identified as one of the key aroma components providing the highest flavor dilution factor in AEDA, whilst three sesquiterpene hydrocarbons (δ-elemene, germacrene B, and bicyclosesquiphellandrene and two esters (heptyl acetate and decyl acetate had superior relative flavor activities. The extended AEDA profile identified variations in assessed odor perceptions, intensity, and duration of aroma components over dilution, whereas the 12 most odor-active compounds showed comparable odor strengths.
Production of hydrocarbons of value
Energy Technology Data Exchange (ETDEWEB)
1931-06-16
A process is described for the production of hydrocarbons of great value by treating with heat and pressure carbonaceous materials such as coals, tars, mineral oils, and products of distillation and transformation of these materials, also for the refining with heat and pressure of mixed liquid hydrocarbons by means of hydrogen gas, preferably in the presence of catalysts, consisting in using as the hydrogenating gas that obtained by gasification of combustible solids after partial or complete cleaning at atmospheric or elevated pressures, by means of solid adsorbents, chemical agents or catalysts, or mixtures of these agents, the hydrocarbons being characterized by strong unsaturation, and the presence of oxygen, sulfur compounds, and oxides of nitrogen.
Total Petroleum Hydrocarbons (TPH): ToxFAQs
... a state: This map displays locations where Total Petroleum Hydrocarbons (TPH) is known to be present. On ... I get more information? ToxFAQs TM for Total Petroleum Hydrocarbons (TPH) ( Hidrocarburos Totales de Petróleo (TPH) ) August ...
The offshore hydrocarbon releases (HCR) database
International Nuclear Information System (INIS)
Bruce, R.A.P.
1995-01-01
Following Cullen Recommendation 39 which states that: ''The regulatory body should be responsible for maintaining a database with regard to hydrocarbon leaks, spills, and ignitions in the Industry and for the benefit of Industry'', HSE Offshore Safety Division (HSE-OSD) has now been operating the Hydrocarbon Releases (HCR) Database for approximately 3 years. This paper deals with the reporting of Offshore Hydrocarbon Releases, the setting up of the HCR Database, the collection of associated equipment population data, and the main features and benefits of the database, including discussion on the latest output information. (author)
Sustainable treatment of hydrocarbon-contaminated industrial land
Cunningham, Colin John
2012-01-01
Land contamination by petroleum hydrocarbons is a widespread and global environmental pollution issue from recovery and refining of crude oil and the ubiquitous use of hydrocarbons in industrial processes and applications. Sustainable treatment of hydrocarbon-contaminated industrial land was considered with reference to seven published works on contaminated railway land including the track ballast, crude oil wastes and contaminated refinery soils. A methodology was developed...
Hydrocarbons biodegradation in unsaturated porous medium
International Nuclear Information System (INIS)
Gautier, C.
2007-12-01
Biological processes are expected to play an important role in the degradation of petroleum hydrocarbons in contaminated soils. However, factors influencing the kinetics of biodegradation are still not well known, especially in the unsaturated zone. To address these biodegradation questions in the unsaturated zone an innovative experimental set up based on a physical column model was developed. This experimental set up appeared to be an excellent tool for elaboration of a structured porous medium, with well defined porous network and adjusted water/oil saturations. Homogeneous repartition of both liquid phases (i.e., aqueous and non aqueous) in the soil pores, which also contain air, was achieved using ceramic membranes placed at the bottom of the soil column. Reproducible interfaces (and connectivity) are developed between gas, and both non mobile water and NAPL phases, depending on the above-defined characteristics of the porous media and on the partial saturations of these three phases (NAPL, water and gas). A respirometric apparatus was coupled to the column. Such experimental set up have been validated with hexadecane in dilution in an HMN phase. This approach allowed detailed information concerning n-hexadecane biodegradation, in aerobic condition, through the profile of the oxygen consumption rate. We have taken benefit of this technique, varying experimental conditions, to determine the main parameters influencing the biodegradation kinetics and compositional evolution of hydrocarbons, under steady state unsaturated conditions and with respect to aerobic metabolism. Impacts of the nitrogen quantity and of three different grain sizes have been examined. Biodegradation of petroleum cut, as diesel cut and middle distillate without aromatic fraction, were, also studied. (author)
Hydrocarbon toxicity: an analysis of AAPCC TESS data.
Cobaugh, Daniel J; Seger, Donna L; Krenzelok, Edward P
2007-01-01
Human hydrocarbon exposures have the potential to cause significant morbidity and mortality. To determine which hydrocarbons were associated with the most severe adverse outcomes, human exposure data reported to American poison information centers were analyzed. Outcome data for single-substance, hydrocarbon exposures reported to the American Association of Poison Control Centers Toxic Exposure Surveillance System from 1994 through 2003 were analyzed. Only cases with definitive medical outcomes were included. Analyses were stratified by five age groups: 59 years. Hazard factors were determined by calculating the sum of the major effects and fatalities for each hydrocarbon category and dividing this by the total number of exposures for that category. To normalize the data, the overall rate of major effects and deaths for each age group was assigned hazard factor value of 1. Hydrocarbon categories with a HF of > or = 1.5 were included in the final analyses. Estimated rates of major effect and fatal outcomes (outcomes/1000 people) were also calculated. 318,939 exposures were analyzed. Exposures to benzene, toluene/xylene, halogenated hydrocarbons, kerosene and lamp oil resulted in the highest hazard factor values. These data demonstrate that hydrocarbons that are absorbed systemically and those with low viscosities are associated with higher hazard factors. The risks associated with hydrocarbons often implicated in abuse by older children and adolescents are also confirmed.
Thermophilic slurry-phase treatment of petroleum hydrocarbon waste sludges
International Nuclear Information System (INIS)
Castaldi, F.J.; Bombaugh, K.J.; McFarland, B.
1995-01-01
Chemoheterotrophic thermophilic bacteria were used to achieve enhanced hydrocarbon degradation during slurry-phase treatment of oily waste sludges from petroleum refinery operations. Aerobic and anaerobic bacterial cultures were examined under thermophilic conditions to assess the effects of mode of metabolism on the potential for petroleum hydrocarbon degradation. The study determined that both aerobic and anaerobic thermophilic bacteria are capable of growth on petroleum hydrocarbons. Thermophilic methanogenesis is feasible during the degradation of hydrocarbons when a strict anaerobic condition is achieved in a slurry bioreactor. Aerobic thermophilic bacteria achieved the largest apparent reduction in chemical oxygen demand, freon extractable oil, total and volatile solid,s and polycyclic aromatic hydrocarbons (PAHs) when treating oily waste sludges. The observed shift with time in the molecular weight distribution of hydrocarbon material was more pronounced under aerobic metabolic conditions than under strict anaerobic conditions. The changes in the hydrocarbon molecular weight distribution, infrared spectra, and PAH concentrations during slurry-phase treatment indicate that the aerobic thermophilic bioslurry achieved a higher degree of hydrocarbon degradation than the anaerobic thermophilic bioslurry during the same time period
Leahy, Joseph G; Tracy, Karen D; Eley, Michael H
2003-03-01
Steam classification is a process for treatment of solid waste that allows recovery of volatile organic compounds from the waste via steam condensate and off-gases. A mixed culture of aromatic hydrocarbon-degrading bacteria was used to degrade the contaminants in the condensate, which contained approx. 60 hydrocarbons, of which 38 were degraded within 4 d. Many of the hydrocarbons, including styrene, 1,2,4-trimethylbenzene, naphthalene, ethylbenzene, m-/p-xylene, chloroform, 1,3-dichloropropene, were completely or nearly completely degraded within one day, while trichloroethylene and 1,2,3-trichloropropane were degraded more slowly.
Thermodynamic analysis of hydrocarbon refrigerants in a sub-cooling refrigeration system
Directory of Open Access Journals (Sweden)
BUKOLA O. BOLAJI
2013-06-01
Full Text Available In this study, the performance simulation of some hydrocarbon refrigerants (R290, R600 and R600a as alternatives to R134a in refrigeration system with sub-cooling is conducted by thermodynamic calculation of performance parameters using the REFPROP software. The results obtained showed that the saturated vapour pressure and temperature characteristic profiles for R600 and R600a are very close to that of R134a. The three hydrocarbon refrigerants exhibited very high refrigerating effect and condenser duty than R134a. The best of these parameters was obtained using R600. The discharge temperatures obtained using R600 and R600a were low, while that of R290 was very much higher. The highest coefficient of performance (COP and relative capacity index were obtained using R600. Average COPs of R600 and R600a are 4.6 and 2.2% higher than that of R134a, respectively. The performances of R600 and R600a in system were better than those of R134a and R290. The best performance was obtained using R600 in the system.
Production of hydrocarbons, especially ethylene
Energy Technology Data Exchange (ETDEWEB)
1952-01-17
The invention has for its object a process for the production of gaseous nonsaturated hydrocarbons, particularly ethylene and aromatic hydrocarbons, by starting with hydrocarbon oils entirely of paraffinic nature or their fractions, which consists in putting the separated products in contact with solid inert material especially with porous nonmetallic inert material or of heavy metals or their alloys, maybe in a finely divided state or in the form, of pieces or chips, at a temperature above 500/sup 0/C, or better between 600 and 700/sup 0/C at a velocity per hour of 0.6 to 3.0, and preferably 0.75 to 1.5 parts per volume of products per each part of space volume of catalyst.
Process of distilling heavy hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
1929-12-03
This invention has for its object the distillation of heavy liquid hydrocarbons for the purpose of obtaining lighter hydrocarbons stable and immediately salable for fuels in combustion motors. The process is distinguished by the fact that the heavy hydrocarbon is distilled by means of heating to a temperature in keeping with the nature of the material to be treated up to 350/sup 0/C under pressure or without pressure the distillation being carried out on catalysts containing successively nickel, copper, and iron (3 parts of nickel, 1 part of copper, and 1 part of iron), the vapors produced by this distillation being exposed in turn to the action of catalysts of the same nature and in the same proportion.
Method for upgrading diene-containing hydrocarbon mixtures
Energy Technology Data Exchange (ETDEWEB)
Kidwell, L.E. Jr.; Holcomb, D.E.
1984-05-22
There is disclosed a method for upgrading of hydrocarbon mixtures, so as to reduce their content of gum precursors such as diolefins and pseudo-diolefins, and provide a resulting product mixture suitable for mild hydrogenation, for use as a motor fuel or as a feed stock to an extraction unit. The process comprises obtaining a hydrocarbon mixture containing about 60-90 wt. % of aromatic components, about 3-40 wt. % of dienes and pseudodienes, and monoolefins, and up to about 6 wt. % of relatively unreactive organic compounds, reacting this mixture with elemental sulfur in the approximate weight ratio of about 5-95 wt. % of the hydrocarbon mixture with about 95-5 wt. % of elemental sulfur, the reaction being carried out at a temperature in the range of 100/sup 0/-150/sup 0/ C. for about 10 minutes to 24 hours with good mixing, removing the unreacted materials by distillation and separating a sulfur-hydrocarbon reaction product to provide the upgraded hydrocarbon mixture.
Seawater-cultured Botryococcus braunii for efficient hydrocarbon extraction.
Directory of Open Access Journals (Sweden)
Kenichi Furuhashi
Full Text Available As a potential source of biofuel, the green colonial microalga Botryococcus braunii produces large amounts of hydrocarbons that are accumulated in the extracellular matrix. Generally, pretreatment such as drying or heating of wet algae is needed for sufficient recoveries of hydrocarbons from B. braunii using organic solvents. In this study, the Showa strain of B. braunii was cultured in media derived from the modified Chu13 medium by supplying artificial seawater, natural seawater, or NaCl. After a certain period of culture in the media with an osmotic pressure corresponding to 1/4-seawater, hydrocarbon recovery rates exceeding 90% were obtained by simply mixing intact wet algae with n-hexane without any pretreatments and the results using the present culture conditions indicate the potential for hydrocarbon milking.Seawater was used for efficient hydrocarbon extraction from Botryococcus braunii. The alga was cultured in media prepared with seawater or NaCl. Hydrocarbon recovery rate exceeding 90% was obtained without any pretreatment.
Effect of hydrocarbons on plasma treatment of NOx
Energy Technology Data Exchange (ETDEWEB)
Penetrante, B.M.; Pitz, W.J.; Hsaio, M.C.; Merritt, B.T.; Vogtlin, G.E. [Lawrence Livermore National Lab., CA (United States)
1997-12-31
Lean burn gasoline engine exhausts contain a significant amount of hydrocarbons in the form of propene. Diesel engine exhausts contain little gaseous hydrocarbon; however, they contain a significant amount of liquid-phase hydrocarbons (known as the volatile organic fraction) in the particulates. The objective of this paper is to examine the fate of NO{sub x} when an exhaust gas mixture that contains hydrocarbons is subjected to a plasma. The authors will show that the hydrocarbons promote the oxidation of NO to NO{sub 2}, but not the reduction of NO to N{sub 2}. The oxidation of NO to NO{sub 2} is strongly coupled with the hydrocarbon oxidation chemistry. This result suggests that gas-phase reactions in the plasma alone cannot lead to the chemical reduction of NO{sub x}. Any reduction of NO{sub x} to N{sub 2} can only be accomplished through heterogeneous reactions of NO{sub 2} with surfaces or particulates.
Molecular characterization of autochthonous hydrocarbon utilizing ...
African Journals Online (AJOL)
Prof. Ogunji
Materials and Methods ... culturable hydrocarbon utilizing bacteria (HUB) were enumerated by vapour phase ... hydrocarbon utilizing bacterial isolates by boiling method according to ... obtained in this investigation are consistent with past field studies (Kostka et ... Microbial and other related changes in a Niger sediment.
Volatilisation of aromatic hydrocarbons from soil
DEFF Research Database (Denmark)
Lindhardt, B.; Christensen, T.H.
1996-01-01
The non-steady-state fluxes of aromatic hydrocarbons were measured in the laboratory from the surface of soils contaminated with coal tar Four soil samples from a former gasworks site were used for the experiments. The fluxes were quantified for 11 selected compounds, 4 mono- and 7 polycyclic...... aromatic hydrocarbons, for a period of up to 8 or 16 days. The concentrations of the selected compounds in the soils were between 0.2 and 3,100 mu g/g. The study included the experimental determination of the distribution coefficient of the aromatic hydrocarbons between the sorbed phase and the water under...... saturated conditions. The determined distribution coefficients showed that the aromatic hydrocarbons were more strongly sorbed to the total organic carbon including the coal tar pitch - by a factor of 8 to 25 - than expected for natural organic matter. The fluxes were also estimated using an analytical...
Energy Technology Data Exchange (ETDEWEB)
1941-02-10
A process is disclosed for recovery of hydrocarbon oils, especially lubricating oils or diesel oils, through pressure hydrogenation of distillation, extraction of hydrogenation products from coal or coaly materials or from oils such as mineral oils or tars in liquid phase by use in a reaction vessel of fixed-bed catalysts, characterized in that as starting material is employed material which has been freed of asphaltic and resinous material by hydrogenation refining, vacuum-steam distillation, treatment with hydrogen-rich hydrocarbons (hydroforming), or sulfuric acid.
Oils; lubricants; paraffin-wax compositions; hydrocarbon condensation products
Energy Technology Data Exchange (ETDEWEB)
1934-04-04
Petroleum hydrocarbons such as gasoline, kerosene, Diesel fuel oil, lubricating-oil, and paraffin wax, and like hydrocarbons such as are obtainable from shale oil and by the hydrogenation of carbonaceous materials, are improved by addition of products obtained by condensing a cyclic hydrocarbon with a saturated dihalogen derivative of an aliphatic hydrocarbon containing less than five carbon atoms. The addition of the condensation products increases the viscosity of the hydrocarbon oils specified, and is particularly useful in the case of lubricating-oils; addition of the condensation products to paraffin wax increases the transparency and adherent properties of the wax, and is useful in the manufacture of moulded articles such as candles; the products may also be used in solid lubricating-compositions.
Imaging fluid/solid interactions in hydrocarbon reservoir rocks.
Uwins, P J; Baker, J C; Mackinnon, I D
1993-08-01
The environmental scanning electron microscope (ESEM) has been used to image liquid hydrocarbons in sandstones and oil shales. Additionally, the fluid sensitivity of selected clay minerals in hydrocarbon reservoirs was assessed via three case studies: HCl acid sensitivity of authigenic chlorite in sandstone reservoirs, freshwater sensitivity of authigenic illite/smectite in sandstone reservoirs, and bleach sensitivity of a volcanic reservoir containing abundant secondary chlorite/corrensite. The results showed the suitability of using ESEM for imaging liquid hydrocarbon films in hydrocarbon reservoirs and the importance of simulating in situ fluid-rock interactions for hydrocarbon production programmes. In each case, results of the ESEM studies greatly enhanced prediction of reservoir/borehole reactions and, in some cases, contradicted conventional wisdom regarding the outcome of potential engineering solutions.
Eslam, Mohammed; Booth, David R; George, Jacob; Ahlenstiel, Golo
2013-11-07
Metabolic changes are inextricably linked to chronic hepatitis C (CHC). Recently polymorphisms in the IFNL3 (IL28B) region have been shown to be strongly associated with spontaneous and treatment induced recovery from hepatitis C virus (HCV) infection. Further, circumstantial evidence suggests a link between IFNL3 single nucleotide polymorphisms and lipid metabolism, steatosis and insulin resistance in CHC. The emerging picture suggests that the responder genotypes of IFNL3 polymorphisms are associated with a higher serum lipid profile, and less frequent steatosis and insulin resistance. This review analyzes the current data regarding this interaction and its meaning for HCV pathogenesis and disease progression.
Ma, Yan; Shi, Yi; Hou, Deyi; Zhang, Xi; Chen, Jiaqi; Wang, Zhifen; Xu, Zhu; Li, Fasheng; Du, Xiaoming
2017-04-01
Mechanical soil aeration is a simple, effective, and low-cost soil remediation technology that is suitable for sites contaminated with volatile chlorinated hydrocarbons (VCHs). Conventionally, this technique is used to treat the mixed soil of a site without considering the diversity and treatability of different soils within the site. A laboratory test was conducted to evaluate the effectiveness of mechanical soil aeration for remediating soils of different textures (silty, clayey, and sandy soils) along a vertical profile at an abandoned chloro-alkali chemical site in China. The collected soils were artificially contaminated with chloroform (TCM) and trichloroethylene (TCE). Mechanical soil aeration was effective for remediating VCHs (removal efficiency >98%). The volatilization process was described by an exponential kinetic function. In the early stage of treatment (0-7hr), rapid contaminant volatilization followed a pseudo-first order kinetic model. VCH concentrations decreased to low levels and showed a tailing phenomenon with very slow contaminant release after 8hr. Compared with silty and sandy soils, clayey soil has high organic-matter content, a large specific surface area, a high clay fraction, and a complex pore structure. These characteristics substantially influenced the removal process, making it less efficient, more time consuming, and consequently more expensive. Our findings provide a potential basis for optimizing soil remediation strategy in a cost-effective manner. Copyright © 2016. Published by Elsevier B.V.
A method of refining aromatic hydrocarbons from coal chemical production
Energy Technology Data Exchange (ETDEWEB)
Zieborak, K.; Koprowski, A.; Ratajczak, W.
1979-10-01
A method is disclosed for refining aromatic hydrocarbons of coal chemical production by contact of liquid aromatic hydrocarbons and their mixtures with a strongly acid macroporous sulfocationite in the H-form at atmospheric pressure and high temperature. The method is distinguished in that the aromatic hydrocarbons and their mixtures, from which alkali compounds have already been removed, are supplied for refinement with the sulfocationite with simultaneous addition of olefin derivatives of aromatic hydrocarbons, followed by separation of pure hydrocarbons by rectification. Styrene or alpha-methylstyrene is used as the olefin derivatives of the aromatic hydrocarbons. The method is performed in several stages with addition of olefin derivatives of aromatic hydrocarbons at each stage.
Process for recovery of liquid hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Millar, J.F.; Cockshott, J.E.
1978-04-11
Methane is recovered as a gas for discharge to a pipeline from a gas stream containing methane and heavier hydrocarbons, principally ethane and propane. Separation is accomplished by condensing the heavier hydrocarbons and distilling the methane therefrom. A liquid product (LPG) comprising the heavier hydrocarbons is subsequently recovered and transferred to storage. Prior to being discharged to a pipeline, the recovered methane gas is compressed and in undergoing compression the gas is heated. The heat content of the gas is employed to reboil the refrigerant in an absorption refrigeration unit. The refrigeration unit is used to cool the LPG prior to its storage.
Worldwide overview of hydrocarbons and perspectives
International Nuclear Information System (INIS)
Tonnac, Alain de; Perves, Jean-Pierre
2013-12-01
This publication presents and comments data regarding the share of hydrocarbons in the world energy consumption, hydrocarbon trade flows, the new situation created by the emergence of shale hydrocarbons and the consequences for the world economy, and possible risks. The authors first comment the evolution of energy consumption and outline that the objectives of CO 2 and greenhouse gas emission will not be reached (these emissions increased in 2012 and in 2013). They indicate the emission situation in the USA and Japan, and notice that the objectives defined by the IEA are quite different from those defined by the EU. They analyse the evolutions by distinguishing different periods: 2005-2008 as a reference period, 2008-2012 as a period of change, and the current period as a period of flow inversion. Then, the authors propose two different scenarios of evolution of economic and energy policies. The evolution of hydrocarbon demand is commented, and the levels of reserves (oil, conventional gas, coal, nuclear fuels) are discussed. The market evolution is also discussed, not only from an economic point of view, but also in relationship with geopolitics. The authors notably outline that the energy price is different from one country to the other, discuss the issue of hydrocarbon refining, the role of CO 2 tax
Hydrocarbon-degradation by Isolate Pseudomonas lundensis UTAR FPE2
Directory of Open Access Journals (Sweden)
Adeline, S. Y. Ting
2009-01-01
Full Text Available In this study, the potential of isolate Pseudomonas lundensis UTAR FPE2 as a hydrocarbon degrader was established. Their biodegradation activity was first detected with the formation of clearing zones on Bushnell-Hass agar plates, with the largest diameter observed on plates supplemented with paraffin, followed by mineral oil and petrol. Utilization of hydrocarbon sources were again detected in broth cultures supplemented with similar hydrocarbon substrates, where the mean viable cell count recovered from hydrocarbon-supplemented broth cultures were higher than the initial inoculum except for napthalene. In both tests, the isolate showed higher degradability towards aliphatic hydrocarbon sources, and the least activity towards the aromatic hydrocarbon naphthalene. The isolate P. lundensis UTAR FPE2 (8 log10 cfu/mL also degraded crude diesel sample, with 69% degradation during the first three days. To conclude, this study suggests the potential use of this isolate for bioremediation of hydrocarbon-contaminated environments.
Biogenic nonmethane hydrocarbon emissions estimated from tethered balloon observations
Davis, K. J.; Lenschow, D. H.; Zimmerman, P. R.
1994-01-01
A new technique for estimating surface fluxes of trace gases, the mixed-layer gradient technique, is used to calculate isoprene and terpene emissions from forests. The technique is applied to tethered balloon measurements made over the Amazon forest and a pine-oak forest in Alabama at altitudes up to 300 m. The observations were made during the dry season Amazon Boundary Layer Experiment (ABLE 2A) and the Rural Oxidants in the Southern Environment 1990 experiment (ROSE I). Results from large eddy simulations of scalar transport in the clear convective boundary layer are used to infer fluxes from the balloon profiles. Profiles from the Amazon give a mean daytime emission of 3630 +/- 1400 micrograms isoprene sq m/h, where the uncertainty represents the standard deviation of the mean of eight flux estimates. Twenty profiles from Alabama give emissions of 4470 +/- 3300 micrograms isoprene sq m/h, 1740 +/- 1060 micrograms alpha-pinene sq m/h, and 790 +/- 560 micrograms beta-pinene sq m/h, respectively. These results are in agreement with emissions derived from chemical budgets. The emissions may be overestimated because of uncertainty about how to incorporate the effects of the canopy on the mixed-layer gradients. The large variability in these emission estimates is probably due to the relatively short sampling times of the balloon profiles, though spatially heterogeneous emissions may also play a role. Fluxes derived using this technique are representative of an upwind footprint of several kilometers and are independent of hydrocarbon oxidation rate and mean advection.
Bioassay of polycyclic aromatic hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Van Kirk, E.A.
1980-08-01
A positive relationship was found between the photodynamic activity of 24 polycyclic aromatic hydrocarbons versus published results on the mutagenicity, carcinogenicity, and initiation of unscheduled DNA synthesis. Metabolic activation of benzo(a)pyrene resulted in detection of increased mutagenesis in Paramecium tetraurelia as found also in the Ames Salmonella assay. The utility of P. tetraurelia as a biological detector of hazardous polycyclic aromatic hydrocarbons is discussed.
Potential hydrocarbon producing species of Western Ghats, Tamil Nadu, India
Energy Technology Data Exchange (ETDEWEB)
Augustus, G.D.P.S.; Jayabalan, M.; Rajarathinam, K. [Research Centre in Bombay, V.H.N.S.N. College, Virudhunagar (India); Ray, A.K. [Sardar Patel Univ., Anand (India). Dept. of Chemistry; Seiler, G.J. [USDA, ARS, Northern Crop Science Lab., Fargo, ND (United States)
2002-09-01
The decline in the world supplies of hydrocarbons has led to the search for alternate sources of fuel and chemicals. Plant species are potential sources of hydrocarbons. Large-scale screening of plants growing in the Western Ghats, Tamil Nadu, India was conducted to assess the hydrocarbon production and the type of isoprene compound(s) present. Three species contained more than 3% hydrocarbon. Sarcostemma brevistigma had the highest concentration of hydrocarbon with 3.6%. Seven species contained more than 2% of hydrocarbons among the plant species screened. The hydrocarbon fraction of Ficus elastica (leaf) had a gross heat value of 9834 cal/g (41.17 MJ/kg), which is close to the caloric value of fuel oil. Six hydrocarbon fractions contained gross heat values of more than 9000 cal/g (37.68 MJ/kg). Of the 13 species hydrocarbon fraction analysed, seven species contained cis-polyisoprene compounds, while two species contained trans-polyisoprenes. Cis and trans polyisoprenes are potential alternative energy sources for fuel and/or as industrial raw materials. (author)
AD1995: NW Europe's hydrocarbon industry
International Nuclear Information System (INIS)
Glennie, K.; Hurst, A.
1996-01-01
This volume concerns itself with wide-ranging aspects of the upstream hydro-carbon industry over the whole of NW Europe. As such, the book contrasts with many thematic volumes by presenting a broad range of topics side-by-side. One section of the book looks back at the history of geological exploration and production, and provides an overview of hydrocarbon exploration across NW Europe. Another section covers the state of the art in hydrocarbon exploration and production. This includes an update on computer-based basin modelling overpressure systems, innovations in reservoir engineering and reserve estimation, 3D seismic and the geochemical aspects of secondary migration. The final section of the book takes a look into the future. This covers the remaining hydrocarbon resources of the North Sea, managing risk in oil field development, oil field economics, and pollution and the environment. It is the editors' hope that several key areas of NW Europe's upstream oil industry have been usefully summarized in the volume. (Author)
Enrichment of light hydrocarbon mixture
Yang,; Dali, [Los Alamos, NM; Devlin, David [Santa Fe, NM; Barbero, Robert S [Santa Cruz, NM; Carrera, Martin E [Naperville, IL; Colling, Craig W [Warrenville, IL
2010-08-10
Light hydrocarbon enrichment is accomplished using a vertically oriented distillation column having a plurality of vertically oriented, nonselective micro/mesoporous hollow fibers. Vapor having, for example, both propylene and propane is sent upward through the distillation column in between the hollow fibers. Vapor exits neat the top of the column and is condensed to form a liquid phase that is directed back downward through the lumen of the hollow fibers. As vapor continues to ascend and liquid continues to countercurrently descend, the liquid at the bottom of the column becomes enriched in a higher boiling point, light hydrocarbon (propane, for example) and the vapor at the top becomes enriched in a lower boiling point light hydrocarbon (propylene, for example). The hollow fiber becomes wetted with liquid during the process.
Energy Technology Data Exchange (ETDEWEB)
Dunstan, A E
1918-06-03
Ligroin, kerosene, and other distillates from petroleum and shale oil, are purified by treatment with a solution of a hypochlorite containing an excess of alkali. The hydrocarbon may be poured into brine, the mixture stirred, and an electric current passed through. Heat may be applied.
Directory of Open Access Journals (Sweden)
Noemí Araceli Rivera Casado
Full Text Available The effect of recalcitrant hydrocarbons on the fatty acid profile from leaf, basal corm, and roots of Cyperus laxus plants cultivated in greenhouse phytoremediation systems of soils from aged oil spill-impacted sites containing from 16 to 340 g/Kg total hydrocarbons (THC was assessed to investigate if this is a C18:3 species and if the hydrocarbon removal during the phytoremediation process has a relationship with the fatty acid profile of this plant. The fatty acid profile was specific to each vegetative organ and was strongly affected by the hydrocarbons level in the impacted sites. Leaf extracts of plants from uncontaminated soil produced palmitic acid (C16, octadecanoic acid (C18:0, unsaturated oleic acids (C18:1-C18:3, and unsaturated eichosanoic (C20:2-C20:3 acids with a noticeable absence of the unsaturated hexadecatrienoic acid (C16:3; this finding demonstrates, for the first time, that C. laxus is a C18:3 plant. In plants from the phytoremediation systems, the total fatty acid contents in the leaf and the corm were negatively affected by the hydrocarbons presence; however, the effect was positive in root. Interestingly, under contaminated conditions, unusual fatty acids such as odd numbered carbons (C15, C17, C21, and C23 and uncommon unsaturated chains (C20:3n6 and C20:4 were produced together with a remarkable quantity of C22:2 and C24:0 chains in the corm and the leaf. These results demonstrate that weathered hydrocarbons may drastically affect the lipidic composition of C. laxus at the fatty acid level, suggesting that this species adjusts the cover lipid composition in its vegetative organs, mainly in roots, in response to the weathered hydrocarbon presence and uptake during the phytoremediation process.
Montes Horcasitas, María del Carmen; Rodríguez Vázquez, Refugio; Esparza García, Fernando José; Pérez Vargas, Josefina; Ariza Castolo, Armando; Ferrera-Cerrato, Ronald; Gómez Guzmán, Octavio
2015-01-01
The effect of recalcitrant hydrocarbons on the fatty acid profile from leaf, basal corm, and roots of Cyperus laxus plants cultivated in greenhouse phytoremediation systems of soils from aged oil spill-impacted sites containing from 16 to 340 g/Kg total hydrocarbons (THC) was assessed to investigate if this is a C18:3 species and if the hydrocarbon removal during the phytoremediation process has a relationship with the fatty acid profile of this plant. The fatty acid profile was specific to each vegetative organ and was strongly affected by the hydrocarbons level in the impacted sites. Leaf extracts of plants from uncontaminated soil produced palmitic acid (C16), octadecanoic acid (C18:0), unsaturated oleic acids (C18:1-C18:3), and unsaturated eichosanoic (C20:2-C20:3) acids with a noticeable absence of the unsaturated hexadecatrienoic acid (C16:3); this finding demonstrates, for the first time, that C. laxus is a C18:3 plant. In plants from the phytoremediation systems, the total fatty acid contents in the leaf and the corm were negatively affected by the hydrocarbons presence; however, the effect was positive in root. Interestingly, under contaminated conditions, unusual fatty acids such as odd numbered carbons (C15, C17, C21, and C23) and uncommon unsaturated chains (C20:3n6 and C20:4) were produced together with a remarkable quantity of C22:2 and C24:0 chains in the corm and the leaf. These results demonstrate that weathered hydrocarbons may drastically affect the lipidic composition of C. laxus at the fatty acid level, suggesting that this species adjusts the cover lipid composition in its vegetative organs, mainly in roots, in response to the weathered hydrocarbon presence and uptake during the phytoremediation process. PMID:26473488
Rivera Casado, Noemí Araceli; Montes Horcasitas, María del Carmen; Rodríguez Vázquez, Refugio; Esparza García, Fernando José; Pérez Vargas, Josefina; Ariza Castolo, Armando; Ferrera-Cerrato, Ronald; Gómez Guzmán, Octavio; Calva Calva, Graciano
2015-01-01
The effect of recalcitrant hydrocarbons on the fatty acid profile from leaf, basal corm, and roots of Cyperus laxus plants cultivated in greenhouse phytoremediation systems of soils from aged oil spill-impacted sites containing from 16 to 340 g/Kg total hydrocarbons (THC) was assessed to investigate if this is a C18:3 species and if the hydrocarbon removal during the phytoremediation process has a relationship with the fatty acid profile of this plant. The fatty acid profile was specific to each vegetative organ and was strongly affected by the hydrocarbons level in the impacted sites. Leaf extracts of plants from uncontaminated soil produced palmitic acid (C16), octadecanoic acid (C18:0), unsaturated oleic acids (C18:1-C18:3), and unsaturated eichosanoic (C20:2-C20:3) acids with a noticeable absence of the unsaturated hexadecatrienoic acid (C16:3); this finding demonstrates, for the first time, that C. laxus is a C18:3 plant. In plants from the phytoremediation systems, the total fatty acid contents in the leaf and the corm were negatively affected by the hydrocarbons presence; however, the effect was positive in root. Interestingly, under contaminated conditions, unusual fatty acids such as odd numbered carbons (C15, C17, C21, and C23) and uncommon unsaturated chains (C20:3n6 and C20:4) were produced together with a remarkable quantity of C22:2 and C24:0 chains in the corm and the leaf. These results demonstrate that weathered hydrocarbons may drastically affect the lipidic composition of C. laxus at the fatty acid level, suggesting that this species adjusts the cover lipid composition in its vegetative organs, mainly in roots, in response to the weathered hydrocarbon presence and uptake during the phytoremediation process.
Dominierende Prozesse bei der thermischen In-situ-Sanierung (TISS) kontaminierter Geringleiter
Hiester, Uwe; Bieber, Laura
2017-09-01
Contaminants such as chlorinated, aromatic or polycyclic aromatic hydrocarbons (CHC, BTEX, PAH) or mineral oil hydrocarbons (TPH) constitute a prevalent threat to water resources. The significant storage capacity of low permeable soils (aquitards) leads to their long-term contamination. In situ thermal remediation (ISTR) proved to work successfully in treating these soils. Thus, the area of ISTR application grew continuously over the past 10 years. The dominating processes during the remediation can vary considerably, depending on hydrogeological and geological boundary conditions and the contamination itself. This article summarizes the application for in-situ thermal remediation (ISTR) in low permeable soils and aquitards for soil and groundwater treatment. Dominating remediation processes during volatile organic compound (VOC) and residual oil phase recovery are presented. The processes are illustrated by project examples.
Culture-dependent characterization of hydrocarbon utilizing bacteria ...
African Journals Online (AJOL)
EARNEST
Hydrocarbons interact with the environment and micro- organisms determining the .... it is pertinent to study the community dynamics of hydrocarbon degrading bacteria ... Chikere CB (2013). Application of molecular microbiology techniques in.
Identifying future directions for subsurface hydrocarbon migration research
Leifer, I.; Clark, J. F.; Luyendyk, B.; Valentine, D.
Subsurface hydrocarbon migration is important for understanding the input and impacts of natural hydrocarbon seepage on the environment. Great uncertainties remain in most aspects of hydrocarbon migration, including some basic mechanisms of this four-phase flow of tar, oil, water, and gas through the complex fracture-network geometry particularly since the phases span a wide range of properties. Academic, government, and industry representatives recently attended a workshop to identify the areas of greatest need for future research in shallow hydrocarbon migration.Novel approaches such as studying temporal and spatial seepage variations and analogous geofluid systems (e.g., geysers and trickle beds) allow deductions of subsurface processes and structures that remain largely unclear. Unique complexities exist in hydrocarbon migration due to its multiphase flow and complex geometry, including in-situ biological weathering. Furthermore, many aspects of the role of hydrocarbons (positive and negative) in the environment are poorly understood, including how they enter the food chain (respiration, consumption, etc.) and “percolate” to higher trophic levels. But understanding these ecological impacts requires knowledge of the emissions' temporal and spatial variability and trajectories.
33 CFR 157.166 - Hydrocarbon emissions.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hydrocarbon emissions. 157.166 Section 157.166 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... Crude Oil Washing (COW) System on Tank Vessels Cow Operations § 157.166 Hydrocarbon emissions. If the...
Jung, Hee Jae; Kim, Young Seok; Kim, Sang Gyune; Lee, Yun Nah; Jeong, Soung Won; Jang, Jae Young; Lee, Sae Hwan; Kim, Hong Soo; Kim, Boo Sung
2014-03-01
Lipid profile and insulin resistance (IR) are associated with hepatitis C virus (HCV) and may predict the chronic hepatitis C (CHC) treatment response. The aim of this study was to determine the association between CHC treatment response and lipid profile and IR change during treatment. In total, 203 CHC patients were reviewed retrospectively between January 2005 and December 2011 at Soon Chun Hyang University Hospital. The lipid profile, homeostasis model for assessment (HOMA) of IR (HOMA-IR), and HOMA of β cells (HOMA-β) were evaluated before interferon plus ribavirin therapy (BTx), at the end of treatment (DTx), and 24 weeks after the end of treatment (ATx). A sustained virologic response (SVR) was achieved by 81% of all patients (49/60), 60% (n=36) of whom possessed genotype 1, with the remainder being non-genotype-1 (40%, n=24). Apart from age, which was significantly higher in the non-SVR group (SVR, 48.0 ± 11.2 years, mean ± SD; non-SVR, 56.6 ± 9.9 years; PC) had significantly changed at DTx and ATx compared to BTx. In addition, HOMA-IR and HOMA-β were significantly changed at DTx in the SVR group. Among those with a high baseline insulin resistance (HOMA-IR >2.5), HOMA-IR was significantly changed at DTx in the SVR group. LDL-C appears to be associated with HCV treatment in SVR patients. Furthermore, eradication of HCV may improve whole-body IR and insulin hypersecretion, as well as high baseline insulin resistance (HOMA-IR >2.5).
Hydrocarbon removal with constructed wetlands
Eke, Paul Emeka
2008-01-01
Wetlands have long played a significant role as natural purification systems, and have been effectively used to treat domestic, agricultural and industrial wastewater. However, very little is known about the biochemical processes involved, and the use of constructed treatment wetlands in the removal of petroleum aromatic hydrocarbons from produced and/or processed water. Wastewaters from the oil industry contain aromatic hydrocarbons such as benzene, toluene, ethylbenzene and x...
Performance estimation of ejector cycles using heavier hydrocarbon refrigerants
International Nuclear Information System (INIS)
Kasperski, Jacek; Gil, Bartosz
2014-01-01
Computer software basing on theoretical model of Huang et al. with thermodynamic properties of hydrocarbons was prepared. Investigation was focused on nine hydrocarbons: propane, butane, iso-butane, pentane, iso-pentane, hexane, heptane and octane. A series of calculations was carried out for the generator temperature between 70 and 200 °C, with assumed temperatures of evaporation 10 °C and condensation 40 °C. Calculation results show that none of the hydrocarbons enables high efficiency of a cycle in a wide range of temperature. Each hydrocarbon has its own maximal entrainment ratio at its individual temperature of optimum. Temperatures of entrainment ratios optimum increase according to the hydrocarbon heaviness with simultaneous increase of entrainment ratio peak values. Peak values of the COP do not increase according to the hydrocarbons heaviness. The highest COP = 0.32 is achieved for iso-butane at 102 °C and the COP = 0.28 for pentane at 165 °C. Heptane and octane can be ignored. - Highlights: • Advantages of use of higher hydrocarbons as ejector refrigerants were presumed. • Computer software basing on theoretical model of Huang et al. (1999) was prepared. • Optimal temperature range of vapor generation for each hydrocarbon was calculated
Polycyclic’ Aromatic Hydrocarbon Induced Intracellular Signaling and Lymphocyte Apoptosis
DEFF Research Database (Denmark)
Schneider, Alexander M.
The aryl hydrocarbon (dioxin) receptor (AhR) is a transcription factor possessing high affinity to potent environmental pollutants, polycyclic aromatic hydrocarbons (PAH) and related halogenated hydrocarbons (e.g. dioxins). Numerous research attribute toxicity of these compounds to the receptor...
Directory of Open Access Journals (Sweden)
Markowicz Anna
2016-12-01
Full Text Available The impacts of long-term polycyclic aromatic hydrocarbons (PAHs and heavy metal pollution on soil microbial communities functioning were studied in soils taken from an old coke plant. The concentrations of PAHs in the tested soils ranged from 171 to 2137 mg kg-1. From the group of tested heavy metals, concentrations of lead were found to be the highest, ranging from 57 to 3478 mg kg-1, while zinc concentrations varied from 247 to 704 mg kg-1 and nickel from 10 to 666 mg kg-1. High dehydrogenase, acid and alkaline phosphatase activities were observed in the most contaminated soil. This may indicate bacterial adaptation to long-term heavy metal and hydrocarbon contamination. However, the Community Level Physiological Profiles (CLPPs analysis showed that the microbial functional diversity was reduced and influenced to a higher extent by some metals (Pb, Ni, moisture and conductivity than by PAHs.
International Nuclear Information System (INIS)
Whitfield Åslund, Melissa; Stephenson, Gladys L.; Simpson, André J.; Simpson, Myrna J.
2013-01-01
1 H NMR metabolomics and conventional ecotoxicity endpoints were used to examine the response of earthworms exposed to petroleum hydrocarbons (PHCs) in soil samples collected from a site that was contaminated with crude oil from a pipeline failure in the mid-1990s. The conventional ecotoxicity tests showed that the soils were not acutely toxic to earthworms (average survival ≥90%), but some soil samples impaired reproduction endpoints by >50% compared to the field control soil. Additionally, metabolomics revealed significant relationships between earthworm metabolic profiles (collected after 2 or 14 days of exposure) and soil properties including soil PHC concentration. Further comparisons by partial least squares regression revealed a significant relationship between the earthworm metabolomic data (collected after only 2 or 14 days) and the reproduction endpoints (measured after 63 days). Therefore, metabolomic responses measured after short exposure periods may be predictive of chronic, ecologically relevant toxicity endpoints for earthworms exposed to soil contaminants. -- Highlights: •Earthworm response to petroleum hydrocarbon exposure in soil is examined. •Metabolomics shows significant changes to metabolic profile after 2 days. •Significant relationships observed between metabolomic and reproduction endpoints. •Metabolomics may have value as a rapid screening tool for chronic toxicity. -- Earthworm metabolomic responses measured after 2 and 14 days are compared to traditional earthworm ecotoxicity endpoints (survival and reproduction) in petroleum hydrocarbon contaminated soil
Luong, J; Gras, R; Shellie, R A; Cortes, H J
2013-07-05
The detection of sulfur compounds in different hydrocarbon matrices, from light hydrocarbon feedstocks to medium synthetic crude oil feeds provides meaningful information for optimization of refining processes as well as demonstration of compliance with petroleum product specifications. With the incorporation of planar microfluidic devices in a novel chromatographic configuration, sulfur compounds from hydrogen sulfide to alkyl dibenzothiophenes and heavier distributions of sulfur compounds over a wide range of matrices spanning across a boiling point range of more than 650°C can be characterized, using one single analytical configuration in less than 25min. In tandem with a sulfur chemiluminescence detector for sulfur analysis is a flame ionization detector. The flame ionization detector can be used to establish the boiling point range of the sulfur compounds in various hydrocarbon fractions for elemental specific simulated distillation analysis as well as profiling the hydrocarbon matrices for process optimization. Repeatability of less than 3% RSD (n=20) over a range of 0.5-1000 parts per million (v/v) was obtained with a limit of detection of 50 parts per billion and a linear range of 0.5-1000 parts per million with a correlation co-efficient of 0.998. Copyright © 2013 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
1952-10-24
A method is described for the production of unsaturated gaseous hydrocarbons, in particular of ethylene, and of aromatic hydrocarbons from hydrocarbon oils or from fractions of the same, characterized by the fact that the raw materials are brought into contact with porous, inert substances in the form of fine distribution or of pieces at a temperature of above 500 and in particular from 600 to about 700/sup 0/C and with a traversing speed of from 0.3 up to about 3.0 volumetric parts, preferably up to 1.5 volumetric parts of raw material per volumetric part of the chamber and per hour.
Catalytic conversion of alcohols to hydrocarbons with low benzene content
Energy Technology Data Exchange (ETDEWEB)
Narula, Chaitanya K.; Davison, Brian H.; Keller, Martin
2016-03-08
A method for converting an alcohol to a hydrocarbon fraction having a lowered benzene content, the method comprising: converting said alcohol to a hydrocarbon fraction by contacting said alcohol, under conditions suitable for converting said alcohol to said hydrocarbon fraction, with a metal-loaded zeolite catalyst catalytically active for converting said alcohol to said hydrocarbon fraction, and contacting said hydrocarbon fraction with a benzene alkylation catalyst, under conditions suitable for alkylating benzene, to form alkylated benzene product in said hydrocarbon fraction. Also described is a catalyst composition useful in the method, comprising a mixture of (i) a metal-loaded zeolite catalyst catalytically active for converting said alcohol to said hydrocarbon, and (ii) a benzene alkylation catalyst, in which (i) and (ii) may be in a mixed or separated state. A reactor for housing the catalyst and conducting the reaction is also described.
Catalytic conversion of alcohols to hydrocarbons with low benzene content
Energy Technology Data Exchange (ETDEWEB)
Narula, Chaitanya K.; Davison, Brian H.; Keller, Martin
2016-09-06
A method for converting an alcohol to a hydrocarbon fraction having a lowered benzene content, the method comprising: converting said alcohol to a hydrocarbon fraction by contacting said alcohol, under conditions suitable for converting said alcohol to said hydrocarbon fraction, with a metal-loaded zeolite catalyst catalytically active for converting said alcohol to said hydrocarbon fraction, and contacting said hydrocarbon fraction with a benzene alkylation catalyst, under conditions suitable for alkylating benzene, to form alkylated benzene product in said hydrocarbon fraction. Also described is a catalyst composition useful in the method, comprising a mixture of (i) a metal-loaded zeolite catalyst catalytically active for converting said alcohol to said hydrocarbon, and (ii) a benzene alkylation catalyst, in which (i) and (ii) may be in a mixed or separated state. A reactor for housing the catalyst and conducting the reaction is also described.
Directory of Open Access Journals (Sweden)
Jean-Francois Ferveur
2018-02-01
Full Text Available Background The insect cuticle covers the whole body and all appendages and has bi-directionnal selective permeability: it protects against environmental stress and pathogen infection and also helps to reduce water loss. The adult cuticle is often associated with a superficial layer of fatty acid-derived molecules such as waxes and long chain hydrocarbons that prevent rapid dehydration. The waterproofing properties of cuticular hydrocarbons (CHs depend on their chain length and desaturation number. Drosophila CH biosynthesis involves an enzymatic pathway including several elongase and desaturase enzymes. Methods The link between desiccation resistance and CH profile remains unclear, so we tested (1 experimentally selected desiccation-resistant lines, (2 transgenic flies with altered desaturase expression and (3 natural and laboratory-induced CH variants. We also explored the possible relationship between desiccation resistance, relative water content and fecundity in females. Results We found that increased desiccation resistance is linked with the increased proportion of desaturated CHs, but not with their total amount. Experimentally-induced desiccation resistance and CH variation both remained stable after many generations without selection. Conversely, flies with a higher water content and a lower proportion of desaturated CHs showed reduced desiccation resistance. This was also the case in flies with defective desaturase expression in the fat body. Discussion We conclude that rapidly acquired desiccation resistance, depending on both CH profile and water content, can remain stable without selection in a humid environment. These three phenotypes, which might be expected to show a simple relationship, turn out to have complex physiological and genetic links.
Methods for reformation of gaseous hydrocarbons using electrical discharge
Cha, Min Suk
2017-02-16
Methods for the reformation of gaseous hydrocarbons are provided. The methods can include forming a bubble containing the gaseous hydrocarbon in a liquid. The bubble can be generated to pass in a gap between a pair of electrodes, whereby an electrical discharge is generated in the bubble at the gap between the electrodes. The electrodes can be a metal or metal alloy with a high melting point so they can sustain high voltages of up to about 200 kilovolts. The gaseous hydrocarbon can be combined with an additive gas such as molecular oxygen or carbon dioxide. The reformation of the gaseous hydrocarbon can produce mixtures containing one or more of H2, CO, H2O, CO2, and a lower hydrocarbon such as ethane or ethylene. The reformation of the gaseous hydrocarbon can produce low amounts of CO2 and H2O, e.g. about 15 mol-% or less.
Methods for reformation of gaseous hydrocarbons using electrical discharge
Cha, Min; Zhang, Xuming
2017-01-01
Methods for the reformation of gaseous hydrocarbons are provided. The methods can include forming a bubble containing the gaseous hydrocarbon in a liquid. The bubble can be generated to pass in a gap between a pair of electrodes, whereby an electrical discharge is generated in the bubble at the gap between the electrodes. The electrodes can be a metal or metal alloy with a high melting point so they can sustain high voltages of up to about 200 kilovolts. The gaseous hydrocarbon can be combined with an additive gas such as molecular oxygen or carbon dioxide. The reformation of the gaseous hydrocarbon can produce mixtures containing one or more of H2, CO, H2O, CO2, and a lower hydrocarbon such as ethane or ethylene. The reformation of the gaseous hydrocarbon can produce low amounts of CO2 and H2O, e.g. about 15 mol-% or less.
Noel , Cécile; Gourry , Jean-Christophe; Deparis , Jacques; Blessing , Michaela; Ignatiadis , Ioannis; Guimbaud , Christophe
2016-01-01
International audience; Hydrocarbon-contaminated aquifers can be successfully remediated through enhanced biodegradation. However, in situ monitoring of the treatment by piezometers is expensive and invasive and might be insufficient as the information provided is restricted to vertical profiles at discrete locations. An alternative method was tested in order to improve the robustness of the monitoring. Geophysical methods, electrical resistivity (ER) and induced polarization (IP), were combi...
Bioremediation of Petroleum Hydrocarbon Contaminated Sites
Energy Technology Data Exchange (ETDEWEB)
Fallgren, Paul
2009-03-30
Bioremediation has been widely applied in the restoration of petroleum hydrocarbon-contaminated. Parameters that may affect the rate and efficiency of biodegradation include temperature, moisture, salinity, nutrient availability, microbial species, and type and concentration of contaminants. Other factors can also affect the success of the bioremediation treatment of contaminants, such as climatic conditions, soil type, soil permeability, contaminant distribution and concentration, and drainage. Western Research Institute in conjunction with TechLink Environmental, Inc. and the U.S. Department of Energy conducted laboratory studies to evaluate major parameters that contribute to the bioremediation of petroleum-contaminated drill cuttings using land farming and to develop a biotreatment cell to expedite biodegradation of hydrocarbons. Physical characteristics such as soil texture, hydraulic conductivity, and water retention were determined for the petroleum hydrocarbon contaminated soil. Soil texture was determined to be loamy sand to sand, and high hydraulic conductivity and low water retention was observed. Temperature appeared to have the greatest influence on biodegradation rates where high temperatures (>50 C) favored biodegradation. High nitrogen content in the form of ammonium enhanced biodegradation as well did the presence of water near field water holding capacity. Urea was not a good source of nitrogen and has detrimental effects for bioremediation for this site soil. Artificial sea water had little effect on biodegradation rates, but biodegradation rates decreased after increasing the concentrations of salts. Biotreatment cell (biocell) tests demonstrated hydrocarbon biodegradation can be enhanced substantially when utilizing a leachate recirculation design where a 72% reduction of hydrocarbon concentration was observed with a 72-h period at a treatment temperature of 50 C. Overall, this study demonstrates the investigation of the effects of
Degradation of petroleum hydrocarbons in a laboratory aquifer column
International Nuclear Information System (INIS)
Billowits, M.; Whyte, L.; Greer, C.; Ramsay, J.
1998-01-01
One of the primary mechanisms for eliminating hydrocarbon pollutants from the environment is degradation of hydrocarbons by indigenous microorganisms. This report describes a study in which samples from a petroleum polluted shallow aquifer in the Yukon were used which contained a hundred times greater concentration of psychrotropic bacteria than mesophilic bacteria. Results showed a maximum degradation of 47 per cent of the total petroleum hydrocarbon in columns which simulated the aquifer conditions and to which nutrients were added. It was concluded that although in this case bioaugmentation of the columns with a psychrotropic hydrocarbon-degrading consortium increased microbial numbers, total petroleum hydrocarbon degradation was not much greater than could be achieved by remediation with nutrients alone
Hydrocarbons in Argentina: networks, territories, integration
International Nuclear Information System (INIS)
Carrizo, S.C.
2003-12-01
Argentinean hydrocarbons networks have lived a huge reorganizing the structure, after the State reform in the 90's. Activities deregulation and the privatization of YPF and Gas del Estado forced the sector re-concentration, since then dominated by foreign companies, leaded by Repsol YPF. The hydrocarbons federalization contributed to the weakening and un-capitalization loss of wealth of the State. These changes resulted in an increase of the hydrocarbons production allowing to achieve the self-supply. Nevertheless, the expansion of internal networks has not been large enough to ensure the coverage of new requirements. Besides, several infrastructures have been built up to join external markets. National networks are connected to those of near neighboring countries. This integration is an opportunity for the 'South Cone' countries to enhance their potentials. In the country, hydrocarbons territories undergo the reorganizing the structure effects (unemployment, loss of territorial identity, etc). With many difficulties and very different possibilities, those territories, like Comodoro Rivadavia, Ensenada et and Bahia Blanca, look for their re-invention. (author)
Bioremediation in soil contaminated with hydrocarbons in Colombia.
María Alejandra Trujillo Toro; Juan Fernando Ramírez Quirama
2012-01-01
This study analyzes bioremediation processes of hydrocarbon contaminated soils in Colombia as a sustainable alternative to the deterioration of environmental quality by hydrocarbon spillage. According to national and international environmental law, all waste contaminated with hydrocarbons is considered dangerous waste, and therefore it cannot be released in the ground, water or be incinerated. Such legislation has motivated companies around the world to implement treatment processes for cont...
Eroglu, Ela; Okada, Shigeru; Melis, Anastasios
2011-08-01
Six different strains of the green microalgae Botryococcus belonging to the A-race or B-race, accumulating alkadiene or botryococcene hydrocarbons, respectively, were compared for biomass and hydrocarbon productivities. Biomass productivity was assessed gravimetrically upon strain growth in the laboratory under defined conditions. Hydrocarbon productivities were measured by three different and independent experimental approaches, including density equilibrium of the intact cells and micro-colonies, spectrophotometric analysis of hydrocarbon extracts, and gravimetric quantitation of eluted hydrocarbons. All three hydrocarbon-quantitation methods yielded similar results for each of the strains examined. The B-race microalgae Botryococcus braunii var. Showa and Kawaguchi-1 constitutively accumulated botryococcene hydrocarbons equivalent to 30% and 20%, respectively, of their overall biomass. The A-race microalgae Botryococcus braunii, varieties Yamanaka, UTEX 2441 and UTEX LB572 constitutively accumulated alkadiene hydrocarbons ranging from 14% to 13% and 10% of their overall biomass, respectively. Botryococcus sudeticus (UTEX 2629), a morphologically different green microalga, had the lowest hydrocarbon accumulation, equal to about 3% of its overall biomass. Results validate the density equilibrium and spectrophotometric analysis methods in the quantitation of botryococcene-type hydrocarbons. These analytical advances will serve in the screening and selection of B. braunii and of other microalgae in efforts to identify those having a high hydrocarbon content for use in commercial applications.
Radiation-induced volatile hydrocarbon production in platelets
International Nuclear Information System (INIS)
Radha, E.; Vaishnav, Y.N.; Kumar, K.S.; Weiss, J.F.
1989-01-01
Generation of volatile hydrocarbons (ethane, pentane) as a measure of lipid peroxidation was followed in preparations from platelet-rich plasma irradiated in vitro. The hydrocarbons in the headspace of sealed vials containing irradiated and nonirradiated washed platelets, platelet-rich plasma, or platelet-poor plasma increased with time. The major hydrocarbon, pentane, increased linearly and significantly with increasing log radiation dose, suggesting that reactive oxygen species induced by ionizing radiation result in lipid peroxidation. Measurements of lipid peroxidation products may give an indication of suboptimal quality of stored and/or irradiated platelets
Waste Plastic Converting into Hydrocarbon Fuel Materials
Energy Technology Data Exchange (ETDEWEB)
Sarker, Moinuddin; Mamunor Rashid, Mohammad; Molla, Mohammad
2010-09-15
The increased demand and high prices for energy sources are driving efforts to convert organic compounds into useful hydrocarbon fuels. Although much of this work has focused on biomass, there are strong benefits to deriving fuels from waste plastic material. Natural State Research Inc. (NSR) has invented a simple and economically viable process to decompose the hydrocarbon polymers of waste plastic into the shorter chain hydrocarbon of liquid fuel (patent pending). The method and principle of the production / process will be discussed. Initial tests with several widely used polymers indicate a high potential for commercialization.
Conversion of hydrocarbon oils into motor fuels
Energy Technology Data Exchange (ETDEWEB)
1937-11-09
The abstract describes a process for producing lower boiling hydrocarbon motor fuels with a starting material of wide boiling range composed primarily of hydrocarbon oils boiling substantially above the boiling range of the desired product. Separate catalytic and pyrolytic conversion zones are simultaneously maintained in an interdependent relationship. Higher boiling constituents are separated from residual constituents by fractionation while desirable reaction conditions are maintained. All or at least a portion of the products from the catalytic and pyrolytic conversion zones are blended to yield the desired lower boiling hydrocarbons or motor fuels.
Determination of polycyclic aromatic hydrocarbons in airborne
International Nuclear Information System (INIS)
Pachon Q, Jorge; Garcia L, Hector; Bustos L, Martha; Bravo A, Humberto; Sosa E, Rodolfo
2004-01-01
Rainfall polycyclic aromatic hydrocarbons (PAH) concentrations were determined in particulate matter with a <10 mm aerodynamic diameter (PM10) in three industrial municipalities of the metropolitan zone of Bogota City (MZBC). The 12 samples of greatest concentration of PM10 collected between 2001 and 2002 at the stations of atmospheric monitoring of Cundinamarca secretary of health (SSC), in the municipalities of Soacha, Sibate and Cajica, were analyzed. The results were correlated with emissions in the area, by means of emission factors and environmental agencies information. The particulate matter results for the analyzed period show concentrations that exceed the air quality standard of the US environmental protection agency EPA on several occasions at the Soacha municipality, whereas the air quality in the Sibate and Cajica municipalities did not show that to be the case. Despite the reduced number of samples and sampling sites, we believe that the reported profiles can be considered a valid estimation of the average air quality of the MZBC. The identified PAH species were: phenanthrene(Phe), anthracene(Ant), fluoranthene(Fla), pyrene(Pyr), benzo(a)anthracene (Baa), chrysene(chr), benzo(ghi)perylene(BgP) and indeno(1,2,3-cd)pyrene(Ind). It was not possible to quantify naphthalene (Nap), acenaphthy-lene(Acy), acenaphthene(Ace), nor fluorene(Flu), being light and volatile hydrocarbons with greater presence in the gaseous phase of the air. The correlation of PAH with source emissions shows mobile sources to be the main origin. The intervals of concentration of both individual PAH and the total species were similar to the ones usually found in other industrial zones of the world. PAHs correlations allowed pinpointing common emission sources between Soacha and Sibate municipalities
Energy Technology Data Exchange (ETDEWEB)
Turner, C
1917-11-23
In the fractional or destructive distillation of hydrocarbon oils or other liquids, the pressure in the still is raised and lowered alternately. The still is closed to raise the pressure, and is opened to lower the pressure rapidly solely by expansion of the vapors. The operation is effected without intermittent cooling, except such as may occur during the lowering of the pressure. In distilling hydrocarbon oil, pressure steam is blown into the oil until the pressure reaches 5 lb/in./sup 2/. The vapor outlet is then opened until the pressure falls to 2 lb/in./sup 2/, whereupon the vapor outlet is closed and steam is again admitted. The operation is continued until the steam, which is of 20 lb pressure, no longer effects distillation; after this stage, superheated steam is used.
Wang, J.; Bovee, T.F.H.; Bi, Y.; Bernhöft, S.; Schramm, K.W.
2014-01-01
Two types of biological tests were employed for monitoring the toxicological profile of sediment cores in the Three Gorges Reservoir (TGR), China. In the present study, sediments collected in June 2010 from TGR were analyzed for estrogen receptor (ER)- and aryl hydrocarbon receptor (AhR)-mediated
Petroleum hydrocarbon assessment in the sediments of the northeastern Havana littoral, Cuba
Energy Technology Data Exchange (ETDEWEB)
Companioni Dams, Eloy Yordad; Nunez Clemente, Ana Catalina; Cora Medina, Miriam Odette [Laboratorio de Quimica Ambiental, Centro de Investigaciones del Petroleo, Habana (Cuba)]. E-mail: elocompa@yahoo.com; Gonzalez Brovo, Luis [Centro de Aplicaciones Tecnologicas y Desarrollo Nuclear, Habana, (Cuba); Marbot Ramada, Rolando [Laboratorio de Quimica Analitica, Centro de Investigaciones del Petroleo, Habana (Cuba); Montes de Oca Porto, Rodny [Laboratorio Antidoping, Habana (Cuba); Rosabal Rodriguez, Maikel [Centro de Ingenieria y Manejo Ambiental de Bahias y Costas, Habana (Cuba); Diaz Diaz, Miguel angel [Laboratorio de Quimica Ambiental, Centro de Investigaciones del Petroleo, Habana (Cuba)
2009-02-15
As a part of a geochemical study, aliphatic and aromatic hydrocarbons were determined in surficial sediments, from a Cuban coastal zone located in the Northeastern Havana Littoral. Sediment samples were collected at 15 sites in this area, and then extracted and analyzed by gas chromatography with flame ionization and mass spectrometry detectors. Total concentration of both, aliphatic (AH) and aromatic (ArH) hydrocarbons, varied from 2.4 {+-} 0.2 to 105.1 {+-} 5.9 {mu}g/g (dry weight) and from 1.1 {+-} 0.2 to 38.4 {+-} 7.6 {mu}g/g (dry weight), respectively. The chromatography profile of AH was dominated by an unresolved complex mixture (UCM), and the presence of isoprenoid hydrocarbons, steranes and hopanes, indicated petroleum - related hydrocarbon inputs. The predominant concentration of phytoplanktonic molecular markers (pristane and nC17) in collected sediments, revealed the marine productivity in this sites. The anthropogenic contribution detected showed the impact of the petroleum exploration along this coastal area. [Spanish] Como parte de un estudio geoquimico se determinaron hidrocarburos alifaticos y aromaticos en sedimentos superficiales, de una zona costera situada en el Litoral Nordeste de La Habana. Las muestras de sedimento se colectaron en 15 estaciones de muestreo en esta area, y posteriormente se extrajeron y analizaron mediante cromatografia gaseosa con detectores de ionizacion a la llama y espectrometria de masas. Las concentraciones totales de hidrocarburos alifaticos (HA) e hidrocarburos aromaticos (HAr) variaron desde 2.4 {+-} 0.2 a 105.1 {+-} 5.9 {mu}g/g (peso eco) y desde 1.1 {+-} 0.2 a 38.4 {+-} 7.6 {mu}g/g (peso eco), respectivamente. El perfil cromatografico de los hidrocarburos alifaticos estuvo dominado por una mezcla compleja no resuelta (MCNR), y la presencia de hidrocarburos isoprenoides, esteranos y hopanos, indico el aporte de hidrocarburos derivados del petroleo. La concentracion predominante de marcadores moleculares
Primary biodegradation of petroleum hydrocarbons in seawater
Energy Technology Data Exchange (ETDEWEB)
Comber, M.I.H.; Den Haan, K.H.; Djemel, N.; Eadsforth, C.V.; King, D.; Paumen, M.L.; Parkerton, T.; Dmytrasz, B.
2012-12-15
This report describes primary biodegradation experiments performed to determine the persistence of higher molecular weight petroleum hydrocarbons in seawater. Results from the biodegradation experiments show that the majority of tested petroleum hydrocarbons have half-lives in seawater less than 60 days.
Aspects of petroleum hydrocarbon metabolism in marine animals
Mironov, O. G.
1980-03-01
Studies on hydrocarbon composition of Black Sea mussels Mytilus galloprovincialis sampled from different habitats indicate that the quantity and composition of hydrocarbons distributed in the molluscs depend on season and sea-water quality. The data obtained under experimental conditions testify to the possibility of hydrocarbon concentration in mussel tissues after death. During filtration in sea water containing oil and oil products, these pollutants are bound into faeces and pseudofaeces which contain a greater percentage of aromatic compounds than the oil initially present in sea water. Quantitative data are presented on hydrocarbon changes in mussel excretory products during transfer from oil-polluted to clean sea water. When Black Sea crabs Eriphia verrucosa are fed with mussels containing fuel-oil components accumulated from sea water, the pollutants concentrate in the whole body of the crab. This is in contrast to parenteral oil uptake, which leads to a concentration of most of the hydrocarbon in the muscles.
Development of oil hydrocarbon fingerprinting and identification techniques
International Nuclear Information System (INIS)
Wang Zhendi; Fingas, Merv F.
2003-01-01
Oil, refined product, and pyrogenic hydrocarbons are the most frequently discovered contaminants in the environment. To effectively determine the fate of spilled oil in the environment and to successfully identify source(s) of spilled oil and petroleum products is, therefore, extremely important in many oil-related environmental studies and liability cases. This article briefly reviews the recent development of chemical analysis methodologies which are most frequently used in oil spill characterization and identification studies and environmental forensic investigations. The fingerprinting and data interpretation techniques discussed include oil spill identification protocol, tiered analytical approach, generic features and chemical composition of oils, effects of weathering on hydrocarbon fingerprinting, recognition of distribution patterns of petroleum hydrocarbons, oil type screening and differentiation, analysis of 'source-specific marker' compounds, determination of diagnostic ratios of specific oil constituents, stable isotopic analysis, application of various statistical and numerical analysis tools, and application of other analytical techniques. The issue of how biogenic and pyrogenic hydrocarbons are distinguished from petrogenic hydrocarbons is also addressed
Total site integration of light hydrocarbons separation process
Ulyev, L.; Vasilyev, M.; Maatouk, A.; Duic, Neven; Khusanovc, Alisher
2016-01-01
Ukraine is the largest consumer of hydrocarbons per unit of production in Europe (Ukraine policy review, 2006). The most important point is a reduction of energy consumption in chemical and metallurgical industries as a biggest consumer. This paper deals with energy savings potential of light hydrocarbons separation process. Energy consumption of light hydrocarbons separation process processes typical of Eastern European countries were analysed. Process Integration (PI) was used to perform a ...
The Attribute for Hydrocarbon Prediction Based on Attenuation
International Nuclear Information System (INIS)
Hermana, Maman; Harith, Z Z T; Sum, C W; Ghosh, D P
2014-01-01
Hydrocarbon prediction is a crucial issue in the oil and gas industry. Currently, the prediction of pore fluid and lithology are based on amplitude interpretation which has the potential to produce pitfalls in certain conditions of reservoir. Motivated by this fact, this work is directed to find out other attributes that can be used to reduce the pitfalls in the amplitude interpretation. Some seismic attributes were examined and studies showed that the attenuation attribute is a better attribute for hydrocarbon prediction. Theoretically, the attenuation mechanism of wave propagation is associated with the movement of fluid in the pore; hence the existence of hydrocarbon in the pore will be represented by attenuation attribute directly. In this paper we evaluated the feasibility of the quality factor ratio of P-wave and S-wave (Qp/Qs) as hydrocarbon indicator using well data and also we developed a new attribute based on attenuation for hydrocarbon prediction -- Normalized Energy Reduction Stack (NERS). To achieve these goals, this work was divided into 3 main parts; estimating the Qp/Qs on well log data, testing the new attribute in the synthetic data and applying the new attribute on real data in Malay Basin data. The result show that the Qp/Qs is better than Poisson's ratio and Lamda over Mu as hydrocarbon indicator. The curve, trend analysis and contrast of Qp/Qs is more powerful at distinguishing pore fluid than Poisson ratio and Lamda over Mu. The NERS attribute was successful in distinguishing the hydrocarbon from brine on synthetic data. Applying this attribute on real data on Malay basin, the NERS attribute is qualitatively conformable with the structure and location where the gas is predicted. The quantitative interpretation of this attribute for hydrocarbon prediction needs to be investigated further
Study on surface geochemistry and microbiology for hydrocarbon exploration
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-12-01
The test results of the experimental device for extraction of dissolved gases from water show that the device can be utilized for the gas geochemistry of water. The device is capable of determining hydrocarbon gases in water to the concentration of less than 5 x 10{sup -4} ml/l of water. According to the results of microbiological studies, the plate count technique can be a useful supplementary method for hydrocarbon exploration. This is based on the facts that the average survival rate to hydrocarbons (pentane, hexane) for heterotrophs is higher in the area known as containing considerable hydrocarbon gases than other areas in the Pohang region. However, it is still necessary to develop techniques to treat the bacteria with gaseous hydrocarbons. (author). 2 figs., 41 tabs.
Energy Technology Data Exchange (ETDEWEB)
Stock, D. J.; Peeters, E., E-mail: dstock84@gmail.com [Department of Physics and Astronomy, University of Western Ontario, London, ON, N6A 3K7 (Canada)
2017-03-10
We decompose the observed 7.7 μ m polycyclic aromatic hydrocarbon (PAH) emission complexes in a large sample of over 7000 mid-infrared spectra of the interstellar medium using spectral cubes observed with the Spitzer /IRS-SL instrument. In order to fit the 7.7 μ m PAH emission complex we invoke four Gaussian components, which are found to be very stable in terms of their peak positions and widths across all of our spectra, and subsequently define a decomposition with fixed parameters, which gives an acceptable fit for all the spectra. We see a strong environmental dependence on the interrelationships between our band fluxes—in the H ii regions all four components are intercorrelated, while in the reflection nebulae (RNs) the inner and outer pairs of bands correlate in the same manner as previously seen for NGC 2023. We show that this effect arises because the maps of RNs are dominated by emission from strongly irradiated photodissociation regions, while the much larger maps of H ii regions are dominated by emission from regions much more distant from the exciting stars, leading to subtly different spectral behavior. Further investigation of this dichotomy reveals that the ratio of two of these components (centered at 7.6 and 7.8 μ m) is linearly related to the UV-field intensity (log G {sub 0}). We find that this relationship does not hold for sources consisting of circumstellar material, which are known to have variable 7.7 μ m spectral profiles.
THE ROLE OF NITROGEN IN TITAN’S UPPER ATMOSPHERIC HYDROCARBON CHEMISTRY OVER THE SOLAR CYCLE
Energy Technology Data Exchange (ETDEWEB)
Luspay-Kuti, A.; Mandt, K. E.; Greathouse, T. K. [Department of Space Research, Southwest Research Institute, San Antonio, TX 78228 (United States); Westlake, J. H. [Johns Hopkins University Applied Physics Laboratory, Laurel, MD 20723 (United States); Plessis, S., E-mail: aluspaykuti@swri.edu [Fund Kis, F-92160 Antony (France)
2016-06-01
Titan’s thermospheric photochemistry is primarily driven by solar radiation. Similarly to other planetary atmospheres, such as Mars’, Titan’s atmospheric structure is also directly affected by variations in the solar extreme-UV/UV output in response to the 11-year-long solar cycle. Here, we investigate the influence of nitrogen on the vertical production, loss, and abundance profiles of hydrocarbons as a function of the solar cycle. Our results show that changes in the atmospheric nitrogen atomic density (primarily in its ground state N({sup 4}S)) as a result of photon flux variations have important implications for the production of several minor hydrocarbons. The solar minimum enhancement of CH{sub 3}, C{sub 2}H{sub 6}, and C{sub 3}H{sub 8}, despite the lower CH{sub 4} photodissociation rates compared with solar maximum conditions, is explained by the role of N({sup 4}S). N({sup 4}S) indirectly controls the altitude of termolecular versus bimolecular chemical regimes through its relationship with CH{sub 3}. When in higher abundance during solar maximum at lower altitudes, N({sup 4}S) increases the importance of bimolecular CH{sub 3} + N({sup 4}S) reactions producing HCN and H{sub 2}CN. The subsequent remarkable CH{sub 3} loss and decrease in the CH{sub 3} abundance at lower altitudes during solar maximum affects the overall hydrocarbon chemistry.
Social dominance molds cuticular and egg chemical blends in a paper wasp.
Dapporto, Leonardo; Romana Dani, Francesca; Turillazzi, Stefano
2007-07-03
Hamilton's theory [1] for the evolution of social behaviour predicts that helpers may renounce direct reproduction to help their more fertile kin. Intra-colony recognition among queens and helpers (subordinate queens or workers) is consequently a central issue in insect sociobiology. In social insects, cuticular hydrocarbons (CHCs) are involved in recognition, and egg-laying and non-egg-laying individuals often differ in CHC composition. These differences are assumed to be directly determined by fertility status [2,3]. In several ants and in Polistes wasps, when egg-layers disappear they are substituted by helpers, which develop their ovaries and become chemically similar to their former queens [2,3]. Sometimes helpers lay eggs in the presence of queens, which recognize and destroy the subordinates' eggs [4]. In ponerine ants, eggs often have the same chemical signature as the maternal cuticle [2]. If chemical signatures depend on fertility, egg-laying subordinates should match the queen's signature even when she is present, making egg recognition and differential oophagy impossible. In the study reported here, we experimentally separated fertility from dominance and analyzed the dynamics of hydrocarbon profiles of the cuticle of Polistes dominulus foundresses and the shell surface of their eggs. We have demonstrated that, contrary to the widely accepted view, dominance, rather than fertility, determines chemical signatures in Polistes wasps. This explains why queens can recognize their own eggs and police reproduction by subordinates if they become fertile and lay eggs.
Temperature-dependent mid-IR absorption spectra of gaseous hydrocarbons
International Nuclear Information System (INIS)
Klingbeil, Adam E.; Jeffries, Jay B.; Hanson, Ronald K.
2007-01-01
Quantitative mid-IR absorption spectra (2500-3400 cm -1 ) for 12 pure hydrocarbon compounds are measured at temperatures ranging from 25 to 500 deg. C using an FTIR spectrometer. The hydrocarbons studied are n-pentane, n-heptane, n-dodecane, 2,2,4-trimethyl-pentane (iso-octane), 2-methyl-butane, 2-methyl-pentane, 2,4,4-trimethyl-1-pentene, 2-methyl-2-butene, propene, toluene, m-xylene, and ethylbenzene. Room-temperature measurements of neat hydrocarbon vapor were made with an instrument resolution of both 0.1 and 1 cm -1 (FWHM) to confirm that the high-resolution setting was required only to resolve the propene absorption spectrum while the spectra of the other hydrocarbons could be resolved with 1 cm -1 resolution. High-resolution (0.1 cm -1 ), room-temperature measurements of neat hydrocarbons were made at low pressure (∼1 Torr, 133 Pa) and compared to measurements of hydrocarbon/N 2 mixtures at atmospheric pressure to verify that no pressure broadening could be observed over this pressure range. The temperature was varied between 25 and 500 o C for atmospheric-pressure measurements of hydrocarbon/N 2 mixtures (X hydrocarbon ∼0.06-1.5%) and it was found that the absorption cross section shows simple temperature-dependent behavior for a fixed wavelength over this temperature range. Comparisons with previous FTIR data over a limited temperature range and with high-resolution laser absorption data over a wide temperature range show good agreement
Method for the conversion of hydrocarbon charges
Energy Technology Data Exchange (ETDEWEB)
Whittam, T V
1976-11-11
The basis of the invention is the application of defined zeolites as catalysts to hydrocarbon conversion processes such as reformation, isomerization, dehydrocyclization, and cracking. By charging the zeolite carrier masses with 0.001 to 5% metal of the 8th group of the periodic system, preferably noble metals, a wide region of applications for the catalysts is achieved. A method for the isomerization of an alkyl benzene (or mixture of alkyl benzenes) in the liquid or gas phase under suitable temperature, pressure and flow-rate conditions, as well as in the presence of a cyclic hydrocarbon, is described as preferential model form of the invention; furthermore, a method for the reformation of a hydrocarbon fraction boiling in the gasoline or benzene boiling region and a method for the hydrocracking of hydrocarbon charge (e.g. naphtha, kerosine, gas oils) are given. Types of performance of the methods are explained using various examples.
Using microorganisms to aid in hydrocarbon degradation
International Nuclear Information System (INIS)
Black, W.; Zamora, J.
1993-01-01
Aliphatic hydrocarbons are threatening the potable water supply and the aquatic ecosystem. Given the right microbial inhabitant(s), a large portion of these aliphatic hydrocarbons could be biodegraded before reaching the water supply. The authors' purpose is to isolate possible oil-degrading organisms. Soil samples were taken from hydrocarbon-laden soils at petroleum terminals, a petroleum refinery waste-treatment facility, a sewage-treatment plant grease collector, a site of previous bioremediation, and various other places. Some isolates known to be good degraders were obtained from culture collection services. These samples were plated on a 10w-30 multigrade motor oil solid medium to screen for aliphatic hydrocarbon degraders. The degrading organisms were isolated, identified, and tested (CO 2 evolution, BOD, and COD) to determine the most efficient degrader(s). Thirty-seven organisms were tested, and the most efficient degraders were Serratia marcescens, Escherichia coli, and Enterobacter agglomerans
Nitrocarburising in ammonia-hydrocarbon gas mixtures
DEFF Research Database (Denmark)
Pedersen, Hanne; Christiansen, Thomas; Somers, Marcel A. J.
2010-01-01
The present work investigates the possibility of nitrocarburising in ammonia-acetylene-hydrogen and ammoniapropene- hydrogen gas mixtures, where unsaturated hydrocarbon gas is the carbon source during nitrocarburising. Consequently, nitrocarburising is carried out in a reducing atmosphere...... microscopy and X-ray diffraction analysis. It is shown that the use of unsaturated hydrocarbon gas in nitrocarburising processes is a viable alternative to traditional nitrocarburising methods....
Ecological risk assessment of a site contaminated with petroleum hydrocarbons
International Nuclear Information System (INIS)
Starodub, M.E.; Feniak, N.A.; Willes, R.F.; Moore, C.E.; Mucklow, L.
1995-01-01
The aquatic and terrestrial health risks associated with petroleum contamination on a decommissioned military base, contaminated with products ranging from Bunker C oil to aviation fuel, were assessed using a methodology whereby an analytical measurement of total petroleum hydrocarbons (TPH) could be correlated with compositional characterization and thus with toxicity. The constituents of petroleum hydrocarbon contamination represent wide ranges of physical-chemical properties, environmental fate, and toxicity. The composition of TPH can vary greatly, dependent on the sources or fuel types and the interaction of age as well as site- and chemical-specific characteristics in determining the impact of weathering processes. Therefore, a bulk sum analysis of TPH cannot be related to toxicity without characterization of its composition and association of the constituents, and therefore composition, with actual toxicity data. To address this need, the constituents of TPH were represented by surrogate chemicals, with selection based on structure-activity relationships and available toxicity data. Toxicological profiles were developed from governmental regulations and on the published literature for both the aquatic and terrestrial media. Risk characterization consisted of a comparison of water concentration limits and exposure limits, developed for each surrogate, to estimated surrogate concentrations throughout the site. The concentrations of surrogates were extrapolated from TPH composition characterization analyses, conducted at a select number of sampling locations, to bulk sum analyses of TPH at related sampling locations
George A. Olah, Carbocation and Hydrocarbon Chemistry
dropdown arrow Site Map A-Z Index Menu Synopsis George A. Olah, Carbocation and Hydrocarbon Chemistry George Olah received the 1994 Nobel Prize in Chemistry "for his contribution to carbocation chemistry" and his 'role in the chemistry of hydrocarbons. In particular, he developed superacids
Detection of irradiated meats by hydrocarbon method
International Nuclear Information System (INIS)
Goto, Michiko; Miyakawa, Hiroyuki; Fujinuma, Kenji; Ozawa, Hideki
2005-01-01
Meats, for example, lamb, razorback, wild duck and turkey were irradiated by gamma ray, and the amounts of hydrocarbons formed from fatty acids were measured. Since C 20:0 was found from wild duck and turkey. C 1-18:1 was recommended for internal standard. Good correlation was found between the amount of hydrocarbons and the doses of gamma irradiation. This study shows that such hydrocarbons induced after radiation procedure as C 1,7-16:2 , C 8-17:1 , C 1-14:1 , and C 15:0 may make it possible to detect irradiated lamb, razorback, wild duck and turkey. (author)
Method of recovering hydrocarbons from oil shale
Energy Technology Data Exchange (ETDEWEB)
Walton, D.K.; Slusser, M.S.
1970-11-24
A method is described for recovering hydrocarbons from an oil-shale formation by in situ retorting. A well penetrating the formation is heated and gas is injected until a pressure buildup within the well is reached, due to a decrease in the conductivity of naturally occurring fissures within the formation. The well is then vented, in order to produce spalling of the walls. This results in the formation of an enlarged cavity containing rubberized oil shale. A hot gas then is passed through the rubberized oil shale in order to retort hydrocarbons and these hydrocarbons are recovered from the well. (11 claims)
Bioremediation of petroleum hydrocarbons in soil environments
International Nuclear Information System (INIS)
Rowell, M.J.; Ashworth, J.; Qureshi, A.A.
1992-12-01
The bioremediation of petroleum hydrocarbons in soil environments was reviewed via a literature survey and discussions with workers in relevant disciplines. The impacts of hydrocarbons on soil are discussed along with a range of methods available to assist in their decomposition by soil microorganisms. The range of petroleum-based materials considered includes conventional and synthetic crude oils, refined oils, sludges, asphalts and bitumens, drilling mud residues, creosote tars, and some pesticides. The degradability of hydrocarbons largely depends upon their aqueous solubility and their adsorption on soil surfaces and, therefore, is related to their molecular structures. The ease of decomposition decreases with increasing complexity of structure, in the order aliphatics > aromatics > heterocyclics and asphaltenes (most recalcitrant). Most soils contain an adequate population of microorganisms and hence bioaugmentation may only be needed in special circumstances. Decomposition is fastest in soils where the hydrocarbon loading rate, aeration, nutrition, moisture, and pH are all optimized. At spill sites there is little control over the application rate, although containment measures can assist in either limiting contamination or distributing it more evenly. The enhancement of bioremediation is discussed in light of all these factors. Other techniques such as enhanced aeration, hydrocarbon decomposition by anaerobic processes, surfactants, and burning are also discussed. 211 refs., 11 figs., 10 tabs
Emissions of hydrocarbons from combustion of biofuels
International Nuclear Information System (INIS)
Olsson, Mona; Persson, Eva Marie.
1991-10-01
Evaluations and measurements of emissions of hydrocarbons from power plants with a capacity exceeding 1 MW using biofuels (wood fuels and peat) have been studied in order to identify and quantify the emissions of incompletely combusted hydrocarbons. The influence of the type of fuel and the combustion technology applied were also studied, using literature references. The report summarizes monitoring results from a number of plants using biofuels. The reported emissions from the different plants can not be compared as they are relatively few and the test results have been obtained under various conditions using different methods of testing and analysis. The methods used are often poorly documented in the studied reports. Few investigations of emissions of hydrocarbons from plants in the range of 1 to 10 MW have been carried out. The plant and the technology used are important factors determining the amount and type of emissions of hydrocarbons. Larger temporary emissions can occur during start up, operational disturbances or when using fuel of inhomogeneous quality. In order to minimize the emissions the combustion process must be efficiently controlled, and a fuel of a hohogeneous quality must be used. The report also summarizes sampling and analysis methods used for monitoring emissions of hydrocarbons. (29 refs., 17 figs.)
Bioremediation of petroleum hydrocarbons in soil environments
Energy Technology Data Exchange (ETDEWEB)
Rowell, M J; Ashworth, J; Qureshi, A A
1992-12-01
The bioremediation of petroleum hydrocarbons in soil environments was reviewed via a literature survey and discussions with workers in relevant disciplines. The impacts of hydrocarbons on soil are discussed along with a range of methods available to assist in their decomposition by soil microorganisms. The range of petroleum-based materials considered includes conventional and synthetic crude oils, refined oils, sludges, asphalts and bitumens, drilling mud residues, creosote tars, and some pesticides. The degradability of hydrocarbons largely depends upon their aqueous solubility and their adsorption on soil surfaces and, therefore, is related to their molecular structures. The ease of decomposition decreases with increasing complexity of structure, in the order aliphatics > aromatics > heterocyclics and asphaltenes (most recalcitrant). Most soils contain an adequate population of microorganisms and hence bioaugmentation may only be needed in special circumstances. Decomposition is fastest in soils where the hydrocarbon loading rate, aeration, nutrition, moisture, and pH are all optimized. At spill sites there is little control over the application rate, although containment measures can assist in either limiting contamination or distributing it more evenly. The enhancement of bioremediation is discussed in light of all these factors. Other techniques such as enhanced aeration, hydrocarbon decomposition by anaerobic processes, surfactants, and burning are also discussed. 211 refs., 11 figs., 10 tabs.
Hydrocarbon phytoremediation in the family Fabaceae--a review.
Hall, Jessica; Soole, Kathleen; Bentham, Richard
2011-04-01
Currently, studies often focus on the use of Poaceae species (grasses) for phytoremediation of hydrocarbon-contaminated soils. Research into the use of Fabaceae species (legumes) to remediate hydrocarbons in soils has been conducted, but these plants are commonly overlooked due to slower recorded rates of degradation compared with many grass species. Evidence in the literature suggests that in some cases Fabaceae species may increase total degradation of hydrocarbons and stimulate degradative capacity of the soil microbial community, particularly for contaminants which are normally more recalcitrant to degradation. As many recalcitrant hydrocarbons have negative impacts on human and ecosystem health, development of remediation options is crucial. Reconsideration of Fabaceae species for removal of such contaminants may lead to environmentally and economically sustainable technologies for remediation of contaminated sites.
The role of mass spectrometry in hydrocarbon analysis
International Nuclear Information System (INIS)
Kerenyi, E.
1980-01-01
Modern mass spectrometry has an outstandin.o role in solving problems concerning the composition and structure of hydrocarbon mixtures and their derivatives, petroleum and petrochemical products. Its efficiency in hydrocarbon analysis has been increased not only by high resolving power and computerized spectrum processing but also by the metastable ion spectrum technique promoting structural examinations, by mild ionization facilitating composition analysis, and by selective ion-detecting technique. The author presents the advantages of the metastable ion spectra, the field ionization, field desorption and other mild ionization methods, and finally, those of fragmentation analysis in connection with the examination of hydrocarbons and hydrocarbon derivatives. Examples taken from the literature and from the research work carried out in the Institute are also given. (author)
Enhancement of in situ Remediation of Hydrocarbon Contaminated Soil
Energy Technology Data Exchange (ETDEWEB)
Palmroth, M.
2006-07-01
Approximately 750 000 sites of contaminated land exist across Europe. The harmful chemicals found in Finnish soils include heavy metals, oil products, polyaromatic hydrocarbons (PAHs), polychlorinated biphenyls (PCBs), chlorophenols, and pesticides. Petroleum and petroleum products enter soil from ruptured oil pipelines, land disposal of refinery products, leaking storage tanks and through accidents. PAH contamination is caused by the spills of coal tar and creosote from coal gasification and wood treatment sites in addition to oil spills. Cleanup of soil by bioremediation is cheaper than by chemical and physical processes. However, the cleaning capacity of natural attenuation and in situ bioremediation is limited. The purpose of this thesis was to find feasible options to enhance in situ remediation of hydrocarbon contaminants. The aims were to increase the bioavailability of the contaminants and microbial activity at the subsurface in order to achieve higher contaminant removal efficiency than by intrinsic biodegradation alone. Enhancement of microbial activity and decrease of soil toxicity during remediation were estimated by using several biological assays. The performance of these assays was compared in order to find suitable indicators to follow the progress of remediation. Phytoremediation and chemical oxidation are promising in situ techniques to increase the degradation of hydrocarbons in soil. Phytoremediation is plant-enhanced decontamination of soil and water. Degradation of hydrocarbons is enhanced in the root zone by increased microbial activity and through the detoxifying enzymes of plants themselves. Chemical oxidation of contaminants by Fenton's reaction can produce degradation products which are more biodegradable than the parent compounds. Fenton's reaction and its modifications apply solutions of hydrogen peroxide and iron for the oxidation of organic chemicals. The cost of oxidation can be reduced by aiming at partial instead of full
Nitrocarburizing in ammonia-hydrocarbon gas mixtures
DEFF Research Database (Denmark)
Pedersen, Hanne; Christiansen, Thomas; Somers, Marcel A. J.
2011-01-01
The present work investigates the possibility of nitrocarburising in ammonia-acetylene-hydrogen and ammonia-propene-hydrogen gas mixtures, where unsaturated hydrocarbon gas is the carbon source during nitrocarburising. Consequently, nitrocarburising is carried out in a reducing atmosphere...... microscopy and X-ray diffraction analysis. It is shown that the use of unsaturated hydrocarbon gas in nitrocarburising processes is a viable alternative to traditional nitrocarburising methods....
Source identification of hydrocarbons following environmental releases
Energy Technology Data Exchange (ETDEWEB)
Birkholz, D.A. [ALS Environmental, Edmonton, AB (Canada)
2010-07-01
Methods of identifying the sources of hydrocarbon contaminations were discussed in this PowerPoint presentation. Laboratories analyze for total petroleum hydrocarbons (TPH) by obtaining chromatograms of observed products. However, many petroleum products provide similar chromatograms. Several independent lines of evidence are needed for the purposes of accurate determination in legal applications. A case study of a lube oil plant spill was used to demonstrate the inconclusiveness of chromatograms and the need to determine petroleum biomarkers. Terpane, sterane, triaromatic sterane, isoprenoid, and alkylcyclohexane analyses were conducted to differentiate between the hydrocarbon samples. The analysis methods are being used with various soil, water, and crab species samples from the BP oil spill. Oil found at the different sites must be directly related to the spill. However, there are 3858 oil and gas platforms currently operating in the Gulf of Mexico. Ratios of biomarkers and polycyclic aromatic hydrocarbons (PAHs) are being developed to generate weight of evidence. A critical difference analysis was also presented. tabs., figs.
Structural segregation of petroleum and prospective hydrocarbon regions in Azerbaijan
International Nuclear Information System (INIS)
Kerimov, K.M.; Huseynov, A.N.; Hajiyev, F.M.
2002-01-01
Full text : Structural segregation allows identify the earth crust blocks according to their geological setting and structural history conductive for hydrocarbon generation and their entrapment in the sedimentary fill reservoirs. Since then there has been a need to design a new tectonic map of petroleum and hydrocarbons potential systems in Azerbaijan embracing both on- and offshore areas. Map's legend designed upon above mentioned concepts and principles has made it possible to evaluate the role of individual stratigraphic units in hydrocarbon generation and its entrapment, as well as in recognition of regional structural criteria of the hydrocarbon bearing potential of different structural patterns. Tectonic map of petroleum and prospective hydrocarbon bearing on and offshore areas in Azerbaijan for the first time contained a wide range of information related to structural criteria of hydrocarbon bearing potential, sedimentary fill's structural architecture, its thickness, both timing of their formation stages and basement consolidation, its subsidence depth, as well as hydrocarbon deposit areal and vertical distribution across individual regions. This map was considered to be of important implication both for the petroleum geoscience and petroleum industry endeavors.
Chemical fingerprinting of hydrocarbon-contamination in soil.
Boll, Esther S; Nejrup, Jens; Jensen, Julie K; Christensen, Jan H
2015-03-01
Chemical fingerprinting analyses of 29 hydrocarbon-contaminated soils were performed to assess the soil quality and determine the main contaminant sources. The results were compared to an assessment based on concentrations of the 16 priority polycyclic aromatic hydrocarbons pointed out by the U.S. Environmental Protection Agency (EPAPAH16) and total petroleum hydrocarbon (TPH). The chemical fingerprinting strategy proposed in this study included four tiers: (i) qualitative analysis of GC-FID chromatograms, (ii) comparison of the chemical composition of both un-substituted and alkyl-substituted polycyclic aromatic compounds (PACs), (iii) diagnostic ratios of selected PACs, and (iv) multivariate data analysis of sum-normalized PAC concentrations. The assessment criteria included quantitative analysis of 19 PACs and C1-C4 alkyl-substituted homologues of naphthalene, fluorene, dibenzothiophene, phenanthrene, pyrene, and chrysene; and 13 oxygenated polycyclic aromatic compounds (O-PACs). The chemical composition of un-substituted and alkyl-substituted PACs and visual interpretation of GC-FID chromatograms were in combination successful in differentiating pyrogenic and petrogenic hydrocarbon sources and in assessing weathering trends of hydrocarbon contamination in the soils. Multivariate data analysis of sum-normalized concentrations could as a stand-alone tool distinguish between hydrocarbon sources of petrogenic and pyrogenic origin, differentiate within petrogenic sources, and detect weathering trends. Diagnostic ratios of PACs were not successful for source identification of the heavily weathered hydrocarbon sources in the soils. The fingerprinting of contaminated soils revealed an underestimation of PACs in petrogenic contaminated soils when the assessment was based solely on EPAPAH16. As alkyl-substituted PACs are dominant in petrogenic sources, the evaluation of the total load of PACs based on EPAPAH16 was not representative. Likewise, the O-PACs are not
The use of passive samplers for monitoring polycyclic aromatic hydrocarbons in ambient air
International Nuclear Information System (INIS)
Jacob, J.; Grimmer, G.; Hildebrandt, A.
1993-01-01
In this study polycyclic aromatic hydrocarbon (PAH) concentrations of ambient air are compared to those present in leaves, spruce sprouts and in the corresponding soil used as passive samplers. Marked profile alterations were detected in various soil horizons with increasing relative concentrations of higher boiling and decreasing relative concentrations of lower boiling PAH with depth. There is no direct correlation between the absolute PAH masses found in air samples and those collected by passive samplers or detected in corresponding soil samples. Even the PAH profiles differ significantly: they can, however, be correlated by introducing PAH - and sampler-specific factors. The PAH profiles appear to indicate that coal combustion mostly contributes to the PAH air pollution in the FRG. The time course of the concentration of benzo(a)pyrene and benzo(e)pyrene during the past seven years as measured with spruce sprouts as biological passive sampler indicate a significant decrease of the PAH concentration (by a factor of two) in the FRG. First measurements in a clean air area of the Eastern part of the FRG exhibited up to ten times higher PAH concentrations than found in comparable areas of the western part of the country
Directory of Open Access Journals (Sweden)
Cécile Noel
2016-01-01
Full Text Available Hydrocarbon-contaminated aquifers can be successfully remediated through enhanced biodegradation. However, in situ monitoring of the treatment by piezometers is expensive and invasive and might be insufficient as the information provided is restricted to vertical profiles at discrete locations. An alternative method was tested in order to improve the robustness of the monitoring. Geophysical methods, electrical resistivity (ER and induced polarization (IP, were combined with gas analyses, CO2 concentration, and its carbon isotopic ratio, to develop a less invasive methodology for monitoring enhanced biodegradation of hydrocarbons. The field implementation of this monitoring methodology, which lasted from February 2014 until June 2015, was carried out at a BTEX-polluted site under aerobic biotreatment. Geophysical monitoring shows a more conductive and chargeable area which corresponds to the contaminated zone. In this area, high CO2 emissions have been measured with an isotopic signature demonstrating that the main source of CO2 on this site is the biodegradation of hydrocarbon fuels. Besides, the evolution of geochemical and geophysical data over a year seems to show the seasonal variation of bacterial activity. Combining geophysics with gas analyses is thus promising to provide a new methodology for in situ monitoring.
Riveroll-Larios, Jessica; Escalante-Espinosa, Erika; Fócil-Monterrubio, Reyna L; Díaz-Ramírez, Ildefonso J
The use of soil health indicators linked to microbial activities, such as key enzymes and respirometric profiles, helps assess the natural attenuation potential of soils contaminated with hydrocarbons. In this study, the intrinsic physicochemical characteristics, biological activity and biodegradation potential were recorded for two soils with different contamination histories (>5 years and soil samples. Soil suspensions were tested as microbial inocula in biodegradation potential assays using contaminated perlite as an inert support. The basal respiratory rate of the recently contaminated soil was 15-38 mg C-CO 2 kg -1 h -1 , while the weathered soil presented a greater basal mineralisation capacity of 55-70 mg C-CO 2 kg -1 h -1 . The basal levels of lipase and dehydrogenase were significantly greater than those recorded in non-contaminated soils (551 ± 21 μg pNP g -1 ). Regarding the biodegradation potential assessment, the lipase (1000-3000 μg pNP g -1 of perlite) and dehydrogenase (~3000 μg INF g -1 of perlite) activities in the inoculum of the recently contaminated soil were greater than those recorded in the inoculum of the weathered soil. This was correlated with a high mineralisation rate (~30 mg C-CO 2 kg -1 h -1 ) in the recently contaminated soil and a reduction in hydrocarbon concentration (~30 %). The combination of an inert support and enzymatic and respirometric analyses made it possible to detect the different biodegradation capacities of the studied inocula and the natural attenuation potential of a recently contaminated soil at high hydrocarbon concentrations.
Process for making unsaturated hydrocarbons using microchannel process technology
Tonkovich, Anna Lee [Dublin, OH; Yuschak, Thomas [Lewis Center, OH; LaPlante, Timothy J [Columbus, OH; Rankin, Scott [Columbus, OH; Perry, Steven T [Galloway, OH; Fitzgerald, Sean Patrick [Columbus, OH; Simmons, Wayne W [Dublin, OH; Mazanec, Terry Daymo, Eric
2011-04-12
The disclosed invention relates to a process for converting a feed composition comprising one or more hydrocarbons to a product comprising one or more unsaturated hydrocarbons, the process comprising: flowing the feed composition and steam in contact with each other in a microchannel reactor at a temperature in the range from about 200.degree. C. to about 1200.degree. C. to convert the feed composition to the product, the process being characterized by the absence of catalyst for converting the one or more hydrocarbons to one or more unsaturated hydrocarbons. Hydrogen and/or oxygen may be combined with the feed composition and steam.
Coelho, Francisco J R C; Cleary, Daniel F R; Costa, Rodrigo; Ferreira, Marina; Polónia, Ana R M; Silva, Artur M S; Simões, Mário M Q; Oliveira, Vanessa; Gomes, Newton C M
2016-09-01
There is growing concern that predicted changes to global ocean chemistry will interact with anthropogenic pollution to significantly alter marine microbial composition and function. However, knowledge of the compounding effects of climate change stressors and anthropogenic pollution is limited. Here, we used 16S and 18S rRNA (cDNA)-based activity profiling to investigate the differential responses of selected microbial taxa to ocean acidification and oil hydrocarbon contamination under controlled laboratory conditions. Our results revealed that a lower relative abundance of sulphate-reducing bacteria (Desulfosarcina/Desulfococcus clade) due to an adverse effect of seawater acidification and oil hydrocarbon contamination (reduced pH-oil treatment) may be coupled to changes in sediment archaeal communities. In particular, we observed a pronounced compositional shift and marked reduction in the prevalence of otherwise abundant operational taxonomic units (OTUs) belonging to the archaeal Marine Benthic Group B and Marine Hydrothermal Vent Group (MHVG) in the reduced pH-oil treatment. Conversely, the abundance of several putative hydrocarbonoclastic fungal OTUs was higher in the reduced pH-oil treatment. Sediment hydrocarbon profiling, furthermore, revealed higher concentrations of several alkanes in the reduced pH-oil treatment, corroborating the functional implications of the structural changes to microbial community composition. Collectively, our results advance the understanding of the response of a complex microbial community to the interaction between reduced pH and anthropogenic pollution. In future acidified marine environments, oil hydrocarbon contamination may alter the typical mixotrophic and k-/r-strategist composition of surface sediment microbiomes towards a more heterotrophic state with lower doubling rates, thereby impairing the ability of the ecosystem to recover from acute oil contamination events. © 2016 John Wiley & Sons Ltd.
Identification and Characterisation of Major Hydrocarbons in ...
African Journals Online (AJOL)
Identification and Characterisation of Major Hydrocarbons in Thermally Degraded Low Density Polyethylene Films. ... There were alkanes, alkenes, halogenated alkanes, and very few aromatics in the liquid product and, the hydrocarbons were observed to range between C10 - C27. The FTIR and GC-MS results show the ...
Complexity and Uniqueness of the Aromatic Profile of Smoked and Unsmoked Herreño Cheese
Directory of Open Access Journals (Sweden)
Gemma Palencia
2014-06-01
Full Text Available In this work, the volatile fraction of unsmoked and smoked Herreño cheese, a type of soft cheese from the Canary Islands, has been characterized for the first time. In order to evaluate if the position in the smokehouse could influence the volatile profile of the smoked variety, cheeses smoked at two different heights were studied. The volatile components were extracted by Solid Phase Microextraction using a divinylbenzene/carboxen/ polydimethylsiloxane fiber, followed by Gas Chromatography/Mass Spectrometry. In total, 228 components were detected. The most numerous groups of components in the unsmoked Herreño cheese were hydrocarbons, followed by terpenes and sesquiterpenes, whereas acids and ketones were the most abundant. It is worth noticing the high number of aldehydes and ketones, and the low number of alcohols and esters in this cheese in relation to others, as well as the presence of some specific unsaturated hydrocarbons, terpenes, sesquiterpenes and nitrogenated derivatives. The smoking process enriches the volatile profile of Herreño cheese with ketones and diketones, methyl esters, aliphatic and aromatic aldehydes, hydrocarbons, terpenes, nitrogenated compounds, and especially with ethers and phenolic derivatives. Among these, methylindanones or certain terpenes like α-terpinolene, have not been detected previously in other types of smoked cheese. Lastly, the results obtained suggest a slightly higher smoking degree in the cheeses smoked at a greater height.
Energy Technology Data Exchange (ETDEWEB)
Raia, J.C.; Blakley, C.R.; Fuex, A.N.; Villalanti, D.C.; Fahrenthold, P.D. [Triton Anal Corp, Houston, TX (United States)
2004-03-01
This article presents a procedure to evaluate and characterize environmental samples containing mixtures of hydrocarbons over a wide boiling range of materials that include fuels and other products used in commerce. The range of the method extends to the higher boiling and heavier molecular weight hydrocarbon products in the range of motor oil, bunker fuel, and heavier residue materials. The procedure uses the analytical laboratory technique of high-temperature simulated distillation along with mathematical regression of the analytical data to estimate the relative contribution of individual products in mixtures of hydrocarbons present in environmental samples. An analytical technique to determine hydrocarbon-type distributions by gas chromatography-mass spectrometry with nitric oxide ionization spectrometry evaluation is also presented. This type of analysis allows complex hydrocarbon mixtures to be classified by their chemical composition, or types of hydrocarbons that include paraffins, cycloparaffins, monoaromatics, and polycyclic aromatic hydrocarbons. Characteristic hydrocarbon patterns for example, in the relative distribution of polycyclic aromatic hydrocarbons are valuable for determining the potential origin of materials present in environmental samples. These methods provide quantitative data for hydrocarbon components in mixtures as a function of boiling range and 'hydrocarbon fingerprints' of the types of materials present. This information is valuable in assessing environmental impacts of hydrocarbons at contaminated sites and establishing the liabilities and cost allocations for responsible parties.
Al-Bader, Dhia; Kansour, Mayada K; Rayan, Rehab; Radwan, Samir S
2013-05-01
Biofilms harboring simultaneously anoxygenic and oxygenic phototrophic bacteria, diazotrophic bacteria, and hydrocarbon-utilizing bacteria were established on glass slides suspended in pristine and oily seawater. Via denaturing gradient gel electrophoresis analysis on PCR-amplified rRNA gene sequence fragments from the extracted DNA from biofilms, followed by band amplification, biofilm composition was determined. The biofilms contained anoxygenic phototrophs belonging to alphaproteobacteria; pico- and filamentous cyanobacteria (oxygenic phototrophs); two species of the diazotroph Azospirillum; and two hydrocarbon-utilizing gammaproteobacterial genera, Cycloclasticus and Oleibacter. The coexistence of all these microbial taxa with different physiologies in the biofilm makes the whole community nutritionally self-sufficient and adequately aerated, a condition quite suitable for the microbial biodegradation of aquatic pollutant hydrocarbons.
Microbial consortia involved in the anaerobic degradation of hydrocarbons.
Zwolinski; Harris, R F; Hickey, W J
2000-01-01
In this review, we examine the energetics of well-characterized biodegradation pathways and explore the possibilities for these to support growth of multiple organisms interacting in consortia. The relevant phenotypic and/or phylogenetic characteristics of isolates and consortia mediating hydrocarbon degradation coupled with different terminal electron-accepting processes (TEAP) are also reviewed. While the information on metabolic pathways has been gained from the analysis of individual isolates, the energetic framework presented here demonstrates that microbial consortia could be readily postulated for hydrocarbon degradation coupled to any TEAP. Several specialized reactions occur within these pathways, and the organisms mediating these are likely to play a key role in defining the hydrocarbon degradation characteristics of the community under a given TEAP. Comparing these processes within and between TEAPs reveals biological unity in that divergent phylotypes display similar degradation mechanisms and biological diversity in that hydrocarbon-degraders closely related as phylotypes differ in the type and variety of hydrocarbon degradation pathways they possess. Analysis of microcosms and of field samples suggests that we have only begun to reveal the diversity of organisms mediating anaerobic hydrocarbon degradation. Advancements in the understanding of how hydrocarbon-degrading communities function will be significantly affected by the extent to which organisms mediating specialized reactions can be identified, and tools developed to allow their study in situ.
Global climate change due to the hydrocarbon industry
International Nuclear Information System (INIS)
Almasi, M.; Racz, L.
1999-01-01
An overview is presented on the industry's response to the agreements of the Rio de Janeiro (1992) and Kyoto (1987) conventions on climate change, and to other international agreements. The announcements by large petroleum companies on the changes introduced according to the international commitments in order to fight climatic impacts of hydrocarbon fuels. The problems and foreseeable future of the Hungarian hydrocarbon industry with environmental protection are discussed. Finally, emission abatement and control possibilities of hydrocarbon combustion are considered. (R.P.)
Hydrocarbons cocktails of the future
International Nuclear Information System (INIS)
Anon.
2004-01-01
This publication of the Areva Group, a world nuclear industry leader, provides information on the energy in many domains. This issue deals with the CO 2 pollution exchange, the carbon sinks to compensate the CO 2 , the green coal as an innovative solution, an outsize dam in China, the solar energy progresses in France and the french medicine academy in favor of Nuclear. A special chapter is devoted to the hydrocarbons of the future, artificial chemical combination created from constituents of hydrocarbons and derived from various sources. (A.L.B.)
Novel Photocatalytic Reactor Development for Removal of Hydrocarbons from Water
Directory of Open Access Journals (Sweden)
Morgan Adams
2008-01-01
Full Text Available Hydrocarbons contamination of the marine environment generated by the offshore oil and gas industry is generated from a number of sources including oil contaminated drill cuttings and produced waters. The removal of hydrocarbons from both these sources is one of the most significant challenges facing this sector as it moves towards zero emissions. The application of a number of techniques which have been used to successfully destroy hydrocarbons in produced water and waste water effluents has previously been reported. This paper reports the application of semiconductor photocatalysis as a final polishing step for the removal of hydrocarbons from two waste effluent sources. Two reactor concepts were considered: a simple flat plate immobilised film unit, and a new rotating drum photocatalytic reactor. Both units proved to be effective in removing residual hydrocarbons from the effluent with the drum reactor reducing the hydrocarbon content by 90% under 10 minutes.
Hydrocarbon Rocket Technology Impact Forecasting
Stuber, Eric; Prasadh, Nishant; Edwards, Stephen; Mavris, Dimitri N.
2012-01-01
Ever since the Apollo program ended, the development of launch propulsion systems in the US has fallen drastically, with only two new booster engine developments, the SSME and the RS-68, occurring in the past few decades.1 In recent years, however, there has been an increased interest in pursuing more effective launch propulsion technologies in the U.S., exemplified by the NASA Office of the Chief Technologist s inclusion of Launch Propulsion Systems as the first technological area in the Space Technology Roadmaps2. One area of particular interest to both government agencies and commercial entities has been the development of hydrocarbon engines; NASA and the Air Force Research Lab3 have expressed interest in the use of hydrocarbon fuels for their respective SLS Booster and Reusable Booster System concepts, and two major commercially-developed launch vehicles SpaceX s Falcon 9 and Orbital Sciences Antares feature engines that use RP-1 kerosene fuel. Compared to engines powered by liquid hydrogen, hydrocarbon-fueled engines have a greater propellant density (usually resulting in a lighter overall engine), produce greater propulsive force, possess easier fuel handling and loading, and for reusable vehicle concepts can provide a shorter turnaround time between launches. These benefits suggest that a hydrocarbon-fueled launch vehicle would allow for a cheap and frequent means of access to space.1 However, the time and money required for the development of a new engine still presents a major challenge. Long and costly design, development, testing and evaluation (DDT&E) programs underscore the importance of identifying critical technologies and prioritizing investment efforts. Trade studies must be performed on engine concepts examining the affordability, operability, and reliability of each concept, and quantifying the impacts of proposed technologies. These studies can be performed through use of the Technology Impact Forecasting (TIF) method. The Technology Impact
Energy Technology Data Exchange (ETDEWEB)
Tausz, J
1924-07-16
Hydrocarbon oils such as petroleum, shale oils, lignite or coal tar oils are purified by distilling them and collecting the distillate in fractions within narrow limits so that all the impurities are contained in one or more of the narrow fractions. In distilling ligroin obtained by destructive distillation of brown coal, it is found that the coloring and resin-forming constituents are contained in the fractions distilling over at 62 to 86/sup 0/C and 108/sup 0/C. The ligroin is purified, therefore, by distillating in an apparatus provided with an efficient dephlegmotor and removing these two fractions. The distillation may be carried out wholly or in part under reduced pressure, and fractions separated under ordinary pressure may be subsequently distilled under reduced pressure. The hydrocarbons may be first separated into fractions over wider limits and the separate fractions be subjected to a further fractional distillation.
Directory of Open Access Journals (Sweden)
Dirk W. Lachenmeier
2017-08-01
Full Text Available Mineral hydrocarbons consist of two fractions, mineral oil saturated hydrocarbons (MOSH and mineral oil aromatic hydrocarbons (MOAH. MOAH is a potential public health hazard because it may include carcinogenic polycyclic compounds. In the present study, 400 MHz nuclear magnetic resonance (NMR spectroscopy was introduced, in the context of official controls, to measure MOSH and MOAH in raw materials or pure mineral hydrocarbon final products (cosmetics and medicinal products. Quantitative determination (qNMR has been established using the ERETIC methodology (electronic reference to access in vivo concentrations based on the PULCON principle (pulse length based concentration determination. Various mineral hydrocarbons (e.g., white oils, paraffins or petroleum jelly were dissolved in deuterated chloroform. The ERETIC factor was established using a quantification reference sample containing ethylbenzene and tetrachloronitrobenzene. The following spectral regions were integrated: MOSH δ 3.0 – 0.2 ppm and MOAH δ 9.2 - 6.5, excluding solvent signals. Validation showed a sufficient precision of the method with a coefficient of variation <6% and a limit of detection <0.1 g/100 g. The applicability of the method was proven by analysing 27 authentic samples with MOSH and MOAH contents in the range of 90-109 g/100 g and 0.02-1.10 g/100 g, respectively. It is important to distinguish this new NMR-approach from the hyphenated liquid chromatography-gas chromatography methodology previously used to characterize MOSH/MOAH amounts in cosmetic products. For mineral hydrocarbon raw materials or pure mineral hydrocarbon-based cosmetic products, NMR delivers higher specificity without any sample preparation besides dilution. Our sample survey shows that previous methods may have overestimated the MOAH amount in mineral oil products and opens new paths to characterize this fraction. Therefore, the developed method can be applied for routine monitoring of consumer
Task 8: Evaluation of hydrocarbon potential
International Nuclear Information System (INIS)
Cashman, P.H.; Trexler, J.H. Jr.
1994-01-01
Our studies focus on the stratigraphy of Late Devonian to early Pennsylvanian rocks at the NTS, because these are the best potential hydrocarbon source rocks in the vicinity of Yucca Mountain. In the last year, our stratigraphic studies have broadened to include the regional context for both the Chainman and the Eleana formations. New age data based on biostratigraphy constrain the age ranges of both Chainman and Eleana; accurate and reliable ages are essential for regional correlation and for regional paleogeographic reconstructions. Source rock analyses throughout the Chainman establish whether these rocks contained adequate organic material to generate hydrocarbons. Maturation analyses of samples from the Chainman determine whether the temperature history has been suitable for the generation of liquid hydrocarbons. Structural studies are aimed at defining the deformation histories and present position of the different packages of Devonian - Pennsylvanian rocks. This report summarizes new results of our structural, stratigraphic and hydrocarbon source rock potential studies at the Nevada Test Site and vicinity. Stratigraphy is considered first, with the Chainman Shale and Eleana Formation discussed separately. New biostratigraphic results are included in this section. New results from our structural studies are summarized next, followed by source rock and maturation analyses of the Chainman Shale. Directions for future work are included where appropriate
Hydrocarbon Reserves: Abundance or Scarcity
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-07-01
IFP and the OAPEC jointly organize a regular international seminar dealing with world oil-related problems appearing in the news. For the first time, this seminar has been opened to oil and gas company specialists, service companies, research centers and independents. This year's theme concerns oil and gas reserves: are they abundant or are we headed towards the shortages announced by some experts? This theme is especially topical in that: oil and gas currently meet two thirds of world energy needs and almost completely dominate the transport sector; the reserves declared by the OAPEC countries account for nearly half of world reserves; the price of a barrel of oil went through the roof in 2004; world energy demand is growing fast and alternative sources of energy are far from ready to take over from oil and gas in the next few decades. Since the reserves correspond to the volume it is technically and economically viable to produce, the seminar has, of course, dealt with the technical and economic questions that arise in connection with exploration and production, but it has also considered changes in the geopolitical context. Presentations by the leading companies of the OAPEC countries and by the IFP group were completed by presentation from the International Energy Agency (IEA), the United States Geological Survey (USGS), the IHS Energy Group, Total and Gaz de France. This document gathers the transparencies of the following presentations: Hydrocarbon reserves in OAPEC members countries: current and future (M. Al-Lababidi); Non OAPEC liquid reserves and production forecasts (Y. Mathieu); World oil and gas resources and production outlook (K. Chew); Global investments in the upstream (F. Birol); Total's policy in the oil and gas sector (C. de Margerie); Gaz de France's policy in the oil and gas sector (J. Abiteboul); NOC/IOC's opportunities in OPEC countries (I. Sandrea); Relationships between companies, countries and investors: How they may impact on the growth
Hydrocarbon Reserves: Abundance or Scarcity
International Nuclear Information System (INIS)
2005-01-01
IFP and the OAPEC jointly organize a regular international seminar dealing with world oil-related problems appearing in the news. For the first time, this seminar has been opened to oil and gas company specialists, service companies, research centers and independents. This year's theme concerns oil and gas reserves: are they abundant or are we headed towards the shortages announced by some experts? This theme is especially topical in that: oil and gas currently meet two thirds of world energy needs and almost completely dominate the transport sector; the reserves declared by the OAPEC countries account for nearly half of world reserves; the price of a barrel of oil went through the roof in 2004; world energy demand is growing fast and alternative sources of energy are far from ready to take over from oil and gas in the next few decades. Since the reserves correspond to the volume it is technically and economically viable to produce, the seminar has, of course, dealt with the technical and economic questions that arise in connection with exploration and production, but it has also considered changes in the geopolitical context. Presentations by the leading companies of the OAPEC countries and by the IFP group were completed by presentation from the International Energy Agency (IEA), the United States Geological Survey (USGS), the IHS Energy Group, Total and Gaz de France. This document gathers the transparencies of the following presentations: Hydrocarbon reserves in OAPEC members countries: current and future (M. Al-Lababidi); Non OAPEC liquid reserves and production forecasts (Y. Mathieu); World oil and gas resources and production outlook (K. Chew); Global investments in the upstream (F. Birol); Total's policy in the oil and gas sector (C. de Margerie); Gaz de France's policy in the oil and gas sector (J. Abiteboul); NOC/IOC's opportunities in OPEC countries (I. Sandrea); Relationships between companies, countries and investors: How they may impact on the growth
International Nuclear Information System (INIS)
Tansel, B.; Fuentes, C.; Sanchez, M.; Predoi, K.; Acevedo, M.
2011-01-01
Highlights: ► The half-lives of PAHs in the deep waters (over 1000 m) are about twice longer than the shallow areas (100–150 m). ► In the water column, anthracene levels can decrease by 50% within 1–2 days. ► The half-lives of the PAHs in the sediments are significantly longer than those in the water column. ► The half-life of pyrene in the shallow and deep sediments is 9 and 16 years, respectively. - Abstract: Persistence profiles of selected polyaromatic hydrocarbons (PAHs) were analyzed depending on temperature variations in the water column and water–sediment interactions in the Gulf of Mexico. The PAHs studied include anthracene, fluoranthene, pyrene, and chrysene. The half-lives of PAHs in the deep waters (over 1000 m) are about twice as long as those in the shallow areas (100–150 m), and almost 2.5 times as long as those in the top layer (0–10 m) of the water column. The half-lives of the PAHs in the sediments are significantly longer. Among the PAHs studied, chrysene is the most persistent in the water column, and pyrene is the most persistent in the sediments. The half-life of chrysene in the shallow and deep waters is over 2.5 and about 5 years, respectively. For pyrene, the half-life in the shallow and deep sediments is about 9 and 16 years, respectively.
High atmosphere–ocean exchange of semivolatile aromatic hydrocarbons
González-Gaya, Belén
2016-05-16
Polycyclic aromatic hydrocarbons, and other semivolatile aromatic-like compounds, are an important and ubiquitous fraction of organic matter in the environment. The occurrence of semivolatile aromatic hydrocarbons is due to anthropogenic sources such as incomplete combustion of fossil fuels or oil spills, and other biogenic sources. However, their global transport, fate and relevance for the carbon cycle have been poorly assessed, especially in terms of fluxes. Here we report a global assessment of the occurrence and atmosphere-ocean fluxes of 64 polycyclic aromatic hydrocarbons analysed in paired atmospheric and seawater samples from the tropical and subtropical Atlantic, Pacific and Indian oceans. The global atmospheric input of polycyclic aromatic hydrocarbons to the global ocean is estimated at 0.09 Tg per month, four times greater than the input from the Deepwater Horizon spill. Moreover, the environmental concentrations of total semivolatile aromatic-like compounds were 10 2 -10 3 times higher than those of the targeted polycyclic aromatic hydrocarbons, with a relevant contribution of an aromatic unresolved complex mixture. These concentrations drive a large global deposition of carbon, estimated at 400 Tg C yr -1, around 15% of the oceanic CO2 uptake. © 2016 Macmillan Publishers Limited.
Bioremediation in soil contaminated with hydrocarbons in Colombia.
Directory of Open Access Journals (Sweden)
María Alejandra Trujillo Toro
2012-10-01
Full Text Available This study analyzes bioremediation processes of hydrocarbon contaminated soils in Colombia as a sustainable alternative to the deterioration of environmental quality by hydrocarbon spillage. According to national and international environmental law, all waste contaminated with hydrocarbons is considered dangerous waste, and therefore it cannot be released in the ground, water or be incinerated. Such legislation has motivated companies around the world to implement treatment processes for contaminated soils. Within Colombia, oil companies have been implementing the bioremediation of hydrocarbon contaminated soils in order to manage the waste coming from activities of oil drilling, refinement, transport and distribution.These practices must be considered viable for their ease of implementation, their low overhead costs, and for the benefits they provide towards environmental quality. Among the positive impacts that these practices have generated, it may consider the following: a solution for the problem of hydrocarbon contaminated soils, alternatives for the ultimate disposal of said waste without affecting ground, water or air resources, the low cost of the operation, and the technical experience of sustainable development which can continue to be implemented in companies dealing with dangerous waste.
Mechanics of vacuum-enhanced recovery of hydrocarbons
International Nuclear Information System (INIS)
Barnes, D.L.; McWhorter, D.B.
1995-01-01
A growing body of field data demonstrates the enhancement of product recovery that can be achieved by applying a partial vacuum to recovery wells. Typical explanations for the observed improvement in performance invoke an increased slope of the cone of depression created in the water-table surface. Explanations related to water-table slope do not consider the gradient induced in the hydrocarbon by virtue of the airflow. Also, the airflow may induce a gradient in the aqueous phase that is not reflected in a water-table drawdown. The equations for steady-state flow of three immiscible fluids elucidate the fundamental mechanics of vacuum-enhanced recovery or bioslurping. Airflow to the recovery well causes hydrocarbon to migrate toward the well, independent of any gravity effects that may be created. Also, the relative permeability to hydrocarbon is affected by both water and airflow in the vicinity of the recovery well. Two critical airflow rates delineate the conditions for which only air is recovered, air and hydrocarbon are recovered, and all three phases are recovered
Antioxidant Functions of the Aryl Hydrocarbon Receptor
Directory of Open Access Journals (Sweden)
Cornelia Dietrich
2016-01-01
Full Text Available The aryl hydrocarbon receptor (AhR is a transcription factor belonging to the basic helix-loop-helix/PER-ARNT-SIM family. It is activated by a variety of ligands, such as environmental contaminants like polycyclic aromatic hydrocarbons or dioxins, but also by naturally occurring compounds and endogenous ligands. Binding of the ligand leads to dimerization of the AhR with aryl hydrocarbon receptor nuclear translocator (ARNT and transcriptional activation of several xenobiotic phase I and phase II metabolizing enzymes. It is generally accepted that the toxic responses of polycyclic aromatic hydrocarbons, dioxins, and structurally related compounds are mediated by activation of the AhR. A multitude of studies indicate that the AhR operates beyond xenobiotic metabolism and exerts pleiotropic functions. Increasing evidence points to a protective role of the AhR against carcinogenesis and oxidative stress. Herein, I will highlight data demonstrating a causal role of the AhR in the antioxidant response and present novel findings on potential AhR-mediated antioxidative mechanisms.
Monitoring in situ biodegradation of hydrocarbons by using stable carbon isotopes
International Nuclear Information System (INIS)
Aggarwal, P.K.; Hinchee, R.E.
1991-01-01
Spilled or leaked nonhalogenated petroleum hydrocarbons in the soil can generally be metabolized by indigenous, aerobic bacteria. In situ biological degradation of hydrocarbons may be accelerated by supplying inorganic nutrients and/or oxygen. Approaches to monitoring and verifying enhanced in situ biodegradation have included measurements of changes over time in the (a) concentration of hydrocarbons, (b) temperature, (c) number of hydrocarbon-degrading microorganisms, (d) ratio of fast-degrading hydrocarbons (e.g., pristanes or phytanes), and (e) metabolic intermediates. Measurements of oxygen consumption over time and elevated carbon dioxide concentrations in soil gas also have been used as indicators of hydrocarbon degradation. An alternative approach that may help substantiate biodegradation is to measure stable carbon isotope ratios in soil gas CO 2 . Stable carbon isotope ratio analysis is inexpensive and commercially available at many laboratories. Carbon dioxide produced by hydrocarbon degradation may be distinguished from that produced by other processes based on the carbon isotopic compositions characteristic of the source material and/or fractionation accompanying microbial metabolism. Here the authors demonstrate the applicability of the stable isotope technique for monitoring enhanced. aerobic biodegradation of hydrocarbons using data from three locations in the United States
Determination of the hydrocarbon-degrading metabolic capabilities of tropical bacterial isolates
Energy Technology Data Exchange (ETDEWEB)
Marquez-Rocha, F.J.; Olmos-Soto, J. [Centro de Investigacion Cientifica y de Educacion Superior de Ensenada, San Diego, CA (United States). Departamento de Biotecnologia Marina; Rosano-Hernandez, M.A.; Muriel-Garcia, M. [Instituto Mexicano del Petroleo, CD Carmen Camp (Mexico). Zona Marina/Tecnologia Ambiental
2005-01-01
Of more than 20 bacteria isolated from a tropical soil using minimal medium supplemented with hydrocarbons, 11 grew well on diesel as sole carbon source, and another 11 grew in the presence of polynuclear aromatic hydrocarbons (PAHs). Ten isolates were identified phenotypically as Pseudomonas sp. and eight as Bacillus sp. Gene sequences representing the catabolic genes (alkM, todM, ndoM, and xylM) and 16S rRNA gene sequences characteristic for Pseudomona and Bacillus were amplified by PCR, using DNA recovered from the supernatant of hydrocarbon-contaminated soil suspensions. Based on their rapid growth characteristics in the presence of hydrocarbons and the formation of PCR products for the catabolic genes alkM and ndoM six isolates were selected for biodegradation assays. After 30 days a mixed culture of two isolates achieved close to 70% hydrocarbon removal and apparent mineralization of 16% of the hydrocarbons present in the soil. Biodegradation rates varied from 275 to 387 mg hydrocarbon kg{sup -1} day{sup -1}. Several bacterial isolates obtained in this study have catabolic capabilities for the biodegradation of alkanes and aromatic hydrocarbons including PAHs. (author)
Letourneau, Joseph M; Cakmak, Hakan; Quinn, Molly; Sinha, Nikita; I Cedars, Marcelle; Rosen, Mitchell P
2017-09-01
Unlike infertility, patients presenting for fertility preservation (FP) are often using combined hormonal contraceptives (CHC). We studied whether long-term (≥6 months) CHC use is associated with reversible suppression of antral follicle count (AFC). This is a longitudinal study of FP cycles from 2012 to 2016. We studied three groups: those without CHC exposure (NO CHC), those with CHC usage with a CHC break (BREAK), and without a break (NO BREAK) prior to ovarian stimulation. We assessed ovarian reserve by AFC at initial consultation and discussed the possibility of CHC suppression of AFC. Patients chose between ovarian stimulation with no CHC break versus ovarian stimulation after a CHC break. AFC was measured serially in the BREAK group. We assessed whether AFC suppression was reversed in the BREAK group. Total oocyte yield was compared among the NO CHC, BREAK, and NO BREAK groups. T tests, ANOVA, and linear/logistic regressions were used. Seven hundred forty-three women underwent FP. Twenty-one percent (n = 154) were taking long-term CHC (≥6 months). AFC suppression was more likely with CHC use (OR 1.6, 95% CI 1.1-2.4, P = 0.011). The BREAK group (n = 79) stopped CHC for an average of 4 months. AFC improvement started at 1 month and plateaued at approximately 6- to 7-month break. The BREAK group had approximately twice as many oocytes per initial AFC as NO BREAK (2.8 ± 3.8 vs. 1.4 ± 0.9, P women present for FP on CHC, AFC may be suppressed. A CHC break of several months is associated with an increase in AFC and a potential improvement in overall egg yield.
Alkanes as Components of Soil Hydrocarbon Status: Behavior and Indication Significance
Gennadiev, A. N.; Zavgorodnyaya, Yu. A.; Pikovskii, Yu. I.; Smirnova, M. A.
2018-01-01
Studies of soils on three key plots with different climatic conditions and technogenic impacts in Volgograd, Moscow, and Arkhangelsk oblasts have showed that alkanes in the soil exchange complex have some indication potential for the identification of soil processes. The following combinations of soil-forming factors and processes have been studied: (a) self-purification of soil after oil pollution; (b) accumulation of hydrocarbons coming from the atmosphere to soils of different land use patterns; and (c) changes in the soil hydrocarbon complex beyond the zone of technogenic impact due to the input of free hydrocarbon-containing gases. At the injection input of hydrocarbon pollutants, changes in the composition and proportions of alkanes allow tracing the degradation trend of pollutants in the soil from their initial content to the final stage of soil self-purification, when the background concentrations of hydrocarbons are reached. Upon atmospheric deposition of hydrocarbons onto the soil, from the composition and mass distribution of alkanes, conclusions can be drawn about the effect of toxicants on biogeochemical processes in the soil, including their manifestation under different land uses. Composition analysis of soil alkanes in natural landscapes can reveal signs of hydrocarbon emanation fluxes in soils. The indication potentials of alkanes in combination with polycyclic aromatic hydrocarbons and other components of soil hydrocarbon complex can also be used for the solution of other soil-geochemical problems.
Cuticular hydrocarbons for species determination of tropical termites
Michael I. Haverty; Lori J. Nelson; Barbara L. Thorne; Margaret S. Collins; Johanna P.E.C. Darlington; Marion Page
1992-01-01
Cuticular hydrocarbons can be used to discriminate species in Coptotermes and Nasutitermes, here discussed for selected species from locations in the Pacific Rim and several Caribbean islands. We recently reexamined the cuticular hydrocarbons of Coptotermes formosanus and identified several dimethylalkanes that...
Graph theory for alternating hydrocarbons with attached ports
Hesselink, Wim H.
Properties of molecules of certain hydrocarbons give rise to difficult questions in graph theory. This paper is primarily devoted to the graph theory, but the physico-chemical motivation, which is somewhat speculative, is also presented. Molecules of unsaturated hydrocarbons exhibit alternating
Purifying and regenerating hydrocarbon oils
Energy Technology Data Exchange (ETDEWEB)
1931-11-19
Hydrocarbons are freed from sulfur-containing compounds, colloidal asphaltic bodies and unstable unsaturated substances by treatment with a small amount of dilute sulfuric acid and a salt of a trivalent cation, such as ferric chloride or sulfate. Hydrocarbons specified are petroleum, crude benzol, low temperature tars, shale oil or vapor-phase cracked spirit. Motor spirit or lubricating oil distillates are refined and finally distilled. The acid reagent may be regenerated by filtering through sand or asbestos. Used lubricating oils may be treated similarly and after removal of refining agent, the oil is heated with an adsorbent and decolorizing material and then filtered.
Method and apparatus for preventing agglomeration within fluid hydrocarbons
International Nuclear Information System (INIS)
Woodbridge, D.D.
1979-01-01
This invention relates to a process for treating a fluid hydrocarbon fuel for retarding the agglomeration between particles thereof and for retarding the growth of bacteria and fungi therein. The process includes that steps of transporting a plurality of unit volumes of said fluid hydrocarbon fuel through an irradiating location and irradiating each unit of the plurality of unit volumes at the irradiating location with either neutron or gamma radiation. An apparatus for treating the fluid hydrocarbon fuels with the nuclear radiation also is provided. The apparatus includes a generally conical central irradiating cavity which is surrounded by a spiral outer irradiating cavity. The fluid hydrocarbon fuel is transported through the cavities while being irradiated by the nuclear radiation
Methods for natural gas and heavy hydrocarbon co-conversion
Kong, Peter C [Idaho Falls, ID; Nelson, Lee O [Idaho Falls, ID; Detering, Brent A [Idaho Falls, ID
2009-02-24
A reactor for reactive co-conversion of heavy hydrocarbons and hydrocarbon gases and includes a dielectric barrier discharge plasma cell having a pair of electrodes separated by a dielectric material and passageway therebetween. An inlet is provided for feeding heavy hydrocarbons and other reactive materials to the passageway of the discharge plasma cell, and an outlet is provided for discharging reaction products from the reactor. A packed bed catalyst may optionally be used in the reactor to increase efficiency of conversion. The reactor can be modified to allow use of a variety of light sources for providing ultraviolet light within the discharge plasma cell. Methods for upgrading heavy hydrocarbons are also disclosed.
Method of removing deterioration product in hydrocarbon type solvent
International Nuclear Information System (INIS)
Ito, Yoshifumi; Takashina, Toru; Murasawa, Kenji.
1988-01-01
Purpose: To remarkably reduce radioactive wastes by bringing adsorbents comprising titanium oxide and/or zirconium oxide into contact with hydrocarbon type solvents. Method: In a nuclear fuel re-processing step, an appropriate processing is applied to extraction solvents suffering from radioactive degradation, to separate the hydrocarbon solvents and store them in a solvent tank. Then, titanium oxide and/or zirconium oxide adsorbents are continuously mixed and agitated therewith to adsorb degradation products on the adsorbents. Then, they are introduced with adsorbent separators to recover purified hydrocarbon type solvents. Meanwhile, the separated adsorbents are discharged from pipeways. This enables to regenerate the hydrocarbon type solvents for reuse, as well as remarkably reduce the radioactive wastes. (Takahashi, M.)
Czech Academy of Sciences Publication Activity Database
Tydlitát, Vratislav; Kotlík, B.; Punčochář, Miroslav; Mikešová, M.
2010-01-01
Roč. 30, č. 4 (2010), s. 208-221 ISSN 1040-6638 Institutional research plan: CEZ:AV0Z40720504 Keywords : car exhausts * polycyclic aromatic hydrocarbons (PAHs) * urban atmosphere Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.982, year: 2010
Risk analysis associated with petroleum hydrocarbons: is everything running smoothly?
International Nuclear Information System (INIS)
Morin, D.
1999-01-01
Petroleum products represent one of the main sources of environmental contamination, and these products are complex, composed of several hundred individual hydrocarbons. The evaluation of the risks associated with petroleum products is often limited by certain specific parameters such as benzene. The petroleum hydrocarbons running from C(10) to C(50) are not often integrated in an analysis of the toxological risks since the toxological characterization of a complex mixture of hydrocarbons is difficult to carry out. There exist in the United States two approaches that were developed recently that allow the integration of various hydrocarbons comprising a mixture. In this presentation, two of these approaches are described and compared. An overview of these approaches related to Canadian regulatory bodies is included, and a case study completes the account. The two approaches that are most well known in this area are: 1) that of the Massachusetts Dept. of Environmental Protection, and 2) that of the Total Petroleum Hydrocarbon Criteria Working Group. The integration of petroleum hydrocarbons in a quantitative evaluation of their toxological risk is possible by present methods. This integration allows a reduction in the uncertainty associated with the use of an integrating parameter in the case of these petroleum hydrocarbons in the C(10) to the C(50) range
Modeling of Antenna for Deep Target Hydrocarbon Exploration
Directory of Open Access Journals (Sweden)
Nadeem Nasir
2017-11-01
Full Text Available Nowadays control source electromagnetic method is used for offshore hydrocarbon exploration. Hydrocarbon detection in sea bed logging (SBL is a very challenging task for deep target hydrocarbon reservoir. Response of electromagnetic (EM field from marine environment is very low and it is very difficult to predict deep target reservoir below 2km from the sea floor. This work premise deals with modeling of new antenna for deep water deep target hydrocarbon exploration. Conventional and new EM antennas at 0.125Hz frequency are used in modeling for the detection of deep target hydrocarbon reservoir. The proposed area of the seabed model (40km ´ 40km was simulated by using CST (computer simulation technology EM studio based on Finite Integration Method (FIM. Electromagnetic field components were compared at 500m target depth and it was concluded that Ex and Hz components shows better resistivity contrast. Comparison of conventional and new antenna for different target depths was done in our proposed model. From the results, it was observed that conventional antenna at 0.125Hz shows 70% ,86% resistivity contrast at target depth of 1000m where as new antenna showed 329%, 355% resistivity contrast at the same target depth for Ex and Hz field respectively. It was also investigated that at frequency of0.125Hz, new antenna gave 46% better delineation of hydrocarbon at 4000m target depth. This is due to focusing of electromagnetic waves by using new antenna. New antenna design gave 125% more extra depth than straight antenna for deep target hydrocarbon detection. Numerical modeling for straight and new antenna was also done to know general equation for electromagnetic field behavior with target depth. From this numerical model it was speculated that this new antenna can detect up to 4.5 km target depth. This new EM antenna may open new frontiers for oil and gas
Increased risk of hepatocellular carcinoma in patients with chronic hepatitis C
DEFF Research Database (Denmark)
Hallager, Sofie; Weis, Nina
2014-01-01
Chronic hepatitis C (CHC) frequently leads to cirrhosis with an increased risk of hepatocellular carcinomas (HCC). CHC therapy is currently changing for the better whereas prognosis for HCC remains dismal if not detected early and thus regular screening in cirrhotic CHC patients for HCC...... is recommended. CHC is known to be underdiagnosed in Denmark where it is up to the involved physician to screen for risk factors for CHC and increase the patient's chance of a cure for CHC with therapy....
Studies on hydrocarbon degradation by the bacterial isolate ...
African Journals Online (AJOL)
The hydrocarbon utilizing capability of Stenotrophomonas rhizophila (PM-1), isolated from oil contaminated soil composts from Western Ghats region of Karnataka was analyzed. In the bioremediation experiment, ONGC heavy crude oil and poly aromatic hydrocarbons (PAHs) utilization by the bacterial isolate was studied.
Mechanistic model for microbial growth on hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Mallee, F M; Blanch, H W
1977-12-01
Based on available information describing the transport and consumption of insoluble alkanes, a mechanistic model is proposed for microbial growth on hydrocarbons. The model describes the atypical growth kinetics observed, and has implications in the design of large scale equipment for single cell protein (SCP) manufacture from hydrocarbons. The model presents a framework for comparison of the previously published experimental kinetic data.
Hydrocarbon formation mechanism during uranium monocarbide hydrolysis
International Nuclear Information System (INIS)
Ermolaev, M.I.; Tishchenko, G.V.
1979-01-01
The hydrolysis of uranium monocarbide in oxidative media and in the presence of excessive hydrogen in statu nascendi has been investigated. It was found that oxydants promote the formation of elementary carbon, while in the presence of hydrogen the yield of light C-C hydrocarbons increases. EPR data confirm the radical mechanism of hydrocarbons formation during the decomposition of uranium monocarbide
Process to separate alkali metal salts from alkali metal reacted hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Gordon, John Howard; Alvare, Javier; Larsen, Dennis; Killpack, Jeff
2017-06-27
A process to facilitate gravimetric separation of alkali metal salts, such as alkali metal sulfides and polysulfides, from alkali metal reacted hydrocarbons. The disclosed process is part of a method of upgrading a hydrocarbon feedstock by removing heteroatoms and/or one or more heavy metals from the hydrocarbon feedstock composition. This method reacts the oil feedstock with an alkali metal and an upgradant hydrocarbon. The alkali metal reacts with a portion of the heteroatoms and/or one or more heavy metals to form an inorganic phase containing alkali metal salts and reduced heavy metals, and an upgraded hydrocarbon feedstock. The inorganic phase may be gravimetrically separated from the upgraded hydrocarbon feedstock after mixing at a temperature between about 350.degree. C. to 400.degree. C. for a time period between about 15 minutes and 2 hours.
Process for scavenging hydrogen sulfide from hydrocarbon gases
International Nuclear Information System (INIS)
Fox, I.
1981-01-01
A process for scavenging hydrogen sulfide from hydrocarbon gases utilizes iron oxide particles of unique chemical and physical properties. These particles have large surface area, and are comprised substantially of amorphous Fe 2 O 3 containing a crystalline phase of Fe 2 O 3 , Fe 3 O 4 and combinations thereof. In scavenging hydrogen sulfide, the iron oxide particles are suspended in a liquid which enters into intimate mixing contact with hydrocarbon gases; the hydrogen sulfide is reacted at an exceptional rate and only acid-stable reaction products are formed. Thereafter, the sweetened hydrocarbon gases are collected
Evaluation and performance analysis of hydrocarbon detection methods using hyperspectral data
Lenz, Andreas; Schilling, Hendrik; Gross, Wolfgang; Middelmann, Wolfgang
2015-01-01
Different methods for the detection for hydrocarbons in aerial hyperspectral images are analyzed in this study. The scope is to find a practical method for airborne oil spill mapping on land. Examined are Hydrocarbon index and Hydrocarbon detection index. As well as spectral reidentification algorithms, like Spectral angle mapper, in comparison to the indices. The influence of different ground coverage and different hydrocarbons was tested and evaluated. A ground measurement campaign was cond...
Hydrocarbon Reserves: Abundance or Scarcity
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-07-01
IFP and the OAPEC jointly organize a regular international seminar dealing with world oil-related problems appearing in the news. For the first time, this seminar has been opened to oil and gas company specialists, service companies, research centers and independents. This year's theme concerns oil and gas reserves: are they abundant or are we headed towards the shortages announced by some experts? This theme is especially topical in that: oil and gas currently meet two thirds of world energy needs and almost completely dominate the transport sector; the reserves declared by the OAPEC countries account for nearly half of world reserves; the price of a barrel of oil went through the roof in 2004; world energy demand is growing fast and alternative sources of energy are far from ready to take over from oil and gas in the next few decades. Since the reserves correspond to the volume it is technically and economically viable to produce, the seminar has, of course, dealt with the technical and economic questions that arise in connection with exploration and production, but it has also considered changes in the geopolitical context. Presentations by the leading companies of the OAPEC countries and by the IFP group were completed by presentation from the International Energy Agency (IEA), the United States Geological Survey (USGS), the IHS Energy Group, Total and Gaz de France. This document gathers the transparencies of the following presentations: Hydrocarbon reserves in OAPEC members countries: current and future (M. Al-Lababidi); Non OAPEC liquid reserves and production forecasts (Y. Mathieu); World oil and gas resources and production outlook (K. Chew); Global investments in the upstream (F. Birol); Total's policy in the oil and gas sector (C. de Margerie); Gaz de France's policy in the oil and gas sector (J. Abiteboul); NOC/IOC's opportunities in OPEC countries (I. Sandrea); Relationships between companies, countries and investors: How they may
International Nuclear Information System (INIS)
Parnell, J.; Monson, B.; Tosswill, R.J.
1990-01-01
Nodules of thorium-rich hydrocarbon are recorded in sandstone sequences from several basins. The hydrocarbon nodules contain mineral inclusions, particularly of thorite or monazite. There is evidence both for accretion of hydrocarbons around detrital heavy mineral grains and for epigenetic growth by interaction of hydrocarbons with thorium-bearing fluids. Both mechanisms depend upon the precipitation of solid hydrocarbons induced by irradiation from thorium. The nodules exhibit aggressive replacement of other grains, a characteristic of radioanomalous hydrocarbons. The occurrence of the nodules is dependent upon an appropriate (plutonic) source for the thorium, but given this constraint they are important evidence for hydrocarbon migration pathways. (author)
International Nuclear Information System (INIS)
Song, Jian; Gu, Chun-wei
2015-01-01
The Organic Rankine Cycle (ORC) has been demonstrated to be a promising technology for the recovery of engine waste heat. Systems with hydrocarbons as the working fluids exhibit good thermal performance. However, the flammability of hydrocarbons limits their practical applications because of safety concerns. This paper examines the potential of using mixtures of a hydrocarbon and a retardant in an ORC system for engine waste heat recovery. Refrigerants R141b and R11 are selected as the retardants and blended with the hydrocarbons to form zeotropic mixtures. The flammability is suppressed, and in addition, zeotropic mixtures provide better temperature matches with the heat source and sink, which reduces the exergy loss within the heat exchange processes, thereby increasing the cycle efficiency. Energetic and exergetic analysis of ORC systems with pure hydrocarbons and with mixtures of a hydrocarbon and a retardant are conducted and compared. The net power output and the second law efficiency are chosen as the evaluation criteria to select the suitable working fluid compositions and to define the optimal set of thermodynamic parameters. The simulation results reveal that the ORC system with cyclohexane/R141b (0.5/0.5) is optimal for this engine waste heat recovery case, thereby increasing the net power output of the system by 13.3% compared to pure cyclohexane. - Highlights: • ORC with zeotropic mixtures for engine waste heat recovery is discussed. • Energetic and exergetic analysis of ORC system are conducted. • Optimal mixture working fluid composition is identified. • Greater utilization of jacket water and lower irreversible loss are important.
Velocity Dependence of Friction of Confined Hydrocarbons
DEFF Research Database (Denmark)
Sivebæk, Ion Marius; Samoilov, Vladimir N.; Persson, Bo N. J.
2010-01-01
We present molecular dynamics friction calculations for confined hydrocarbon “polymer” solids with molecular lengths from 20 to 1400 carbon atoms. Two cases are considered: (a) polymer sliding against a hard substrate and (b) polymer sliding on polymer. We discuss the velocity dependence of the f......We present molecular dynamics friction calculations for confined hydrocarbon “polymer” solids with molecular lengths from 20 to 1400 carbon atoms. Two cases are considered: (a) polymer sliding against a hard substrate and (b) polymer sliding on polymer. We discuss the velocity dependence...... of the frictional shear stress for both cases. In our simulations, the polymer films are very thin (∼3 nm), and the solid walls are connected to a thermostat at a short distance from the polymer slab. Under these circumstances we find that frictional heating effects are not important, and the effective temperature...... in the polymer film is always close to the thermostat temperature. In the first setup (a), for hydrocarbons with molecular lengths from 60 to 1400 carbon atoms, the shear stresses are nearly independent of molecular length, but for the shortest hydrocarbon C20H42 the frictional shear stress is lower. In all...
The presence of hydrocarbons in southeast Norway
DEFF Research Database (Denmark)
Hanken, Niels Martin; Hansen, Malene Dolberg; Kresten Nielsen, Jesper
Hydrocarbons, mostly found as solid pyrobitumen, are known from more than 30 localities in southeast Norway. They occur as inclusions in a wide range of "reservoir rocks" spanning from Permo-Carboniferous breccias to veins (vein quartz and calcite veins) in Precambrian granites, gneisses and amph......Hydrocarbons, mostly found as solid pyrobitumen, are known from more than 30 localities in southeast Norway. They occur as inclusions in a wide range of "reservoir rocks" spanning from Permo-Carboniferous breccias to veins (vein quartz and calcite veins) in Precambrian granites, gneisses......, indicating that Alum Shale was the most important source rock. Petrographic investigations combined with stable isotope analyses (d13C and d18O) of the cement containing pyrobitumen indicate two phases of hydrocarbon migration. The first phase probably took place in Upper Silurian to Lower Devonian time......, when the Alum Shale entered the oil window. These hydrocarbons are mostly found as pyrobitumen in primary voids and calcite cemented veins in Cambro-Silurian sedimentary deposits. The second phase is probably of Late Carboniferous/Permian age and was due to the increased heat flow during the formation...
Geochemical assessment of light gaseous hydrocarbons in near ...
Indian Academy of Sciences (India)
Light hydrocarbons in soil have been used as direct indicators in geochemical hydrocarbon exploration, which remains an unconventional path in the petroleum industry. The occurrence of adsorbed soil ... Kalpana1 D J Patil1 A M Dayal1. National Geophysical Research Institute, Uppal Road, Hyderabad 500606, India.
Hydrocarbon uptake and loss by the mussel Mytilus edulis
Energy Technology Data Exchange (ETDEWEB)
Fossato, V U; Canzonier, W J
1976-01-01
The dynamics of accumulation and elimination of hydrocarbons by the blue mussel Mytilus edulis were studied in a continuous-flow system. Mussels were exposed for as long as 41 days to 200 to 400 ..mu..g/l of diesel fuel adsorbed on kaolin particles. Hydrocarbons were accumulated in the tissues in excess of 1000 times the exposure levels. Upon termination of dosing, the mussels exhibited a rather rapid loss of hydrocarbons for the first 15 to 20 days (biological half-life = 2.7 to 3.5 days). Subsequently, however, elimination was reduced to a minimum and a considerable fraction of the hydrocarbons could be recovered from the tissues after as long as 32 days of depuration. The mussels exhibited definite signs of physiological stress due to chronic exposure to diesel fuel, although recovery was rapid upon termination of dosing. It is concluded that mussels could be utilized as a test organism for monitoring long-term hydrocarbon pollution in marine waters. The implications for the mussel culture industry are discussed.
The origin of high hydrocarbon groundwater in shallow Triassic aquifer in Northwest Guizhou, China.
Liu, Shan; Qi, Shihua; Luo, Zhaohui; Liu, Fangzhi; Ding, Yang; Huang, Huanfang; Chen, Zhihua; Cheng, Shenggao
2018-02-01
Original high hydrocarbon groundwater represents a kind of groundwater in which hydrocarbon concentration exceeds 0.05 mg/L. The original high hydrocarbon will significantly reduce the environment capacity of hydrocarbon and lead environmental problems. For the past 5 years, we have carried out for a long-term monitoring of groundwater in shallow Triassic aquifer in Northwest Guizhou, China. We found the concentration of petroleum hydrocarbon was always above 0.05 mg/L. The low-level anthropogenic contamination cannot produce high hydrocarbon groundwater in the area. By using hydrocarbon potential, geochemistry and biomarker characteristic in rocks and shallow groundwater, we carried out a comprehensive study in Dalongjing (DLJ) groundwater system to determine the hydrocarbon source. We found a simplex hydrogeology setting, high-level water-rock-hydrocarbon interaction and obviously original hydrocarbon groundwater in DLJ system. The concentration of petroleum hydrocarbon in shallow aquifer was found to increase with the strong water-rock interaction. Higher hydrocarbon potential was found in the upper of Guanling formation (T 2 g 3 ) and upper of Yongningzhen formation (T 1 yn 4 ). Heavily saturated carbon was observed from shallow groundwater, which presented similar distribution to those from rocks, especially from the deeper groundwater. These results indicated that the high concentrations of original hydrocarbon in groundwater could be due to the hydrocarbon release from corrosion and extraction out of strata over time.
Condensation Mechanism of Hydrocarbon Field Formation.
Batalin, Oleg; Vafina, Nailya
2017-08-31
Petroleum geology explains how hydrocarbon fluids are generated, but there is a lack of understanding regarding how oil is expelled from source rocks and migrates to a reservoir. To clarify the process, the multi-layer Urengoy field in Western Siberia was investigated. Based on this example, we have identified an alternative mechanism of hydrocarbon field formation, in which oil and gas accumulations result from the phase separation of an upward hydrocarbon flow. There is evidence that the flow is generated by the gases released by secondary kerogen destruction. This study demonstrates that oil components are carried by the gas flow and that when the flow reaches a low-pressure zone, it condenses into a liquid with real oil properties. The transportation of oil components in the gas flow provides a natural explanation for the unresolved issues of petroleum geology concerning the migration process. The condensation mechanism can be considered as the main process of oil field formation.
Preparing valuable hydrocarbons by hydrogenation
Energy Technology Data Exchange (ETDEWEB)
Pier, M
1930-08-22
A process is described for the preparation of valuable hydrocarbons by treatment of carbonaceous materials, like coal, tars, minerals oils, and their distillation and conversion products, and for refining of liquid hydrocarbon mixture obtained at raised temperature and under pressure, preferably in the presence of catalysts, by the use of hydrogen-containing gases, purified and obtained by distilling solid combustibles, characterized by the purification of the hydrogen-containing gases being accomplished for the purpose of practically complete removal of the oxygen by heating at ordinary or higher pressure in the presence of a catalyst containing silver and oxides of metals of group VI of the periodic system.
In Situ Hydrocarbon Degradation by Indigenous Nearshore Bacterial Populations
International Nuclear Information System (INIS)
Cherrier, J.
2005-01-01
Potential episodic hydrocarbon inputs associated with oil mining and transportation together with chronic introduction of hydrocarbons via urban runoff into the relatively pristine coastal Florida waters poses a significant threat to Florida's fragile marine environment. It is therefore important to understand the extent to which indigenous bacterial populations are able to degrade hydrocarbon compounds and also determine factors that could potentially control and promote the rate at which these compounds are broken down in situ. Previous controlled laboratory experiments carried out by our research group demonstrated that separately both photo-oxidation and cometabolism stimulate bacterial hydrocarbon degradation by natural bacterial assemblages collected from a chronically petroleum contaminated site in Bayboro Bay, Florida. Additionally, we also demonstrated that stable carbon and radiocarbon abundances of respired CO 2 could be used to trace in situ hydrocarbon degradation by indigenous bacterial populations at this same site. This current proposal had two main objectives: (a) to evaluate the cumulative impact of cometabolism and photo-oxidation on hydrocarbon degradation by natural bacterial assemblages collected the same site in Bayboro Bay, Florida and (b) to determine if in situ hydrocarbon degradation by indigenous bacterial populations this site could be traced using natural radiocarbon and stable carbon abundances of assimilated bacterial carbon. Funds were used for 2 years of full support for one ESI Ph.D. student, April Croxton. To address our first objective a series of closed system bacterial incubations were carried out using photo-oxidized petroleum and pinfish (i.e. cometabolite). Bacterial production of CO 2 was used as the indicator of hydrocarbon degradation and (delta) 13 C analysis of the resultant CO 2 was used to evaluate the source of the respired CO 2 (i.e. petroleum hydrocarbons or the pinfish cometabolite). Results from these time
Insights into hydrocarbon formation by nitrogenase cofactor homologs.
Lee, Chi Chung; Hu, Yilin; Ribbe, Markus W
2015-04-14
The L-cluster is an all-iron homolog of nitrogenase cofactors. Driven by europium(II) diethylenetriaminepentaacetate [Eu(II)-DTPA], the isolated L-cluster is capable of ATP-independent reduction of CO and CN(-) to C1 to C4 and C1 to C6 hydrocarbons, respectively. Compared to its cofactor homologs, the L-cluster generates considerably more CH4 from the reduction of CO and CN(-), which could be explained by the presence of a "free" Fe atom that is "unmasked" by homocitrate as an additional site for methanation. Moreover, the elevated CH4 formation is accompanied by a decrease in the amount of longer hydrocarbons and/or the lengths of the hydrocarbon products, illustrating a competition between CH4 formation/release and C-C coupling/chain extension. These observations suggest the possibility of designing simpler synthetic clusters for hydrocarbon formation while establishing the L-cluster as a platform for mechanistic investigations of CO and CN(-) reduction without complications originating from the heterometal and homocitrate components. Nitrogenase is a metalloenzyme that is highly complex in structure and uniquely versatile in function. It catalyzes two reactions that parallel two important industrial processes: the reduction of nitrogen to ammonia, which parallels the Haber-Bosch process in ammonia production, and the reduction of carbon monoxide to hydrocarbons, which parallels the Fischer-Tropsch process in fuel production. Thus, the significance of nitrogenase can be appreciated from the perspective of the useful products it generates: (i) ammonia, the "fixed" nitrogen that is essential for the existence of the entire human population; and (ii) hydrocarbons, the "recycled" carbon fuel that could be used to directly address the worldwide energy shortage. This article provides initial insights into the catalytic characteristics of various nitrogenase cofactors in hydrocarbon formation. The reported assay system provides a useful tool for mechanistic
Energy Technology Data Exchange (ETDEWEB)
Yuan, Dingsheng [Department of Chemistry and Institute of Nanochemistry, Jinan University, Guangzhou 510632 (China); State Key Laboratories of Optoelectronic Materials and Technologies, School of Physics and Engineering, Sun Yat-Sen University, Guangzhou 510275 (China); Xu, Changwei; Liu, Yingliang; Tan, Shaozao [Department of Chemistry and Institute of Nanochemistry, Jinan University, Guangzhou 510632 (China); Wang, Xin [School of Chemical and Biomedical Engineering, Nanyang Technological University, Singapore 639798 (Singapore); Wei, Zidong [School of Chemical Engineering, Chongqing University, Chongqing 400044 (China); Shen, Pei Kang [State Key Laboratories of Optoelectronic Materials and Technologies, School of Physics and Engineering, Sun Yat-Sen University, Guangzhou 510275 (China)
2007-10-15
The coin-like hollow carbon (CHC) has been synthesized by only using ethanol as the carbon source with a novel Mg/NiCl{sub 2} catalytic system via a facile solvothermal method for the first time. The CHC synthesized at optimized conditions shows an average thickness of less than 154 nm and the coin diameter of 1-3 {mu}m. The CHC is characterized by SEM, TEM, XRD and electrochemical techniques. Pd on CHC (denotes as Pd/CHC) electrocatalysts are prepared for methanol oxidation in alkaline media. The Pd/CHC electrocatalyst gives a mass activity of 2930 A g{sup -1} Pd for methanol oxidation against 870 A g{sup -1} Pd on Pd/C electrocatalyst. One main reason for the higher mass activity of the Pd/CHC is the higher electrochemical active surface area (EASA) of the Pd/CHC. (author)
Diesel-related hydrocarbons can dominate gas phase reactive carbon in megacities
Directory of Open Access Journals (Sweden)
R. E. Dunmore
2015-09-01
Full Text Available Hydrocarbons are key precursors to two priority air pollutants, ozone and particulate matter. Those with two to seven carbons have historically been straightforward to observe and have been successfully reduced in many developed cities through air quality policy interventions. Longer chain hydrocarbons released from diesel vehicles are not considered explicitly as part of air quality strategies and there are few direct measurements of their gaseous abundance in the atmosphere. This study describes the chemically comprehensive and continuous measurements of organic compounds in a developed megacity (London, which demonstrate that on a seasonal median basis, diesel-related hydrocarbons represent only 20–30 % of the total hydrocarbon mixing ratio but comprise more than 50 % of the atmospheric hydrocarbon mass and are a dominant local source of secondary organic aerosols. This study shows for the first time that 60 % of the winter primary hydrocarbon hydroxyl radical reactivity is from diesel-related hydrocarbons and using the maximum incremental reactivity scale, we predict that they contribute up to 50 % of the ozone production potential in London. Comparing real-world urban composition with regulatory emissions inventories in the UK and US highlights a previously unaccounted for, but very significant, under-reporting of diesel-related hydrocarbons; an underestimation of a factor ~4 for C9 species rising to a factor of over 70 for C12 during winter. These observations show that hydrocarbons from diesel vehicles can dominate gas phase reactive carbon in cities with high diesel fleet fractions. Future control of urban particulate matter and ozone in such locations requires a shift in policy focus onto gas phase hydrocarbons released from diesels as this vehicle type continues to displace gasoline world-wide.
A PROCESS FOR THE CATALYTIC OXIDATION OF HYDROCARBONS
DEFF Research Database (Denmark)
1999-01-01
A process for producing an alcohol from a gaseous hydrocarbon, e.g. a lower alkane such as methane, via oxidative reaction of the hydrocarbon in a concentrated sulfuric acid medium in the presence of a catalyst employs an added catalyst comprising a substance selected from iodine, iodine compounds...
YAN, BEIZHAN; ABRAJANO, TEOFILO A.; BOPP, RICHARD F.; CHAKY, DAMON A.; BENEDICT, LUCILLE A.; CHILLRUD, STEVEN N.
2011-01-01
Saturated hydrocarbons (SH) and polycyclic aromatic hydrocarbons (PAHs) have been quantified in a sediment core obtained from Central Park Lake, New York City. Radionuclides 210Pb and 137Cs were used to assign approximate dates to each individual section in the core. The dating profile based on 210Pb matches very well with the time constraints provided by 137Cs. Radionuclide-derived depositional dates are consistent with temporal information from the petroleum-indicator ratio U/R [the ratio of unresolved complex mixture (UCM) to saturated hydrocarbons in the aliphatic fraction] and the history of fuel use in the NYC area. Ratios of 1,7-dimethylphenanthrane (DMP) to 1,7-DMP plus 2,6-DMP [1,7/(1,7 + 2,6)-DMP], retene to retene plus chrysene [Ret/(Ret + Chy)], and fluoranthene to fluoranthene plus pyrene [Fl/(Fl + Py)] provide additional source discrimination throughout the core. Results show that the ratio U/R is sensitive to petroleum inputs and Ret/(Ret + Chy) is responsive to contributions from softwood combustion, whereas both Fl/(Fl + Py) and 1,7/(1,7 + 2,6)-DMP can be used to discriminate among wood, coal, and petroleum combustion sources. Combined use of these ratios suggests that in New York City, wood combustion dominated 100 years ago, with a shift to coal combustion occurring from the 1900s to the 1950s. Petroleum use began around the 1920s and has dominated since the 1940s. PMID:16201624
Directory of Open Access Journals (Sweden)
Nikole Elizabeth Kimes
2013-03-01
Full Text Available Marine subsurface environments, such as deep-sea sediments, house abundant and diverse microbial communities that are believed to influence large-scale geochemical processes. These processes include the biotransformation and mineralization of numerous petroleum constituents. Thus, microbial communities in the Gulf of Mexico are thought to be responsible for the intrinsic bioremediation of crude oil released by the Deepwater Horizon (DWH oil spill. While hydrocarbon contamination is known to enrich for aerobic, oil-degrading bacteria in deep-seawater habitats, relatively little is known about the response of communities in deep-sea sediments, where low oxygen levels may hinder such a response. Here, we examined the hypothesis that increased hydrocarbon exposure results in an altered sediment microbial community structure that reflects the prospects for oil biodegradation under the prevailing conditions. We explore this hypothesis using metagenomic analysis and metabolite profiling of deep-sea sediment samples following the DWH oil spill. The presence of aerobic microbial communities and associated functional genes was consistent among all samples, whereas, a greater number of Deltaproteobacteria and anaerobic functional genes were found in sediments closest to the DWH blowout site. Metabolite profiling also revealed a greater number of putative metabolites in sediments surrounding the blowout zone relative to a background site located 127 km away. The mass spectral analysis of the putative metabolites revealed that alkylsuccinates remained below detection levels, but a homologous series of benzylsuccinates (with carbon chain lengths from 5 to 10 could be detected. Our findings suggest that increased exposure to hydrocarbons enriches for Deltaproteobacteria, which are known to be capable of anaerobic hydrocarbon metabolism. We also provide evidence for an active microbial community metabolizing aromatic hydrocarbons in deep-sea sediments of the
Injection halos of hydrocarbons above oil-gas fields with super-high pressures
Energy Technology Data Exchange (ETDEWEB)
Bakhtin, V.V.
1979-09-01
We studied the origin of injection halos of hydrocarbons above oil-gas fields with anomalously high formation pressures (AHFP). Using fields in Azerbaydzhan and Chechen-Ingushetiya as an example, we demonstrate the effect of certain factors (in particular, faults and zones of increased macro- and micro-jointing) on the morpholoy of the halos. The intensity of micro-jointing (jointing permeability, three-dimensional density of micro-jointing) is directly connected with vertical dimensions of the halos. We measured halos based on transverse profiles across the Khayan-Kort field and studied the distribution of bitumen saturation within the injection halo. Discovery of injection halos during drilling has enabled us to improve the technology of wiring deep-seated exploratory wells for oil and gas in regions with development of AHFP.
EVALUATION OF PETROLEUM HYDROCARBONS ELUTION FROM SOIL
Directory of Open Access Journals (Sweden)
Janina Piekutin
2015-06-01
Full Text Available The paper presents studies on oil removal from soil by means of water elution with a help of shaking out the contaminants from the soil. The tests were performed on simulated soil samples contaminated with a mixture of petroleum hydrocarbons. The study consisted in recording the time influence and the number of elution cycles to remove contaminants from the soil. The samples were then subject to the determination of petroleum hydrocarbons, aliphatic hydrocarbons, and BTEX compounds (benzene, toluene, ethylbenzene, xylene. Due to adding various concentrations of petroleum into particular soil samples and applying different shaking times, it was possible to find out the impact of petroleum content and sample shaking duration on the course and possibility of petroleum substances removal by means of elution process.
Influence of adhesion on aerobic biodegradation and bioremediation of liquid hydrocarbons.
Abbasnezhad, Hassan; Gray, Murray; Foght, Julia M
2011-11-01
Biodegradation of poorly water-soluble liquid hydrocarbons is often limited by low availability of the substrate to microbes. Adhesion of microorganisms to an oil-water interface can enhance this availability, whereas detaching cells from the interface can reduce the rate of biodegradation. The capability of microbes to adhere to the interface is not limited to hydrocarbon degraders, nor is it the only mechanism to enable rapid uptake of hydrocarbons, but it represents a common strategy. This review of the literature indicates that microbial adhesion can benefit growth on and biodegradation of very poorly water-soluble hydrocarbons such as n-alkanes and large polycyclic aromatic hydrocarbons dissolved in a non-aqueous phase. Adhesion is particularly important when the hydrocarbons are not emulsified, giving limited interfacial area between the two liquid phases. When mixed communities are involved in biodegradation, the ability of cells to adhere to the interface can enable selective growth and enhance bioremediation with time. The critical challenge in understanding the relationship between growth rate and biodegradation rate for adherent bacteria is to accurately measure and observe the population that resides at the interface of the hydrocarbon phase. © Springer-Verlag 2011
Abd El-Kader, Shehab M; Al-Jiffri, Osama H; Al-Shreef, Fadwa M
2014-06-01
Chronic hepatitis C (CHC) is a medical condition that has broad implications for a person's physical and psychological health. The aim of this study was to detect changes in liver enzymes and psychological well-being in response to aerobic exercise training in patients with CHC. Fifty CHC patients were included in two equal groups. The first group (A) received aerobic exercise training in addition to their regular medical treatment. The second group (B) received no training and only has their regular medical treatment. The program consisted of three sessions per week for three months. There was a significant decrease in mean values of Alkaline Phosphatase (ALP), Alanine Aminotransferase (ALT), Aspartate Aminotransferase (AST), Gamma - Glutamyltransferase (GGT), Beck Depression Inventory (BDI ) & Profile of Mood States(POMS) and increase in Rosenberg Self-Esteem Scale (RSES) in group (A) after treatments, but the changes in group (B) were not significant. Also, there were significant differences between mean levels of the investigated parameters in group (A) and group (B) at the end of the study. Aerobic exercise training improves hepatic enzymes and psychological well-being in patients with chronic hepatitis C.
International Nuclear Information System (INIS)
Sauer, T.C.; Brown, J.S.; Boehm, P.D.
1993-01-01
Recent advances in analytical instrumental hardware and software have permitted the use of more sophisticated approaches in identifying or fingerprinting sources of hydrocarbons in complex matrix environments. In natural resource damage assessments and contaminated site investigations of both terrestrial and aquatic environments, chemical fingerprinting has become an important interpretative tool. The alkyl homologues of the major polycyclic and heterocyclic aromatic hydrocarbons (e.g., phenanthrenes/anthracenes, dibenzothiophenes, chrysenes) have been found to the most valuable hydrocarbons in differentiating hydrocarbon sources, but there are other hydrocarbon analytes, such as the chemical biomarkers steranes and triterpanes, and alkyl homologues of benzene, and chemical methodologies, such as scanning UV fluorescence, that have been found to be useful in certain environments. This presentation will focus on recent data interpretative approaches for hydrocarbon source identification assessments. Selection of appropriate targets analytes and data quality requirements will be discussed and example cases including the Arabian Gulf War oil spill results will be presented
Response of microalgae from mud-flats to petroleum hydrocarbons ...
African Journals Online (AJOL)
SERVER
2008-03-04
Mar 4, 2008 ... hydrocarbons in the presence of nitrogenous fertilizer ... the hydrocarbon, there was delayed nutrient uptake. ... waters, but the use of inorganic of organic nitrogen in ... ment, fish kills as oxygen is depleted, offensive odour.
Hydrocarbon composition products of the catalytic recycling plastics waste
Directory of Open Access Journals (Sweden)
Zhaksyntay Kairbekov
2013-09-01
Full Text Available The paper represents the IR spectroscopy results of the hydrocarbon composition of products, which is obtained from catalytic processing of plastic wastes. The optimal conditions for the hydrogenation with to producny liquid of products are identified. These liquid products are enriched with aromatics, paraffinic- naphthenic and unsaturated hydrocarbons. The main characteristics of the distillates received by hydrogenation of plastics (as density, refractive index, iodine number, pour point, cloud point, filtering, sulfur content, fractional and composition of the hydrocarbon group.
Formation of hydrocarbons by bacteria and algae
Energy Technology Data Exchange (ETDEWEB)
Tornabene, T.G.
1980-12-01
A literature review has been performed summarizing studies on hydrocarbon synthesis by microorganisms. Certain algal and bacterial species produce hydrocarbons in large quantities, 70 to 80% of dry cell mass, when in a controlled environment. The nutritional requirements of these organisms are simple: CO/sub 2/ and mineral salts. The studies were initiated to determine whether or not microorganisms played a role in petroleum formation. 90 references. (DMC)
Zeolitic catalytic conversion of alcohols to hydrocarbons
Narula, Chaitanya K.; Davison, Brian H.; Keller, Martin
2018-04-10
A method for converting an alcohol to a hydrocarbon, the method comprising contacting said alcohol with a metal-loaded zeolite catalyst at a temperature of at least 100.degree. C. and up to 550.degree. C., wherein said alcohol can be produced by a fermentation process, said metal is a positively-charged metal ion, and said metal-loaded zeolite catalyst is catalytically active for converting said alcohol to said hydrocarbon.
Microbial Hydrocarbon and ToxicPollutant Degradation Method
Energy Technology Data Exchange (ETDEWEB)
Schlueter, Dietrich [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Janabi, Mustafa [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); O' Neil, James [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Budinger, Thomas [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2011-08-16
The goal of this project is to determine optimum conditions for bacterial oxidation of hydrocarbons and long-chain alkanes that are representative of petroleum contamination of the environment. Polycyclic Aromatic Hydrocarbons (PAHs) are of concern because of their toxicity, low volatility, and resistance to microbial degradation, especially under anaerobic conditions. The uniqueness of our approach is to use carbon-11 in lieu of the traditional use of carbon-14.
Zeolitic catalytic conversion of alochols to hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Narula, Chaitanya K.; Davison, Brian H.; Keller, Martin
2017-01-03
A method for converting an alcohol to a hydrocarbon, the method comprising contacting said alcohol with a metal-loaded zeolite catalyst at a temperature of at least 100.degree. C. and up to 550.degree. C., wherein said alcohol can be produced by a fermentation process, said metal is a positively-charged metal ion, and said metal-loaded zeolite catalyst is catalytically active for converting said alcohol to said hydrocarbon.
International Nuclear Information System (INIS)
Perez Garcia, M.M.; Perez Pastor, R.M.; Bea, J.F.; Campos, A.; Gonzalez Diaz, D.
1990-01-01
A study on daily concentration changes of polycyclic aromatic and aliphatic hydrocarbons (PAH's and AH's), was carried out in aerosols sampled in the Ciudad Universitaria of Madrid. Samples were taken at morning and night during February and June, for short sampling times, on glass fiber filters in Hi-Vol samplers, and then extracted ultrasonically with cyclohexane. Analysis were performed by HRGC with fused-silica capillary columns. The variable traffic rate, and the strong influence during winter periods of domestic heating are characteristic of this place. The aim of this work was to evaluate diurnal and seasonal variations of selected AH and PAH in the urban area of Madrid, by using descriptive parameters, such as total concentrations of AH and PAH, characteristic profiles and predominance carbon index. From these results, it has been tried to identify emission sources of the studied hydrocarbons. (Author). 10 refs
Receptor Model Source Apportionment of Nonmethane Hydrocarbons in Mexico City
Directory of Open Access Journals (Sweden)
V. Mugica
2002-01-01
Full Text Available With the purpose of estimating the source contributions of nonmethane hydrocarbons (NMHC to the atmosphere at three different sites in the Mexico City Metropolitan Area, 92 ambient air samples were measured from February 23 to March 22 of 1997. Light- and heavy-duty vehicular profiles were determined to differentiate the NMHC contribution of diesel and gasoline to the atmosphere. Food cooking source profiles were also determined for chemical mass balance receptor model application. Initial source contribution estimates were carried out to determine the adequate combination of source profiles and fitting species. Ambient samples of NMHC were apportioned to motor vehicle exhaust, gasoline vapor, handling and distribution of liquefied petroleum gas (LP gas, asphalt operations, painting operations, landfills, and food cooking. Both gasoline and diesel motor vehicle exhaust were the major NMHC contributors for all sites and times, with a percentage of up to 75%. The average motor vehicle exhaust contributions increased during the day. In contrast, LP gas contribution was higher during the morning than in the afternoon. Apportionment for the most abundant individual NMHC showed that the vehicular source is the major contributor to acetylene, ethylene, pentanes, n-hexane, toluene, and xylenes, while handling and distribution of LP gas was the major source contributor to propane and butanes. Comparison between CMB estimates of NMHC and the emission inventory showed a good agreement for vehicles, handling and distribution of LP gas, and painting operations; nevertheless, emissions from diesel exhaust and asphalt operations showed differences, and the results suggest that these emissions could be underestimated.
Remediation of hydrocarbons in crude oil-contaminated soils using Fenton's reagent.
Ojinnaka, Chukwunonye; Osuji, Leo; Achugasim, Ozioma
2012-11-01
Sandy soil samples spiked with Bonny light crude oil were subsequently treated with Fenton's reagent at acidic, neutral, and basic pH ranges. Oil extracts from these samples including an untreated one were analyzed 1 week later with a gas chromatograph to provide evidence of hydrocarbon depletion by the oxidant. The reduction of three broad hydrocarbon groups-total petroleum hydrocarbon (TPH); benzene, toluene, ethylbenzene, and xylene (BTEX); and polycyclic aromatic hydrocarbon (PAH) were investigated at various pHs. Hydrocarbon removal was efficient, with treatment at the acidic pH giving the highest removal of about 96% for PAH, 99% for BTEX, and some TPH components experiencing complete disappearance. The four-ringed PAHs were depleted more than their three-ringed counterparts at the studied pH ranges.
Plasma-catalytic reforming of liquid hydrocarbons
International Nuclear Information System (INIS)
Nedybaliuk, O.A.; Chernyak, V.Ya; Kolgan, V.V.; Iukhymenko, V.V.; Solomenko, O.V.; Fedirchyk, I.I.; Martysh, E.V.; Demchina, V.P.; Klochok, N.V.; Dragnev, S.V.
2015-01-01
The series of experiments studying the plasma-catalytic reforming of liquid hydrocarbons was carried out. The dynamic plasma-liquid system based on a low-power rotating gliding arc with solid electrodes was used for the investigation of liquid hydrocarbons reforming process. Conversion was done via partial oxidation. A part of oxidant flow was activated by the discharge. Synthesis-gas composition was analysed by means of mass-spectrometry and gas-chromatography. A standard boiler, which operates on natural gas and LPG, was used for the burning of synthesis-gas
Thraustochytrid protists degrade hydrocarbons
Digital Repository Service at National Institute of Oceanography (India)
Raikar, M.T.; Raghukumar, S.; Vani, V.; David, J.J.; Chandramohan, D.
isolation tubes with crude oil. Three isolates tested showed positive hydrophobicity of cell walls as judged by the Microbial Adhesion to Hydrocarbons (MATH) assay. Addition of Bombay High crude oil to nutrient broth slightly enhanced growth of the protists...
Detailed profiling of CNTs arrays along the growth window in a floating catalyst reactor
International Nuclear Information System (INIS)
Maghrebi, Morteza; Khodadadi, Abbas Ali; Mortazavi, Yadollah; Mhaisalkar, Subodh
2009-01-01
We report a detailed longitudinal and depth profiles of multi-wall carbon nanotubes (CNTs) arrays synthesized using xylene and ferrocene in a floating catalyst reactor. Point to point analyses of the CNTs grown in a 'growth window' with CNTs arrays longer than 0.5 mm were performed using optical microscopy, Raman spectroscopy, FESEM, high-resolution TGA/DTA, and TEM techniques. The heights of the CNTs arrays show a maximum at a mid point of the growth window, while a reverse trend of minimum is observed for iron-to-CNTs atomic ratios. The ratio of amorphous carbon to CNTs sharply increases along the growth window and from the bottom to top of CNTs arrays. The CNTs diameter also increases along the growth window, due to deposition of the amorphous carbon, which can be almost removed by temperature programmed oxidation up to around 500 deg. C. A base growth mechanism, the variations of catalyst content, residence time and temperature profile along the growth window, the adsorption and decomposition of polycyclic aromatic hydrocarbons to amorphous carbon, and a limited diffusion of hydrocarbon species through the arrays covered by excessive amorphous carbon may explain the results.
Microbial production of gaseous hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Fukuda, Hideo
1987-10-20
Microbial production of ethylene, isobutane and a saturated gaseous hydrocarbon mixture was described. Microbial ethylene production was studied with Penicillium digitatum IFO 9372 and a novel pathway of the ethylene biosynthesis through alpha-ketoglutarate was proposed. Rhodotorula minuta IFO 1102 was selected for the microbial production of isobutane and the interesting actions of L-leucine and L-phenylalanine for the isobutane production were found. It was finally presented about the microbial production of a saturated gaseous hydrocarbon mixture with Rhizopus japonicus IFO 4758 was described. A gas mixture was produced through a chemical reaction of SH compounds and some cellular component such as squalene under aerobic conditions. (4 figs, 7 tabs, 41 refs)
Site characterization and petroleum hydrocarbon plume mapping
Energy Technology Data Exchange (ETDEWEB)
Ravishankar, K. [Harding Lawson Associates, Houston, TX (United States)
1996-12-31
This paper presents a case study of site characterization and hydrocarbon contamination plume mapping/delineation in a gas processing plant in southern Mexico. The paper describes innovative and cost-effective use of passive (non-intrusive) and active (intrusive) techniques, including the use of compound-specific analytical methods for site characterization. The techniques used, on a demonstrative basis, include geophysical, geochemical, and borehole drilling. Geochemical techniques used to delineate the horizontal extent of hydrocarbon contamination at the site include soil gas surveys. The borehole drilling technique used to assess the vertical extent of contamination and confirm geophysical and geochemical data combines conventional hollow-stem auguring with direct push-probe using Geoprobe. Compound-specific analytical methods, such as hydrocarbon fingerprinting and a modified method for gasoline range organics, demonstrate the inherent merit and need for such analyses to properly characterize a site, while revealing the limitations of noncompound-specific total petroleum hydrocarbon analysis. The results indicate that the techniques used in tandem can properly delineate the nature and extent of contamination at a site; often supplement or complement data, while reducing the risk of errors and omissions during the assessment phase; and provide data constructively to focus site-specific remediation efforts. 7 figs.
First principles modeling of hydrocarbons conversion in non-equilibrium plasma
Energy Technology Data Exchange (ETDEWEB)
Deminsky, M.A.; Strelkova, M.I.; Durov, S.G.; Jivotov, V.K.; Rusanov, V.D.; Potapkin, B.V. [Russian Research Centre Kurchatov Inst., Moscow (Russian Federation)
2001-07-01
Theoretical justification of catalytic activity of non-equilibrium plasma in hydrocarbons conversion process is presented in this paper. The detailed model of highest hydrocarbons conversion includes the gas-phase reactions, chemistry of the growth of polycyclic aromatic hydrocarbons (PAHs), precursor of soot particles formation, neutral, charged clusters and soot particle formation, ion-molecular gas-phase and heterogeneous chemistry. The results of theoretical analysis are compared with experimental results. (authors)
International Nuclear Information System (INIS)
Zhang Zhihuan; He Fengpeng; Bu Qingwei; Lu Song
2008-01-01
Vertical distribution of the concentration and composition of some sulfur and oxygen heterocyclic aromatic hydrocarbons (SOHAHs), such as, fluorene, dibenzofuran, dibenzothiophene and their alkyl homologues in 10 soil profiles in Beijing have been investigated. The results showed that the concentrations and composition of SOHAHs in topsoil (0-30 cm) from different profiles are different. The concentrations of SOHAHs in topsoils are much higher than that in bottom soils where the concentrations are relatively constant. The fingerprints of SOHAHs from same profile are similar in topsoil samples, which are obviously different at the deep part, which suggested that the sources of these compounds are consistent in topsoil and are discriminating between surface and bottom soils. The main sources of SOHAHs in surface soil were fossil fuel combustion, petroleum and wastewater irrigation, while those at deep part were likely derived from the degradation products of soil organic matters. - The vertical distribution of SOHAHs was provided and possible sources were different between topsoils and deep part
Qiao, Yuan; Li, Qiang; Du, Hong-Yang; Wang, Qiao-Wei; Huang, Ye; Liu, Wei
2017-07-01
Accumulating evidence suggests that polycyclic aromatic hydrocarbons (PAH) which adsorbed on the surface of ambient air particulate matters (PM), are the major toxic compound to cause cardiovascular and respiratory diseases, even cancer. However, its detrimental effects on human skin cell remain unclear. Here, we demonstrated that SRM1649b, a reference urban dust material of PAH, triggers human skin cells aging through cell cycle arrest, cell growth inhibition and apoptosis. Principally, SRM1649b facilitated Aryl hydrocarbon receptor (AhR) translocated into nucleus, subsequently activated ERK/MAPK signaling pathway, and upregulated aging-related genes expression. Most important, we found that AhR antagonist efficiently revert the aging of skin cells. Thus our novel findings firstly revealed the mechanism of skin aging under PAH contamination and provided potential strategy for clinical application. Copyright © 2017. Published by Elsevier Inc.
Direct electroreduction of CO2 into hydrocarbon
International Nuclear Information System (INIS)
Winea, Gauthier; Ledoux, Marc-Jacques; Pham-Huu, Cuong; Gangeri, Miriam; Perathoner, Siglinda; Centi, Gabriele
2006-01-01
A lot of methods exist to directly reduce carbon dioxide into hydrocarbons: the photoelectrochemical process is certainly the most interesting, essentially due to the similarities with photosynthesis. As the human activities produce a great quantity of CO 2 , this one can then be considered as an infinite source of carbon. The products of this reaction are identical to those obtained during a Fischer-Tropsch reaction, that is to say hydrocarbons, alcohols and carboxylic acids. These works deal with the electrochemical reduction of CO 2 in standard conditions of temperature and pressure. The photochemical part has been replaced by a current generator as electrons source and a KHCO 3 aqueous solution as protons source. The first catalytic results clearly show that it is possible to reduce CO 2 into light hydrocarbons, typically from C1 to C9. (O.M.)
Application of fission track analysis to hydrocarbon exploration
International Nuclear Information System (INIS)
Duddy, I.R.; Green, P.F.; Gleadow, A.J.W.; Marshallsea, S.; Tingate, P.; Laslett, G.M.; Hegarty, K.A.; Lovering, J.F.
1985-01-01
The temperature range over which fission tracks in apatite show observable annealing effects coincides with that responsible for the maximum generation of liquid hydrocarbons. Work is currently in progress in a number of Australian and overseas sedimentary basins, applying Apatite Fission Track Analysis (AFTA) to investigate the thermal evolution of these hydrocarbon prospective regions
MICROORGANISMS’ SURFACE ACTIVE SUBSTANCES ROLE IN HYDROCARBONS BIODEGRADATION
Directory of Open Access Journals (Sweden)
Оlga Vasylchenko
2012-09-01
Full Text Available Existing data and publications regarding oil, hydrocarbon biodegradation, metabolism, and bioremediation were analyzed. Search of hydrocarbon degrading bacteria which are producers of biosurfactants was provided, types of microbial surfactants and their physiological role were analyzed and ordered. The study of factors affecting the surface active properties of producers’ cultures was done.
Source rock hydrocarbons. Present status
International Nuclear Information System (INIS)
Vially, R.; Maisonnier, G.; Rouaud, T.
2013-01-01
This report first presents the characteristics of conventional oil and gas system, and the classification of liquid and gaseous non conventional hydrocarbons, with the peculiar case of coal-bed methane. The authors then describe how source rock hydrocarbons are produced: production of shale oils and gases (horizontal drilling, hydraulic fracturing, exploitation) and of coal-bed methane and coal mine methane. In the next part, they address and discuss the environmental impact of source rock hydrocarbon production: installation footprint, water resource management, drilling fluids, fracturing fluids composition, toxicity and recycling, air pollution, induced seismicity, pollutions from other exploitation and production activities. They propose an overview of the exploitation and production of source rock gas, coal-bed gas and other non conventional gases in the world. They describe the current development and discuss their economic impacts: world oil context and trends in the USA, in Canada and other countries, impacts on the North American market, on the world oil industry, on refining industries, on the world oil balance. They analyse the economic impacts of non conventional gases: development potential, stakes for the world gas trade, consequence for gas prices, development opportunities for oil companies and for the transport sector, impact on CO 2 emissions, macro-economic impact in the case of the USA
Jovanovic, Larisa; Aleksic, Gorica; Radosavljevic, Milan; Onjia, Antonije
2015-04-01
Mineral oil leaking from vehicles or released during accidents is an important source of soil and ground water pollution. In the railway junction Niš (Serbia) total 90 soil samples polluted with mineral oil derivatives were investigated. Field work at the railway Niš sites included the opening of soil profiles and soil sampling. The aim of this work is the determination of petroleum hydrocarbons concentration in the soil samples and the investigation of the bioremediation technique for treatment heavily contaminated soil. For determination of petroleum hydrocarbons in the soil samples method of gas-chromatography was carried out. On the basis of measured concentrations of petroleum hydrocarbons in the soil it can be concluded that: Obtained concentrations of petroleum hydrocarbons in 60% of soil samples exceed the permissible values (5000 mg/kg). The heavily contaminated soils, according the Regulation on the program of systematic monitoring of soil quality indicators for assessing the risk of soil degradation and methodology for development of remediation programs, Annex 3 (Official Gazette of RS, No.88 / 2010), must be treated using some of remediation technologies. Between many types of phytoremediation of soil contaminated with mineral oils and their derivatives, the most suitable are phytovolatalisation and phytostimulation. During phytovolatalisation plants (poplar, willow, aspen, sorgum, and rye) absorb organic pollutants through the root, and then transported them to the leaves where the reduced pollutants are released into the atmosphere. In the case of phytostimulation plants (mulberry, apple, rye, Bermuda) secrete from the roots enzymes that stimulates the growth of bacteria in the soil. The increase in microbial activity in soil promotes the degradation of pollutants. Bioremediation is performed by composting the contaminated soil with addition of composting materials (straw, manure, sawdust, and shavings), moisture components, oligotrophs and
Converting higher to lower boiling hydrocarbons. [Australian patent
Energy Technology Data Exchange (ETDEWEB)
1937-06-16
To transform or convert higher boiling hydrocarbons into lower boiling hydrocarbons for the production of motor fuel, the hydrocarbons are maintained in vapor phase until the desired conversion has been effected and the separation of the high from low boiling hydrocarbons is carried out by utilization of porous contact material with a preferential absorption for the former. The vapor is passed by supply line to a separator containing the porous material and heated to 750 to 950/sup 0/F for a few seconds, the higher boiling parts being retained by the porous material and the lower passing to a vent line. The latter is closed and the vapor supply cut off and an ejecting medium is passed through a line to carry the higher boiling parts to an outlet line from which it may be recycled through the apparatus. The porous mass may be regenerated by introducing medium from a line that carries off impurities to another line. A modified arrangement shows catalytic cracking apparatus through which the vaporized material is passed on the way to the separators.
Geophysical Responses of Hydrocarbon-impacted Zones at the Various Contamination Conditions
Kim, C.; Ko, K.; Son, J.; Kim, J.
2008-12-01
One controlled experiment and two field surveys were conducted to investigate the geoelectrical responses of hydrocarbon-contaminated zones, so called smeared zone, on the geophysical data at the hydrocarbon- contaminated sites with various conditions. One controlled physical model experiment with GPR using fresh gasoline and two different 3-D electrical resistivity investigations at the aged sites. One field site (former military facilities for arms maintenance) was mainly contaminated with lubricating oils and the other (former gas station) was contaminated with gasoline and diesel, respectively. The results from the physical model experiment show that GPR signals were enhanced when LNAPL was present as a residual saturation in the water-saturated system due to less attenuation of the electromagnetic energy through the soil medium of the hydrocarbon-impacted zone (no biodegradation), compared to when the medium was saturated with only water (no hydrocarbon impaction). In the former gas station site, 3-D resistivity results demonstrate that the highly contaminated zones were imaged with low resistivity anomalies since the biodegradation of petroleum hydrocarbons has been undergone for many years, causing the drastic increase in the TDS at the hydrocarbon-impacted zones. Finally, 3-D resistivity data obtained from the former military maintenance site show that the hydrocarbon-contaminated zones show high resistivity anomalies since the hydrocarbons such as lubricating oils at the contaminated soils were not greatly influenced by microbial degradation and has relatively well kept their original physical properties of high electrical resistivity. The results of the study illustrated that the hydrocarbon-impacted zones under various contamination conditions yielded various geophysical responses which include (1) enhanced GPR amplitudes at the fresh LNAPL (Gasoline to middle distillates) spill sites, (2) low electrical resistivity anomalies due to biodegradation at the
The future of oil and hydrocarbon man
Campbell, Colin
1999-01-01
Man appeared on the planet about four million years ago, and by 1850 numbered about one billion Ten came Hydrocarbon man. World population has since increased six-fold. After the oil price shocks of the 1970s, people asked "when will production peak?". It is not easy to answer this question because of the very poor database. Reserves and the many different hydrocarbon categories are poorly defined, reporting practices are ambiguous, revisions are not backdated...
Surfactant-enhanced recovery of dissolved hydrocarbons at petroleum production facilities
International Nuclear Information System (INIS)
Freeman, J.T.; Mayes, M.; Wassmuth, F.; Taylor, K.; Rae, W.; Kuipers, F.
1997-01-01
The feasibility and cost effectiveness of surfactant-enhanced pumping to reduce source concentrations of petroleum hydrocarbons from contaminated soils was discussed. Light non-aqueous phase liquids (LNAPL) hydrocarbons are present beneath many petroleum production processing facilities in western Canada. Complete removal of LNAPLs from geologic materials is difficult and expensive. Treatment technologies include costly ex-situ methods such as excavation and in-situ methods such as physical extraction by soil venting and pumping, bioremediation, and combination methods such as bioventing, bioslurping or air sparging. Surfactant-aided pumping can reduce source hydrocarbon concentrations when used in conjunction with traditional pump and treat, or deep well injection. This study involved the selection of an appropriate surfactant from a wide variety of commercially available products. A site contaminated by hydrocarbons in Turner Valley, Alberta, was used for field scale testing. One of the major problems was quantifying the increase in the dissolved hydrocarbon concentrations in the recovered water once a surfactant was added. From the 30 surfactants screened in a series of washing and oil solubilization tests, two surfactants, Brij 97 and Tween 80, were selected for further evaluation. Increased hydrocarbon recovery was observed within 10 days of the introduction of the first surfactant. 2 refs., 7 figs
Risk factors for congenital hydrocephalus
DEFF Research Database (Denmark)
Munch, Tina Noergaard; Rasmussen, Marie-Louise Hee; Wohlfahrt, Jan
2014-01-01
. Furthermore, to identify the risk factors unique for isolated CHC as compared to syndromic CHC. METHODS: We established a cohort of all children born in Denmark between 1978 and 2008. Information on CHC and maternal medical diseases were obtained from the National Patient Discharge Register, maternal intake...... increased risk of isolated CHC compared to unexposed children (RR 2.52, 95% CI 1.47 to 4.29) (1.5/1000 born children). Risk factors also found for syndromic CHC were: Male gender, multiples and maternal diabetes. CONCLUSIONS: The higher risk for isolated CHC in first-born children as well as behavioural......-born children, we observed 1193 cases of isolated CHC (0.062/1000) born children. First-borns had an increased risk of isolated CHC compared to later-borns (1.32 95% CI 1.17 to 1.49) (0.72/1000 born children). First trimester exposure to maternal use of antidepressants was associated with a significantly...
Krishnamoorthy, Ganesan; Sehgal, Praveen Kumar; Mandal, Asit Baran; Sadulla, Sayeed
2012-06-01
We report the detailed studies on the inhibitory effect of tannic acid (TA) on Clostridium histolyticum collagenase (ChC) activity against degradation of extracellular matrix component of collagen. The TA treated collagen exhibited 64% resistance against collagenolytic hydrolysis by ChC, whereas direct interaction of TA with ChC exhibited 99% inhibition against degradation of collagen and the inhibition was found to be concentration dependant. The kinetic inhibition of ChC has been deduced from the extent of hydrolysis of N-[3-(2-furyl) acryloyl]-Leu-Gly-Pro-Ala (FALGPA). This data provides a selective competitive mode of inhibition on ChC activity seems to be influenced strongly by the nature and structure of TA. TA showed inhibitor activity against the ChC by molecular docking method. This result demonstrated that TA containing digalloyl radical possess the ability to inhibit the ChC. The inhibition of ChC in gaining new insight into the mechanism of stabilization of collagen by TA is discussed.
Recovering hydrocarbons with surfactants from lignin
Energy Technology Data Exchange (ETDEWEB)
Naae, D.G.; Whittington, L.E.; Ledoux, W.A.; Debons, F.E.
1988-11-29
This patent describes a method of recovering hydrocarbons from an underground hydrocarbon formation penetrated by at least one injection well and at least one production well, which comprises: injecting into the formation through an injection well a surfactant slug comprising about 0.1% to about 10% by weight of surfactants produced from lignin, the surfactants produced by placing lignin in contact with water, converting the lignin into low molecular weight lignin phenols by reducing the lignin in the presence of a reducing agent of carbon monoxide or hydrogen creating a reduction reaction mixture comprising oil soluble lignin phenols, the reduction occurring at a temperature greater than about 200/sup 0/C and a pressure greater than about 100 psi, recovering the oil soluble lignin phenols from the reduction mixture, and converting the lignin phenols into lignin surfactants by a reaction selected from the group consisting of alkoxylation, sulfonation, sulfation, aklylation, sulfomethylation, and alkoxysulfation; injecting into the formation through the injection well a drive fluid to push the surfactant slug towards a production well; and recovering hydrocarbons at the production well.
LaMori, Joyce; Tandon, Neeta; Laliberté, François; Germain, Guillaume; Pilon, Dominic; Lefebvre, Patrick; Prabhakar, Avinash
2016-01-01
Since hepatitis C virus therapy is typically prioritized for patients with more advanced disease, predicting which patients will progress could help direct scarce resources to those likely to benefit most. This study aims to identify demographics and clinical characteristics associated with high healthcare resource utilization (HRU) and liver disease progression among CHC patients. Using health insurance claims (January 2001-March 2013), adult patients with ≥2 CHC claims (ICD-9-CM: 070.44 or 070.54), and ≥6 months of continuous insurance coverage before and ≥36 months after the first CHC diagnosis were included. Patients with human immunodeficiency virus were excluded. Generalized estimating equations were used to identify the demographic and clinical characteristics of being in the 20% of patients with the highest HRU. Factors predicting liver disease progression were also identified. In the study population (n = 4898), liver disease severity and both CHC- and non-CHC-related comorbidities and conditions were strong predictors of high healthcare costs, with odds ratios (ORs; 95% confidence interval [CI]) for ≥2 CHC-related and ≥2 non-CHC-related comorbidities/conditions of 2.78 (2.48-3.12) and 2.19 (1.76-2.72), respectively. CHC- and non-CHC-related comorbidities and conditions were also strong predictors of liver disease progression with ORs (95% CI) for ≥2 CHC-related and ≥2 non-CHC-related comorbidities and conditions of 2.18 (1.83-2.60) and 1.50 (1.14-1.97), respectively. Potential inaccuracies in claims data, information or classification bias, and findings based on a privately insured population. This study suggests that CHC patients with high healthcare resource utilization have a high level of comorbidity at baseline and also that non-CHC comorbidities and conditions are strong predictors of high HRU. Non-cirrhotic CHC patients with one or more comorbidities are at high risk of progressing to cirrhosis or end-stage liver disease.
Liu, Danping; Meng, Hongdao; Dobbs, Debra; Conner, Kyaien O; Hyer, Kathryn; Li, Ningxiu; Ren, Xiaohui; Gao, Bo
2017-06-08
Public investment in community health centres (CHCs) has been increasing as a response to rapid urbanisation in China. The objectives of this study were: (1) to examine factors associated with CHC use among residents from a recently urbanised community in western China and (2) to describe satisfaction with CHC among users. Cross-sectional design. A community recently converted to urban status with a newly constructed CHC in Southwest China. A random sample of 2259 adults in the Hezuo community in Chengdu, China, completed the survey in 2013. Trained staff interviewed study participants in their homes using structured questionnaires. The survey included questions regarding sociodemographics, health status, access to and usage of healthcare, health behaviours and CHC use. The Andersen's behavioural model of health service use was used to guide multivariable logistic regression modelling in identifying predisposing, enabling and need factors associated with the likelihood of using CHC. Descriptive statistics were used to describe residents' satisfaction with the CHC. A total of 71.8% of the respondents reported using the CHC during the past year. Factors influencing adults' CHC use included: gender, marital status, education level and knowledge of one's blood pressure (predisposing factors); annual household per capita income and walking time to the CHC (enabling factors) and self-rated health as well as physical activities (need factors). CHC users reported modest satisfaction across various aspects of the CHC. Neighbourhood CHC in urban areas provides important services to these residents living in a recently urbanised community. All three categories of factors in the Andersen model help explain the likelihood of CHC use. There is much room for improvement in CHC to enhance customer satisfaction. Future research is needed to improve access to CHCs and promote their use in urbanised populations with low to modest education. © Article author(s) (or their employer
Comparative survey of petroleum hydrocarbons i lake sediments
Energy Technology Data Exchange (ETDEWEB)
Wakeham, S G
1976-11-01
Hydrocarbon distribution in sediments from three lakes in Washington State were studied and found to be related to the level of human activity in the respective drainage basins. Petroleum hydrocarbon contamination was found in surface sediments of a lake surrounded by a major city, compared to no detectable contamination in a lake located in a National Park.
The separation of hydrocarbons from waste vapor streams
International Nuclear Information System (INIS)
Behling, R.D.; Ohlrogge, K.; Peinemann, K.V.; Kyburz, E.
1989-01-01
Hydrocarbon vapors generated from industrial processes dispersed into air are contributing factors for the creation of photochemical smog. The separation of hydrocarbon vapor by means of membranes is in case of some applications a technically simple and economic process. A membrane vapor separation process with a following treatment of the retentate by catalytic incineration is introduced in this paper
Gurudath Nayak, H.; Venkatarathnam, G.
2009-07-01
There is a worldwide interest in the development of auto refrigerant cascade (ARC) refrigerators operating with refrigerant mixtures. Both flammable and non-flammable refrigerant mixtures can be used in these systems. The performance of an ARC system with optimum nitrogen-hydrocarbon and argon-hydrocarbon mixtures between 90 and 160 K is presented in this paper.
Biological effects of petroleum hydrocarbons: Predictions of long-term effects and recovery
International Nuclear Information System (INIS)
Capuzzo, J.M.
1990-01-01
Biological effects of petroleum hydrocarbons on marine organisms and ecosystems are dependent on the persistence and bioavailability of specific hydrocarbons, the ability of organisms to accumulate and metabolize various hydrocarbons, the fate of metabolized products, and the interference of specific hydrocarbons with normal metabolic processes that may alter an organism's chances for survival and reproduction in the environment. In considering the long-term effects of petroleum hydrocarbons on marine ecosystems it is important to ascertain what biological effects may result in subtle ecological changes, changes in community structure and function, and possible impairment of fisheries resources. It is also important to understand which hydrocarbons persist in benthic environments and the sublethal effects that lead to reduced growth, delayed development and reduced reproductive effort, population decline and the loss of that population's function in marine communities. Only through a multi-disciplinary approach to the study of the fate, transport and effects of petroleum hydrocarbons on marine ecosystems will there be a significant improvement in the ability to predict the long-term effects of oil spills and to elucidate the mechanisms of recovery
Frequency–amplitude range of hydrocarbon microtremors and a discussion on their source
International Nuclear Information System (INIS)
Gerivani, H; Hafezi Moghaddas, N; Ghafoori, M; Lashkaripour, G R; Haghshenas, E
2012-01-01
Recently, some studies have suggested using ambient noise as a tool for hydrocarbon reservoir investigation. This new passive seismic technique, named HyMas, is based on the positive energy anomaly in data spectra between 1 to 6 Hz for microtremor measurements over reservoirs, which are called hydrocarbon microtremors. Despite the acceptable results obtained by the HyMas technique, there are many unknowns, especially concerning the source and generation mechanism of hydrocarbon microtremors and the relations between reservoir characteristics and the attributes of hydrocarbon microtremors. In this study we tried to find the relations between reservoir characteristics, including fluid content and depth, for 12 sites around the world with hydrocarbon microtremor attributes, including peak amplitude and frequency. Based on the power spectral density curves of these 12 reservoirs, a frequency–amplitude range is also proposed as a criterion for separating hydrocarbon microtremors from local noise not related to reservoirs. Finally, the source of the hydrocarbon microtremors is discussed and tidal displacement is suggested as a probable agent for the generation of these anomalies. (paper)
Uptake of vapor and particulate polycyclic aromatic hydrocarbons by cabbage
International Nuclear Information System (INIS)
Tao, S.; Jiao, X.C.; Chen, S.H.; Xu, F.L.; Li, Y.J.; Liu, F.Z.
2006-01-01
Polycyclic aromatic hydrocarbons (PAHs) in cabbage (aerial part), air (gas and particles) and soil samples collected from two sites in Tianjin, China were measured. Although the levels of PAHs in all samples from the heavily contaminated site B were higher than those from the less contaminated site A, the PAH profiles were similar, suggesting the similarity in source type. PAH concentrations in cabbages were positively correlated to either gas or particle-bound PAHs in air. A multivariate linear regression with cabbage PAH as a function of both gas and particle-bound PAHs in air was established to quantitatively characterize the relationship between them. Inclusion of soil PAH concentrations would not improve the model, indicating that the contribution of soil PAHs to cabbage (aerial part) accumulation was insignificant. - A multivariate linear regression model was developed for predicting vegetable uptake of PAHs based on both gas and particle phases PAH concentrations
Assessing human error during collecting a hydrocarbon sample of ...
African Journals Online (AJOL)
This paper reports the assessment method of the hydrocarbon sample collection standard operation procedure (SOP) using THERP. The Performance Shaping Factors (PSF) from THERP analyzed and assessed the human errors during collecting a hydrocarbon sample of a petrochemical refinery plant. Twenty-two ...
A Review of Polycyclic Aromatic Hydrocarbons and Heavy Metal ...
African Journals Online (AJOL)
A Review of Polycyclic Aromatic Hydrocarbons and Heavy Metal Contamination of Fish from Fish Farms. ... Journal of Applied Sciences and Environmental Management ... Polycyclic aromatic hydrocarbons (PAHs) and heavy metals contribute to pollutants in aquaculture facilities and thus need to be further investigated.
Soil bioremediation approaches for petroleum hydrocarbon polluted environments
Directory of Open Access Journals (Sweden)
Eman Koshlaf
2017-01-01
Full Text Available Increasing industrialisation, continued population growth and heavy demand and reliance on petrochemical products have led to unprecedented economic growth and development. However, inevitably this dependence on fossil fuels has resulted in serious environmental issues over recent decades. The eco-toxicity and the potential health implications that petroleum hydrocarbons pose for both environmental and human health have led to increased interest in developing environmental biotechnology-based methodologies to detoxify environments impacted by petrogenic compounds. Different approaches have been applied for remediating polluted sites with petroleum derivatives. Bioremediation represents an environmentally sustainable and economical emerging technology for maximizing the metabolism of organic pollutants and minimizing the ecological effects of oil spills. Bioremediation relies on microbial metabolic activities in the presence of optimal ecological factors and necessary nutrients to transform organic pollutants such as petrogenic hydrocarbons. Although, biodegradation often takes longer than traditional remediation methods, the complete degradation of the contaminant is often accomplished. Hydrocarbon biodegradation in soil is determined by a number of environmental and biological factors varying from site to site such as the pH of the soil, temperature, oxygen availability and nutrient content, the growth and survival of hydrocarbon-degrading microbes and bioavailability of pollutants to microbial attack. In this review we have attempted to broaden the perspectives of scientists working in bioremediation. We focus on the most common bioremediation technologies currently used for soil remediation and the mechanisms underlying the degradation of petrogenic hydrocarbons by microorganisms.
Solo Mycoremediation Impacted by Waste Hydrocarbons
Directory of Open Access Journals (Sweden)
Franklin Santos Freire
2015-06-01
Full Text Available Oil and its derivatives are the principal means of energy generation for vehicles that transport raw materials and goods produced in developed and developing regions accentuating the risk of accidents by spills in stockpiling, transport, use or discarding. The contamination by total hydrocarbons suggests the elevated propension to mutations and to the formation of carcinogenic tumors, as a consequence of the exposure to human contamination by these products. This work had as aims: a To investigate, in a laboratorial scale, the degrading capacity of autochthonous microbiota in the presence of differing concentrations of hydrocarbons (0%, 2,5%, 5% e 7,5%; b To isolate fungi tolerant to the contaminant; c To quantify and analyze the biodegradation capacity of soil through the microbial biomass and metabolic quotient; and d To set, in laboratory, ideal conditions of biodegradation of the xenobiotic compound. Some parameters of microbial activity have been evaluated, such as: biological (Carbon of microbial biomass, CO2 , qCO2 emission, and fungi growth, chemical (pH, electrical conductivity –EC –, analysis of fertility and total hydrocarbons and physical (physical composition of the soil for analysis and comparisons. The obtained results suggest that the adding of 5% of waste oil in the ground provided ideal condition for the biodegradation of he contaminant in the environment. From the evaluated parameters, the emission of CO2 and microbial C were considered more indicative of changes in soil microbial activity subject to the addition of hydrocarbons, confirming the possibility of microremediation use.
Process for conversion of lignin to reformulated hydrocarbon gasoline
Shabtai, Joseph S.; Zmierczak, Wlodzimierz W.; Chornet, Esteban
1999-09-28
A process for converting lignin into high-quality reformulated hydrocarbon gasoline compositions in high yields is disclosed. The process is a two-stage, catalytic reaction process that produces a reformulated hydrocarbon gasoline product with a controlled amount of aromatics. In the first stage, a lignin material is subjected to a base-catalyzed depolymerization reaction in the presence of a supercritical alcohol as a reaction medium, to thereby produce a depolymerized lignin product. In the second stage, the depolymerized lignin product is subjected to a sequential two-step hydroprocessing reaction to produce a reformulated hydrocarbon gasoline product. In the first hydroprocessing step, the depolymerized lignin is contacted with a hydrodeoxygenation catalyst to produce a hydrodeoxygenated intermediate product. In the second hydroprocessing step, the hydrodeoxygenated intermediate product is contacted with a hydrocracking/ring hydrogenation catalyst to produce the reformulated hydrocarbon gasoline product which includes various desirable naphthenic and paraffinic compounds.
Evaluation of synthetic hydrocarbons for mark-recapture studies on the red milkweed beetle.
Ginzel, Matthew D; Hanks, Lawrence M
2002-05-01
This study evaluates the potential for using blends of synthetic hydrocarbons in mark-recapture studies of insects. To test the durability of hydrocarbons, we applied a blend of five straight-chain hydrocarbons (C24, C21, C26. C28, C30) to detached elytra of the red milkweed beetle, Tetraopes tetrophthalmus (Forster) (Coleoptera: Cerambycidae), mounted the elytra on pins, and placed them in an exposed location outdoors. The amount of hydrocarbons on the elytra did not change over time, even after two months of exposure to sun and rain. Synthetic hydrocarbons applied to the elytra of living beetles did not significantly influence their longevity or mating success in a laboratory study. and the amounts of hydrocarbons did not change with age. The invariability of hydrocarbon ratios over time suggests that blends could provide a nearly infinite variety of ratios to mark individual insects uniquely and indelibly with a hydrocarbon "fingerprint." This technique offers a convenient, safe, and durable means of individually marking insects and may find application in field studies of larger bodied insects that are long-lived and sedentary.
Electron microscopy of hydrocarbon production in parthenium argentatum (guayule)
Energy Technology Data Exchange (ETDEWEB)
Bauer, Thomas E. [Univ. of California, Berkeley, CA (United States)
1977-11-01
The electron microscope was used to study the biological processes involved in hydrocarbon production. The little desert shrub Guayule (Parthenium argentatum) was selected for study. This shrub can produce hydrocarbons (rubber) in concentrations up to 1/4 of its dry weight. It grows on semi-arid land and has been extensively studied. The potential of Guayule is described in detail. Results of an investigation into the morphology of Guayule at the electron microscope level are given. Experiments, which would allow the biosynthesis of hydrocarbon in Guayule to be followed, were designed. In order to do this, knowledge of the biochemistry of rubber formation was used to select a tracer, mevalonic acid. Mevalonic acid is the precursor of all the terpenoids, a large class of hydrocarbons which includes rubber. It was found that when high enough concentrations of mevalonic acid are administered to seedling Guayule plants, build-ups of metabolized products are found within the chloroplasts of the seedlings. Also, tritium labeled mevalonic acid was used as a precursor, and its metabolic progress was followed by using the technique of electron microscope autoradiography. The results of these experiments also implicated chloroplasts of the Guayule plant in hydrocarbon production. The final task was the development of a system to produce three-dimensional stereo reconstructions of organelles suspected of involvement in hydrocarbon biosynthesis in Guayule. The techniques are designed to reconstruct an object from serial sections of that object. The techniques use stereo imaging both to abstract information for computer processing, and also in the computer produced reconstruction.
Electrochemical removal of NOx and hydrocarbons
DEFF Research Database (Denmark)
Friedberg, Anja Zarah
on the electrodes during polarisation, probably because of strong adsorption of the hydrocarbon relative to NO. On LSF/CGO electrode the impregnation of ionic conducting material increased the oxidation of NO to NO2 which is an important step before nitrogen formation. The propene inhibited this reaction because....... This could only be done if the electrode was impregnated with BaO. The nitrate formation did not seem to be inhibited by the presence of the hydrocarbon. However, the oxidation of propene was inhibited by the BaO because the active sites for oxidations were partially covered by the BaO nanoparticles...
Autothermal reforming of liquid hydrocarbons for H{sub 2} production
Energy Technology Data Exchange (ETDEWEB)
Palm, C.; Montel, S.; Cremer, P.; Peters, R.; Stolten, D. [Forschungszentrum Juelich GmbH (Germany). Inst. for Materials and Processes in Energy Systems IWV-3: Process Engineering
2001-07-01
The process of autothermal reforming of hydrocarbons can be used for the production of hydrogen within a fuel cell system. The application of three precious metal catalysts for the autothermal reforming of alkane mixtures with boiling ranges between 235 and 325 C was examined. The experiments were carried out at n(O{sub 2})/n(C) = 0.40, n(H{sub 2}O)/n(C) = 2.20, a catalyst bed temperature between 730 and 570 C and a hydrocarbon feed of 30 g/h. The catalysts yielded different hydrocarbon conversions, which can be explained by differences in the activity for the steam reforming reaction. The most active catalyst was also successfully utilized in the conversion of 400 g/h hydrocarbon feed. (orig.)
Microbial hydrocarbon degradation - bioremediation of oil spills
Energy Technology Data Exchange (ETDEWEB)
Atlas, R M [Louisville Univ., KY (United States). Dept. of Biology
1991-01-01
Bioremediation has become a major method employed in restoration of oil-polluted environments that makes use of natural microbial biodegradative activities. Bioremediation of petroleum pollutants overcomes the factors limiting rates of microbial hydrocarbon biodegradation. Often this involves using the enzymatic capabilities of the indigenous hydrocarbon-degrading microbial populations and modifying environmental factors, particularly concentrations of molecular oxygen, fixed forms of nitrogen and phosphate to achieve enhanced rates of hydrocarbon biodegradation. Biodegradation of oily sludges and bioremediation of oil-contaminated sites has been achieved by oxygen addition-e.g. by tilling soils in landfarming and by adding hydrogen peroxide or pumping oxygen into oiled aquifers along with addition of nitrogen- and phosphorous-containing fertilizers. The success of seeding oil spills with microbial preparations is ambiguous. Successful bioremediation of a major marine oil spill has been achieved based upon addition of nitrogen and phosphorus fertilizers. (author).
Sensitivity of molecular marker-based CMB models to biomass burning source profiles
Sheesley, Rebecca J.; Schauer, James J.; Zheng, Mei; Wang, Bo
To assess the contribution of sources to fine particulate organic carbon (OC) at four sites in North Carolina, USA, a molecular marker chemical mass balance model (MM-CMB) was used to quantify seasonal contributions for 2 years. The biomass burning contribution at these sites was found to be 30-50% of the annual OC concentration. In order to provide a better understanding of the uncertainty in MM-CMB model results, a biomass burning profile sensitivity test was performed on the 18 seasonal composites. The results using reconstructed emission profiles based on published profiles compared well, while model results using a single source test profile resulted in biomass burning contributions that were more variable. The biomass burning contribution calculated using an average regional profile of fireplace emissions from five southeastern tree species also compared well with an average profile of open burning of pine-dominated forest from Georgia. The standard deviation of the results using different source profiles was a little over 30% of the annual average biomass contributions. Because the biomass burning contribution accounted for 30-50% of the OC at these sites, the choice of profile also impacted the motor vehicle source attribution due to the common emission of elemental carbon and polycyclic aromatic hydrocarbons. The total mobile organic carbon contribution was less effected by the biomass burning profile than the relative contributions from gasoline and diesel engines.
Kosakowski, Paweł; Wróbel, Magdalena
2012-08-01
Burial history, thermal maturity, and timing of hydrocarbon generation were modelled for the Jurassic source rocks in the basement of the Carpathian Foredeep and marginal part of the Outer Carpathians. The area of investigation was bounded to the west by Kraków, to the east by Rzeszów. The modelling was carried out in profiles of wells: Będzienica 2, Dębica 10K, Góra Ropczycka 1K, Goleszów 5, Nawsie 1, Pławowice E1 and Pilzno 40. The organic matter, containing gas-prone Type III kerogen with an admixture of Type II kerogen, is immature or at most, early mature to 0.7 % in the vitrinite reflectance scale. The highest thermal maturity is recorded in the south-eastern part of the study area, where the Jurassic strata are buried deeper. The thermal modelling showed that the obtained organic matter maturity in the initial phase of the "oil window" is connected with the stage of the Carpathian overthrusting. The numerical modelling indicated that the onset of hydrocarbon generation from the Middle Jurassic source rocks was also connected with the Carpathian thrust belt. The peak of hydrocarbon generation took place in the orogenic stage of the overthrusting. The amount of generated hydrocarbons is generally small, which is a consequence of the low maturity and low transformation degree of kerogen. The generated hydrocarbons were not expelled from their source rock. An analysis of maturity distribution and transformation degree of the Jurassic organic matter shows that the best conditions for hydrocarbon generation occurred most probably in areas deeply buried under the Outer Carpathians. It is most probable that the "generation kitchen" should be searched for there.
THE STRUCTURE, ORIGIN, AND EVOLUTION OF INTERSTELLAR HYDROCARBON GRAINS
Energy Technology Data Exchange (ETDEWEB)
Chiar, J. E.; Ricca, A. [SETI Institute, Carl Sagan Center, 189 Bernardo Avenue, Mountain View, CA 94043 (United States); Tielens, A. G. G. M. [Leiden Observatory, P.O. Box 9513, NL-2300 RA Leiden (Netherlands); Adamson, A. J., E-mail: jchiar@seti.org, E-mail: Alessandra.Ricca@1.nasa.gov, E-mail: tielens@strw.leidenuniv.nl, E-mail: aadamson@gemini.edu [Gemini Observatory, Northern Operations Center, 670 North A' ohoku Place, Hilo, HI 96729 (United States)
2013-06-10
Many materials have been considered for the carrier of the hydrocarbon absorption bands observed in the diffuse interstellar medium (ISM). In order to refine the model for ISM hydrocarbon grains, we analyze the observed aromatic (3.28, 6.2 {mu}m) and aliphatic (3.4 {mu}m) hydrocarbon absorption features in the diffuse ISM along the line of sight toward the Galactic center Quintuplet Cluster. Observationally, sp {sup 2} bonds can be measured in astronomical spectra using the 6.2 {mu}m CC aromatic stretch feature, whereas the 3.4 {mu}m aliphatic feature can be used to quantify the fraction of sp {sup 3} bonds. The fractional abundance of these components allows us to place the Galactic diffuse ISM hydrocarbons on a ternary phase diagram. We conclude that the Galactic hydrocarbon dust has, on average, a low H/C ratio and sp {sup 3} content and is highly aromatic. We have placed the results of our analysis within the context of the evolution of carbon dust in the ISM. We argue that interstellar carbon dust consists of a large core of aromatic carbon surrounded by a thin mantle of hydrogenated amorphous carbon (a-C:H), a structure that is a natural consequence of the processing of stardust grains in the ISM.
THE STRUCTURE, ORIGIN, AND EVOLUTION OF INTERSTELLAR HYDROCARBON GRAINS
International Nuclear Information System (INIS)
Chiar, J. E.; Ricca, A.; Tielens, A. G. G. M.; Adamson, A. J.
2013-01-01
Many materials have been considered for the carrier of the hydrocarbon absorption bands observed in the diffuse interstellar medium (ISM). In order to refine the model for ISM hydrocarbon grains, we analyze the observed aromatic (3.28, 6.2 μm) and aliphatic (3.4 μm) hydrocarbon absorption features in the diffuse ISM along the line of sight toward the Galactic center Quintuplet Cluster. Observationally, sp 2 bonds can be measured in astronomical spectra using the 6.2 μm CC aromatic stretch feature, whereas the 3.4 μm aliphatic feature can be used to quantify the fraction of sp 3 bonds. The fractional abundance of these components allows us to place the Galactic diffuse ISM hydrocarbons on a ternary phase diagram. We conclude that the Galactic hydrocarbon dust has, on average, a low H/C ratio and sp 3 content and is highly aromatic. We have placed the results of our analysis within the context of the evolution of carbon dust in the ISM. We argue that interstellar carbon dust consists of a large core of aromatic carbon surrounded by a thin mantle of hydrogenated amorphous carbon (a-C:H), a structure that is a natural consequence of the processing of stardust grains in the ISM.
Hydrocarbons (aliphatic and aromatic) in the snow-ice cover in the Arctic
International Nuclear Information System (INIS)
Nemirovskaya, I.A.; Novigatsky, A.N.; Kluvitkin, A.A.
2002-01-01
This paper presented the concentration and composition of aliphatic hydrocarbons and polycyclic aromatic hydrocarbons (PAHs) in snow and ice-infested waters in the France-Victoria trough in the northern Barents Sea and in the Mendeleev ridge in the Amerasian basin of the Arctic Ocean. Extreme conditions such as low temperatures, ice sheets and the polar nights render the arctic environment susceptible to oil spills. Hydrocarbons found in these northern seas experience significant transformations. In order to determine the sources, pathways and transformations of the pollutants, it is necessary to know their origin. Hydrocarbon distributions is determined mostly by natural hydrobiological and geochemical conditions. The regularity of migration is determined by natural factors such as formation and circulation of air and ice drift. There is evidence suggesting that the hydrocarbons come from pyrogenic sources. It was noted that hydrocarbons could be degraded even at low temperatures. 17 refs., 1 tab
Study of Combustion Characteristics of Hydrocarbon Nanofuel Droplets
2017-08-23
NUMBER (Include area code) 23 August 2017 Briefing Charts 01 August 2017 - 31 August 2017 Study of Combustion Characteristics of Hydrocarbon...Douglas Talley N/A 1 Study of Combustion Characteristics of Hydrocarbon Nanofuel Droplets DISTRIBUTION STATEMENT A. Approved for public release...Angeles ϯAir Force Research Laboratory, Aerospace Systems Directorate, Combustion Devices Group, Edwards AFB, CA ONR/ARO/AFOSR Meeting, 23 Aug., 2017
Biological Conversion of Sugars to Hydrocarbons Technology Pathway
Energy Technology Data Exchange (ETDEWEB)
Davis, R.; Biddy, M.; Tan, E.; Tao, L.; Jones, S.
2013-03-01
This technology pathway case investigates the biological conversion of biomass-derived sugars to hydrocarbon biofuels, utilizing data from recent literature references and information consistent with recent pilot-scale demonstrations at NREL. Technical barriers and key research needs have been identified that should be pursued for the pathway to become competitive with petroleum-derived gasoline-, diesel-, and jet-range hydrocarbon blendstocks.
Biodegradation of aliphatic vs. aromatic hydrocarbons in fertilized arctic soils
Braddock, J.F.
1999-01-01
A study was carried out to test a simple bioremediation treatment strategy in the Arctic and analyze the influence of fertilization the degradation of aliphatic and aromatic hydrocarbons, e.g., pristine, n-tetradecane, n-pentadecane, 2-methylnaphthalene, naphthalene, and acenaphthalene. The site was a coarse sand pad that once supported fuel storage tanks. Diesel-range organics concentrations were 250-860 mg/kg soil at the beginning of the study. Replicate field plots treated with fertilizer yielded final concentrations of 0, 50, 100, or 200 mg N/kg soil. Soil pH and soil-water potentials decreased due to fertilizer application. The addition of fertilizer considerably increased soil respiration potentials, but not the populations of microorganisms measured. Fertilizer addition also led to ??? 50% loss of measured aliphatic and aromatic hydrocarbons in surface and subsurface soils. For fertilized plots, hydrocarbon loss was not associated with the quantity of fertilizer added. Losses of aliphatic hydrocarbons were ascribed to biotic processes, while losses of aromatic hydrocarbons were due to biotic and abiotic processes.
A case study of the intrinsic bioremediation of petroleum hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Barker, G.W.; Raterman, K.T.; Fisher, J.B.; Corgan, J.M. [and others
1995-12-31
Condensate liquids have been found to contaminate soil and groundwater at two gas production sites in the Denver Basin operated by Amoco Production Co. These sites have been closely monitored since July 1993 to determine whether intrinsic aerobic or anaerobic bioremediation of hydrocarbons occurs at a sufficient rate and to an adequate endpoint to support a no-intervention decision. Groundwater monitoring and analysis of soil cores suggest that intrinsic bioremediation is occurring at these sites by multiple pathways including aerobic oxidation, Fe{sup 3+} reduction, and sulfate reduction. In laboratory experiments the addition of gas condensate hydrocarbons to saturated soil from the gas production site stimulated sulfate reduction under anaerobic and oxygen-limiting conditions, and nitrate and Fe{sup 3+} reduction under oxygen-limiting conditions, compared to biotic controls that lacked hydrocarbon and sterile controls. The sulfate reduction corresponded to a reduction in the amount of toluene relative to other hydrocarbons. These results confirmed that subsurface soils at the gas production site have the potential for intrinsic bioremediation of hydrocarbons.
Polycyclic aromatic hydrocarbons in storm runoff from urban and coastal South Carolina.
Ngabe, B; Bidleman, T F; Scott, G I
2000-06-08
Stormwater runoff was collected in urbanized areas of South Carolina to investigate the levels and sources of polycyclic aromatic hydrocarbons (PAHs). Mean concentrations of total PAHs in runoff (sum(PAHs), 14 compounds), determined by gas chromatography-mass spectrometry, were 5590 ng/l in the city of Columbia and 282 ng/l in the coastal community of Murrells Inlet. Lower concentrations were found in estuarine water at Murrells Inlet (mean = 35 ng/l) and at undeveloped North Inlet estuary (13 ng/l). The PAH profiles in Columbia and Murrells Inlet runoff were similar to those of atmospheric particulate matter and unlike those in used crankcase oil. Examination of the aliphatic fraction of Columbia runoff samples by gas chromatography with flame ionization detection showed patterns that were more similar to used crankcase oil than to urban aerosols.
The role of hydrocarbons in energy transition
International Nuclear Information System (INIS)
2015-11-01
This publication presents some reflections and statements as well as data regarding the role of hydrocarbons in energy production and consumption, in order to better highlight the role hydrocarbons may have in energy transition. It outlines the still very important share of oil in primary and final energy, and more particularly in transports, and that, despite the development of other energies, an energy transition is always very slow. It discusses the perspectives for hydrocarbon reserves and production of oil and natural gas. It outlines that oil remains the most important energy for mobility, the benefits of conventional fuels, and that distribution infrastructures must be preserved and developed. It discusses the evolution of the economic situation of the refining activity (more particularly its margin). It outlines the high contribution of oil industry to economic activity and employment in France, discusses the French energy taxing policy and environmental taxing policy, discusses the issue of security of energy supply (with its different components: exploration-production, refining, logistics and depots, distribution and station network). It discusses the possible role shale hydrocarbons may have in the future. For each issue, the position and opinion of the UFIP (the French Union of oil industries) is stated. The second part of the document proposes a Power Point presentation with several figures and data on these issues
Recent interstellar molecular line work
International Nuclear Information System (INIS)
Winnewisser, G.
1975-01-01
A summary of recent interstellar molecular line work is presented. Transitions of the following molecules have been detected in Sgr B2: Vinylcyanide, H 2 C 2 HCN, formic acid, HCOOH, dimethyl ether (CH 3 ) 2 O and isotopically labelled cyanoacetylene- 13 C,HC 13 CCN and HCC 13 CN. The data on cyanoacetylene give an upper limit to the abundance ratio 12 C/ 13 C of 36 +- 5. A short discussion of the interstellar chemistry leads to the conclusion that hydrocarbons such as acetylene, HCCH, ethylen, H 2 CCH 2 and ethane H 3 CCH 3 should be present in interstellar clouds. 13 refs
The analysis of hydrocarbons by dual-energy gamma-ray densitometry
International Nuclear Information System (INIS)
Taylor, T.; Reynolds, P.W.; Lipsett, J.J.
1985-11-01
Various hydrocarbons have been analyzed noninvasively by dual-energy gamma-ray densitometry. The hydrogen/carbon atomic ratio was deduced for pure hydrocarbons while for heavy oil process samples, the ash content was inferred
Disease burden of chronic hepatitis C among immigrants in Canada.
Chen, W; Krahn, M
2015-12-01
Immigrants with chronic hepatitis C (CHC) in Canada have doubled risk of hepatocellular carcinoma. To measure the burden of CHC among immigrants in Canada. A decision analytic model was developed to compare immigrants with CHC and age-matched immigrants without CHC for survival years, quality-adjusted life-years (QALYs) and medical costs per life year. Hepatitis C epidemiology among immigrants was based on hepatitis C prevalence in their home countries. A cohort of immigrant patients was retrospectively followed up to estimate fibrosis stage distribution, treatment patterns and prognosis of compensated cirrhosis. Other model variables were based on published sources. Base case analysis, one-way sensitivity analysis and probabilistic sensitivity analysis were performed to measure the burden of CHC and assess the impact of uncertainty associated with model variables on the burden of CHC. CHC could reduce survival by 9.6 years [95% credible interval (CI): 8.0-10.9 years], reduce QALYs by 9.5 years (95% CI: 6.0-13.8 years) and increase medical costs per life year by $1950 (95% CI: $1518 to $2486, 2006 Canadian dollars). Because nearly half of immigrants with CHC were not diagnosed until the development of cirrhosis, the burden of CHC was highly sensitive to the risks of liver-related complications and mortality but insensitive to pegylated interferon plus ribavirin. The burden of CHC among immigrants in Canada is substantial mainly due to liver-related complications and mortality. The delay in diagnosis was another important contributor to the burden of CHC among immigrants. © 2015 John Wiley & Sons Ltd.
Method of cleansing and refining of liquid hydrocarbons and derivatives of hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Hahn, C A; Nielsen, H
1934-10-11
A process is described for cleaning and refining liquid hydrocarbons and derivatives by utilization of acids, followed by washing partly with a basic solution, partly with clean water. The process is characterized by using, in connection with the acid solutions mentioned, a strong solution of a mixture of sulfuric acid and phosphoric acid.
Analysis of petroleum hydrocarbons in soil from view of bioremediation process
International Nuclear Information System (INIS)
Mracnova, R.; Sojak, L.; Kubinec, R.; Kraus, A.; Eszenyiova, A.; Ostrovsky, I.
2002-01-01
The pollution of the environment by petroleum hydrocarbons is the most often pollution of them all. Nevertheless, hydrocarbons present in environment can be not only of petroleum or anthropogenic origin, but of biogenic as well. Typically the hydrocarbons are presented in the environment as very complex mixtures of individual compounds with very different chemical structure, wide range of the boiling points (∼800 0 C) as well as with the wide range of the number of carbon atoms. Immediately they are spread in any environmental matrix the complex physical, chemical and biochemical reactions start. A lot of methods have been developed and new are permanently in progress for the monitoring and control of petroleum hydrocarbons contamination and/or soils bioremediation. Generally, all methods by whose the hydrocarbons contaminants are determined in GC-FID system do not satisfied recommendations for enough accurate and precise results. Hyphenation of capillary gas chromatography and mass selective detector operated in the selective ion monitoring mode essentially allows detailed specification of non-polar extractable hydrocarbons. Isoprenoid alkanes, alkylhomologues of aromatic hydrocarbons and polycyclic alkanes hopanes-like were investigated as markers for recognition of petroleum and biogenic contamination. C 30 17α(H)21β(H)-hopane (C 30 -hopane) seems to be a suitable marker to identify hydrocarbons origin, to determine composting rates for nonpolar extractable compounds and to calculate real content of non-polar extractable compounds in final composting status on the assumption that the contamination is of mineral oil type. This is the survey into the results obtained in this field published in the literature as well as reached in our laboratory. (author)
Determination of polynuclear hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Lodge, Jr, J P
1963-01-01
At the present time, the method of choice for the determination of polynuclear hydrocarbons appears to be the following, (a) extraction of the benzene-soluble fraction from the gross collected particulate matter, (b) one pass through a chromatographic column of partially deactivated alumina, (c) spectral examination of the fractions and (d) the application of appropriate chemical tests as indicated by the previous step. Using this method, the presence of pyrene, fluoranthene, one of the benzofluorenes, chrysens, benz(a)anthracene, benzo(a)pyrene, benzo(e)pyrene, benzo(k)fluoranthene, anthanthrene, and coronene was demonstrated in the air of numerous American cities, and benzo(a)pyrene was measured at some 130 sites. Invaluable as such accurate determinations may be for research purposes, they are still too costly and time-consuming for routine survey purposes. While studies on the subject are by no means complete, they indicate the validity of piperonal chloride test as a general index of polycyclic hydrocarbons. This procedure is described in this paper. 7 references.
Hydrocarbons: source of energy
International Nuclear Information System (INIS)
Imarisio, G.; Frias, M.; Bemtgen, J.M.
1989-01-01
Hydrocarbons are at present the single most important source of energy, since they are the most versatile and widely used. It is expected that their importance will extend well into the next century and therefore it is essential to provide for all those improvements which will extend their availability and usefulness. The sub-programme ''Optimization of the production and utilization of hydrocarbons'' (within the Non-Nuclear Energy R and D Programme of the European Communities) is pursuing a number of R and D topics aimed at the above-mentioned results. It is implemented by means of shared-cost R and D contracts. At this first Seminar held in Lyon (France) from 21-23 September, 1988, all contractors of the sub-programme presented the state of progress of their R and D projects. These proceedings comprise all the papers presented at the Seminar. The section on oilfield exploration includes a report of work on the interpretation of nuclear logs by means of mathematical models. (author)
International Nuclear Information System (INIS)
Siegrist, R.L.
1991-01-01
Due to their widespread use throughout commerce and industry, volatile hydrocarbons such as toluene, trichloroethene, and 1, 1,1-trichloroethane routinely appears as principal pollutants in contamination of soil system hydrocarbons is necessary to confirm the presence of contamination and its nature and extent; to assess site risks and the need for cleanup; to evaluate remedial technologies; and to verify the performance of a selected alternative. Decisions regarding these issues have far-reaching impacts and, ideally, should be based on accurate measurements of soil hydrocarbon concentrations. Unfortunately, quantification of volatile hydrocarbons in soils is extremely difficult and there is normally little understanding of the accuracy and precision of these measurements. Rather, the assumptions often implicitly made that the hydrocarbon data are sufficiently accurate for the intended purpose. This appear presents a discussion of measurement error potential when quantifying volatile hydrocarbons in soils, and outlines some methods for understanding the managing these errors
Mineralisation of target hydrocarbons in three contaminated soils from former refinery facilities.
Towell, Marcie G; Bellarby, Jessica; Paton, Graeme I; Coulon, Frédéric; Pollard, Simon J T; Semple, Kirk T
2011-02-01
This study investigated the microbial degradation of (14)C-labelled hexadecane, octacosane, phenanthrene and pyrene and considered how degradation might be optimised in three genuinely hydrocarbon-contaminated soils from former petroleum refinery sites. Hydrocarbon mineralisation by the indigenous microbial community was monitored over 23 d. Hydrocarbon mineralisation enhancement by nutrient amendment (biostimulation), hydrocarbon degrader addition (bioaugmentation) and combined nutrient and degrader amendment, was also explored. The ability of indigenous soil microflora to mineralise (14)C-target hydrocarbons was appreciable; ≥ 16% mineralised in all soils. Generally, addition of nutrients or degraders increased the rates and extents of mineralisation of (14)C-hydrocarbons. However, the addition of nutrients and degraders in combination had a negative effect upon (14)C-octacosane mineralisation and resulted in lower extents of mineralisation in the three soils. In general, the rates and extents of mineralisation will be dependent upon treatment type, nature of the contamination and adaptation of the ingenious microbial community. Copyright © 2010 Elsevier Ltd. All rights reserved.
Nestmate recognition in social insects and the role of hydrocarbons
DEFF Research Database (Denmark)
van Zweden, Jelle Stijn; D'Ettorre, Patrizia
2010-01-01
A unique and critical analysis of the wealth of research conducted on the biology, biochemistry and chemical ecology of the rapidly growing field of insect cuticular hydrocarbons. Authored by leading experts in their respective fields, the twenty chapters show the complexity that has been...... discovered in the nature and role of hydrocarbons in entomology. Covers, in great depth, aspects of chemistry (structures, qualitative and quantitative analysis), biochemistry (biosynthesis, molecular biology, genetics, evolution), physiology, taxonomy, and ecology. Clearly presents to the reader the array...... of data, ideas, insights and historical disagreements that have been accumulated during the past half century. An emphasis is placed on the role of insect hydrocarbons in chemical communication, especially among the social insects. Includes the first review on the chemical synthesis of insect hydrocarbons...
Phenomenology of tremor-like signals observed over hydrocarbon reservoirs
Dangel, S.; Schaepman, M.E.; Stoll, E.P.; Carniel, R.; Barzandji, O.; Rode, E.D.; Singer, J.M.
2003-01-01
We have observed narrow-band, low-frequency (1.5-4 Hz, amplitude 0.01-10 mum/s) tremor signals on the surface over hydrocarbon reservoirs (oil, gas and water multiphase fluid systems in porous media) at currently 15 sites worldwide. These 'hydrocarbon tremors' possess remarkably similar spectral and
BioDegradation of Refined Petroleum Hydrocarbons in Soil | Obire ...
African Journals Online (AJOL)
Carbon-dioxide production and hydrocarbon degradation of refined petroleum hydrocarbon in soils treated with 5% gasoline, kerosene and diesel oil were investigated. Soil for study was bulked from around a car park in Port Harcourt. Soil samples were collected at weekly intervals for four weeks and subsequently at ...
Conversion of oligomeric starch, cellulose, or sugars to hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
Silks, Louis A.; Sutton, Andrew; Kim, Jin Kyung; Gordon, John Cameron; Wu, Ruilian; Kimball, David B.
2016-10-18
The present invention is directed to the one step selective conversion of starch, cellulose, or glucose to molecules containing 7 to 26 contiguous carbon atoms. The invention is also directed to the conversion of those intermediates to saturated hydrocarbons. Such saturated hydrocarbons are useful as, for example, fuels.
Biotransformation of monoaromatic hydrocarbons under anoxic conditions
International Nuclear Information System (INIS)
Ball, H.A.; Reinhard, M.; McCarty, P.L.
1991-01-01
Aromatic hydrocarbons contained in gasoline are environmental pollutants of particular concern since they are relatively soluble in water, many are toxic, and some are confirmed carcinogens, (e.g., benzene). Although most gasoline constituents are readily degraded in aerobic surface water systems, the groundwater environment associated with hydrocarbon spills is typically anaerobic, thus precluding aerobic degradation pathways. In the absence of oxygen, degradation of gasoline components can take place only with the utilization of alternate electron acceptors such as nitrate, sulfate, carbon dioxide, and possibly ferric iron or other metal oxides. Benzene, toluene, and xylene isomers were completely degraded by aquifer- or sewage sludge-derived microorganisms under dentrifying and methanogenic conditions. Recently, a pure culture was found to degrade toluene and m-xylene nitrate or nitrous oxide as an electron acceptor. This paper presents initial results of ongoing study to develop and characterize microbial consortia capable of transforming aromatic hydrocarbons under nitrate-reducing conditions, and understand the effect of environmental factors on the biotransformation processes
Catalytic Upgrading of Sugars to Hydrocarbons Technology Pathway
Energy Technology Data Exchange (ETDEWEB)
Biddy, M.; Jones, S.
2013-03-01
This technology pathway case investigates the catalytic conversion of solubilized carbohydrate streams to hydrocarbon biofuels, utilizing data from recent efforts within the National Advanced Biofuels Consortium (NABC) in collaboration with Virent, Inc. Technical barriers and key research needs that should be pursued for the catalytic conversion of sugars pathway to be competitive with petroleum-derived gasoline-, diesel-, and jet-range hydrocarbon blendstocks have been identified.
Energy Technology Data Exchange (ETDEWEB)
Carvan, M.J. III.
1993-01-01
Cetaceans bioaccumulate high aromatic hydrocarbon tissue residues, and elevated levels of PCB residues in tissues are proposed to have occurred concurrently with recent epizootic deaths of dolphins. The objectives of this study were: (1) to develop and characterize an epithelial cell line derived from dolphin tissues, (2) to investigate the effects of hydrocarbon pollutants on those cells, and (3) to analyze the toxicity of hydrocarbon pollutants on cetacean tissues in vitro. An epithelial cell line, Carvan dolphin kidney (CDK), isolated from a spontaneously aborted female bottlenose dolphin, Tursiops truncatus, grew rapidly. These cells were neither transformed nor immortal. Velocity sedimentation analysis showed CDK cells contained nuclear aryl hydrocarbon receptor, suggestive of cytochrome P450 inducibility. BaP inhibited mitosis in CDK cells in a dose-dependent manner. Data indicate that CDK cells metabolize BaP, that BaP metabolites bind to cellular DNA initiating unscheduled DNA synthesis, and that the inhibition of cytochrome P450 metabolism decrease the BaP-associated inhibition of mitosis in dolphin cells. The data also suggest that TCDD acts synergistically to increase the levels of DNA damage by the procarcinogen BaP. Cetacean liver microsomes was isolated and evaluated for the presence of cytochrome P450 proteins by SDS-PAGE, apparent minimum molecular weight determination, and immunoblot analysis. P450 activity was induced in cetacean tissue samples and CDK cells by exposure in vitro to one of several cytochrome P450-inducing chemicals. The data suggest that cetacean tissues and cells can be utilized to study the in vitro induction of cytochrome P450, resultant metabolism of xenobiotic contaminants, and the subsequent cellular and molecular responses. However, the identity of specific P450 isozymes involved in this process will remain undetermined until monoclonal antibodies that recognize cetacean P450s can be generated.
Enumeration of petroleum hydrocarbon utilizing bacteria
International Nuclear Information System (INIS)
Mukherjee, S.; Barot, M.; Levine, A.D.
1996-01-01
In-situ biological treatment is one among a number of emerging technologies that may be applied to the remediation of contaminated soils and groundwater. In 1985, a surface spill of 1,500 gallons of dielectric transformer oil at the Sandia National Laboratories (HERMES II facility) resulted in contamination of soil up to depths of 160 feet. The extent of contamination and site characteristics favored the application of in-situ bioremediation as a potential remedial technology. The purpose of this research was to enumerate indigenous microbial populations capable of degrading petroleum hydrocarbons. Microbial enumeration and characterization methods suitably adapted for hydrocarbon utilizing bacteria were used as an indicator of the presence of viable microbial consortia in excavated oil samples with hydrocarbon (TPH) concentrations ranging from 300 to 26,850 ppm. Microbial activity was quantified by direct and streak plating soil samples on silica gel media. Effects of toxicity and temperature were studied using batch cultures of hydrocarbon utilizing bacteria (selectively isolated in an enrichment medium), at temperatures of 20 and 35 C. It was concluded from this study that it is possible to isolate native microorganisms from contaminated soils from depths of 60 to 160 feet, and with oil concentration ranging from 300 to 26,850 ppm. About 62% of the microorganisms isolated form the contaminated soil were capable of using contaminant oil as a substrate for growth and metabolism under aerobic conditions. Growth rates were observed to be 50% higher for the highest contaminant concentration at 20 C. Resistance to toxicity to contaminant oil was also observed to be greater at 20 C than at 35 C
Characterization of a nose-only inhalation exposure system for hydrocarbon mixtures and jet fuels.
Martin, Sheppard A; Tremblay, Raphael T; Brunson, Kristyn F; Kendrick, Christine; Fisher, Jeffrey W
2010-04-01
A directed-flow nose-only inhalation exposure system was constructed to support development of physiologically based pharmacokinetic (PBPK) models for complex hydrocarbon mixtures, such as jet fuels. Due to the complex nature of the aerosol and vapor-phase hydrocarbon exposures, care was taken to investigate the chamber hydrocarbon stability, vapor and aerosol droplet compositions, and droplet size distribution. Two-generation systems for aerosolizing fuel and hydrocarbons were compared and characterized for use with either jet fuels or a simple mixture of eight hydrocarbons. Total hydrocarbon concentration was monitored via online gas chromatography (GC). Aerosol/vapor (A/V) ratios, and total and individual hydrocarbon concentrations, were determined using adsorbent tubes analyzed by thermal desorption-gas chromatography-mass spectrometry (TDS-GC-MS). Droplet size distribution was assessed via seven-stage cascade impactor. Droplet mass median aerodynamic diameter (MMAD) was between 1 and 3 mum, depending on the generator and mixture utilized. A/V hydrocarbon concentrations ranged from approximately 200 to 1300 mg/m(3), with between 20% and 80% aerosol content, depending on the mixture. The aerosolized hydrocarbon mixtures remained stable during the 4-h exposure periods, with coefficients of variation (CV) of less than 10% for the total hydrocarbon concentrations. There was greater variability in the measurement of individual hydrocarbons in the A-V phase. In conclusion, modern analytical chemistry instruments allow for improved descriptions of inhalation exposures of rodents to aerosolized fuel.
Natural hydrocarbon seeps observation with underwater gliders and UV fluorescence sensor
Rochet, V.
2016-02-01
Hydrocarbons may leak to the near-surface from subsurface accumulations, from mature source rock, or by buoyancy along major cross-strata routes. The presence of migrating near-surface hydrocarbons can provide strong evidence for the presence of a working petroleum system, as well as valuable information on source, maturity, and migration pathways. Detection and characterization of hydrocarbons in the water column may then help to de-risk hydrocarbon plays at a very preliminary stage of an exploration program. In order to detect hydrocarbons in the water column, an underwater glider survey was conducted in an offshore frontier area. Driven by buoyancy variation, underwater gliders enable collecting data autonomously along the water column for weeks to months. Underwater gliders are regularly piloted from shore by satellite telemetry and do not require a surface supervising vessel resulting in substantial operational costs savings. The data compiled, over 700m depth of the water column, included temperature, salinity, pressure, dissolved oxygen and hydrocarbon components (phenanthrene and naphthalene) measured by "MINIFLUO" sensors to particularly target representative crude oil compounds Two gliders were deployed at sea, one from coast in shallow water and the other one offshore on the survey area. Both accurately squared the survey area following pre-defined lines and cross lines. Data files were transmitted by satellite telemetry in near real time during the performance of the mission for real time observations and appropriate re-positioning of the gliders. Using rechargeable underwater gliders increased reliability reducing the risk of leakage and associated logistics during operation at sea. Despite strong evidences of seabed seepages such as pockmarks, faults, etc, over the area of interest, no hydrocarbon indices were detected in the water column, which was confirmed later by seabed sample analysis. The use of glider platforms for hydrocarbon detection has
The role of fluid migration system in hydrocarbon accumulation in Maichen Sag, Beibuwan Basin
Liu, Hongyu; Yang, Jinxiu; Wu, Feng; Chen, Wei; Liu, Qianqian
2018-02-01
Fluid migration system is of great significance for hydrocarbon accumulation, including the primary migration and secondary migration. In this paper, the fluid migration system is analysed in Maichen Sag using seismic, well logging and core data. Results show that many factors control the hydrocarbon migration process, including hydrocarbon generation and expulsion period from source rocks, microfractures developed in the source rocks, the connected permeable sand bodies, the vertical faults cutting into/through the source rocks and related fault activity period. The spatial and temporal combination of these factors formed an effective network for hydrocarbon expulsion and accumulation, leading to the hydrocarbon reservoir distribution at present. Generally, a better understanding of the hydrocarbon migration system can explain the present status of hydrocarbon distribution, and help select future target zones for oil and gas exploration.
Ambient aromatic hydrocarbon measurements at Welgegund, South Africa
Jaars, K.; Beukes, J. P.; van Zyl, P. G.; Venter, A. D.; Josipovic, M.; Pienaar, J. J.; Vakkari, V.; Aaltonen, H.; Laakso, H.; Kulmala, M.; Tiitta, P.; Guenther, A.; Hellén, H.; Laakso, L.; Hakola, H.
2014-07-01
Aromatic hydrocarbons are associated with direct adverse human health effects and can have negative impacts on ecosystems due to their toxicity, as well as indirect negative effects through the formation of tropospheric ozone and secondary organic aerosol, which affect human health, crop production and regional climate. Measurements of aromatic hydrocarbons were conducted at the Welgegund measurement station (South Africa), which is considered to be a regionally representative background site. However, the site is occasionally impacted by plumes from major anthropogenic source regions in the interior of South Africa, which include the western Bushveld Igneous Complex (e.g. platinum, base metal and ferrochrome smelters), the eastern Bushveld Igneous Complex (platinum and ferrochrome smelters), the Johannesburg-Pretoria metropolitan conurbation (> 10 million people), the Vaal Triangle (e.g. petrochemical and pyrometallurgical industries), the Mpumalanga Highveld (e.g. coal-fired power plants and petrochemical industry) and also a region of anticyclonic recirculation of air mass over the interior of South Africa. The aromatic hydrocarbon measurements were conducted with an automated sampler on Tenax-TA and Carbopack-B adsorbent tubes with heated inlet for 1 year. Samples were collected twice a week for 2 h during daytime and 2 h during night-time. A thermal desorption unit, connected to a gas chromatograph and a mass selective detector was used for sample preparation and analysis. Results indicated that the monthly median (mean) total aromatic hydrocarbon concentrations ranged between 0.01 (0.011) and 3.1 (3.2) ppb. Benzene levels did not exceed the local air quality standard limit, i.e. annual mean of 1.6 ppb. Toluene was the most abundant compound, with an annual median (mean) concentration of 0.63 (0.89) ppb. No statistically significant differences in the concentrations measured during daytime and night-time were found, and no distinct seasonal patterns were
Hydrocarbon isotope detection by elastic peak electron spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Kostanovskiy, I.A., E-mail: kostanovskiyia@gmail.com [National Research University MPEI, Krasnokazarmennaya 14, 111250 Moscow (Russian Federation); Afanas’ev, V.P. [National Research University MPEI, Krasnokazarmennaya 14, 111250 Moscow (Russian Federation); Naujoks, D. [Max-Planck-Institut für Plasmaphysik, Teilinstitut Greifswald, Wendelsteinstraße 1, D-17491 Greifswald (Germany); Mayer, M. [Max-Planck-Institut für Plasmaphysik, D-85748 Garching (Germany)
2015-07-15
Highlights: • PCVD hydrocarbon coatings containing protium or deuterium are analyzed via NRA, ERD, XPS and EPES. • EPES analysis with modern electron energy analyzer SPECS Phoibos 225 shows a clear signal from the hydrogen isotopes. • Different primary energies and scattering angles help to quantify isotope content from EPES spectra. - Abstract: Experimental results on the hydrocarbon isotope analysis by elastic peak electron spectroscopy are presented. Amorphous hydrocarbon samples (a-C:H, a-C:D) are prepared by PCVD and analyzed by nuclear reaction analysis (NRA), elastic recoil detection analysis (ERD), X-ray photoelectron spectroscopy (XPS) and elastic peak electron spectroscopy (EPES). Electron energy spectra show a clear signal from the hydrogen isotopes deuterium and protium. Different incident energies and scattering geometries help to resolve plasmon and elastic energy losses.
Hydrocarbon isotope detection by elastic peak electron spectroscopy
International Nuclear Information System (INIS)
Kostanovskiy, I.A.; Afanas’ev, V.P.; Naujoks, D.; Mayer, M.
2015-01-01
Highlights: • PCVD hydrocarbon coatings containing protium or deuterium are analyzed via NRA, ERD, XPS and EPES. • EPES analysis with modern electron energy analyzer SPECS Phoibos 225 shows a clear signal from the hydrogen isotopes. • Different primary energies and scattering angles help to quantify isotope content from EPES spectra. - Abstract: Experimental results on the hydrocarbon isotope analysis by elastic peak electron spectroscopy are presented. Amorphous hydrocarbon samples (a-C:H, a-C:D) are prepared by PCVD and analyzed by nuclear reaction analysis (NRA), elastic recoil detection analysis (ERD), X-ray photoelectron spectroscopy (XPS) and elastic peak electron spectroscopy (EPES). Electron energy spectra show a clear signal from the hydrogen isotopes deuterium and protium. Different incident energies and scattering geometries help to resolve plasmon and elastic energy losses
Tedetti, Marc; Bachet, Caroline; Joffre, Pascal; Ferretto, Nicolas; Guigue, Catherine; Goutx, Madeleine
2014-05-01
PHE, NAP, FLU and PYR in the range 0.1-100 µg l-1 and 2) on a water soluble fraction (WSF) of crude oil diluted in 0.2 µm filtered seawater (0 to 50% of WSF in seawater). Then, the MiniFluo-UV sensors were mounted onto a conductivity temperature depth (CTD) vertical profiler and tested at sea. Several profiles were performed in the Bay of Marseilles, in different harbours and hydrocarbon-impacted sites. The MiniFluo-UV measurements performed in the laboratory and in the field were associated with spectrofluorometric (EEM/PARAFAC) and/or chromatographic (GC-MS) analyses. The result obtained show that the MiniFluo-UV are pertinent and efficient tool for monitoring hydrocarbon pollutions in the marine environment. This work is a contribution of three projects labelled by the Competitivity Cluster Mer PACA: FUI SEA EXPLORER, DGCIS - Eco industries VASQUE (PI: ACSA-ALCEN, Meyreuil, France) and ANR - ECOTECH IBISCUS (PI: M. Goutx, MIO, Marseille, France).
Natural and anthropogenic hydrocarbon inputs to sediments of Patos Lagoon Estuary, Brazil.
Medeiros, Patricia Matheus; Bícego, Márcia Caruso; Castelao, Renato Menezes; Del Rosso, Clarissa; Fillmann, Gilberto; Zamboni, Ademilson Josemar
2005-01-01
The Patos Lagoon Estuary, southern Brazil, is an area of environmental interest not only because of tourism, but also because of the presence of the second major port of Brazil, with the related industrial and shipping activities. Thus, potential hydrocarbon pollution was examined in this study. Sediment samples were collected at 10 sites in the estuary, extracted, and analyzed by GC-FID and GC-MS for composition and concentration of the following organic geochemical markers: normal and isoprenoid alkanes, petroleum biomarkers, linear alkylbenzenes (LABs), and polycyclic aromatic hydrocarbons (PAHs). The total concentrations varied from 1.1 to 129.6 microg g(-1) for aliphatic hydrocarbons, from 17.8 to 4510.6 ng g(-1) for petroleum biomarkers, from 3.2 to 1601.9 ng g(-1) for LABs, and from 37.7 to 11,779.9 ng g(-1) for PAHs. Natural hydrocarbons were mainly derived from planktonic inputs due to a usual development of blooms in the estuary. Terrestrial plant wax compounds prevailed at sites located far from Rio Grande City and subject to stronger currents. Anthropogenic hydrocarbons are related to combustion/pyrolysis processes of fossil fuel, release of unburned oil products and domestic/industrial waste outfalls. Anthropogenic hydrocarbon inputs were more apparent at sites associated with industrial discharges (petroleum distributor and refinery), shipping activities (dry docking), and sewage outfalls (sewage). The overall concentrations of anthropogenic hydrocarbons revealed moderate to high hydrocarbon pollution in the study area.
Mathematics of Periodic Tables for Benzenoid Hydrocarbons.
Dias, Jerry Ray
2007-01-01
The upper and lower bounds for invariants of polyhex systems based on the Harary and Harborth inequalities are studied. It is shown that these invariants are uniquely correlated by the Periodic Table for Benzenoid Hydrocarbons. A modified periodic table for total resonant sextet (TRS) benzenoids based on the invariants of Ds and r(empty) is presented; Ds is the number of disconnections among the empty rings for fused TRS benzenoid hydrocarbons. This work represents a contribution toward deciphering the topological information content of benzenoid formulas.
Hydrocarbon potential of Ordovician and Silurian rocks. Siljan Region (Sweden)
Energy Technology Data Exchange (ETDEWEB)
Berner, U. [Bundesanstalt fuer Geowissenschaften und Rohstoffe (BGR), Hannover (Germany); Lehnert, O. [Erlangen-Nuernberg Univ., Erlangen (Germany); Meinhold, G. [Goettingen Univ. (Germany)
2013-08-01
Hydrocarbon exploration in the vicinity of Europe's largest impact structure (Siljan, Central Sweden) focused for years on abiogenic concepts and largely neglected state of the art knowledge on hydrocarbon generation via thermal decomposition of organic matter. In our study we use sedimentary rocks obtained from three drill sites (Mora001, Stumsnaes 1 and Solberga 1) within the ring structure around the central uplift to investigate the hydrocarbon potential of Ordovician and Silurian strata of the region and also for comparison with the shale oil and gas potential of age equivalent rocks of the Baltic Sea. Elemental analyses provided information on concentrations of carbonate and organic carbon, total sulfur as well as on the composition of major and minor elements of the sediments. The data has been used to evaluate the depositional environment and possible diagenetic alterations of the organic matter. RockEval pyrolysis and solvent hydrocarbon extraction gave insight into the hydrocarbon generation potential and the type and thermal maturity of the sediments. From the geochemistry data of the studied wells it is obvious that changes of depositional environments (lacustrine - marine) have occurred during Ordovician and Silurian times. Although, the quality of the organic matter has been influenced in marine and brackish environments through sulfate reduction, we observe for a number of marine and lacustrine sediments a good to excellent preservation of the biological precursors which qualify the sediments as hydrocarbon source rocks (Type II kerogens). Lacustrine source rocks show a higher remaining hydrocarbon potential (up to {proportional_to}550 mg HC per g C{sub org}) than those of marine or brackish environments. Our investigations indicate that the thermal maturity of organic matter of the drill sites has reached the initial stage of oil generation. However, at Mora001 some of the sediments were stained with oil indicating that hydrocarbons have
Source apportionment of hydrocarbons measured in the Eagle Ford shale
Roest, G. S.; Schade, G. W.
2016-12-01
The rapid development of unconventional oil and gas in the US has led to hydrocarbon emissions that are yet to be accurately quantified. Emissions from the Eagle Ford Shale in southern Texas, one of the most productive shale plays in the U.S., have received little attention due to a sparse air quality monitoring network, thereby limiting studies of air quality within the region. We use hourly atmospheric hydrocarbon and meteorological data from three locations in the Eagle Ford Shale to assess their sources. Data are available from the Texas commission of environmental quality (TCEQ) air quality monitors in Floresville, a small town southeast of San Antonio and just north of the shale area; and Karnes city, a midsize rural city in the center of the shale. Our own measurements were carried out at a private ranch in rural Dimmit County in southern Texas from April to November of 2015. Air quality monitor data from the TCEQ were selected for the same time period. Non-negative matrix factorization in R (package NMF) was used to determine likely sources and their contributions above background. While the TCEQ monitor data consisted mostly of hydrocarbons, our own data include both CO, CO2, O3, and NOx. We find that rural Dimmit County hydrocarbons are dominated by oil and gas development sources, while central shale hydrocarbons at the TCEQ monitoring sites have a mix of sources including car traffic. However, oil and gas sources also dominate hydrocarbons at Floresville and Karnes City. Toxic benzene is nearly exclusively due to oil and gas development sources, including flaring, which NMF identifies as a major hydrocarbon source in Karnes City. Other major sources include emissions of light weight alkanes (C2-C5) from raw natural gas emissions and a larger set of alkanes (C2-C10) from oil sources, including liquid storage tanks.
Climate change and the hydrocarbon industry; A klimavaltozas es a szenhidrogenipar
Energy Technology Data Exchange (ETDEWEB)
Almasi, M.; Racz, L.
1999-07-01
The theory of the greenhouse effect and the impact of greenhouse phenomena on climate change are summarized. Theoretical bases of climate changes are outlined and the relationship between greenhouse effects and hydrocarbon production is analyzed. Hungary's carbon dioxide emissions as well as the possibilities of reducing the emissions caused by hydrocarbons are discussed. Finally the tasks of the Hungarian hydrocarbon industry in relation to the environmental problems are concerned.
Bioavailability enhanced rhizosphere remediation of petroleum hydrocarbon contaminated soil
International Nuclear Information System (INIS)
Marchenko, A.; Vorobyov, A.; Zharikov, G.; Ermolenko, Z.; Dyadishchev, N.; Borovick, R.; Sokolov, M.; Ortega-Calvo, J.J.
2005-01-01
Aliphatic, aromatic and polycyclic aromatic oil hydrocarbons are structurally complicated man-caused pollutants that are constantly brought into biosphere. Oil production in Russia, so as all over the world, is connected with pollution of biotopes, ecosystems and agro-landscapes. Presently large funds are allocated either for oil leak prevention or for discharged oil gathering. At the same time, in spite of large necessity in technologies for efficient reconstruction of soil bio-productivity, reliable regional systems of their remediation in situ have not been developed yet. One such method is rhizosphere remediation, a biotechnology, based on the functioning of plant-microbial complexes. Little is known about bioavailability in phyto-remediation systems. Specific bioavailability-promoting mechanisms, operating in soil with hydrocarbon-degrading populations, may be responsible for increased rates of pollutant transformation (increased bacterial adherence to the pollutants, production of bio-surfactants by bacteria or by plants, possible role of chemotaxis). In the course of work collection of 42 chemo-tactically active bio-surfactant producing strain-degraders of petroleum hydrocarbons including polycyclic aromatic hydrocarbons (PAHs) was created. Two representative strains were selected for detailed chemotaxis studies with PAHs (naphthalene, phenanthrene, anthracene, and pyrene), bacterial lipopolysaccharide and root exudates from seven different plants. These strains are produce the bio-surfactants (rhamno-lipid). The chemotactic response was quantified with a capillary and densitometric chemotaxis assay. Surface tension of cultural liquid was measured after cultivation of strains in the presence of hexadecane or phenanthrene with the use of a ring tensiometer. Before measuring of surface tension microbial cells were collected from liquid culture by centrifugation. Total petroleum Hydrocarbons (TPH) in soil were analyzed by infra-red spectroscopy method. PAHs
Bioavailability enhanced rhizosphere remediation of petroleum hydrocarbon contaminated soil
Energy Technology Data Exchange (ETDEWEB)
Marchenko, A.; Vorobyov, A.; Zharikov, G.; Ermolenko, Z.; Dyadishchev, N.; Borovick, R.; Sokolov, M. [Research Centre for Toxicology and Hygienic Regulation of Biopreparations, Moscow region (Russian Federation); Ortega-Calvo, J.J. [Instituto de Recursos Naturales y Agrobiologia, CSIC, Sevilla (Spain)
2005-07-01
Aliphatic, aromatic and polycyclic aromatic oil hydrocarbons are structurally complicated man-caused pollutants that are constantly brought into biosphere. Oil production in Russia, so as all over the world, is connected with pollution of biotopes, ecosystems and agro-landscapes. Presently large funds are allocated either for oil leak prevention or for discharged oil gathering. At the same time, in spite of large necessity in technologies for efficient reconstruction of soil bio-productivity, reliable regional systems of their remediation in situ have not been developed yet. One such method is rhizosphere remediation, a biotechnology, based on the functioning of plant-microbial complexes. Little is known about bioavailability in phyto-remediation systems. Specific bioavailability-promoting mechanisms, operating in soil with hydrocarbon-degrading populations, may be responsible for increased rates of pollutant transformation (increased bacterial adherence to the pollutants, production of bio-surfactants by bacteria or by plants, possible role of chemotaxis). In the course of work collection of 42 chemo-tactically active bio-surfactant producing strain-degraders of petroleum hydrocarbons including polycyclic aromatic hydrocarbons (PAHs) was created. Two representative strains were selected for detailed chemotaxis studies with PAHs (naphthalene, phenanthrene, anthracene, and pyrene), bacterial lipopolysaccharide and root exudates from seven different plants. These strains are produce the bio-surfactants (rhamno-lipid). The chemotactic response was quantified with a capillary and densitometric chemotaxis assay. Surface tension of cultural liquid was measured after cultivation of strains in the presence of hexadecane or phenanthrene with the use of a ring tensiometer. Before measuring of surface tension microbial cells were collected from liquid culture by centrifugation. Total petroleum Hydrocarbons (TPH) in soil were analyzed by infra-red spectroscopy method. PAHs
Sand amendment enhances bioelectrochemical remediation of petroleum hydrocarbon contaminated soil.
Li, Xiaojing; Wang, Xin; Ren, Zhiyong Jason; Zhang, Yueyong; Li, Nan; Zhou, Qixing
2015-12-01
Bioelectrochemical system is an emerging technology for the remediation of soils contaminated by petroleum hydrocarbons. However, performance of such systems can be limited by the inefficient mass transport in soil. Here we report a new method of sand amendment, which significantly increases both oxygen and proton transports, resulting to increased soil porosity (from 44.5% to 51.3%), decreased Ohmic resistance (by 46%), and increased charge output (from 2.5 to 3.5Cg(-1)soil). The degradation rates of petroleum hydrocarbons increased by up to 268% in 135d. The degradation of n-alkanes and polycyclic aromatic hydrocarbons with high molecular weight was accelerated, and denaturing gradient gel electrophoresis showed that the microbial community close to the air-cathode was substantially stimulated by the induced current, especially the hydrocarbon degrading bacteria Alcanivorax. The bioelectrochemical stimulation imposed a selective pressure on the microbial community of anodes, including that far from the cathode. These results suggested that sand amendment can be an effective approach for soil conditioning that will enhances the bioelectrochemical removal of hydrocarbons in contaminated soils. Copyright © 2015 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Bataafsche, N V; de Brey, J H.C.
1918-10-30
Hydrocarbons containing a very volatile constituent and less volatile constituents, such as casing-head gases, still gases from the distillation of crude petroleum and bituminous shale are separated into their constituents by rectification under pressure; a pressure of 20 atmospheres and limiting temperatures of 150/sup 0/C and 40/sup 0/C are mentioned as suitable. The mixture may be subjected to a preliminary treatment consisting in heating to a temperature below the maximum rectification temperature at a pressure greater than that proposed to be used in the rectification.
Algal Lipid Extraction and Upgrading to Hydrocarbons Technology Pathway
Energy Technology Data Exchange (ETDEWEB)
Davis, R.; Biddy, M.; Jones, S.
2013-03-01
This technology pathway case investigates the cultivation of algal biomass followed by further lipid extraction and upgrading to hydrocarbon biofuels. Technical barriers and key research needs have been assessed in order for the algal lipid extraction and upgrading pathway to be competitive with petroleum-derived gasoline-, diesel-, and jet-range hydrocarbon blendstocks.
Catalyst for hydrocarbon conversion
International Nuclear Information System (INIS)
Duhaut, P.; Miquel, J.
1975-01-01
A description is given for a catalyst and process for hydrocarbon conversions, e.g., reforming. The catalyst contains an alumina carrier, platinum, iridium, at least one metal selected from uranium, vanadium, and gallium, and optionally halogen in the form of metal halide of one of the aforesaid components. (U.S.)
Aliphatic hydrocarbons in surface sediments from South China Sea off Kuching Division, Sarawak
International Nuclear Information System (INIS)
Hafidz Yusoff; Zaini Assim; Samsur Mohamad
2012-01-01
Eighteen surface sediment samples collected from South China Sea off Kuching Division, Sarawak were analyzed for aliphatic hydrocarbons. These hydrocarbons were recovered from sediment by Soxhlet extraction method and then analyzed using gas chromatography equipped with mass spectrometer (GC/ MS). Total concentrations of aliphatic hydrocarbons in surface sediments from South China Sea off Kuching division are ranged from 35.6 μg/ g to 1466.1 μg/ g dry weights. The sediments collected from Bako Bay, Kuching showed high concentrations of total aliphatic hydrocarbons. Several molecular indices were used to predict the predominant sources of hydrocarbons. Carbon preference index (CPI) value revealed widespread anthropogenic input in this study area (CPI= 0 to 4.1). The ratio of C 31 / C 19 and C 29 / C 31 indicated that major input of aliphatic hydrocarbon mostly transfer by lateral input to the marine environment than atmospheric movements. Generally, the concentrations of aliphatic hydrocarbons in sediment from South China Sea off Kuching division are generally higher compare to other area in the world. (author)
Mobile geophysics for searching and exploration of Domanic hydrocarbon deposits
Borovsky, M. Ya; Uspensky, B. V.; Valeeva, S. E.; Borisov, A. S.
2018-05-01
There are noted features of shale hydrocarbons occurrence. It is shown the role of geophysical prospecting in the geological prospecting process for non-traditional sources of hydrocarbon. There are considered the possibilities of non-seismic methods for forecasting, prospecting, exploration and preparation of Domanikovian hydrocarbons accumulations for exploration. It is emphasized the need for geophysical studies of tectonic disturbances. Modern aerogeophysical instrumentation and methodological support allows to combine high-precision magneto-prospecting with gravimetric and gamma spectrometry. This combination of geophysical methods contributes to the diagnosis of active and latent faults.
Shi, Jianwu; Deng, Hao; Bai, Zhipeng; Kong, Shaofei; Wang, Xiuyan; Hao, Jiming; Han, Xinyu; Ning, Ping
2015-05-15
107 kinds of C₂-C₁₂ volatile organic compound (VOC) mass concentrations and profiles for four types of coal-fired stationary sources in Liaoning Province were studied by a dilution sampling system and GC-MS analysis method, which are of significant importance with regard to VOC emissions in northeast of China. The results showed that there were some differences among these VOC source profiles. The total mass concentrations of analyzed 107 VOC species varied from 10,917 to 19,652 μg m(-3). Halogenated hydrocarbons exhibited higher mass percentages for the VOC source profiles of iron smelt (48.8%) and coke production plant (37.7%). Aromatic hydrocarbons were the most abundant in heating station plant (69.1%). Ketones, alcohols and acetates held 45.0% of total VOCs in thermal power plant. For non-methane hydrocarbons (NMHCs), which are demanded for photochemical assessment in the USA, toluene and n-hexane were the most abundant species in the iron smelt, coke production and thermal power plant, with the mass percentages of 64.8%, 52.7% and 38.6%, respectively. Trimethylbenzene, n-propylbenzene and o,m-ethyltoluene approximately accounted for 70.0% in heating station plant. NMHCs emitted from coke production, iron smelt, heating station and power plant listed above presented different chemical reactivities. The average OH loss rate of NMHCs from heating station, was 4 to 5.6 times higher than that of NMHCs from iron smelt, coke production and power plant, which implies that VOCs emitted from heating station in northeast of China should be controlled firstly to avoid photochemical ozone pollution and protect human health. There are significant variations in the ratios of benzene/toluene and m, p-xylene/ethylbenzene of these coal-fired source profiles. The representativeness of the coal-fired sources studied and the VOC samples collected should be more closely examined. The accuracy of VOC source profiles related to coal-fired processes is highly dependent on
HYDROCARBON POLLUTION IN THE NORTH-WESTERN PART OF THE CASPIAN SEA
Directory of Open Access Journals (Sweden)
E. V. Ostrovskaya
2016-01-01
Full Text Available Aim. The paper is aimed to estimate the current level of hydrocarbon pollution of the marine environment in the North-Western part of the Caspian Sea.Methods. The paper discusses the results of three-year studies conducted in 2012-2014 within the framework of Roshydromet’s Programme of monitoring of transboundary waters of the Caspian Sea. Spatial distribution of concentrations of hydrocarbons (total and polyaromatic in water and bottom sediments of the area was analysed. Concentrations of total hydrocarbons were determined by means of infrared spectrometry and PAHs – of gas chromatography with mass spectrometry.Results. The range of the total hydrocarbons in the area’s water is from slight traces to 240 µg/l, in sediments – from traces to 114 µg/g (dry weight. Total concentrations of PAHs in water varied from traces to 321 ng/l, in sediments – from traces to 699 ng/g (dry weight. For the source identification, data of satellite monitoring of the area were used. The data showed increasing input of hydrocarbons coming into the marine environment with discharges from vessels.Conclusion. The results of these studies are compared to those of previous research and show that the level of hydrocarbons in the area is typical for slightly polluted areas.
Directory of Open Access Journals (Sweden)
Mini Priya Rajendran
2014-05-01
Full Text Available Objective: This study is designed to extract and examine chemical composition, antimicrobial and antioxidant activity of the hydro-distillated essential oil of Murraya koenigii leaves from the south region of Tamilnadu, India. Matherials and Methods: Gas Chromatography (GC and Gas Chromatography-Mass Spectrometry (GC-MS analysis of the essential oil result was indicates the 33 different compounds representing 97.56 % of the total oil. Results: Major compounds detected in the oil were Linalool (32.83%, Elemol (7.44%, Geranyl acetate (6.18%, Myrcene (6.12%, Allo-Ocimene (5.02, α-Terpinene (4.9%, and (E-β-Ocimene (3.68% and Neryl acetate (3.45%. From the identified compounds, they were classified into four groups that are oxygenated monoterpenes (72.15%, monoterpene hydrocarbons (11.81%, oxygenated sesquiterpenes (10.48% and sesquiterpenes hydrocarbons (03.12%. The antibacterial activity of essential oil has pronounced by Disc Diffusion Method against various pathogenic microbes. Conclusion: The oil has a maximum zone of inhibition ability against Corynebacterium tuberculosis, Pseudomonas aeruginosa, Streptococcus pyogenes, Klebsiella pneumonia and Enterobacter aerogenes. The antioxidant profile of the sample was determined by different test systems. In all the systems, essential oil showed a strongest activity profile within the concentration range.
International Nuclear Information System (INIS)
Huesemann, M.H.
1995-01-01
A comprehensive petroleum hydrocarbon characterization procedure involving group type separation, boiling point distribution, and hydrocarbon typing by field desorption mass spectroscopy (FDMS) has been developed to quantify changes in hydrocarbon type composition during bioremediation of petroleum-contaminated soils. FDMS is able to quantify the concentration of hundreds of specific hydrocarbon types based on their respective hydrogen deficiency (z-number) and molecular weight (carbon number). Analytical results from two bioremediation experiments involving soil contaminated with crude oil and motor oil indicate that alkanes and two-ring saturates (naphthenes) were readily biodegradable. In addition, low-molecular-weight hydrocarbons generally were biodegraded to a larger extent than those of high molecular weight. More importantly, it was found that the extent of biodegradation of specific hydrocarbon types was comparable between treatments and appeared to be unaffected by the petroleum contaminant source, soil type, or experimental conditions. It was therefore concluded that in these studies the extent of total petroleum hydrocarbon (TPH) biodegradation is primarily affected by the molecular composition of the petroleum hydrocarbons present in the contaminated soil
Energy Technology Data Exchange (ETDEWEB)
Akinlua, A., E-mail: geochemresearch@yahoo.com [Fossil Fuels and Environmental Geochemistry Group, Department of Chemistry, Obafemi Awolowo University, Ile-Ife (Nigeria); Jochmann, M.A.; Laaks, J.; Ewert, A.; Schmidt, T.C. [Instrumental Analytical Chemistry, University Duisburg-Essen, Universitaetsstr, 5, 45141 Essen (Germany)
2011-04-08
The extraction of aliphatic hydrocarbons from petroleum source rock using nonionic surfactants with the assistance of microwave was investigated and the conditions for maximum yield were determined. The results showed that the extraction temperatures and kinetic rates have significant effects on extraction yields of aliphatic hydrocarbons. The optimum temperature for microwave-assisted nonionic surfactant extraction of aliphatic hydrocarbons from petroleum source rock was 105 deg. C. The optimum extraction time for the aliphatic hydrocarbons was at 50 min. Concentration of the nonionic surfactant solution and irradiation power had significant effect on the yields of aliphatic hydrocarbons. The yields of the analytes were much higher using microwave assisted nonionic surfactant extraction than with Soxhlet extraction. The recoveries of the n-alkanes and acyclic isoprenoid hydrocarbons for GC-MS analysis from the extractant nonionic surfactant solution by in-tube extraction (ITEX 2) with a TENAX TA adsorbent were found to be efficient. The results show that microwave-assisted nonionic surfactant extraction (MANSE) is a good and efficient green analytical preparatory technique for geochemical evaluation of petroleum source rock.
International Nuclear Information System (INIS)
Akinlua, A.; Jochmann, M.A.; Laaks, J.; Ewert, A.; Schmidt, T.C.
2011-01-01
The extraction of aliphatic hydrocarbons from petroleum source rock using nonionic surfactants with the assistance of microwave was investigated and the conditions for maximum yield were determined. The results showed that the extraction temperatures and kinetic rates have significant effects on extraction yields of aliphatic hydrocarbons. The optimum temperature for microwave-assisted nonionic surfactant extraction of aliphatic hydrocarbons from petroleum source rock was 105 deg. C. The optimum extraction time for the aliphatic hydrocarbons was at 50 min. Concentration of the nonionic surfactant solution and irradiation power had significant effect on the yields of aliphatic hydrocarbons. The yields of the analytes were much higher using microwave assisted nonionic surfactant extraction than with Soxhlet extraction. The recoveries of the n-alkanes and acyclic isoprenoid hydrocarbons for GC-MS analysis from the extractant nonionic surfactant solution by in-tube extraction (ITEX 2) with a TENAX TA adsorbent were found to be efficient. The results show that microwave-assisted nonionic surfactant extraction (MANSE) is a good and efficient green analytical preparatory technique for geochemical evaluation of petroleum source rock.
Mineral oil and synthetic hydrocarbons in cosmetic lip products.
Niederer, M; Stebler, T; Grob, K
2016-04-01
Lipsticks and lip care products may contain saturated hydrocarbons which either stem from mineral oil saturated hydrocarbons (MOSH) or are synthetic, that is polyolefin oligomeric saturated hydrocarbons (POSH). Some of these hydrocarbons are strongly accumulated and form granulomas in human tissues, which prompted Cosmetics Europe (former Colipa) to issue a recommendation for their use in lip care and oral products. From 2012 to 2014, MOSH+POSH were determined in 175 cosmetic lip products taken from the Swiss market in order to estimate their contribution to human exposure. Mineral oil saturated hydrocarbons and POSH were extracted and analysed by GC with FID. Areas were integrated as a total as well as by mass ranges with cuts at n-C25 and n-C34 to characterize the molecular mass distribution. About 68% of the products contained at least 5% MOSH+POSH (total concentration). For regular users, these products would be major contributors to their MOSH+POSH exposure. About 31% of the products contained more than 32% MOSH+POSH. Their regular usage would amount in an estimated MOSH+POSH exposure exceeding the highest estimated dietary exposure. The majority of the products contained hydrocarbons with a molecular mass range which was not in line with the recommendations of Cosmetics Europe. Taking into account that material applied to the lips largely ends up being ingested, MOSH and POSH levels should be reduced in the majority of cosmetic lip products. As the extensive evaluation of the data available on MOSH (EFSA J., 10, 2012, 2704) did not enable the specification of limits considered as safe, the present level of dietary exposure and its evaluation as 'of potential concern' provide the relevant bench mark, which means that lip products should contain clearly less than 5% MOSH+POSH. © 2015 Society of Cosmetic Scientists and the Société Française de Cosmétologie.
Ex-situ bioremediation of polycyclic aromatic hydrocarbons in sewage sludge
DEFF Research Database (Denmark)
Larsen, Sille Bendix; Karakashev, Dimitar Borisov; Angelidaki, Irini
2009-01-01
Polycyclic aromatic hydrocarbons (PAH) are regarded as environmental pollutants. A promising approach to reduce PAH pollution is based on the implementation of the natural potential of some microorganisms to utilize hydrocarbons. In this study Proteiniphilum acetatigenes was used for bioaugmentat...
Santoro, Robert J.; Pal, Sibtosh
2003-01-01
This addendum report documents the results of two additional efforts for the Rocket Based Combined Cycle (RBCC) rocket-ejector mode research work carried out at the Penn State Propulsion Engineering Research Center in support of NASA s technology development efforts for enabling 3 d generation Reusable Launch Vehicles (RLV). The tasks reported here build on an earlier NASA MSFC funded research program on rocket ejector investigations. The first task investigated the improvements of a gaseous hydrogen/oxygen twin thruster RBCC rocket ejector system over a single rocket system. The second task investigated the performance of a hydrocarbon (liquid JP-7)/gaseous oxygen single thruster rocket-ejector system. To gain a systematic understanding of the rocket-ejector s internal fluid mechanic/combustion phenomena, experiments were conducted with both direct-connect and sea-level static diffusion and afterburning (DAB) configurations for a range of rocket operating conditions. For all experimental conditions, overall system performance was obtained through global measurements of wall static pressure profiles, heat flux profiles and engine thrust. Detailed mixing and combustion information was obtained through Raman spectroscopy measurements of major species (gaseous oxygen, hydrogen, nitrogen and water vapor) for the gaseous hydrogen/oxygen rocket ejector experiments.
Motor fuels by hydrogenation of liquid hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
1938-05-07
A process is disclosed for the production of knock-stable low-boiling motor fuels by conversion of liquid hydrocarbons which are vaporizable under the reaction conditions, which comprises passing the initial material at a temperature above 380/sup 0/C in a true vapor phase under pressure of more than 40 atmospheres together with hydrogen and gaseous hydrocarbons containing more than 1 carbon atom in the molecule in an amount by volume larger than that of the hydrogen over catalysts stable to poisoning stationarily confined in the reaction vessel.
Distinguishing natural hydrocarbons from anthropogenic contamination in ground water
International Nuclear Information System (INIS)
Lesage, S.; Xu, H.; Novakowski, K.S.
1997-01-01
Differentiation between natural and anthropogenic sources of ground-water contamination by petroleum hydrocarbons is necessary in areas where natural hydrocarbons may be present in the subsurface. Because of the similarity in composition between natural and refined petroleum, the use of statistical techniques to discern trends is required. In this study, both multivariate plotting techniques and principal component analysis were used to investigate the origin of hydrocarbons from a variety of study sites. Ground-water and gas samples were collected from the Niagara Falls area and from three gasoline stations where leaking underground storage tanks had been found. Although soil gas surveys are used to indicate the presence of hydrocarbons, they were not useful in differentiating between natural and anthropogenic sources of contamination in ground water. Propane and pentene were found to be the most useful chemical parameters in discriminating between the natural and anthropogenic sources. These chemicals are not usually measured in investigations of ground-water contamination, yet analysis can be conducted by most environmental laboratories using conventional methods
Directory of Open Access Journals (Sweden)
Shihui Yang
2018-04-01
Full Text Available The aim of this work was to identify inhibitors in pretreated lignocellulosic slurries, evaluate high-throughput screening strategies, and investigate the impact of inhibitors on potential hydrocarbon-producing microorganisms. Compounds present in slurries that could inhibit microbial growth were identified through a detailed analysis of saccharified slurries by applying a combination of approaches of high-performance liquid chromatography, GC-MS, LC-DAD-MS, and ICP-MS. Several high-throughput assays were then evaluated to generate toxicity profiles. Our results demonstrated that Bioscreen C was useful for analyzing bacterial toxicity but not for yeast. AlamarBlue reduction assay can be a useful high-throughput assay for both bacterial and yeast strains as long as medium components do not interfere with fluorescence measurements. In addition, this work identified two major inhibitors (furfural and ammonium acetate for three potential hydrocarbon-producing bacterial species that include Escherichia coli, Cupriavidus necator, and Rhodococcus opacus PD630, which are also the primary inhibitors for ethanologens. This study was strived to establish a pipeline to quantify inhibitory compounds in biomass slurries and high-throughput approaches to investigate the effect of inhibitors on microbial biocatalysts, which can be applied for various biomass slurries or hydrolyzates generated through different pretreatment and enzymatic hydrolysis processes or different microbial candidates.
Chang, Ming-Ling; Kuo, Chia-Jung; Huang, Hsin-Chih; Chu, Yin-Yi; Chiu, Cheng-Tang
2016-01-01
The association between leptin and complement in hepatitis C virus (HCV) infection remains unknown. A prospective study was conducted including 474 (250 genotype 1, 224 genotype 2) consecutive chronic hepatitis C (CHC) patients who had completed an anti-HCV therapy course and undergone pre-therapy and 24-week post-therapy assessments of interferon λ3-rs12979860 and HCV RNA/genotypes, anthropometric measurements, metabolic and liver profiles, and complement component 3 (C3), C4, and leptin levels. Of the 474 patients, 395 had a sustained virological response (SVR). Pre-therapy leptin levels did not differ between patients with and without an SVR. Univariate and multivariate analyses showed that sex (pre- and post-therapy, pimmune and metabolic homeostasis through association with C4 and TC. Positive alterations in C4 and TC levels reflect viral clearance after therapy in CHC patients.
Filamentous fungi remove weathered hydrocarbons from polluted soil of tropical Mexico
PÉREZ-ARMENDÁRIZ, Beatriz; MARTÍNEZ-CARRERA, Daniel; CALIXTO-MOSQUEDA, María; ALBA, Joel; RODRÍGUEZ-VÁZQUEZ, Refugio
2010-01-01
Weathered hydrocarbons from worldwide petrolic activities become more recalcitrant over time. The removal of petroleum hydrocarbons from a polluted soil [65,000 mg total petroleum hydrocarbons (TPH)/kg soil], which had been exposed to tropical environmental conditions for more than 20 years in southeast Mexico, was studied using filamentous fungi. Experiments were carried out in batch reactors (60 mL) containing a substrate consisting of polluted soil and sugar cane bagasse pith as bulk agent...
Process for producing volatile hydrocarbons from hydrocarbonaceous solids
Energy Technology Data Exchange (ETDEWEB)
1949-02-03
In a process for producing volatile hydrocarbons from hydrocarbonaceous solids, a hydrocarbonaceus solid is passed in subdivided state and in the form of a bed downwardly through an externally unheated distilling retort wherein the evolution of volatiles from the bed is effected while solid material comprising combustible heavy residue is discharged from the lower portion of the bed and retort, combustibles are burned from the discharged solid material. The admixture resultant combustion gases with the vapours evolved in the retort is prevented, and a stream of hydrocarbon fluid is heated by indirect heat exchange with hot combustion gases produced by burning to a high temperature and is introduced into the distilling retort and direct contact with bed, supplying heat to the latter for effecting the evolution of volatiles from the hydrocarbonaceous solid. The improvement consists of subjecting the volatile distillation products evolved and removed from the bed to a fractionation and separating selected relatively light and heavy hydrocarbon fractions from the distillation products, withdrawing at least one of the selected fractions from the prcess as a product heating at least one other of the selected fractions to high temperature by the indirect heat exchange with hot combustion gases, and introducing the thus heated hydrocarbon fraction into direct contact with the bed.
Do sealless pumps belong in hydrocarbon processing services?
Energy Technology Data Exchange (ETDEWEB)
Bennett, Shawn L. [Sundyne Corporation, Arvada, CO (Brazil)
2004-07-01
Sealless pump technology seems unimaginable in the hot, dirty and high-pressure world of hydrocarbon processing. Furthermore the high flow rates typical of the industry seem incompatible with sealless pumps. Seals and their environmental controls used in conventional technologies are not immune from these factors making sealless worth another look. In October 2000 the Sealless Centrifugal Pump Specification API 685 was published. This specification lends sealless pumps credibility and emphasizes the proper application of the technology. In many process units seal leaks can be extremely dangerous and costly. The heavy hydrocarbons can auto-ignite and light hydrocarbons will tend to find a source of ignition. The ever-increasing requirements for clean fuels are driving many of the current refinery upgrades. Best Also available control technology requirements and additional focus on Environmental Health and Safety increase the attractiveness of sealless technology to mitigate the hazards associated with seal leaks. Sealless has a place in hydrocarbon processing to eliminate seals, provide mechanical simplification, and ensure personnel/environmental protection. The proper application involves evaluating canned motor/magnetic drive technology, API 685 Guidelines, and vapor pressure versus pump circuit pressure analysis. There are four (4) specific processes where sealless pumps should be targeted: Alkylation, Sulfur Recovery/Hydrotreating, Naphtha Reforming Production, and Neutralization. (author)
Toxicity of oils and petroleum hydrocarbons to estuarine crustaceans
Energy Technology Data Exchange (ETDEWEB)
Tatem, H.E. (Army Engineer Waterways Experiment Station, Vicksburg, MS); Cox, B.A.; Anderson, J.W.
1978-04-01
Bioassay experiments with various life stages of three estuarine shrimp and soluble petroleum hydrocarbons (PH) revealed residual Bunker C oil and refined No. 2 fuel oil to be more toxic than two crude oils tested. Larvae of Palaemonetes pugio were slightly more sensitive to the PH than adults, while young penaeid shrimp were shown to be more resistant than older, larger individuals. Shrimp exposed to PH in conjunction with temperature and salinity changes were more susceptible to the PH. Some common aromatic and diaromatic PH, including three naphthalene compounds, were utilized in bioassays. Naphthalenes were highly toxic. The toxicity of petroleum products is closely related to aromatic hydrocarbon content, especially the naphthalenes and related hydrocarbons.
Phytoremediation of hydrocarbon-contaminated soil using plants adapted to western Canadian climate
International Nuclear Information System (INIS)
Robson, D.B.
2003-01-01
Phytoremediation relies on the use of plants for in-situ treatment of hydrocarbon contaminated soils. It is based on relationships between plants, microorganisms and the environment. The advantages of the process are its low cost and minimal soil disturbance. Phytoremediation has not been widely implemented in Canada because only a few native or non-native plant species have been tested for hydrocarbon tolerance or degradation ability. More studies are needed to fully understand why some plants are more tolerant of hydrocarbons than others, and whether tolerant species increase hydrocarbon degradation. In this study, several field and growth chamber experiments were conducted to examine hydrocarbon tolerance in plants. Hydrocarbon contaminated field plots had higher soil pH, carbon to nitrogen ratio and bare ground, lower total nitrogen, available phosphorous and litter cover. The mean diversity at the uncontaminated sites was 0.52. It was 0.45 at the contaminated sites. Mean species similarity between contaminated and uncontaminated sites was 31.1 per cent and cover similarity was 22.2 per cent. The common plants in the contaminated field included kochia, wild barley, salt grass, bluegrass, and wheatgrass. The plants that formed most plant cover on contaminated plots were non-mycorrhizal, self-pollinating, and large seeded. The species with the highest survival after 5 weeks in hydrocarbon contaminated soils included one native and 4 non-native grasses, 2 native and 3 non-native legumes and 2 native forbs. All plants (with the exception of Indian breadroot) grown in hydrocarbon contaminated potting soil had lower total biomass and lower growth rates compared to the control
Phytoremediation of hydrocarbon-contaminated soil using plants adapted to western Canadian climate
Energy Technology Data Exchange (ETDEWEB)
Robson, D.B.
2003-07-01
Phytoremediation relies on the use of plants for in-situ treatment of hydrocarbon contaminated soils. It is based on relationships between plants, microorganisms and the environment. The advantages of the process are its low cost and minimal soil disturbance. Phytoremediation has not been widely implemented in Canada because only a few native or non-native plant species have been tested for hydrocarbon tolerance or degradation ability. More studies are needed to fully understand why some plants are more tolerant of hydrocarbons than others, and whether tolerant species increase hydrocarbon degradation. In this study, several field and growth chamber experiments were conducted to examine hydrocarbon tolerance in plants. Hydrocarbon contaminated field plots had higher soil pH, carbon to nitrogen ratio and bare ground, lower total nitrogen, available phosphorous and litter cover. The mean diversity at the uncontaminated sites was 0.52. It was 0.45 at the contaminated sites. Mean species similarity between contaminated and uncontaminated sites was 31.1 per cent and cover similarity was 22.2 per cent. The common plants in the contaminated field included kochia, wild barley, salt grass, bluegrass, and wheatgrass. The plants that formed most plant cover on contaminated plots were non-mycorrhizal, self-pollinating, and large seeded. The species with the highest survival after 5 weeks in hydrocarbon contaminated soils included one native and 4 non-native grasses, 2 native and 3 non-native legumes and 2 native forbs. All plants (with the exception of Indian breadroot) grown in hydrocarbon contaminated potting soil had lower total biomass and lower growth rates compared to the control.
Distribution and origin of hydrocarbons in water and sediment in Sao Sebastiao, SP, Brazil
International Nuclear Information System (INIS)
Zanardi, Eliete; Bicego, Marcia Caruso; Miranda, Luiz Bruner de; Weber, Rolf Roland
1999-01-01
This study describes the dissolved/dispersed petroleum hydrocarbons (DDPH) in surface water and the origin and distribution of aliphatic and aromatic hydrocarbons in samples from the surface bottom sediments. The main objective was to verify the anthropogenic contribution on the adjacent inner shelf of Sao Sebastiao, taking into account the distribution of hydrographic properties and knowledge of the main circulation. The DDPH concentration range of the 20 samples were from 0.35 to 2.50 m u g . L -1 , characterising this region as slightly affected by the contribution of petroleum hydrocarbons. Considering sediment hydrocarbon results, sites located in the inner shelf were divided into three groups: one with mainly biogenic hydrocarbons, a second one with biogenic and petroleum hydrocarbons and a third with significant contribution of petroleum hydrocarbons. These results show an influence of human activities in the Sao Sebastiao Channel on the surrounding areas of the inner shelf. (Author)
Studies on the effect of petroleum hydrocarbon on the microbial and ...
African Journals Online (AJOL)
SERVER
2007-08-20
Aug 20, 2007 ... Key words: Hydrocarbon, microbial counts, physico-chemical characteristics. INTRODUCTION. Petroleum ... carbons, whose composition also varies with the source. ... hydrocarbons into aquifers can lead to concentrations of.
Geophysical monitoring in a hydrocarbon reservoir
Caffagni, Enrico; Bokelmann, Goetz
2016-04-01
Extraction of hydrocarbons from reservoirs demands ever-increasing technological effort, and there is need for geophysical monitoring to better understand phenomena occurring within the reservoir. Significant deformation processes happen when man-made stimulation is performed, in combination with effects deriving from the existing natural conditions such as stress regime in situ or pre-existing fracturing. Keeping track of such changes in the reservoir is important, on one hand for improving recovery of hydrocarbons, and on the other hand to assure a safe and proper mode of operation. Monitoring becomes particularly important when hydraulic-fracturing (HF) is used, especially in the form of the much-discussed "fracking". HF is a sophisticated technique that is widely applied in low-porosity geological formations to enhance the production of natural hydrocarbons. In principle, similar HF techniques have been applied in Europe for a long time in conventional reservoirs, and they will probably be intensified in the near future; this suggests an increasing demand in technological development, also for updating and adapting the existing monitoring techniques in applied geophysics. We review currently available geophysical techniques for reservoir monitoring, which appear in the different fields of analysis in reservoirs. First, the properties of the hydrocarbon reservoir are identified; here we consider geophysical monitoring exclusively. The second step is to define the quantities that can be monitored, associated to the properties. We then describe the geophysical monitoring techniques including the oldest ones, namely those in practical usage from 40-50 years ago, and the most recent developments in technology, within distinct groups, according to the application field of analysis in reservoir. This work is performed as part of the FracRisk consortium (www.fracrisk.eu); this project, funded by the Horizon2020 research programme, aims at helping minimize the
Treatment of petroleum hydrocarbon polluted environment through bioremediation: a review.
Singh, Kriti; Chandra, Subhash
2014-01-01
Bioremediation play key role in the treatment of petroleum hydrocarbon contaminated environment. Exposure of petroleum hydrocarbon into the environment occurs either due to human activities or accidentally and cause environmental pollution. Petroleum hydrocarbon cause many toxic compounds which are potent immunotoxicants and carcinogenic to human being. Remedial methods for the treatment of petroleum contaminated environment include various physiochemical and biological methods. Due to the negative consequences caused by the physiochemical methods, the bioremediation technology is widely adapted and considered as one of the best technology for the treatment of petroleum contaminated environment. Bioremediation utilizes the natural ability of microorganism to degrade the hazardous compound into simpler and non hazardous form. This paper provides a review on the role of bioremediation in the treatment of petroleum contaminated environment, discuss various hazardous effects of petroleum hydrocarbon, various factors influencing biodegradation, role of various enzymes in biodegradation and genetic engineering in bioremediation.
Santonicola, Serena; Albrizio, Stefania; Murru, Nicoletta; Ferrante, Maria Carmela; Mercogliano, Raffaelina
2017-10-01
The study compared the profile of 14 polycyclic aromatic hydrocarbons, frequently occurred in food, in milk (N = 22) and meat/fish based (N = 18) baby foods available on the Italian market. PAH total levels, markers (Regulation EC/835/2011) and carcinogenic PAHs were determined by high- performance liquid chromatography with fluorescence detector (HPLC-FD). The average of total PAHs was 52.25 μg kg -1 in milk and 11.82 μg kg -1 in meat/fish based baby foods. The levels of PAH markers were higher than the permissible EU limits of 1 μg kg -1 in 18.2% and 77.7% milk, and 5.6% and 44.4% meat/fish based baby foods. Milk based samples showed significant higher values (P carcinogenic and possible carcinogenic hydrocarbons than meat/fish based products. The Margins of Exposure (MOE) value of milk based baby food samples indicated a potential concern for consumer health. Monitoring programs, and good agriculture and manufacture practices should be recommended. Copyright © 2017 Elsevier Ltd. All rights reserved.
Kozielska, B; Konieczyńiski, J
2008-11-01
Occurrence of polycyclic aromatic hydrocarbons (PAHs) in granulometric fractions of dust emitted from a hard coal fired circulating fluidized bed (CFB) boiler was investigated. The dust was sampled with the use of a Mark III impactor. In each fraction of dust, by using gas chromatography (GC), 16 selected PAHs and total PAHs were determined and the toxic equivalent B(a)P (TE B(a)P) was computed. The results, recalculated for the standard granulometric fractions, are presented as concentrations and content of the determined PAHs in dust. Distributions of PAHs and their profiles in the granulometric dust fractions were studied also. The PAHs in dust emitted from the CFB boiler were compared with those emitted from mechanical grate boilers; a distinctly lower content of PAHs was found in dust emitted from the former.
International Nuclear Information System (INIS)
Narvaez Florez, Silvia; Gomez, Martha L; Martinez Maria M
2008-01-01
Thirty one bacterial isolations in minimal salts supplemented medium with hydrocarbons (ACPM or crude oil) as sole carbon source were isolated from sediment samples from the Colombian Caribbean. Bacterial strains underwent selection tests in different concentrations of hydrocarbons; 11 tolerant crude oil and ACPM strains in a range of 1-8%v/v were chosen. A mixed bacterial culture was created and assessed its ability to degrade hydrocarbons in a laboratory-scale test, with a concentration of 2% v/v of ACPM over a period of 21 days. Measurements of biomass in Colony Forming Units (CFU)/mL were used to develop the growth curve of the mixed culture. Hydrocarbons remotion was measured by mass chromatography. The mixed culture was able to degrade the 68.6% of aliphatic hydrocarbons in preference of long chain n- alkenes (C12- C31), reaching a maximum growth of 3.13 x 10 9 UFC / mL. Degradation of aromatic hydrocarbons was not evidenced under the observation time. Nine of the eleven strains were identified using the biochemical systems BBL and API 50 CHB/E; they belonged to the genus Klebsiella, Chromobacterium, Flavimonas, Enterobacter,Pseudomonas, and Bacillus. The evaluated strains have enzymatic potential to degrade hydrocarbons and it is necessary to characterize them at molecular level in order to develop and effective consortium for field application
Aromatic hydrocarbon concentrations in sediments of Placentia Bay, Newfoundland
International Nuclear Information System (INIS)
Kiceniuk, J.W.
1992-01-01
A study was conducted to examine the potential for contamination of recent sediments with polycyclic aromatic hydrocarbons due to tanker and refinery activity in Placentia Bay, Newfoundland, an area without large local anthropogenic sources of aromatics. Sediment samples were taken from the vicinity of the Come By Chance refinery, Woody Island, Wild Cove, and Port Royal Arm, all in the north end of the bay. The samples were extracted by two methods, dichloromethane extraction of dried sediment for determination of total aromatic hydrocarbon content and hexane extraction of wet sediment for estimation of the bioavailability of hydrocarbons and determination of more volatile compounds. Class analysis of aromatic hydrocarbons was conducted on a NH 2 column with detection at 255 nm. Total concentrations of di-tricyclic aromatics were highest at the Woody Island site (0.6 μg/g). The sediments from the Come By Chance site, Wild Cove, and Port Royal Arm sediments contained 0.3, 0.1, and 0.2 μg/g respectively. The hexane extracts from Come By Chance were lowest in di-tricyclic aromatics (0.007 μg/g), with the other sites being equal in concentration (0.01 μg/g). It is evident from the study that aromatic hydrocarbon concentrations in Placentia Bay are elevated in some parts of the bay in the absence of local combustion sources, and that the most likely source is petroleum. 12 refs., 5 figs., 2 tabs
Directory of Open Access Journals (Sweden)
R Cameron Coates
Full Text Available Cyanobacteria possess the unique capacity to naturally produce hydrocarbons from fatty acids. Hydrocarbon compositions of thirty-two strains of cyanobacteria were characterized to reveal novel structural features and insights into hydrocarbon biosynthesis in cyanobacteria. This investigation revealed new double bond (2- and 3-heptadecene and methyl group positions (3-, 4- and 5-methylheptadecane for a variety of strains. Additionally, results from this study and literature reports indicate that hydrocarbon production is a universal phenomenon in cyanobacteria. All cyanobacteria possess the capacity to produce hydrocarbons from fatty acids yet not all accomplish this through the same metabolic pathway. One pathway comprises a two-step conversion of fatty acids first to fatty aldehydes and then alkanes that involves a fatty acyl ACP reductase (FAAR and aldehyde deformylating oxygenase (ADO. The second involves a polyketide synthase (PKS pathway that first elongates the acyl chain followed by decarboxylation to produce a terminal alkene (olefin synthase, OLS. Sixty-one strains possessing the FAAR/ADO pathway and twelve strains possessing the OLS pathway were newly identified through bioinformatic analyses. Strains possessing the OLS pathway formed a cohesive phylogenetic clade with the exception of three Moorea strains and Leptolyngbya sp. PCC 6406 which may have acquired the OLS pathway via horizontal gene transfer. Hydrocarbon pathways were identified in one-hundred-forty-two strains of cyanobacteria over a broad phylogenetic range and there were no instances where both the FAAR/ADO and the OLS pathways were found together in the same genome, suggesting an unknown selective pressure maintains one or the other pathway, but not both.
Gargouri, Boutheina; Mhiri, Najla; Karray, Fatma; Aloui, Fathi; Sayadi, Sami
2015-01-01
Two yeast strains are enriched and isolated from industrial refinery wastewater. These strains were observed for their ability to utilize several classes of petroleum hydrocarbons substrates, such as n-alkanes and aromatic hydrocarbons as a sole carbon source. Phylogenetic analysis based on the D1/D2 variable domain and the ITS-region sequences indicated that strains HC1 and HC4 were members of the genera Candida and Trichosporon, respectively. The mechanism of hydrocarbon uptaking by yeast, Candida, and Trichosporon has been studied by means of the kinetic analysis of hydrocarbons-degrading yeasts growth and substrate assimilation. Biodegradation capacity and biomass quantity were daily measured during twelve days by gravimetric analysis and gas chromatography coupled with mass spectrometry techniques. Removal of n-alkanes indicated a strong ability of hydrocarbon biodegradation by the isolated yeast strains. These two strains grew on long-chain n-alkane, diesel oil, and crude oil but failed to grow on short-chain n-alkane and aromatic hydrocarbons. Growth measurement attributes of the isolates, using n-hexadecane, diesel oil, and crude oil as substrates, showed that strain HC1 had better degradation for hydrocarbon substrates than strain HC4. In conclusion, these yeast strains can be useful for the bioremediation process and decreasing petroleum pollution in wastewater contaminated with petroleum hydrocarbons. PMID:26339653
Directory of Open Access Journals (Sweden)
Boutheina Gargouri
2015-01-01
Full Text Available Two yeast strains are enriched and isolated from industrial refinery wastewater. These strains were observed for their ability to utilize several classes of petroleum hydrocarbons substrates, such as n-alkanes and aromatic hydrocarbons as a sole carbon source. Phylogenetic analysis based on the D1/D2 variable domain and the ITS-region sequences indicated that strains HC1 and HC4 were members of the genera Candida and Trichosporon, respectively. The mechanism of hydrocarbon uptaking by yeast, Candida, and Trichosporon has been studied by means of the kinetic analysis of hydrocarbons-degrading yeasts growth and substrate assimilation. Biodegradation capacity and biomass quantity were daily measured during twelve days by gravimetric analysis and gas chromatography coupled with mass spectrometry techniques. Removal of n-alkanes indicated a strong ability of hydrocarbon biodegradation by the isolated yeast strains. These two strains grew on long-chain n-alkane, diesel oil, and crude oil but failed to grow on short-chain n-alkane and aromatic hydrocarbons. Growth measurement attributes of the isolates, using n-hexadecane, diesel oil, and crude oil as substrates, showed that strain HC1 had better degradation for hydrocarbon substrates than strain HC4. In conclusion, these yeast strains can be useful for the bioremediation process and decreasing petroleum pollution in wastewater contaminated with petroleum hydrocarbons.
Lan, Jia-Cheng; Sun, Yu-Chuan; Tian, Ping; Lu, Bing-Qing; Shi, Yang; Xu, Xin; Liang Zuo-Bing; Yang, Ping-Heng
2014-10-01
Water samples in Laolongdong underground river catchment were collected to determine the concentration, compositional profiles, and evaluate ecological risk of 16 priority polycyclic aromatic hydrocarbons (PAHs). PAHs were measured by GC/MS. The total concentrations of 16 PAH ranged from 81.5-8019 ng · L(-1) in underground river, 288.7-15,200 ng · L(-1) in karst springs, and 128.4-2,442 ng · L(-1) in surface water. Affected by waste water from Huangjueya town, concentrations of PAHs in underground river were higher than those in surface water and waste water from sinkhole. The PAHs profiles were dominated by 3 ring PAHs. There were differences of monthly variations of PAHs contents in the water, due to waste water, season and different characteristics of PAH. Surface water and waste water from sinkhole played an important role on contamination in the river. The levels of ecological risk were generally moderately polluted and heavily polluted according to all detected PAH compounds in the water.
Lozada, Mariana; Marcos, Magalí S; Commendatore, Marta G; Gil, Mónica N; Dionisi, Hebe M
2014-09-17
The aim of this study was to design a molecular biological tool, using information provided by amplicon pyrosequencing of 16S rRNA genes, that could be suitable for environmental assessment and bioremediation in marine ecosystems. We selected 63 bacterial genera that were previously linked to hydrocarbon biodegradation, representing a minimum sample of the bacterial guild associated with this process. We defined an ecological indicator (ecological index of hydrocarbon exposure, EIHE) using the relative abundance values of these genera obtained by pyrotag analysis. This index reflects the proportion of the bacterial community that is potentially capable of biodegrading hydrocarbons. When the bacterial community structures of intertidal sediments from two sites with different pollution histories were analyzed, 16 of the selected genera (25%) were significantly overrepresented with respect to the pristine site, in at least one of the samples from the polluted site. Although the relative abundances of individual genera associated with hydrocarbon biodegradation were generally low in samples from the polluted site, EIHE values were 4 times higher than those in the pristine sample, with at least 5% of the bacterial community in the sediments being represented by the selected genera. EIHE values were also calculated in other oil-exposed marine sediments as well as in seawater using public datasets from experimental systems and field studies. In all cases, the EIHE was significantly higher in oiled than in unpolluted samples, suggesting that this tool could be used as an estimator of the hydrocarbon-degrading potential of microbial communities.
Thermal Adsorption Processing Of Hydrocarbon Residues
Directory of Open Access Journals (Sweden)
Sudad H. Al.
2017-04-01
Full Text Available The raw materials of secondary catalytic processes must be pre-refined. Among these refining processes are the deasphalting and demetallization including their thermo adsorption or thermo-contact adsorption variety. In oil processing four main processes of thermo-adsorption refining of hydrocarbon residues are used ART Asphalt Residual Treating - residues deasphaltizing 3D Discriminatory Destructive Distillation developed in the US ACT Adsorption-Contact Treatment and ETCC Express Thermo-Contact Cracking developed in Russia. ART and ACT are processes with absorbers of lift type reactor while 3D and ETCC processes are with an adsorbing reactor having ultra-short contact time of the raw material with the adsorbent. In all these processes refining of hydrocarbon residues is achieved by partial Thermo-destructive transformations of hydrocarbons and hetero-atomic compounds with simultaneous adsorption of the formed on the surface of the adsorbents resins asphaltene and carboids as well as metal- sulphur - and nitro-organic compounds. Demetallized and deasphalted light and heavy gas oils or their mixtures are a quality raw material for secondary deepening refining processes catalytic and hydrogenation cracking etc. since they are characterized by low coking ability and low content of organometallic compounds that lead to irreversible deactivation of the catalysts of these deepening processes.
Energy Technology Data Exchange (ETDEWEB)
Seigle, A A.F.M.
1922-12-20
Hydrocarbon oils such as petroleum, peat, shale, or lignite oils, heavy tars, resin oils, naphthalene oils, etc., are vaporized by being fed from a tank through a preheater to the lower part of a vertical annular retort heated by a flame projected down the central cavity from a burner. The oil vapors rise through annular passages formed by disks, on which are placed chips of copper, iron, aluminum, etc., to act as catalysts.
Distribution and origin of hydrocarbons in water and sediment in Sao Sebastiao, SP, Brazil
Energy Technology Data Exchange (ETDEWEB)
Zanardi, Eliete [Universidade de Sao Paulo, Instituto Oceanografico, Sao Paulo, SP (Brazil); Bicego, Marcia Caruso; Miranda, Luiz Bruner de; Weber, Rolf Roland [Miami Univ., RSMAS/NAC, Miami, FL (United States)
1999-04-01
This study describes the dissolved/dispersed petroleum hydrocarbons (DDPH) in surface water and the origin and distribution of aliphatic and aromatic hydrocarbons in samples from the surface bottom sediments. The main objective was to verify the anthropogenic contribution on the adjacent inner shelf of Sao Sebastiao, taking into account the distribution of hydrographic properties and knowledge of the main circulation. The DDPH concentration range of the 20 samples were from 0.35 to 2.50 {sup m}u{sup g}. L{sup -1}, characterising this region as slightly affected by the contribution of petroleum hydrocarbons. Considering sediment hydrocarbon results, sites located in the inner shelf were divided into three groups: one with mainly biogenic hydrocarbons, a second one with biogenic and petroleum hydrocarbons and a third with significant contribution of petroleum hydrocarbons. These results show an influence of human activities in the Sao Sebastiao Channel on the surrounding areas of the inner shelf. (Author)
Petroleum hydrocarbon concentration in sediments along northern west coast of India
Digital Repository Service at National Institute of Oceanography (India)
Ram, A.; Kadam, A.N.
Gas chromatography revealed that nonpolar material extracted from surface sediments collected along the northern west coast of India was originated from petroleum hydrocarbon residue. Petroleum hydrocarbon levels as determinEd. by fluorescence...
Sikorska, Katarzyna; Stalke, Piotr; Romanowski, Tomasz; Rzepko, Robert; Bielawski, Krzysztof Piotr
2013-08-01
Liver steatosis and iron overload, which are frequently observed in chronic hepatitis C (CHC), may contribute to the progression of liver injury. This study aimed to evaluate the correlation between liver steatosis and iron overload in Polish patients with CHC compared to non-alcoholic fatty liver disease (NAFLD) and HFE-hereditary hemochromatosis (HH) patients. A total of 191 CHC patients were compared with 67 NAFLD and 21 HH patients. Liver function tests, serum markers of iron metabolism, cholesterol and triglycerides were assayed. The inflammatory activity, fibrosis, iron deposits and steatosis stages were assessed in liver specimens. HFE gene polymorphisms were investigated by PCR-RFLP. Liver steatosis was associated with obesity and diabetes mellitus. This disease was confirmed in 76/174 (44%) CHC patients, most of whom were infected with genotype 1. The average grade of steatosis was higher in NAFLD patients. CHC patients had significantly higher iron concentrations and transferrin saturations than NAFLD patients. Compared with CHC patients, HH patients had higher values of serum iron parameters and more intensive hepatocyte iron deposits without differences in the prevalence and intensity of liver steatosis. In the CHC group, lipids accumulation in hepatocytes was significantly associated with the presence of serum markers of iron overload. No correlation between the HFE gene polymorphism and liver steatosis in CHC patients was found. Liver steatosis was diagnosed in nearly half of CHC patients, most of whom were infected with genotype 1. The intensity of steatosis was lower in CHC patients than that in NAFLD patients because of a less frequent diagnosis of metabolic syndrome. Only in CHC patients were biochemical markers of iron accumulation positively correlated with liver steatosis; these findings were independent of HFE gene mutations.
Ambient aromatic hydrocarbon measurements at Welgegund, South Africa
Energy Technology Data Exchange (ETDEWEB)
Jaars, K.; Beukes, J. P.; van Zyl, P. G.; Venter, A. D.; Josipovic, M.; Pienaar, J. J.; Vakkari, Ville; Aaltonen, H.; Laakso, H.; Kulmala, M.; Tiitta, P.; Guenther, Alex B.; Hellen, H.; Laakso, L.; Hakola, H.
2014-07-11
Aromatic hydrocarbons are associated with direct adverse human health effects and can have negative impacts on ecosystems due to their toxicity, as well as indirect negative effects through the formation of tropospheric ozone and secondary organic aerosol that affect human health, crop production and regional climate. Measurements were conducted at the Welgegund measurement station (South Africa) that is considered to be a regionally representative background site. However, the site is occasionally impacted by plumes from major anthropogenic source regions in the interior of South Africa, which include the western Bushveld Igneous Complex (e.g. platinum, base metal and ferrochrome smelters), the eastern Bushveld Igneous Complex (platinum and ferrochrome smelters), the Johannesburg-Pretoria metropolitan conurbation (>10 million people), the Vaal Triangle (e.g. petrochemical and industries), the Mpumalanga Highveld (e.g. coal-fired power plants and petrochemical industry) and also a region of anti-cyclonic recirculation of air mass over the interior of South Africa. The aromatic hydrocarbon measurements were conducted with an automated sampler on Tenax-TA and Carbopack-B adsorbent tubes with heated inlet for one year. Samples were collected twice a week for two hours during daytime and two hours 1 during night-time. A thermal desorption unit, connected to a gas chromatograph and a mass 2 selective detector was used for sample preparation and analysis. Results indicated that the 3 monthly median total aromatic hydrocarbon concentrations ranged between 0.01 to 3.1 ppb. 4 Benzene levels did not exceed local air quality standards. Toluene was the most abundant 5 species, with an annual median concentration of 0.63 ppb. No statistically significant 6 differences in the concentrations measured during daytime and night-time were found and no distinct seasonal patterns were observed. Air mass back trajectory analysis proved that the lack of seasonal cycles could be
Yildiz, Evrim; Ozcan, Birgul; Caliskan, Mahmut
2012-01-01
The haloarchaeal diversity of a salt mine, a natural cave in central Anatolia, was investigated using convential microbiological and molecular biology methods. Eight halophilic archaeal isolates selected based on their colony morphology and whole cell protein profiles were taxonomically classified on the basis of their morphological, physiological, biochemical properties, polar lipid and protein profiles and 16S rDNA sequences. From the 16S rDNA sequences comparisons it was established that the isolates CH2, CH3 and CHC resembled Halorubrum saccharovorum by 98.8%, 98.9% and 99.5%, respectively. There was a 99.7% similarity between the isolate CH11 and Halobacterium noricense and 99.2% between the isolate CHA1 and Haloarcula argentinensis. The isolate CH8K and CH8B revealed a similarity rate of 99.8% and 99.3% to Halococcus dombrowskii, respectively. It was concluded that the isolates named CH2, CH3 and CHC were clustered in the genus Halorubrum and that CHA1 and CH7 in the genus Haloarcula, CH8K and CH8B in the genus Halococcus and CH11 in the genus Halobacterium.
Acquired and innate immunity to polyaromatic hydrocarbons
International Nuclear Information System (INIS)
Yusuf, Nabiha; Timares, Laura; Seibert, Megan D.; Xu Hui; Elmets, Craig A.
2007-01-01
Polyaromatic hydrocarbons are ubiquitous environmental pollutants that are potent mutagens and carcinogens. Researchers have taken advantage of these properties to investigate the mechanisms by which chemicals cause cancer of the skin and other organs. When applied to the skin of mice, several carcinogenic polyaromatic hydrocarbons have also been shown to interact with the immune system, stimulating immune responses and resulting in the development of antigen-specific T-cell-mediated immunity. Development of cell-mediated immunity is strain-specific and is governed by Ah receptor genes and by genes located within the major histocompatibility complex. CD8 + T cells are effector cells in the response, whereas CD4 + T cells down-regulate immunity. Development of an immune response appears to have a protective effect since strains of mice that develop a cell-mediated immune response to carcinogenic polyaromatic hydrocarbons are less likely to develop tumors when subjected to a polyaromatic hydrocarbon skin carcinogenesis protocol than mice that fail to develop an immune response. With respect to innate immunity, TLR4-deficient C3H/HeJ mice are more susceptible to polyaromatic hydrogen skin tumorigenesis than C3H/HeN mice in which TLR4 is normal. These findings support the hypothesis that immune responses, through their interactions with chemical carcinogens, play an active role in the prevention of chemical skin carcinogenesis during the earliest stages. Efforts to augment immune responses to the chemicals that cause tumors may be a productive approach to the prevention of tumors caused by these agents
Investigation Status of Heat Exchange while Boiling Hydrocarbon Fuel
Directory of Open Access Journals (Sweden)
D. S. Obukhov
2006-01-01
Full Text Available The paper contains analysis of heat exchange investigations while boiling hydrocarbon fuel. The obtained data are within the limits of the S.S. Kutateladze dependence proposed in 1939. Heat exchange at non-stationary heat release has not been investigated. The data for hydrocarbon fuel with respect to critical density of heat flow are not available even for stationary conditions.
Electrochemical masstransfer of oil hydrocarbons in dispersed soils
Energy Technology Data Exchange (ETDEWEB)
Nekrasova, M.A.; Zvolinsky, V.P.; Kanev, M.V. [Russian Friendship Peoples Univ., Dept. of Eecological Monitoring and Forecasting, Moscow (Russian Federation)
2001-07-01
A large-scale pollution of the geological environment is a result of imperfect processes of mining, refining, haul of oil and irrational use of petroleum. The processes of masstransfer of hydrocarbons in dispersed soils and the problems of forming of a dual electric layer (DEL) on the demarcations 'water-oil' and 'mineral-water' are still insufficiently studied. Therefore, one of the most important problems in the field of the ecological geology is the analysis of ways of cleaning of soils from hydrocarbons. The kaolinitic clay from the Tirlianskoye deposit (K{sub 2}, st. Jabik, Bashkiria) and average polymineral loam (prlllkl, Moscow region, the south-east of town Zvenigorod) was chosen as the objects of the experimental study. The mixture of West Siberian oils was used for model pollution. The experimental laboratory researches of electrochemical migration of hydrocarbons were carried out on dispersiblis clayey soils. (orig.)
Unconventional hydrocarbons. New prospects for the para-petroleum industry
International Nuclear Information System (INIS)
Bennaceur, Kamel
2011-01-01
Unconventional hydrocarbons represent a significant potential despite complications in extracting them. The International Energy Agency's annual report in 2008 estimated that 9 trillion barrels of liquid hydrocarbons could be produced - a figure to be compared with the current production of 1,1 trillion barrels and the 1,3-1,4 trillion barrels of proven reserves. This estimate includes the potential production from heavy oils, shale oil and tar belts as well as the liquid hydrocarbons obtained by converting coal and natural gas. The IAE's 2009 report estimates resources in gas at more than 850 trillion cubic meters (T m"3), as compared with the 80 T m"3 now being produced and the 187 T m"3 of proven reserves