WorldWideScience

Sample records for hydraulic gradients vhg

  1. Dicty_cDB: VHG208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHG208 (Link to dictyBase) - - - Contig-U16299-1 VHG208P (Link to Original site) VHG20...8F 658 VHG208Z 627 VHG208P 1265 - - Show VHG208 Library VH (Link to library) Clone ID VHG20...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHG2-A/VHG208Q.Seq.d/ Representative seq. ID VHG20...8P (Link to Original site) Representative DNA sequence >VHG208 (VHG208Q) /CSM/VH/VHG2-A/VHG20...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHG208 (VHG208Q) /CSM/VH/VHG2-A/VHG20

  2. Investigating patterns and controls of groundwater up-welling in a lowland river by combining Fibre-optic Distributed Temperature Sensing with observations of vertical hydraulic gradients

    Directory of Open Access Journals (Sweden)

    S. Krause

    2012-06-01

    Full Text Available This paper investigates the patterns and controls of aquifer–river exchange in a fast-flowing lowland river by the conjunctive use of streambed temperature anomalies identified with Fibre-optic Distributed Temperature Sensing (FO-DTS and observations of vertical hydraulic gradients (VHG.

    FO-DTS temperature traces along this lowland river reach reveal discrete patterns with "cold spots" indicating groundwater up-welling. In contrast to previous studies using FO-DTS for investigation of groundwater–surface water exchange, the fibre-optic cable in this study was buried in the streambed sediments, ensuring clear signals despite fast flow and high discharges. During the observed summer baseflow period, streambed temperatures in groundwater up-welling locations were found to be up to 1.5 °C lower than ambient streambed temperatures. Due to the high river flows, the cold spots were sharp and distinctly localized without measurable impact on down-stream surface water temperature.

    VHG patterns along the stream reach were highly variable in space, revealing strong differences even at small scales. VHG patterns alone are indicators of both, structural heterogeneity of the stream bed as well as of the spatial heterogeneity of the groundwater–surface water exchange fluxes and are thus not conclusive in their interpretation. However, in combination with the high spatial resolution FO-DTS data we were able to separate these two influences and clearly identify locations of enhanced exchange, while also obtaining information on the complex small-scale streambed transmissivity patterns responsible for the very discrete exchange patterns. The validation of the combined VHG and FO-DTS approach provides an effective strategy for analysing drivers and controls of groundwater–surface water exchange, with implications for the quantification of biogeochemical cycling and contaminant transport at aquifer–river interfaces.

  3. Dicty_cDB: VHG280 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHG280 (Link to dictyBase) - - - Contig-U12022-1 | Contig-U13289-1 VHG280...P (Link to Original site) VHG280F 537 VHG280Z 579 VHG280P 1096 - - Show VHG280 Library VH (Link to library) Clone ID VHG28...022-1 | Contig-U13289-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHG2-D/VHG280...Q.Seq.d/ Representative seq. ID VHG280P (Link to Original site) Representative DNA sequence >VHG280 (VHG280...Q) /CSM/VH/VHG2-D/VHG280Q.Seq.d/ AACTCGTTCACTTATTTTGTTGTTCGATAATATTATTTTATTTATTTATTTTATTATAAC

  4. Variation of hydraulic gradient in nonlinear finite strain consolidation

    Institute of Scientific and Technical Information of China (English)

    谢新宇; 黄杰卿; 王文军; 李金柱

    2014-01-01

    In the research field of ground water, hydraulic gradient is studied for decades. In the consolidation field, hydraulic gradient is yet to be investigated as an important hydraulic variable. So, the variation of hydraulic gradient in nonlinear finite strain consolidation was focused on in this work. Based on lab tests, the nonlinear compressibility and nonlinear permeability of Ningbo soft clay were obtained. Then, a strongly nonlinear governing equation was derived and it was solved with the finite element method. Afterwards, the numerical analysis was performed and it was verified with the existing experiment for Hong Kong marine clay. It can be found that the variation of hydraulic gradient is closely related to the magnitude of external load and the depth in soils. It is interesting that the absolute value of hydraulic gradient (AVHG) increases rapidly first and then decreases gradually after reaching the maximum at different depths of soils. Furthermore, the changing curves of AVHG can be roughly divided into five phases. This five-phase model can be employed to study the migration of pore water during consolidation.

  5. Dicty_cDB: VHG172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ificant alignments: (bits) Value VHG172 (VHG172Q) /CSM/VH/VHG1-C/VHG172Q.Seq.d/ 224 4e-58 VHM530 (VHM530Q) /... vs DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ44...date 2008.11. 1 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  6. Heavy Metal Diffusion through Soft Clay under High Hydraulic Gradients

    Directory of Open Access Journals (Sweden)

    Zaheer Ahmed Almani

    2013-04-01

    Full Text Available This study was focused on the determination of contaminant transport parameters of heavy metal Zinc moving through saturated soft Bangkok undisturbed clay under high hydraulic gradients. These parameters were compared with contaminant transport determined under concentration gradient alone (pure diffusion. In total fifteen column tests were conducted and a mathematical model was applied to determine the coefficients. Two different source concentrations conditions, constant and decreasing, were applied. Testing periods were ranged from 15-60 days while hydraulic gradients were ranged from 0-500. The curves between relative concentration and time and pore volume were developed for the constant source condition whereas curves between source reservoirs concentrations and time were developed for decreasing source condition. The effective diffusion and distribution coefficients, De and Kd, were determined by curve fitting using the computer code POLLUTE v 6.3. The results showed that diffusion coefficient increases and distribution coefficient decreases as hydraulic gradient increases from 0 to high value of 500 due to contribution of dispersion and additional molecular diffusion at high advective velocity. Thus, testing at high gradients ensures the safe performance of earthen barriers under worse conditions.

  7. Assimilation of temperature and hydraulic gradients for quantifying the spatial variability of streambed hydraulics

    Science.gov (United States)

    Huang, Xiang; Andrews, Charles B.; Liu, Jie; Yao, Yingying; Liu, Chuankun; Tyler, Scott W.; Selker, John S.; Zheng, Chunmiao

    2016-08-01

    Understanding the spatial and temporal characteristics of water flux into or out of shallow aquifers is imperative for water resources management and eco-environmental conservation. In this study, the spatial variability in the vertical specific fluxes and hydraulic conductivities in a streambed were evaluated by integrating distributed temperature sensing (DTS) data and vertical hydraulic gradients into an ensemble Kalman filter (EnKF) and smoother (EnKS) and an empirical thermal-mixing model. The formulation of the EnKF/EnKS assimilation scheme is based on a discretized 1D advection-conduction equation of heat transfer in the streambed. We first systematically tested a synthetic case and performed quantitative and statistical analyses to evaluate the performance of the assimilation schemes. Then a real-world case was evaluated to calculate assimilated specific flux. An initial estimate of the spatial distributions of the vertical hydraulic gradients was obtained from an empirical thermal-mixing model under steady-state conditions using a constant vertical hydraulic conductivity. Then, this initial estimate was updated by repeatedly dividing the assimilated specific flux by estimates of the vertical hydraulic gradients to obtain a refined spatial distribution of vertical hydraulic gradients and vertical hydraulic conductivities. Our results indicate that optimal parameters can be derived with fewer iterations but greater simulation effort using the EnKS compared with the EnKF. For the field application in a stream segment of the Heihe River Basin in northwest China, the average vertical hydraulic conductivities in the streambed varied over three orders of magnitude (5 × 10-1 to 5 × 102 m/d). The specific fluxes ranged from near zero (qz < ±0.05 m/d) to ±1.0 m/d, while the vertical hydraulic gradients were within the range of -0.2 to 0.15 m/m. The highest and most variable fluxes occurred adjacent to a debris-dam and bridge pier. This phenomenon is very likely

  8. Dicty_cDB: VHG689 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available re E Sequences producing significant alignments: (bits) Value VHG689 (VHG689Q) /CSM/VH/VHG6-D/VHG689Q.Seq.d/...ificant alignments: (bits) Value N ( BJ440790 ) Dictyostelium discoideum cDNA clone:ddv44a24, 3' ... 252 3e-...42 3 dna update 2008.11. 4 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  9. Modeling of Propagation of Interacting Cracks Under Hydraulic Pressure Gradient

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Hai [Idaho National Laboratory; Mattson, Earl Douglas [Idaho National Laboratory; Podgorney, Robert Karl [Idaho National Laboratory

    2015-04-01

    A robust and reliable numerical model for fracture initiation and propagation, which includes the interactions among propagating fractures and the coupling between deformation, fracturing and fluid flow in fracture apertures and in the permeable rock matrix, would be an important tool for developing a better understanding of fracturing behaviors of crystalline brittle rocks driven by thermal and (or) hydraulic pressure gradients. In this paper, we present a physics-based hydraulic fracturing simulator based on coupling a quasi-static discrete element model (DEM) for deformation and fracturing with conjugate lattice network flow model for fluid flow in both fractures and porous matrix. Fracturing is represented explicitly by removing broken bonds from the network to represent microcracks. Initiation of new microfractures and growth and coalescence of the microcracks leads to the formation of macroscopic fractures when external and/or internal loads are applied. The coupled DEM-network flow model reproduces realistic growth pattern of hydraulic fractures. In particular, simulation results of perforated horizontal wellbore clearly demonstrate that elastic interactions among multiple propagating fractures, fluid viscosity, strong coupling between fluid pressure fluctuations within fractures and fracturing, and lower length scale heterogeneities, collectively lead to complicated fracturing patterns.

  10. Dicty_cDB: VHG524 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHG524 (Link to dictyBase) - G23409 DDB0217550 Contig-U11536-1...brary) Clone ID VHG524 (Link to dictyBase) Atlas ID - NBRP ID G23409 dictyBase ID DDB0217550 Link to Contig ...Contig-U11536-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHG5-...GKFIKKAII NGNRIVTINNKLLNENQLNSNSTITKEKDSSNQLSSFISIEIPHYDSNVLLDPSFSVLLD SNESYKNSENSICTSKKSSKLTTAQIIAIVIVSVVFV...MTLQIGTYSFEGKFIKKAII NGNRIVTINNKLLNENQLNSNSTITKEKDSSNQLSSFISIEIPHYDSNVLLDPSFSVLLD SNESYKNSENSICTSKKSSKLTTAQI

  11. Dicty_cDB: VHG494 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available : mitochondrial 4.0 %: extracellular, including cell wall >> prediction for VHG494 is nuc 5' end seq. ID VHG...3b: 0.00 m_ : 1.00 48.0 %: nuclear 28.0 %: cytoplasmic 12.0 %: cytoskeletal 8.0 %

  12. Hydraulic integration and shrub growth form linked across continental aridity gradients.

    Science.gov (United States)

    Schenk, H Jochen; Espino, Susana; Goedhart, Christine M; Nordenstahl, Marisa; Cabrera, Hugo I Martinez; Jones, Cynthia S

    2008-08-12

    Both engineered hydraulic systems and plant hydraulic systems are protected against failure by resistance, reparability, and redundancy. A basic rule of reliability engineering is that the level of independent redundancy should increase with increasing risk of fatal system failure. Here we show that hydraulic systems of plants function as predicted by this engineering rule. Hydraulic systems of shrubs sampled along two transcontinental aridity gradients changed with increasing aridity from highly integrated to independently redundant modular designs. Shrubs in humid environments tend to be hydraulically integrated, with single, round basal stems, whereas dryland shrubs typically have modular hydraulic systems and multiple, segmented basal stems. Modularity is achieved anatomically at the vessel-network scale or developmentally at the whole-plant scale through asymmetric secondary growth, which results in a semiclonal or clonal shrub growth form that appears to be ubiquitous in global deserts.

  13. Hydraulic and biochemical gradients limit wetland mercury supply to an Adirondack stream

    Science.gov (United States)

    Bradley, Paul M.; Burns, Douglas A.; Harvey, Judson; Journey, Celeste A.; Brigham, Mark E.; Murray, Karen

    2016-01-01

    Net fluxes (change between upstream and downstream margins) for water, methylmercury (MeHg), total mercury (THg), dissolved organic carbon (DOC), and chloride (Cl) were assessed twice in an Adirondack stream reach (Sixmile Brook, USA), to test the hypothesized importance of wetland-stream hydraulic and chemical gradients as fundamental controls on fluvial mercury (Hg) supply. The 500 m study reach represented less than 4% of total upstream basin area. During a snowmelt high-flow event in May 2009 surface water, DOC, and chloride fluxes increased by 7.1±1.3%, 8.0±1.3%, and 9.0±1.3%, respectively, within the reach, demonstrating that the adjacent wetlands are important sources of water and solutes to the stream. However, shallow groundwater Hg concentrations lower than in the surface water limited groundwater-surface water Hg exchange and no significant changes in Hg (filtered MeHg and THg) fluxes were observed within the reach despite the favorable hydraulic gradient. In August 2009, the lack of significant wetland-stream hydraulic gradient resulted in no net flux of water or solutes (MeHg, THg, DOC, or Cl) within the reach. The results are consistent with the wetland-Hg-source hypothesis and indicate that hydraulic and chemical gradient (direction and magnitude) interactions are fundamental controls on the supply of wetland Hg to the stream.

  14. Time-Varying Hydraulic Gradient Model of Paste-Like Tailings in Long-Distance Pipeline Transportation

    Directory of Open Access Journals (Sweden)

    Li Yang

    2017-01-01

    Full Text Available Paste-like tailings slurry (PTLS is always simplified as a Bingham plastic fluid, leading to excessive computational errors in the calculation of the hydraulic gradient. In the case of paste-like tailings in long-distance pipeline transportation, to explore a high-precision and reliable hydraulic gradient formula, the rheological behavior of paste-like tailings slurry was analyzed, a time-varying hydraulic gradient model was constructed, and a series of laboratory shear tests were conducted. The results indicate that the PTLS shows noticeable shear-thinning characteristics in constant shear tests; the calculated hydraulic gradient declined by about 56%, from 4.44 MPa·km−1 to 1.95 MPa·km−1 within 253 s, and remained constant for the next four hours during the pipeline transportation. Comparing with the balance hydraulic gradient obtained in a semi-industrial loop test, the computational errors of those calculated by using the time-varying hydraulic gradient model, Jinchuan formula, and Shanxi formula are 15%, 78%, and 130%, respectively. Therefore, our model is a feasible and high-precision solution for the calculation of the hydraulic gradient of paste-like tailings in long-distance pipeline transportation.

  15. Constraining key hydraulic parameters of Scots Pine through sapflow data assimilation along a climatic gradient

    Science.gov (United States)

    Sus, O.; Martínez-Vilalta, J.; Poyatos, R.; Williams, M.

    2012-04-01

    In order to model the water balance of a forest ecosystem and predict its response to environmental changes, the response of tree transpiration to environmental conditions needs to be simulated. The plant hydraulic system can be conceptualised as a series of hydraulic resistances. The flow of water between any two locations of this system is proportional to the hydraulic conductivity and the water potential gradient linking them. The different components of the plant hydraulic system can change during drought as a result of varying stomatal conductance, xylem hydraulics and the regulation of leaf and root area. However, within this soil-plant-atmosphere continuum (SPAC), physical processes of water flow are better understood than plant hydraulics. For example, the effects of leaf microclimate on stomatal regulation of transpiration are not well understood. Moreover, little is known about how key hydraulic traits vary seasonally or as a function of environmental conditions. Within corresponding models, empirical parameters are introduced as surrogates for a range of complex and/or unknown mechanisms. Data assimilation (DA) methodology has shown to be a useful technique for model parameter estimation in various disciplines of the geosciences. However, few studies have applied DA to constrain parameter values within the SPAC in forest transpiration models. DA could prove to be particularly useful in quantifying these parameters, which are often not directly measurable. Sapflow data are highly appropriate for this purpose, as they are the measurable end-product of water transport through the SPAC in response to environmental conditions. Accordingly, these data provide temporally highly resolved, direct constraints on associated key parameters within models. In this study, we assimilated sapflow data from three different Scots Pine sites - following a climatic gradient from the southern dry limit of its distribution (southern Catalunya, Spain) up to the northern

  16. Hydraulics.

    Science.gov (United States)

    Decker, Robert L.; Kirby, Klane

    This curriculum guide contains a course in hydraulics to train entry-level workers for automotive mechanics and other fields that utilize hydraulics. The module contains 14 instructional units that cover the following topics: (1) introduction to hydraulics; (2) fundamentals of hydraulics; (3) reservoirs; (4) lines, fittings, and couplers; (5)…

  17. Groundwater Flow and Thermal Modeling to Support a Preferred Conceptual Model for the Large Hydraulic Gradient North of Yucca Mountain

    Energy Technology Data Exchange (ETDEWEB)

    McGraw, D.; Oberlander, P.

    2007-12-18

    The purpose of this study is to report on the results of a preliminary modeling framework to investigate the causes of the large hydraulic gradient north of Yucca Mountain. This study builds on the Saturated Zone Site-Scale Flow and Transport Model (referenced herein as the Site-scale model (Zyvoloski, 2004a), which is a three-dimensional saturated zone model of the Yucca Mountain area. Groundwater flow was simulated under natural conditions. The model framework and grid design describe the geologic layering and the calibration parameters describe the hydrogeology. The Site-scale model is calibrated to hydraulic heads, fluid temperature, and groundwater flowpaths. One area of interest in the Site-scale model represents the large hydraulic gradient north of Yucca Mountain. Nearby water levels suggest over 200 meters of hydraulic head difference in less than 1,000 meters horizontal distance. Given the geologic conceptual models defined by various hydrogeologic reports (Faunt, 2000, 2001; Zyvoloski, 2004b), no definitive explanation has been found for the cause of the large hydraulic gradient. Luckey et al. (1996) presents several possible explanations for the large hydraulic gradient as provided below: The gradient is simply the result of flow through the upper volcanic confining unit, which is nearly 300 meters thick near the large gradient. The gradient represents a semi-perched system in which flow in the upper and lower aquifers is predominantly horizontal, whereas flow in the upper confining unit would be predominantly vertical. The gradient represents a drain down a buried fault from the volcanic aquifers to the lower Carbonate Aquifer. The gradient represents a spillway in which a fault marks the effective northern limit of the lower volcanic aquifer. The large gradient results from the presence at depth of the Eleana Formation, a part of the Paleozoic upper confining unit, which overlies the lower Carbonate Aquifer in much of the Death Valley region. The

  18. Capture-zone design in an aquifer influenced by cyclic fluctuations in hydraulic gradients

    Science.gov (United States)

    Zawadzki, Willy; Chorley, Don; Patrick, Guy

    2002-10-01

    Design of a groundwater pumping and treatment system for a wood-treatment facility adjacent to the tidally influenced Fraser River estuary required the development of methodologies to account for cyclic variations in hydraulic gradients. Design of such systems must consider the effects of these cyclic fluctuations on the capture of dissolved-phase contaminants. When the period of the cyclic fluctuation is much less than the travel time of the dissolved contaminant from the source to the discharge point, the hydraulic-gradient variations resulting from these cycles can be ignored. Capture zones are then designed based on the average hydraulic gradient determined using filter techniques on continuous groundwater-level measurements. When the period of cyclic fluctuation in hydraulic gradient is near to or greater than the contaminant travel time, the resulting hydraulic-gradient variations cannot be ignored. In these instances, procedures are developed to account for these fluctuations in the capture-zone design. These include proper characterization of the groundwater regime, assessment of the average travel time and period of the cyclic fluctuations, and numerical techniques which allow accounting for the cyclic fluctuations in the design of the capture zone. Résumé. L'étude d'un système de pompage et de traitement de l'eau souterraine d'une usine de traitement du bois proche de l'estuaire de la rivière Fraser, influencé par les marées, a nécessité la mise au point de méthodologies pour prendre en compte les variations cycliques de gradients hydrauliques. L'étude de tels systèmes doit considérer les effets de ces variations cycliques sur l'extraction des contaminants en phase dissoute. Lorsque la période des variations cycliques est très inférieure au temps de parcours du contaminant dissous entre la source et le point d'émergence, les variations du gradient hydraulique résultant de ces cycles peuvent être ignorées. Les zones d'extraction sont

  19. HydrogeoEstimatorXL: an Excel-based tool for estimating hydraulic gradient magnitude and direction

    Science.gov (United States)

    Devlin, J. F.; Schillig, P. C.

    2017-01-01

    HydrogeoEstimatorXL is a free software tool for the interpretation of flow systems based on spatial hydrogeological field data from multi-well networks. It runs on the familiar Excel spreadsheet platform. The program accepts well location coordinates and hydraulic head data, and returns an analysis of the area flow system in two dimensions based on (1) a single best fit plane of the potentiometric surface and (2) three-point estimators, i.e., well triplets assumed to bound planar sections of the potentiometric surface. The software produces graphical outputs including histograms of hydraulic gradient magnitude and direction, groundwater velocity (based on a site average hydraulic properties), as well as mapped renditions of the estimator triangles and the velocity vectors associated with them. Within the software, a transect can be defined and the mass discharge of a groundwater contaminant crossing the transect can be estimated. This kind of analysis is helpful in gaining an overview of a site's hydrogeology, for problem definition, and as a review tool to check the reasonableness of other independent calculations.

  20. Hydrologic connectivity responses to thermally-controlled changes in hydraulic gradients on Arctic hillslopes

    Science.gov (United States)

    Rushlow, C. R.; Godsey, S.

    2012-12-01

    Active layer freeze and thaw exerts a first-order control on Arctic hillslope hydrology, and thus the weathering and transport of material within Arctic watersheds. We investigate how changes in active layer thaw depth over the summer warm season affect the storage and flux of water, especially in response to snowmelt and storm events. We focus our investigation on six water tracks -linear regions of preferential, but unchannelized flow- draining the hillslopes of the Upper Kuparuk River basin in northern Alaska. Water tracks form a slight topographic depression on the hillslope, and snow depth surveys from before spring snowmelt indicate that snow depths are deeper in the water tracks than on the surrounding hillslope. Thermocouples installed at ten intervals up to 35 cm below ground on the inside, edge and outside of each water track monitored ground temperatures as the active layer expanded throughout the summer. In general, the amplitude of diurnal temperature variability decreases with increasing depth, and the amplitude increases over the course of the season at all depths. Temperatures inside the water track have a muted diurnal cyclicity relative to the temperatures on the edge and outside the water track. Furthermore, surface soil moisture content inside the water tracks is consistently higher than outside. Both of these observations reflect that water moderates subsurface temperatures. Thaw depth surveys perpendicular to the water track show that over the course of the season, thaw depth becomes greater within the water track, increasing the hydraulic gradient from the surrounding hillslope to the water track. Thus, during annual late May snowmelt the surface topography is the main control on water flow paths, but as temperatures continue to warm, the topography of the active layer dominates. Thirty pressure transducers deployed in shallow groundwater wells along perpendicular transects of one water track measure changes in water table elevation during

  1. Physically-based approach to analyze rainfall-triggered landslide using hydraulic gradient as slide direction

    Institute of Scientific and Technical Information of China (English)

    Qi-hua RAN; Dan-yang SU; Qun QIAN; Xu-dong FU; Guang-qian WANG; Zhi-guo HE

    2012-01-01

    An infinite slope stability numerical model driven by the comprehensive physically-based integrated hydrology model (InHM) is presented.In this approach,the failure plane is assumed to be parallel to the hydraulic gradient instead of the slope surface.The method helps with irregularities in complex terrain since depressions and flat areas are allowed in the model.The present model has been tested for two synthetic single slopes and a small catchment in the Mettman Ridge study area in Oregon,United States,to estimate the shallow landslide susceptibility.The results show that the present approach can reduce the simulation error of hydrological factors caused by the rolling topography and depressions,and is capable of estimating spatial-temporal variations for landslide susceptibilities at simple slopes as well as at catchment scale,providing a valuable tool for the prediction of shallow landslides.

  2. Integrating hydraulic conductivity with biogeochemical gradients and microbial activity along river-groundwater exchange zones in a subtropical stream

    Science.gov (United States)

    Claret, Cécile; Boulton, Andrew J.

    2009-02-01

    The pervious lateral bars (parafluvial zone) and beds (hyporheic zone), where stream water and groundwater exchange, are dynamic sites of hydrological and biological retention. The significance of these biogeochemical ‘hotspots’ to stream and groundwater metabolism is largely controlled by filtration capacity, defined as the extent to which subsurface flowpaths and matrix hydraulic conductivity modify water characteristics. Where hydraulic conductivity is high, gradients in biogeochemistry and microbial activity along subsurface flowpaths were hypothesized to be less marked than where hydraulic conductivity is low. This hypothesis was tested in two riffles and gravel bars in an Australian subtropical stream. At one site, gradients in chemical and microbial variables along flowpaths were associated with reduced hydraulic conductivity, longer water residence time and reduced filtration capacity compared with the second site where filtration capacity was greater and longitudinal biogeochemical trends were dampened. These results imply that factors affecting the sediment matrix in this subtropical stream can alter filtration capacity, interstitial microbial activity and biogeochemical gradients along subsurface flowpaths. This hydroecological approach also indicates potential for a simple field technique to estimate filtration capacity and predict the prevailing hyporheic gradients in microbial activity and biogeochemical processing efficiency, with significant implications for stream ecosystem function.

  3. Use of Plant Hydraulic Theory to Predict Ecosystem Fluxes Across Mountainous Gradients in Environmental Controls and Insect Disturbances

    Science.gov (United States)

    Ewers, B. E.; Pendall, E.; Reed, D. E.; Barnard, H. R.; Whitehouse, F.; Frank, J. M.; Massman, W. J.; Brooks, P. D.; Biederman, J. A.; Harpold, A. A.; Naithani, K. J.; Mitra, B.; Mackay, D. S.; Norton, U.; Borkhuu, B.

    2011-12-01

    While mountainous areas are critical for providing numerous ecosystem benefits at the regional scale, the strong gradients in environmental controls make predictions difficult. A key part of the problem is quantifying and predicting the feedback between mountain gradients and plant function which then controls ecosystem cycling. The emerging theory of plant hydraulics provides a rigorous yet simple platform from which to generate testable hypotheses and predictions of ecosystem pools and fluxes. Plant hydraulic theory predicts that plant controls over carbon, water, energy and nutrient fluxes can be derived from the limitation of plant water transport from the soil through xylem and out of stomata. In addition, the limit to plant water transport can be predicted by combining plant structure (e.g. xylem diameters or root-to-shoot ratios) and plant function (response of stomatal conductance to vapor pressure deficit or root vulnerability to cavitation). We evaluate the predictions of the plant hydraulic theory by testing it against data from a mountain gradient encompassing sagebrush steppe through subalpine forests (2700 to 3400 m). We further test the theory by predicting the carbon, water and nutrient exchanges from several coniferous trees in the same gradient that are dying from xylem dysfunction caused by blue-stain fungi carried by bark beetles. The common theme of both of these data sets is a change in water limitation caused by either changing precipitation along the mountainous gradient or lack of access to soil water from xylem-occluding fungi. Across all of the data sets which range in scale from individual plants to hillslopes, the data fit the predictions of plant hydraulic theory. Namely, there was a proportional tradeoff between the reference canopy stomatal conductance to water vapor and the sensitivity of that conductance to vapor pressure deficit that quantitatively fits the predictions of plant hydraulic theory. Incorporating this result into

  4. Influences of hydraulic gradient, surface roughness, intersecting angle, and scale effect on nonlinear flow behavior at single fracture intersections

    Science.gov (United States)

    Li, Bo; Liu, Richeng; Jiang, Yujing

    2016-07-01

    Fluid flow tests were conducted on two crossed fracture models for which the geometries of fracture segments and intersections were measured by utilizing a visualization technique using a CCD (charged coupled device) camera. Numerical simulations by solving the Navier-Stokes equations were performed to characterize the fluid flow at fracture intersections. The roles of hydraulic gradient, surface roughness, intersecting angle, and scale effect in the nonlinear fluid flow behavior through single fracture intersections were investigated. The simulation results of flow rate agreed well with the experimental results for both models. The experimental and simulation results showed that with the increment of the hydraulic gradient, the ratio of the flow rate to the hydraulic gradient, Q/J, decreases and the relative difference of Q/J between the calculation results employing the Navier-Stokes equations and the cubic law, δ, increases. When taking into account the fracture surface roughness quantified by Z2 ranging 0-0.42 for J = 1, the value of δ would increase by 0-10.3%. The influences of the intersecting angle on the normalized flow rate that represents the ratio of the flow rate in a segment to the total flow rate, Ra, and the ratio of the hydraulic aperture to the mechanical aperture, e/E, are negligible when J 10-2. Based on the regression analysis on simulation results, a mathematical expression was proposed to quantify e/E, involving variables of J and Rr, where Rr is the radius of truncating circles centered at an intersection. For E/Rr > 10-2, e/E varies significantly and the scale of model has large impacts on the nonlinear flow behavior through intersections, while for E/Rr < 10-3, the scale effect is negligibly small. Finally, a necessary condition to apply the cubic law to fluid flow through fracture intersections is suggested as J < 10-3, E/Rr < 10-3, and Z2 = 0.

  5. FAST TRACK PAPER: The creation of an asymmetric hydraulic fracture as a result of driving stress gradients

    Science.gov (United States)

    Fischer, T.; Hainzl, S.; Dahm, T.

    2009-10-01

    Hydraulic fracture stimulation is frequently performed in hydrocarbon reservoirs and geothermal systems to increase the permeability of the rock formation. These hydraulic fractures are often mapped by hypocentres of induced microearthquakes. In some cases microseismicity exhibits asymmetry relative to the injection well, which can be interpreted by unequal conditions for fracture growth at opposite sides of the well or by observation effects. Here we investigate the role of the lateral change of the minimum compressive stress. We use a simple model to describe the relation among the lateral stress gradient, the mean viscous pressure gradients in the fracture wings, the fracture geometry, and the net pressure in the fracture. Our model predicts a faster fracture growth in the direction of decreasing stress and a limited growth in the opposite direction. We derive a simple relationship to estimate the lateral stress gradient from the injection pressure and the shape of the seismic hypocentre cloud. The model is tested by microseismic data obtained during stimulation of a Canyon Sands gas field in West Texas. Using a maximum likelihood method we fit the parameters of the asymmetric fracture model to the space-time pattern of hypocentres. The estimated stress gradients per metre are in the range from 0.008 to 0.010 times the bottom-hole injection overpressure (8-10 kPam-1 assuming the net pressure of 1 MPa). Such large horizontal gradients in the order of the hydrostatic gradient could be caused by the inhomogeneous extraction of gas resulting in a lateral change of the effective normal stress acting normal to the fracture wall.

  6. Hydraulic gradient and dust emissivity along a playa to distal fan transect

    Science.gov (United States)

    Caldwell, T. G.; Sweeney, M.; Bacon, S. N.; McDonald, E.

    2009-12-01

    Distal alluvial fans along the margins of playas in the desert southwest, as well as the playas themselves, are subjected to severe temporal changes in groundwater levels. Soil moisture decreases with elevation above the playa floor where groundwater levels control both soil moisture and salinity. A series of measurements were conducted along transects of a wet playa (Soda Lake, California) and a dry playa (Silver Lake; California) to quantify changes in PM10) emissions, in addition to soil physical and chemical properties. The relatively high moisture content at the playa surface of Soda Lake is controlled by a perennial shallow ground water system that promotes the precipitation and wicking of evaporates and the formation of soluble salt crusts. In contrast, Silver Lake playa is underlain by a deep ground water system, therefore the playa surface remains dry throughout the year, except for unseasonably wet winters when flooding occurs of the playa surface during inundation events. Measurements were taken along linear transects across a diverse range of playa features ranging from the playa floor to distal fans using the Portable In-Situ Wind Erosion Lab (PI-SWERL), electromagnetic induction, and soil sampling. Results indicate that dust emissivity of undisturbed soils at a friction velocity (u*) of 0.56 m s-1 increases substantially at the playa fringe (3.53 ± 1.44 mg m-2 s-1) compared to the relatively higher distal alluvial fans (0.13 ± 0.08 mg m-2 s-1) and lower emission on the playa surfaces of either the silt crust of Silver Lake playa (fans. The area between these landforms, the silt-rich playa fringe, is subjected to transient groundwater and surface water influx resulting in monovalent bicarbonate (HCO3-) salts which disperse clays and creates an area of high emissivity. As distance to groundwater increases, the hydraulic gradient shifts from the upward evaporation of saline groundwater to downward flushing by dilute precipitation. This shift results in

  7. Investigating patterns and controls of groundwater up-welling in a lowland river by combining fibre-optic distributed temperature sensing with observations of vertical head gradients

    Directory of Open Access Journals (Sweden)

    S. Krause

    2012-01-01

    Full Text Available This paper investigates the patterns and controls of aquifer-river exchange in a fast-flowing lowland river by the conjunctive use of streambed temperature anomalies identified with Fibre-optic Distributed Temperature Sensed (FO-DTS and observations of vertical hydraulic gradients (VHG.

    FO-DTS temperature traces along this lowland river reach reveal discrete patterns with "cold spots" indicating groundwater up-welling. In contrast to previous studies using FO-DTS for investigation of groundwater-surface water exchange, the fibre-optic cable in this study was buried in the streambed sediments, ensuring clear signals despite fast flow and high discharges. During the observed summer baseflow period, streambed temperatures in groundwater up-welling locations were found to be up to 1.5 °C lower than ambient streambed temperatures. Due to the high river flows the cold spots were sharp and distinctly localized without measurable impact on downstream surface water temperature.

    VHG patterns along the stream reach were highly variable in space, revealing strong differences even at small scales. VHG patterns alone are indicators of both, structural heterogeneity of the stream bed as well as of the spatial heterogeneity of the groundwater-surface water exchange fluxes and are thus not conclusive in their interpretation. However, in combination with the high spatial resolution DTS data we were able to separate these two influences and clearly identify locations of enhanced exchange, while also obtaining information on the complex small-scale streambed transmissivity patterns responsible for the very discrete exchange patterns.

  8. Towards improved estimation of the unsaturated soil hydraulic conductivity in the near saturated range by a fully automated, pressure controlled unit gradient experiment.

    Science.gov (United States)

    Werisch, Stefan; Müller, Marius

    2017-04-01

    Determination of soil hydraulic properties has always been an important part of soil physical research and model applications. While several experiments are available to measure the water retention of soil samples, the determination of the unsaturated hydraulic conductivity is often more complicated, bound to strong assumption and time consuming. Although, the application of unit gradient experiments is recommended since the middle of the last century, as one method towards a (assumption free) direct measurement of the unsaturated hydraulic conductivity, data from unit gradient experiments is seldom to never reported in literature. We developed and build a fully automated, pressure controlled, unit gradient experiment, which allows a precise determination of the unsaturated soil hydraulic conductivity K(h) and water retention VWC(h), especially in the highly dynamic near saturated range. The measurement apparatus applies the concept of hanging water columns and imposes the required soil water pressure by dual porous plates. This concepts allows the simultaneous and direct measurement of water retention and hydraulic conductivity. Moreover, this approach results in a technically less demanding experiment than related flux controlled experiments, and virtually any flux can be measured. Thus, both soil properties can be measured in mm resolution, for wetting and drying processes, between saturation and field capacity for all soil types. Our results show, that it is important to establish separate measurements of the unsaturated hydraulic conductivity in the near saturated range, as the shape of the retention function and hydraulic conductivity curve do not necessarily match. Consequently, the prediction of the hydraulic conductivity curve from measurements of the water retention behavior in combination with a value for the saturated hydraulic conductivity can be misleading. Thus, separate parameterizations of the individual functions might be necessary and are

  9. Chloride concentration gradients in tank-stored hydraulic fracturing fluids following flowback

    Science.gov (United States)

    Pamela J. Edwards; Linda L. Tracy; William K. Wilson

    2011-01-01

    A natural gas well in West Virginia was hydraulically fractured and the flowback was recovered and stored in an 18-foot-deep tank. Both in situ field test kit and laboratory measurements of electrical conductivity and chloride concentrations increased substantially with depth, although the laboratory measurements showed a greater increase. The field test kit also...

  10. Hydraulic conductance and water potential gradients in squash leaves showing mycorrhiza-induced increases in stomatal conductance.

    Science.gov (United States)

    Augé, Robert M; Toler, Heather D; Sams, Carl E; Nasim, Ghazala

    2008-03-01

    Stomatal conductance (gs) and transpiration rates vary widely across plant species. Leaf hydraulic conductance (k leaf) tends to change with g (s), to maintain hydraulic homeostasis and prevent wide and potentially harmful fluctuations in transpiration-induced water potential gradients across the leaf (Delta Psi leaf). Because arbuscular mycorrhizal (AM) symbiosis often increases gs in the plant host, we tested whether the symbiosis affects leaf hydraulic homeostasis. Specifically, we tested whether k leaf changes with gs to maintain Delta Psi leaf or whether Delta Psi leaf differs when gs differs in AM and non-AM plants. Colonization of squash plants with Glomus intraradices resulted in increased gs relative to non-AM controls, by an average of 27% under amply watered, unstressed conditions. Stomatal conductance was similar in AM and non-AM plants with exposure to NaCl stress. Across all AM and NaCl treatments, k leaf did change in synchrony with gs (positive correlation of gs and k leaf), corroborating leaf tendency toward hydraulic homeostasis under varying rates of transpirational water loss. However, k leaf did not increase in AM plants to compensate for the higher gs of unstressed AM plants relative to non-AM plants. Consequently, Delta Psi leaf did tend to be higher in AM leaves. A trend toward slightly higher Delta Psi leaf has been observed recently in more highly evolved plant taxa having higher productivity. Higher Delta Psi leaf in leaves of mycorrhizal plants would therefore be consistent with the higher rates of gas exchange that often accompany mycorrhizal symbiosis and that are presumed to be necessary to supply the carbon needs of the fungal symbiont.

  11. Very high gravity (VHG) ethanolic brewing and fermentation: a research update.

    Science.gov (United States)

    Puligundla, Pradeep; Smogrovicova, Daniela; Obulam, Vijaya Sarathi Reddy; Ko, Sanghoon

    2011-09-01

    There have been numerous developments in ethanol fermentation technology since the beginning of the new millennium as ethanol has become an immediate viable alternative to fast-depleting crude reserves as well as increasing concerns over environmental pollution. Nowadays, although most research efforts are focused on the conversion of cheap cellulosic substrates to ethanol, methods that are cost-competitive with gasoline production are still lacking. At the same time, the ethanol industry has engaged in implementing potential energy-saving, productivity and efficiency-maximizing technologies in existing production methods to become more viable. Very high gravity (VHG) fermentation is an emerging, versatile one among such technologies offering great savings in process water and energy requirements through fermentation of higher concentrations of sugar substrate and, therefore, increased final ethanol concentration in the medium. The technology also allows increased fermentation efficiency, without major alterations to existing facilities, by efficient utilization of fermentor space and elimination of known losses. This comprehensive research update on VHG technology is presented in two main sections, namely VHG brewing, wherein the effects of nutrients supplementation, yeast pitching rate, flavour compound synthesis and foam stability under increased wort gravities are discussed; and VHG bioethanol fermentation studies. In the latter section, aspects related to the role of osmoprotectants and nutrients in yeast stress reduction, substrates utilized/tested so far, including saccharide (glucose, sucrose, molasses, etc.) and starchy materials (wheat, corn, barley, oats, etc.), and mash viscosity issues in VHG bioethanol production are detailed. Thereafter, topics common to both areas such as process optimization studies, mutants and gene level studies, immobilized yeast applications, temperature effect, reserve carbohydrates profile in yeast, and economic aspects are

  12. Hydraulic redistribution in dwarf Rhizophora mangle trees driven by interstitial soil water salinity gradients: impacts on hydraulic architecture and gas exchange.

    Science.gov (United States)

    Hao, Guang-You; Jones, Tim J; Luton, Corene; Zhang, Yong-Jiang; Manzane, Eric; Scholz, Fabian G; Bucci, Sandra J; Cao, Kun-Fang; Goldstein, Guillermo

    2009-05-01

    Rhizophora mangle L. trees of Biscayne National Park (Florida, USA) have two distinct growth forms: tall trees (5-10 m) growing along the coast and dwarf trees (1 m or less) growing in the adjacent inland zone. Sharp decreases in salinity and thus increases in soil water potential from surface soil to about a depth of 1 m were found at the dwarf mangrove site but not at the tall mangrove site. Consistent with our prediction, hydraulic redistribution detected by reverse sap flow in shallow prop roots was observed during nighttime, early morning and late afternoon in dwarf trees, but not in tall trees. In addition, hydraulic redistribution was observed throughout the 24-h period during a low temperature spell. Dwarf trees had significantly lower sapwood-specific hydraulic conductivity, smaller stem vessel diameter, lower leaf area to sapwood area ratio (LA/SA), smaller leaf size and higher leaf mass per area. Leaves of dwarf trees had lower CO(2) assimilation rate and lower stomatal conductance compared to tall trees. Leaf water potentials at midday were more negative in tall trees that are consistent with their substantially higher stomatal conductance and LA/SA. The substantially lower water transport efficiency and the more conservative water use of dwarf trees may be due to a combination of factors such as high salinity in the surface soil, particularly during dry periods, and substantial reverse sap flow in shallow roots that make upper soil layers with high salinity a competing sink of water to the transpiring leaves. There may also be a benefit for the dwarf trees in having hydraulic redistribution because the reverse flow and the release of water to upper soil layers should lead to dilution of the high salinity in the rhizosphere and thus relieve its potential harm to dwarf R. mangle trees.

  13. (VHG) fermentation

    African Journals Online (AJOL)

    user

    2012-05-17

    May 17, 2012 ... ... synergistic effects of environmental or physiological stress imposed upon the .... a consequence of osmotic pressure, ethanol stress and other metabolic ... affected, of these genes, 816 genes were ≥2 fold up- regulated and ...

  14. Simultaneous saccharification and fermentation (SSF) of very high gravity (VHG) potato mash for the production of ethanol

    Energy Technology Data Exchange (ETDEWEB)

    Srichuwong, Sathaporn; Fujiwara, Maki; Wang, Xiaohui; Seyama, Tomoko; Shiroma, Riki; Arakane, Mitsuhiro; Tokuyasu, Ken [National Food Research Institute, National Agriculture and Food Research Organization (NARO), 2-1-12 Kannondai, Tsukuba, Ibaraki 305-8642 (Japan); Mukojima, Nobuhiro [National Agricultural Research Center for Hokkaido Region, NARO, 9-4 Shinsei-minami, Memuro-cho, Kasai-gun, Hokkaido 082-0071 (Japan)

    2009-05-15

    Simultaneous saccharification and fermentation (SSF) of very high gravity (VHG) potato mash, containing 304 g L{sup -1} of dissolved carbohydrates, was carried out for ethanol production. Potato tubers were ground into a mash, which was highly viscous. Mash viscosity was reduced by the pretreatment with mixed enzyme preparations of pectinase, cellulase and hemicellulase. The enzymatic pretreatment established the use of VHG mash with a suitable viscosity. Starch in the pretreated mash was liquefied to maltodextrins by the action of thermo-stable {alpha}-amylase at 85 C. SSF of liquefied mash was performed at 30 C with the simultaneous addition of glucoamylase, yeast (Saccharomyces cerevisiae) and ammonium sulfate as a nitrogen source for the yeast. The optimal glucoamylase loading, ammonium sulfate concentration and fermentation time were 1.65 AGU g{sup -1}, 30.2 mM and 61.5 h, respectively, obtained using the response surface methodology (RSM). Ammonium sulfate supplementation was necessary to avoid stuck fermentation under VHG condition. Using the optimized condition, ethanol yield of 16.61% (v/v) was achieved, which was equivalent to 89.7% of the theoretical yield. (author)

  15. Effect of tapioca starch and amyloglucosidase concentration on very high gravity simultaneous saccharification and fermentation (VHG-SSF) of bioethanol

    Science.gov (United States)

    Sugih, A. K.; Santoso, I. V.; Kristijarti, A. P.

    2015-12-01

    Tapioca starch is isolated from the root of cassava plant (Manihot esculenta). It is produced in a large quantity in Indonesia and other south east Asian countries. Tapioca starch has been commonly used as a feedstock for food as well as non-food industries. Due to its high carbohydrate content, tapioca starch has the potentiality to be used as a raw material for bioethanol production. In this research, a novel approach (Very High Gravity Simultaneous Sacharification and Fermentation/ VHG-SSF) to synthesise highly concentrated ethanol from tapioca starch was investigated. Tapioca starch suspension was first gelatinised for two hours at 90°C and hydrolised at the same temperature for another two hours using commercial α- amylase (Liquozyme Supra, 0.16%-v/ w starch). The pretreated suspension was sterilised and mixed with nitrogenous supplement. In order to start the fermentation, Saccharomyces cereviseae NRRL Y-132 inoculum (10%-v/v; 107 cells/ ml) and commercial amyloglucosidase (Dextrozyme GA, 35-105 AGU/ g starch) were added to the mixture. The initial total carbohydrate, yeast extract, and peptone concentrations of the fermentation broths were 30-40 %-w/v, 1%-w/v, and 2%-w/v, respectively. VHG-SSF was allowed to proceed for 6 days at 30°C with rotary shaker speed of 100 rpm. The concentration of glucose and ethanol during fermentation was monitored using HPLC. The experimental result shows that tapioca starch has been successfully converted to ethanol with a final concentration of 10.12-16.14 %-w/v, which is corresponding to yield of 34.68-56.83 %-w ethanol/ w-converted sugar. The result suggests that VHG-SSF is a prospective method to synthesise bioethanol from tapioca starch.

  16. 用L管测定膏体料浆水力坡度试验研究%Experimental Study on Hydraulic Gradient of Paste Slurry by L-pipe

    Institute of Scientific and Technical Information of China (English)

    陈琴瑞; 王洪江; 吴爱祥; 翟永刚; 张仪; 章清涛

    2011-01-01

    全尾砂膏体料浆的水力坡度是浆体管道输送的关键参数之一.采用自制的L管,结合全尾砂膏体料浆的流态特性来测定其水力坡度,根据水力坡度来计算其流变参数,并用数据证明了膏体料浆的均质流特性.试验结果表明:全尾砂膏体料浆不沉粒径d0>dmax,属均质流;雷诺数Re<2 100,属柱塞流;流变参数为膏体料浆的固有属性,不同管径、不同流速下的水力坡度可根据其流变参数进行计算.%The hydraulic gradient of full-tailings paste slurry is one of the key parameters of pipeline transportation. In this paper, using self-made L-pipe, the hydraulic gradient was measured through the combination of the flow characteristics of full-tailings paste slurry,then slurry rheological parameters was calculated on the basis of hydraulic gradient, and slurry's homogeneous property was proved through data. The results showed that: the full-tailings paste slurry belongs to homogeneous flow because of unsinkable diameter d0 >dmax, plug flow because of Reynolds number Re <2 100; The rheological parameters are intrinsic properties of slurry. The hydraulic gradient with various diameters and various velocities can be calculated in accordance with the rheological parameters.

  17. Thermally Actuated Hydraulic Pumps

    Science.gov (United States)

    Jones, Jack; Ross, Ronald; Chao, Yi

    2008-01-01

    Thermally actuated hydraulic pumps have been proposed for diverse applications in which direct electrical or mechanical actuation is undesirable and the relative slowness of thermal actuation can be tolerated. The proposed pumps would not contain any sliding (wearing) parts in their compressors and, hence, could have long operational lifetimes. The basic principle of a pump according to the proposal is to utilize the thermal expansion and contraction of a wax or other phase-change material in contact with a hydraulic fluid in a rigid chamber. Heating the chamber and its contents from below to above the melting temperature of the phase-change material would cause the material to expand significantly, thus causing a substantial increase in hydraulic pressure and/or a substantial displacement of hydraulic fluid out of the chamber. Similarly, cooling the chamber and its contents from above to below the melting temperature of the phase-change material would cause the material to contract significantly, thus causing a substantial decrease in hydraulic pressure and/or a substantial displacement of hydraulic fluid into the chamber. The displacement of the hydraulic fluid could be used to drive a piston. The figure illustrates a simple example of a hydraulic jack driven by a thermally actuated hydraulic pump. The pump chamber would be a cylinder containing encapsulated wax pellets and containing radial fins to facilitate transfer of heat to and from the wax. The plastic encapsulation would serve as an oil/wax barrier and the remaining interior space could be filled with hydraulic oil. A filter would retain the encapsulated wax particles in the pump chamber while allowing the hydraulic oil to flow into and out of the chamber. In one important class of potential applications, thermally actuated hydraulic pumps, exploiting vertical ocean temperature gradients for heating and cooling as needed, would be used to vary hydraulic pressures to control buoyancy in undersea research

  18. Simplified modeling of liquid sodium medium with temperature and velocity gradient using real thermal-hydraulic data. Application to ultrasonic thermometry in sodium fast reactor

    Science.gov (United States)

    Massacret, N.; Moysan, J.; Ploix, M. A.; Jeannot, J. P.; Corneloup, G.

    2013-01-01

    In the framework of the French R&D program for the Generation IV reactors and specifically for the sodium cooled fast reactors (SFR), studies are carried out on innovative instrumentation methods in order to improve safety and to simplify the monitoring of fundamental physical parameters during reactor operation. The aim of the present work is to develop an acoustic thermometry method to follow up the sodium temperature at the outlet of subassemblies. The medium is a turbulent flow of liquid sodium at 550 °C with temperature inhomogeneities. To understand the effect of disturbance created by this medium, numerical simulations are proposed. A ray tracing code has been developed with Matlabin order to predict acoustic paths in this medium. This complex medium is accurately described by thermal-hydraulic data which are issued from a simulation of a real experiment in Japan. The analysis of these results allows understanding the effects of medium inhomogeneities on the further thermometric acoustic measurement.

  19. Simplified modeling of liquid sodium medium with temperature and velocity gradient using real thermal-hydraulic data. Application to ultrasonic thermometry in sodium fast reactor

    Energy Technology Data Exchange (ETDEWEB)

    Massacret, N.; Jeannot, J. P. [DEN/DTN/STPA/LIET, CEA Cadarache, Saint Paul Lez Durance (France); Moysan, J.; Ploix, M. A.; Corneloup, G. [Aix-Marseille Univ, LMA UPR 7051 CNRS, site LCND, 13625 Aix-en-Provence (France)

    2013-01-25

    In the framework of the French R and D program for the Generation IV reactors and specifically for the sodium cooled fast reactors (SFR), studies are carried out on innovative instrumentation methods in order to improve safety and to simplify the monitoring of fundamental physical parameters during reactor operation. The aim of the present work is to develop an acoustic thermometry method to follow up the sodium temperature at the outlet of subassemblies. The medium is a turbulent flow of liquid sodium at 550 Degree-Sign C with temperature inhomogeneities. To understand the effect of disturbance created by this medium, numerical simulations are proposed. A ray tracing code has been developed with Matlab Copyright-Sign in order to predict acoustic paths in this medium. This complex medium is accurately described by thermal-hydraulic data which are issued from a simulation of a real experiment in Japan. The analysis of these results allows understanding the effects of medium inhomogeneities on the further thermometric acoustic measurement.

  20. Hydraulic structures

    CERN Document Server

    Chen, Sheng-Hong

    2015-01-01

    This book discusses in detail the planning, design, construction and management of hydraulic structures, covering dams, spillways, tunnels, cut slopes, sluices, water intake and measuring works, ship locks and lifts, as well as fish ways. Particular attention is paid to considerations concerning the environment, hydrology, geology and materials etc. in the planning and design of hydraulic projects. It also considers the type selection, profile configuration, stress/stability calibration and engineering countermeasures, flood releasing arrangements and scouring protection, operation and maintenance etc. for a variety of specific hydraulic structures. The book is primarily intended for engineers, undergraduate and graduate students in the field of civil and hydraulic engineering who are faced with the challenges of extending our understanding of hydraulic structures ranging from traditional to groundbreaking, as well as designing, constructing and managing safe, durable hydraulic structures that are economical ...

  1. HYDRAULIC SERVO

    Science.gov (United States)

    Wiegand, D.E.

    1962-05-01

    A hydraulic servo is designed in which a small pressure difference produced at two orifices by an electrically operated flapper arm in a constantly flowing hydraulic loop is hydraulically amplified by two constant flow pumps, two additional orifices, and three unconnected ball pistons. Two of the pistons are of one size and operate against the additional orifices, and the third piston is of a different size and operates between and against the first two pistons. (AEC)

  2. Basic hydraulics

    CERN Document Server

    Smith, P D

    1982-01-01

    BASIC Hydraulics aims to help students both to become proficient in the BASIC programming language by actually using the language in an important field of engineering and to use computing as a means of mastering the subject of hydraulics. The book begins with a summary of the technique of computing in BASIC together with comments and listing of the main commands and statements. Subsequent chapters introduce the fundamental concepts and appropriate governing equations. Topics covered include principles of fluid mechanics; flow in pipes, pipe networks and open channels; hydraulic machinery;

  3. Hydraulic Structures

    Data.gov (United States)

    Department of Homeland Security — This table is required whenever hydraulic structures are shown in the flood profile. It is also required if levees are shown on the FIRM, channels containing the...

  4. A calculation method of water distribution network hydraulic based on preconditioned conjugate gradient method%一种基于预处理共轭梯度法的给水管网水力计算方法

    Institute of Scientific and Technical Information of China (English)

    王美香

    2014-01-01

    提出了一种新的给水管网水力计算方法.该方法对给水管网系统的节点流量连续性方程进行重新构造,用改进的Cholesky分解方法对重新构造的矩阵进行三角分解,然后使用预处理共轭梯度法求解.经用供水管网模型进行验证并与EPANET软件的计算结果进行比较,结果表明:该算法共迭代5次,用时0.102 s,与EPANET混合节点-环方法的求解精度和速度非常接近,且弥补了EPA-NET软件的应用缺陷,可用于求解大型城市的给水管网系统.%A calculation method of water distribution network hydraulic was proposed.The nodes flow conti-nuity equation of water distribution system was reconstructed,the reconstructed matrix was decomposed tri-angularly by a modified Cholesky decomposition method,and thus it was suitable for the use of precondi-tioned conjugate gradient method.It was tested by the model of water distribution network(WDN)hydrau-lic.Compared with calculation result of EPANET software,the proposed algorithm does total iteration five times in 0.1 02 s,which closed to the result of mixed node-ring method used in EPANET software in the as-pect of accuracy and speed.The proposed algorithm overcame the defects of EPANET software,which could be used to solve large-scale urban water supply network system.

  5. Hydraulic conductivity of GCLs in MSW landfills

    Institute of Scientific and Technical Information of China (English)

    LI Guo-cheng; YANG Wu-chao; DAN Tang-hui

    2008-01-01

    The state of the art of the study on the hydraulic conductivity of GCLs is presented in terms of the in-fluence of the effective stress, chemical interactions, freeze - thaw cycles and temperature gradients. The chan-ges of void ratio caused by changes of effective stress have a direct linear effect on the hydraulic conductivity, regardless of the cation concentration or the thickness of the adsorbed layer. The hydraulic conductivity is relat-ed to the relative abundance of monovalent and divalent cation(RMD), and RMD has a great effect on the hy-draulic conductivity in weak solution. The long-term susceptibility of GCLs to increased hydraulic conductivity as a response to repeated freeze-thaw cycling is minimal, which has been proved after 150 freeze-thaw cycles. The potential of desiccation cracking increases with the increasing temperature gradient and is related to the ini-tial subsoil water content, the applied overburden stress, etc.

  6. HYDRAULICS, LOUISA COUNTY, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydraulic data include spatial datasets and data tables necessary for documenting the hydraulic analysis for estimating flood stages for a flood insurance study. It...

  7. Hydraulic Hybrid Vehicles

    Science.gov (United States)

    EPA and the United Parcel Service (UPS) have developed a hydraulic hybrid delivery vehicle to explore and demonstrate the environmental benefits of the hydraulic hybrid for urban pick-up and delivery fleets.

  8. Gradient networks

    Science.gov (United States)

    Toroczkai, Zoltán; Kozma, Balázs; Bassler, Kevin E.; Hengartner, N. W.; Korniss, G.

    2008-04-01

    Gradient networks are defined (Toroczkai and Bassler 2004 Nature 428 716) as directed graphs formed by local gradients of a scalar field distributed on the nodes of a substrate network G. We present the derivation for some of the general properties of gradient graphs and give an exact expression for the in-degree distribution R(l) of the gradient network when the substrate is a binomial (Erd{\\;\\kern -0.10em \\raise -0.35ex \\{{^{^{\\prime\\prime}}}}\\kern -0.57em \\o} s-Rényi) random graph, G_{N,p} , and the scalars are independent identically distributed (i.i.d.) random variables. We show that in the limit N \\to \\infty, p \\to 0, z = pN = \\mbox{const} \\gg 1, R(l)\\propto l^{-1} for l Bassler (2004 Nature 428 716).

  9. Hydraulic Redistribution: A Modeling Perspective

    Science.gov (United States)

    Daly, E.; Verma, P.; Loheide, S. P., III

    2014-12-01

    Roots play a key role in the soil water balance. They extract and transport water for transpiration, which usually represents the most important soil water loss in vegetated areas, and can redistribute soil water, thereby increasing transpiration rates and enhancing root nutrient uptake. We present here a two-dimensional model capable of describing two key aspects of root water uptake: root water compensation and hydraulic redistribution. Root water compensation is the ability of root systems to respond to the reduction of water uptake from areas of the soil with low soil water potential by increasing the water uptake from the roots in soil parts with higher water potential. Hydraulic redistribution is a passive transfer of water through the root system from areas of the soil with greater water potential to areas with lower water potential. Both mechanisms are driven by gradients of water potential in the soil and the roots. The inclusion of root water compensation and hydraulic redistribution in models can be achieved by describing root water uptake as a function of the difference in water potential between soil and root xylem. We use a model comprising the Richards equation for the water flow in variably saturated soils and the Darcy's equation for the water flow in the xylem. The two equations are coupled via a sink term, which is assumed to be proportional to the difference between soil and xylem water potentials. The model is applied in two case studies to describe vertical and horizontal hydraulic redistribution and the interaction between vegetation with different root depths. In the case of horizontal redistribution, the model is used to reproduce the fluxes of water across the root system of a tree subjected to uneven irrigation. This example can be extended to situations when only part of the root system has access to water, such as vegetation near creeks, trees at the edge of forests, and street trees in urban areas. The second case is inspired by recent

  10. Vibration of hydraulic machinery

    CERN Document Server

    Wu, Yulin; Liu, Shuhong; Dou, Hua-Shu; Qian, Zhongdong

    2013-01-01

    Vibration of Hydraulic Machinery deals with the vibration problem which has significant influence on the safety and reliable operation of hydraulic machinery. It provides new achievements and the latest developments in these areas, even in the basic areas of this subject. The present book covers the fundamentals of mechanical vibration and rotordynamics as well as their main numerical models and analysis methods for the vibration prediction. The mechanical and hydraulic excitations to the vibration are analyzed, and the pressure fluctuations induced by the unsteady turbulent flow is predicted in order to obtain the unsteady loads. This book also discusses the loads, constraint conditions and the elastic and damping characters of the mechanical system, the structure dynamic analysis, the rotor dynamic analysis and the system instability of hydraulic machines, including the illustration of monitoring system for the instability and the vibration in hydraulic units. All the problems are necessary for vibration pr...

  11. Handbook of hydraulic fluid technology

    CERN Document Server

    Totten, George E

    2011-01-01

    ""The Handbook of Hydraulic Fluid Technology"" serves as the foremost resource for designing hydraulic systems and for selecting hydraulic fluids used in engineering applications. Featuring new illustrations, data tables, as well as practical examples, this second edition is updated with essential information on the latest hydraulic fluids and testing methods. The detailed text facilitates unparalleled understanding of the total hydraulic system, including important hardware, fluid properties, and hydraulic lubricants. Written by worldwide experts, the book also offers a rigorous overview of h

  12. On the Hydraulics of Flowing Horizontal Wells

    Science.gov (United States)

    Bian, A.; Zhan, H.

    2003-12-01

    A flowing horizontal well is a special type of horizontal well that does not have pumping/injecting facility. The discharge rate of a flowing horizontal well is controlled by the hydraulic gradient between the aquifer and the well and it generally varies with time if the hydraulic head of the aquifer is transient. This type of well has been used in landslide control, mining dewatering, water table control, underground water transportation through a horizontal tunnel, agricultural water drainage, and other applications. Flowing horizontal wells have quite different hydrodynamic characteristics from horizontal wells with fixed pumping or injecting rates because their discharge rates are functions of the aquifer hydraulic heads (Zhan et al, 2001; Zhan and Zlotnik, 2002). Hydraulics of flowing horizontal wells have rarely been studied although the hydraulics of flowing vertical wells have been extensively investigated before. The purpose of this paper is to obtain analytical solutions of groundwater flow to a flowing horizontal-well in a confined aquifer, in a water table aquifer without precipitation, and in a water table aquifer with precipitation. The functions of the flowing horizontal well discharge rates versus time will be obtained under above mentioned different aquifer conditions. The relationships of the aquifer hydraulic heads versus the discharge rates of the well will be investigated. The rate of water table decline due to the dewatering of the well will also be computed, and this solution is particularly useful for landslide control and mining dewatering. The theoretical solutions will be compared with results of experiments that will be conducted in the hydrological laboratory at Texas A&M University. Reference: Zhan, H., Wang, L.V., and Park, E, On the horizontal well pumping tests in the anisotropic confined aquifers, J. hydrol., 252, 37-50, 2001. Zhan, H., and Zlotnik, V. A., Groundwater flow to a horizontal or slanted well in an unconfined aquifer

  13. FEMA DFIRM Hydraulic Structures

    Data.gov (United States)

    Minnesota Department of Natural Resources — This layer and accompanying attribute table is required whenever hydraulic structures are shown in the flood profile. It is also required if levees are shown on the...

  14. Water Hydraulic Systems

    DEFF Research Database (Denmark)

    Conrad, Finn

    2005-01-01

    The paper presents research results using IT-Tools for CAD and dynamic modelling, simulation, analysis, and design of water hydraulic actuators for motion control of machines, lifts, cranes and robots. Matlab/Simulink and CATIA are used as IT-Tools. The contributions include results from on......-going research projects on fluid power and mechatronics based on tap water hydraulic servovalves and linear servo actuators and rotary vane actuators for motion control and power transmission. Development and design a novel water hydraulic rotary vane actuator for robot manipulators. Proposed mathematical...... modelling, control and simulation of a water hydraulic rotary vane actuator applied to power and control a two-links manipulator and evaluate performance. The results include engineering design and test of the proposed simulation models compared with IHA Tampere University’s presentation of research...

  15. Constant-Pressure Hydraulic Pump

    Science.gov (United States)

    Galloway, C. W.

    1982-01-01

    Constant output pressure in gas-driven hydraulic pump would be assured in new design for gas-to-hydraulic power converter. With a force-multiplying ring attached to gas piston, expanding gas would apply constant force on hydraulic piston even though gas pressure drops. As a result, pressure of hydraulic fluid remains steady, and power output of the pump does not vary.

  16. Root water extraction and limiting soil hydraulic conditions estimated by numerical simulation

    NARCIS (Netherlands)

    Jong van Lier, de Q.; Metselaar, K.; Dam, van J.C.

    2006-01-01

    Root density, soil hydraulic functions, and hydraulic head gradients play an important role in the determination of transpiration-rate-limiting soil water contents. We developed an implicit numerical root water extraction model to solve the Richards equation for the modeling of radial root water

  17. Spatial variability in streambed hydraulic conductivity of contrasting stream morphologies

    DEFF Research Database (Denmark)

    Sebök, Éva; Calvache, Carlos Duque; Engesgaard, Peter Knudegaard;

    2015-01-01

    Streambed hydraulic conductivity is one of the main factors controlling variability in surface water-groundwater interactions, but only few studies aim at quantifying its spatial and temporal variability in different stream morphologies. Streambed horizontal hydraulic conductivities (Kh) were...... therefore determined from in-stream slug tests, vertical hydraulic conductivities (Kv) were calculated with in-stream permeameter tests and hydraulic heads were measured to obtain vertical head gradients at eight transects, each comprising five test locations, in a groundwater-dominated stream. Seasonal...... small-scale measurements were taken in December 2011 and August 2012, both in a straight stream channel with homogeneous elevation and downstream of a channel meander with heterogeneous elevation. All streambed attributes showed large spatial variability. Kh values were the highest at the depositional...

  18. Trend of hydraulic units

    Energy Technology Data Exchange (ETDEWEB)

    Deshimaru, Jun' ichi

    1988-11-01

    The gear, vane and piston pumps occupy a more then 90% share in the hydraulic pumps. Comparatively large pumps are mainly variable delivery piston pumps. The piston pumps are comparatively high in output density (output per unit weight), indicating the hydraulic pump in performance, and tend to become higher and higher in it. Though they are mainly 210 to 350kgf/cm/sup 2/ in rated pressure, some of them come to surpass 400kgf/cm/sup 3/ in it. While the progress in computation also requires the high speed operation, high accuracy and other severe conditions for the hydraulic units, which accordingly and increasingly intensify the requirement for hydraulic oil in abrasion resistibility, oxidation stability and response characteristics. While cavitation comes to easily occur, which considerably and disadvantageously influences hydraulic oil in life through degradation, noise level and respondingness. From now on, the development of high performance oil and study of mechanical structure are important. 19 references, 9 figures, 2 tables.

  19. Hydraulic conductivity of a firn aquifer system in southeast Greenland

    Science.gov (United States)

    Miller, Olivia L.; Solomon, D. Kip; Miège, Clément; Koenig, Lora S.; Forster, Richard R.; Montgomery, Lynn N.; Schmerr, Nicholas; Ligtenberg, Stefan R. M.; Legchenko, Anatoly; Brucker, Ludovic

    2017-05-01

    Some regions of the Greenland ice sheet, where snow accumulation and melt rates are high, currently retain substantial volumes of liquid water within the firn pore space throughout the year. These firn aquifers, found between 10-30 m below the snow surface, may significantly affect sea level rise by storing or draining surface meltwater. The hydraulic gradient and the hydraulic conductivity control flow of meltwater through the firn. Here we describe the hydraulic conductivity of the firn aquifer estimated from slug tests and aquifer tests at six sites located upstream of Helheim Glacier in southeastern Greenland. We conducted slug tests using a novel instrument, a piezometer with a heated tip that melts itself into the ice sheet. Hydraulic conductivity ranges between 2.5x10-5 and 1.1x10-3 m/s. The geometric mean of hydraulic conductivity of the aquifer is 2.7x10-4 m/s with a geometric standard deviation of 1.4 from both depth specific slug tests (analyzed using the Hvorslev method) and aquifer tests during the recovery period. Hydraulic conductivity is relatively consistent between boreholes and only decreases slightly with depth. The hydraulic conductivity of the firn aquifer is crucial for determining flow rates and patterns within the aquifer, which inform hydrologic models of the aquifer, its relation to the broader glacial hydrologic system, and its effect on sea level rise.

  20. Hydraulic Conductivity of a Firn Aquifer in Southeast Greenland

    Directory of Open Access Journals (Sweden)

    Olivia L. Miller

    2017-05-01

    Full Text Available Some regions of the Greenland ice sheet, where snow accumulation and melt rates are high, currently retain substantial volumes of liquid water within the firn pore space throughout the year. These firn aquifers, found between ~10 and 30 m below the snow surface, may significantly affect sea level rise by storing or draining surface meltwater. The hydraulic gradient and the hydraulic conductivity control flow of meltwater through the firn. Here we describe the hydraulic conductivity of the firn aquifer estimated from slug tests and aquifer tests at six sites located upstream of Helheim Glacier in southeastern Greenland. We conducted slug tests using a novel instrument, a piezometer with a heated tip that melts itself into the ice sheet. Hydraulic conductivity ranges between 2.5 × 10−5 and 1.1 × 10−3 m/s. The geometric mean of hydraulic conductivity of the aquifer is 2.7 × 10−4 m/s with a geometric standard deviation of 1.4 from both depth specific slug tests (analyzed using the Hvorslev method and aquifer tests during the recovery period. Hydraulic conductivity is relatively consistent between boreholes and only decreases slightly with depth. The hydraulic conductivity of the firn aquifer is crucial for determining flow rates and patterns within the aquifer, which inform hydrologic models of the aquifer, its relation to the broader glacial hydrologic system, and its effect on sea level rise.

  1. Cavitation in Hydraulic Machinery

    Energy Technology Data Exchange (ETDEWEB)

    Kjeldsen, M.

    1996-11-01

    The main purpose of this doctoral thesis on cavitation in hydraulic machinery is to change focus towards the coupling of non-stationary flow phenomena and cavitation. It is argued that, in addition to turbulence, superimposed sound pressure fluctuations can have a major impact on cavitation and lead to particularly severe erosion. For the design of hydraulic devices this finding may indicate how to further limit the cavitation problems. Chapter 1 reviews cavitation in general in the context of hydraulic machinery, emphasizing the initial cavitation event and the role of the water quality. Chapter 2 discusses the existence of pressure fluctuations for situations common in such machinery. Chapter 3 on cavitation dynamics presents an algorithm for calculating the nucleation of a cavity cluster. Chapter 4 describes the equipment used in this work. 53 refs., 55 figs.,10 tabs.

  2. Hydraulics and pneumatics

    CERN Document Server

    Parr, Andrew

    2006-01-01

    Nearly all industrial processes require objects to be moved, manipulated or subjected to some sort of force. This is frequently accomplished by means of electrical equipment (such as motors or solenoids), or via devices driven by air (pneumatics) or liquids (hydraulics).This book has been written by a process control engineer as a guide to the operation of hydraulic and pneumatic systems for all engineers and technicians who wish to have an insight into the components and operation of such a system.This second edition has been fully updated to include all recent developments su

  3. Popeye Project: Hydraulic umbilical

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, K.G.; Williams, V.T.

    1996-12-31

    For the Popeye Project, the longest super-duplex hydraulic umbilical in the world was installed in the Gulf of Mexico. This paper reports on its selection and project implementation. Material selection addresses corrosion in seawater, water-based hydraulic fluid, and methanol. Five alternatives were considered: (1) carbon-steel with traditional coating and anodes, (2) carbon-steel coated with thermally sprayed aluminum, (3) carbon-steel sheathed in aluminum, (4) super-duplex, and (5) titanium. The merits and risks associated with each alternative are discussed. The manufacture and installation of the selected umbilical are also reported.

  4. Hydraulic Arm Modeling via Matlab SimHydraulics

    OpenAIRE

    Věchet, Stanislav; Krejsa, Jiří

    2009-01-01

    System modeling is a vital tool for cost reduction and design process speed up in most engineering fields. The paper is focused on modeling of hydraulic arm as a part of intelligent prosthesis project, in the form of 2DOF open kinematic chain. The arm model combines mechanical, hydraulic and electric subsystems and uses Matlab as modeling tool. SimMechanics Matlab extension is used for mechanical part modeling, SimHydraulics toolbox is used for modeling of hydraulic circuit used for actuating...

  5. HYDRAULICS, TUSCARAWAS COUNTY, OHIO, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydraulic data include spatial datasets and data tables necessary for documenting the hydraulic procedures for estimating flood discharges for a flood insurance...

  6. Hydraulic hoist-press

    Energy Technology Data Exchange (ETDEWEB)

    Babayev, Z.B.; Abashev, Z.V.

    1982-01-01

    The efficiency expert of the Angrenskiy production-technological administration of the production association Sredazugol A. V. Bubnov has suggested a hydraulic hoist-press for repairing road equipment which is a device consisting of lifting mechanism, press and test stand for verifying the high pressure hoses and pumps.

  7. Modelling of Hydraulic Robot

    DEFF Research Database (Denmark)

    Madsen, Henrik; Zhou, Jianjun; Hansen, Lars Henrik

    1997-01-01

    This paper describes a case study of identifying the physical model (or the grey box model) of a hydraulic test robot. The obtained model is intended to provide a basis for model-based control of the robot. The physical model is formulated in continuous time and is derived by application...

  8. Water Treatment Technology - Hydraulics.

    Science.gov (United States)

    Ross-Harrington, Melinda; Kincaid, G. David

    One of twelve water treatment technology units, this student manual on hydraulics provides instructional materials for three competencies. (The twelve units are designed for a continuing education training course for public water supply operators.) The competencies focus on the following areas: head loss in pipes in series, function loss in…

  9. Water Hydraulic Systems

    DEFF Research Database (Denmark)

    Conrad, Finn

    2005-01-01

    The paper presents research results using IT-Tools for CAD and dynamic modelling, simulation, analysis, and design of water hydraulic actuators for motion control of machines, lifts, cranes and robots. Matlab/Simulink and CATIA are used as IT-Tools. The contributions include results from on-going...

  10. Phenomenon of methane driven caused by hydraulic fracturing in methane-bearing coal seams

    Institute of Scientific and Technical Information of China (English)

    Huang Bingxiang; Cheng Qingying; Chen Shuliang

    2016-01-01

    The methane concentration of the return current will always be enhanced to a certain degree when hydraulic fracturing with bedding drilling is implemented to a gassy coal seam in an underground coal mine. The methane in coal seam is driven out by hydraulic fracturing. Thus, the phenomenon is named as methane driven effect of hydraulic fracturing. After deep-hole hydraulic fracturing at the tunneling face of the gassy coal seam, the coal methane content exhibits a‘low-high-low”distribution along exca-vation direction in the following advancing process, verifying the existence of methane driven caused by hydraulic fracturing in methane-bearing coal seam. Hydraulic fracturing causes the change of pore-water and methane pressure in surrounding coal. The uneven distribution of the pore pressure forms a pore pressure gradient. The free methane migrates from the position of high pore (methane) pressure to the position of low pore (methane) pressure. The methane pressure gradient is the fundamental driving force for methane-driven coal seam hydraulic fracturing. The uneven hydraulic crack propagation and the effect of time (as some processes need time to complete and are not completed instantaneously) will result in uneven methane driven. Therefore, an even hydraulic fracturing technique should be used to avoid the negative effects of methane driven; on the other hand, by taking fully advantage of methane driven, two technologies are presented.

  11. Hydraulic constraints modify optimal photosynthetic profiles in giant sequoia trees.

    Science.gov (United States)

    Ambrose, Anthony R; Baxter, Wendy L; Wong, Christopher S; Burgess, Stephen S O; Williams, Cameron B; Næsborg, Rikke R; Koch, George W; Dawson, Todd E

    2016-11-01

    Optimality theory states that whole-tree carbon gain is maximized when leaf N and photosynthetic capacity profiles are distributed along vertical light gradients such that the marginal gain of nitrogen investment is identical among leaves. However, observed photosynthetic N gradients in trees do not follow this prediction, and the causes for this apparent discrepancy remain uncertain. Our objective was to evaluate how hydraulic limitations potentially modify crown-level optimization in Sequoiadendron giganteum (giant sequoia) trees up to 90 m tall. Leaf water potential (Ψ l ) and branch sap flow closely followed diurnal patterns of solar radiation throughout each tree crown. Minimum leaf water potential correlated negatively with height above ground, while leaf mass per area (LMA), shoot mass per area (SMA), leaf nitrogen content (%N), and bulk leaf stable carbon isotope ratios (δ(13)C) correlated positively with height. We found no significant vertical trends in maximum leaf photosynthesis (A), stomatal conductance (g s), and intrinsic water-use efficiency (A/g s), nor in branch-averaged transpiration (E L), stomatal conductance (G S), and hydraulic conductance (K L). Adjustments in hydraulic architecture appear to partially compensate for increasing hydraulic limitations with height in giant sequoia, allowing them to sustain global maximum summer water use rates exceeding 2000 kg day(-1). However, we found that leaf N and photosynthetic capacity do not follow the vertical light gradient, supporting the hypothesis that increasing limitations on water transport capacity with height modify photosynthetic optimization in tall trees.

  12. Hydraulic manipulator research at ORNL

    Energy Technology Data Exchange (ETDEWEB)

    Kress, R.L.; Jansen, J.F. [Oak Ridge National Lab., TN (United States); Love, L.J. [Oak Ridge Inst. for Science and Education, TN (United States)

    1997-03-01

    Recently, task requirements have dictated that manipulator payload capacity increase to accommodate greater payloads, greater manipulator length, and larger environmental interaction forces. General tasks such as waste storage tank cleanup and facility dismantlement and decommissioning require manipulator life capacities in the range of hundreds of pounds rather than tens of pounds. To meet the increased payload capacities demanded by present-day tasks, manipulator designers have turned once again to hydraulics as a means of actuation. In order to successfully design, build, and deploy a new hydraulic manipulator (or subsystem), sophisticated modeling, analysis, and control experiments are usually needed. Oak Ridge National Laboratory (ORNL) has a history of projects that incorporate hydraulics technology, including mobile robots, teleoperated manipulators, and full-scale construction equipment. In addition, to support the development and deployment of new hydraulic manipulators, ORNL has outfitted a significant experimental laboratory and has developed the software capability for research into hydraulic manipulators, hydraulic actuators, hydraulic systems, modeling of hydraulic systems, and hydraulic controls. The purpose of this article is to describe the past hydraulic manipulator developments and current hydraulic manipulator research capabilities at ORNL. Included are example experimental results from ORNL`s flexible/prismatic test stand.

  13. The numerical simulation based on CFD of hydraulic turbine pump

    Science.gov (United States)

    Duan, X. H.; Kong, F. Y.; Liu, Y. Y.; Zhao, R. J.; Hu, Q. L.

    2016-05-01

    As the functions of hydraulic turbine pump including self-adjusting and compensation with each other, it is far-reaching to analyze its internal flow by the numerical simulation based on CFD, mainly including the pressure field and the velocity field in hydraulic turbine and pump.The three-dimensional models of hydraulic turbine pump are made by Pro/Engineer software;the internal flow fields in hydraulic turbine and pump are simulated numerically by CFX ANSYS software. According to the results of the numerical simulation in design condition, the pressure field and the velocity field in hydraulic turbine and pump are analyzed respectively .The findings show that the static pressure decreases systematically and the pressure gradient is obvious in flow area of hydraulic turbine; the static pressure increases gradually in pump. The flow trace is regular in suction chamber and flume without spiral trace. However, there are irregular traces in the turbine runner channels which contrary to that in flow area of impeller. Most of traces in the flow area of draft tube are spiral.

  14. Remotely Adjustable Hydraulic Pump

    Science.gov (United States)

    Kouns, H. H.; Gardner, L. D.

    1987-01-01

    Outlet pressure adjusted to match varying loads. Electrohydraulic servo has positioned sleeve in leftmost position, adjusting outlet pressure to maximum value. Sleeve in equilibrium position, with control land covering control port. For lowest pressure setting, sleeve shifted toward right by increased pressure on sleeve shoulder from servovalve. Pump used in aircraft and robots, where hydraulic actuators repeatedly turned on and off, changing pump load frequently and over wide range.

  15. Undular Hydraulic Jump

    Directory of Open Access Journals (Sweden)

    Oscar Castro-Orgaz

    2015-04-01

    Full Text Available The transition from subcritical to supercritical flow when the inflow Froude number Fo is close to unity appears in the form of steady state waves called undular hydraulic jump. The characterization of the undular hydraulic jump is complex due to the existence of a non-hydrostatic pressure distribution that invalidates the gradually-varied flow theory, and supercritical shock waves. The objective of this work is to present a mathematical model for the undular hydraulic jump obtained from an approximate integration of the Reynolds equations for turbulent flow assuming that the Reynolds number R is high. Simple analytical solutions are presented to reveal the physics of the theory, and a numerical model is used to integrate the complete equations. The limit of application of the theory is discussed using a wave breaking condition for the inception of a surface roller. The validity of the mathematical predictions is critically assessed using physical data, thereby revealing aspects on which more research is needed

  16. Hydraulic System Design of Hydraulic Actuators for Large Butterfly Valves

    OpenAIRE

    HUANG, Ye; Liu, Changsheng; Shiongur Bamed

    2014-01-01

    Hydraulic control systems of butterfly valves are presently valve-controlled and pump-controlled. Valve-controlled hydraulic systems have serious power loss and generate much heat during throttling. Pump-controlled hydraulic systems have no overflow or throttling losses but are limited in the speed adjustment of the variable-displacement pump, generate much noise, pollute the environment, and have motor power that does not match load requirements, resulting in low efficiency under...

  17. Hydraulic System Design of Hydraulic Actuators for Large Butterfly Valves

    Directory of Open Access Journals (Sweden)

    Ye HUANG

    2014-09-01

    Full Text Available Hydraulic control systems of butterfly valves are presently valve-controlled and pump-controlled. Valve-controlled hydraulic systems have serious power loss and generate much heat during throttling. Pump-controlled hydraulic systems have no overflow or throttling losses but are limited in the speed adjustment of the variable-displacement pump, generate much noise, pollute the environment, and have motor power that does not match load requirements, resulting in low efficiency under light loads and wearing of the variable-displacement pump. To overcome these shortcomings, this article designs a closed hydraulic control system in which an AC servo motor drives a quantitative pump that controls a spiral swinging hydraulic cylinder, and analyzes and calculates the structure and parameters of a spiral swinging hydraulic cylinder. The hydraulic system adjusts the servo motor’s speed according to the requirements of the control system, and the motor power matches the power provided to components, thus eliminating the throttling loss of hydraulic circuits. The system is compact, produces a large output force, provides stable transmission, has a quick response, and is suitable as a hydraulic control system of a large butterfly valve.

  18. Modelling of Hydraulic Robot

    DEFF Research Database (Denmark)

    Madsen, Henrik; Zhou, Jianjun; Hansen, Lars Henrik

    1997-01-01

    This paper describes a case study of identifying the physical model (or the grey box model) of a hydraulic test robot. The obtained model is intended to provide a basis for model-based control of the robot. The physical model is formulated in continuous time and is derived by application...... of the laws of physics on the system. The unknown (or uncertain) parameters are estimated with Maximum Likelihood (ML) parameter estimation. The identified model has been evaluated by comparing the measurements with simulation of the model. The identified model was much more capable of describing the dynamics...... of the system than the deterministic model....

  19. Hydraulic mining method

    Science.gov (United States)

    Huffman, Lester H.; Knoke, Gerald S.

    1985-08-20

    A method of hydraulically mining an underground pitched mineral vein comprising drilling a vertical borehole through the earth's lithosphere into the vein and drilling a slant borehole along the footwall of the vein to intersect the vertical borehole. Material is removed from the mineral vein by directing a high pressure water jet thereagainst. The resulting slurry of mineral fragments and water flows along the slant borehole into the lower end of the vertical borehole from where it is pumped upwardly through the vertical borehole to the surface.

  20. Spinning hydraulic jump

    Science.gov (United States)

    Abderrahmane, Hamid; Kasimov, Aslan

    2013-11-01

    We report an experimental observation of a new symmetry breaking of circular hydraulic jump into a self-organized structure that consists of a spinning polygonal jump and logarithmic-spiral waves of fluid elevation downstream. The waves are strikingly similar to spiral density waves in galaxies. The fluid flow exhibits counterparts of salient morphological features of galactic flows, in particular the outflow from the center, jets, circum-nuclear rings, gas inflows toward the galactic center, and vortices. The hydrodynamic instability revealed here may have a counterpart that plays a role in the formation and sustainability of spiral arms in galaxies.

  1. 46 CFR 28.880 - Hydraulic equipment.

    Science.gov (United States)

    2010-10-01

    ... hydraulic equipment and the adjacent work area. Protection shall be afforded to the operator of hydraulic... 46 Shipping 1 2010-10-01 2010-10-01 false Hydraulic equipment. 28.880 Section 28.880 Shipping... INDUSTRY VESSELS Aleutian Trade Act Vessels § 28.880 Hydraulic equipment. (a) Each hydraulic system must...

  2. Dependence of Segregation Potential on the Thermal and Hydraulic Conditions Predicted by Model M1

    Science.gov (United States)

    1994-04-01

    of Segregation Potential on the Thermal and Hydraulic Conditions Predicted by Model M, Yoshisuke Nakano April 1994 Rom edfor OFFICE OF THE CHIEF OF...function where i = 1, 2, 3 final ice lens k thermal conductivity of a frozen fringe 7* temperature at n, at the phase equilib- k ...hermalcoductivityoftheunfrozenpart rium of water of the soil T; average temperature gradient in R1 k , thermal conductivity of an ice layer U defined by eq 29a K0 hydraulic

  3. Applied hydraulic transients

    CERN Document Server

    Chaudhry, M Hanif

    2014-01-01

    This book covers hydraulic transients in a comprehensive and systematic manner from introduction to advanced level and presents various methods of analysis for computer solution. The field of application of the book is very broad and diverse and covers areas such as hydroelectric projects, pumped storage schemes, water-supply systems, cooling-water systems, oil pipelines and industrial piping systems. Strong emphasis is given to practical applications, including several case studies, problems of applied nature, and design criteria. This will help design engineers and introduce students to real-life projects. This book also: ·         Presents modern methods of analysis suitable for computer analysis, such as the method of characteristics, explicit and implicit finite-difference methods and matrix methods ·         Includes case studies of actual projects ·         Provides extensive and complete treatment of governed hydraulic turbines ·         Presents design charts, desi...

  4. Transport efficiency and dynamics of hydraulic fracture networks

    Science.gov (United States)

    Sachau, Till; Bons, Paul; Gomez-Rivas, Enrique

    2015-08-01

    Intermittent fluid pulses in the Earth's crust can explain a variety of geological phenomena, for instance the occurrence of hydraulic breccia. Fluid transport in the crust is usually modeled as continuous darcian flow, ignoring that sufficient fluid overpressure can cause hydraulic fractures as fluid pathways with very dynamic behavior. Resulting hydraulic fracture networks are largely self-organized: opening and healing of hydraulic fractures depends on local fluid pressure, which is, in turn, largely controlled by the fracture network. We develop a crustal-scale 2D computer model designed to simulate this process. To focus on the dynamics of the process we chose a setup as simple as possible. Control factors are constant overpressure at a basal fluid source and a constant 'viscous' parameter controlling fracture-healing. Our results indicate that at large healing rates hydraulic fractures are mobile, transporting fluid in intermittent pulses to the surface and displaying a 1/fα behavior. Low healing rates result in stable networks and constant flow. The efficiency of the fluid transport is independent from the closure dynamics of veins or fractures. More important than preexisting fracture networks is the distribution of fluid pressure. A key requirement for dynamic fracture networks is the presence of a fluid pressure gradient.

  5. Transport efficiency and dynamics of hydraulic fracture networks

    Directory of Open Access Journals (Sweden)

    Till eSachau

    2015-08-01

    Full Text Available Intermittent fluid pulses in the Earth's crust can explain a variety of geological phenomena, for instance the occurrence of hydraulic breccia. Fluid transport in the crust is usually modeled as continuous darcian flow, ignoring that sufficient fluid overpressure can cause hydraulic fractures as fluid pathways with very dynamic behavior. Resulting hydraulic fracture networks are largely self-organized: opening and healing of hydraulic fractures depends on local fluid pressure, which is, in turn, largely controlled by the fracture network. We develop a crustal-scale 2D computer model designed to simulate this process. To focus on the dynamics of the process we chose a setup as simple as possible. Control factors are constant overpressure at a basal fluid source and a constant 'viscous' parameter controlling fracture-healing. Our results indicate that at large healing rates hydraulic fractures are mobile, transporting fluid in intermittent pulses to the surface and displaying a 1/fα behavior. Low healing rates result in stable networks and constant flow. The efficiency of the fluid transport is independent from the closure dynamics of veins or fractures. More important than preexisting fracture networks is the distribution of fluid pressure. A key requirement for dynamic fracture networks is the presence of a fluid pressure gradient.

  6. Hydraulic rams; a comparative investigation

    NARCIS (Netherlands)

    Tacke, J.H.P.M.

    1988-01-01

    A mathematical model describing the essential features of hydraulic ram operation is developed in order to clarify the possibilities and limitations of the ram relative to its site and its adjustments. The model distinguishes three different periods in the pumping cycle of the hydraulic ram: acceler

  7. Hydraulics. FOS: Fundamentals of Service.

    Science.gov (United States)

    John Deere Co., Moline, IL.

    This manual on hydraulics is one of a series of power mechanics texts and visual aids for training in the servicing of agricultural and industrial machinery. Focus is on oil hydraulics. Materials provide basic information and illustrations for use by vocational students and teachers as well as shop servicemen and laymen. The twelve chapters focus…

  8. Hydraulic Stability of Accropode Armour

    DEFF Research Database (Denmark)

    Jensen, T.; Burcharth, H. F.; Frigaard, Peter

    , and to assess the influence of core permeability on the hydraulic stability of Accropodes. Two structures were examined, one with a relatively permeable core and one with a relatively impermeable core. In November/December 1995, Ph.D.-student Marten Christensen carried out the model tests on the structure...... with permeable core (crushed granite with a gradation of 5-8 mm). The outcome of this study is described in "Hydraulic Stability of Single-Layer Dolos and Accropode Armour Layers" by Christensen & Burcharth (1995). In January/February 1996, Research Assistant Thomas Jensen carried out a similar study......The present report describes the hydraulic model tests of Accropode armour layers carried out at the Hydraulics Laboratory at Aalborg University from November 1995 through March 1996. The objective of the model tests was to investigate the hydraulic stability of Accropode armour layers...

  9. Hydraulic Stability of Accropode Armour

    DEFF Research Database (Denmark)

    Jensen, T.; Burcharth, H. F.; Frigaard, Peter

    , and to assess the influence of core permeability on the hydraulic stability of Accropodes. Two structures were examined, one with a relatively permeable core and one with a relatively impermeable core. In November/December 1995, Ph.D.-student Marten Christensen carried out the model tests on the structure...... with permeable core (crushed granite with a gradation of 5-8 mm). The outcome of this study is described in "Hydraulic Stability of Single-Layer Dolos and Accropode Armour Layers" by Christensen & Burcharth (1995). In January/February 1996, Research Assistant Thomas Jensen carried out a similar study......The present report describes the hydraulic model tests of Accropode armour layers carried out at the Hydraulics Laboratory at Aalborg University from November 1995 through March 1996. The objective of the model tests was to investigate the hydraulic stability of Accropode armour layers...

  10. Combining 3D Hydraulic Tomography with Tracer Tests for Improved Transport Characterization.

    Science.gov (United States)

    Sanchez-León, E; Leven, C; Haslauer, C P; Cirpka, O A

    2016-07-01

    Hydraulic tomography (HT) is a method for resolving the spatial distribution of hydraulic parameters to some extent, but many details important for solute transport usually remain unresolved. We present a methodology to improve solute transport predictions by combining data from HT with the breakthrough curve (BTC) of a single forced-gradient tracer test. We estimated the three dimensional (3D) hydraulic-conductivity field in an alluvial aquifer by inverting tomographic pumping tests performed at the Hydrogeological Research Site Lauswiesen close to Tübingen, Germany, using a regularized pilot-point method. We compared the estimated parameter field to available profiles of hydraulic-conductivity variations from direct-push injection logging (DPIL), and validated the hydraulic-conductivity field with hydraulic-head measurements of tests not used in the inversion. After validation, spatially uniform parameters for dual-domain transport were estimated by fitting tracer data collected during a forced-gradient tracer test. The dual-domain assumption was used to parameterize effects of the unresolved heterogeneity of the aquifer and deemed necessary to fit the shape of the BTC using reasonable parameter values. The estimated hydraulic-conductivity field and transport parameters were subsequently used to successfully predict a second independent tracer test. Our work provides an efficient and practical approach to predict solute transport in heterogeneous aquifers without performing elaborate field tracer tests with a tomographic layout.

  11. A quantitative analysis of hydraulic interaction processes in stream-aquifer systems.

    Science.gov (United States)

    Wang, Wenke; Dai, Zhenxue; Zhao, Yaqian; Li, Junting; Duan, Lei; Wang, Zhoufeng; Zhu, Lin

    2016-01-28

    The hydraulic relationship between the stream and aquifer can be altered from hydraulic connection to disconnection when the pumping rate exceeds the maximum seepage flux of the streambed. This study proposes to quantitatively analyze the physical processes of stream-aquifer systems from connection to disconnection. A free water table equation is adopted to clarify under what conditions a stream starts to separate hydraulically from an aquifer. Both the theoretical analysis and laboratory tests have demonstrated that the hydraulic connectedness of the stream-aquifer system can reach a critical disconnection state when the horizontal hydraulic gradient at the free water surface is equal to zero and the vertical is equal to 1. A boundary-value problem for movement of the critical point of disconnection is established for an analytical solution of the inverted water table movement beneath the stream. The result indicates that the maximum distance or thickness of the inverted water table is equal to the water depth in the stream, and at a steady state of disconnection, the maximum hydraulic gradient at the streambed center is 2. This study helps us to understand the hydraulic phenomena of water flow near streams and accurately assess surface water and groundwater resources.

  12. Hydraulic Yaw System

    DEFF Research Database (Denmark)

    Stubkier, Søren; Pedersen, Henrik C.; Mørkholt, M.

    As wind turbines increase in size, combined with increased lifetime demands, new methods for load reduction needs to be examined. One method is to make the yaw system of the turbine soft/flexible and hereby dampen the loads to the system, which is the focus of the current paper. By utilizing...... the HAWC2 aeroelastic code and an extended model of the NREL 5MW turbine combined with a simplified linear model of the turbine, the parameters of the soft yaw system are optimized to reduce loading in critical components. Results shows that a significant reduction in fatigue and extreme loads to the yaw...... system and rotor shaft when utilizing the soft yaw drive concept compared to the original stiff yaw system. The physical demands of the hydraulic yaw system are furthermore examined for a life time of 20 years. Based on the extrapolated loads, the duty cycles show that it is possible to construct...

  13. Electro Hydraulic Hitch Control

    DEFF Research Database (Denmark)

    Hansen, M. R.; Andersen, T. O.; Nielsen, B.

    2003-01-01

    system for agricultural applications and driving for transportation. During tranport phases, the lack of suspension causes the vehicle to bounce and pitch, and makes it difficalt to control. Many systems have been proposed to cope with the oscillatory behavior, and different solutions exist. Common......This paper present and discusses R&D results on electro hydraulic hitch control for off-road vehicle, in particular active damping of oscillation occuring on tractors. The research deals with analysis and control of the oscillations occuring on tractors which are design without any susspection...... for most of the systems are that they operate on the hydrailc actuators generally providing the motive forces for moving the implement and/or attachment, typically a plough. The basic idea and physical working principle are to use the implement, moveable relative to the vehicle, as a damper mass. The paper...

  14. Hydraulic conductivity of compacted zeolites.

    Science.gov (United States)

    Oren, A Hakan; Ozdamar, Tuğçe

    2013-06-01

    Hydraulic conductivities of compacted zeolites were investigated as a function of compaction water content and zeolite particle size. Initially, the compaction characteristics of zeolites were determined. The compaction test results showed that maximum dry unit weight (γ(dmax)) of fine zeolite was greater than that of granular zeolites. The γ(dmax) of compacted zeolites was between 1.01 and 1.17 Mg m(-3) and optimum water content (w(opt)) was between 38% and 53%. Regardless of zeolite particle size, compacted zeolites had low γ(dmax) and high w(opt) when compared with compacted natural soils. Then, hydraulic conductivity tests were run on compacted zeolites. The hydraulic conductivity values were within the range of 2.0 × 10(-3) cm s(-1) to 1.1 × 10(-7) cm s(-1). Hydraulic conductivity of all compacted zeolites decreased almost 50 times as the water content increased. It is noteworthy that hydraulic conductivity of compacted zeolite was strongly dependent on the zeolite particle size. The hydraulic conductivity decreased almost three orders of magnitude up to 39% fine content; then, it remained almost unchanged beyond 39%. Only one report was found in the literature on the hydraulic conductivity of compacted zeolite, which is in agreement with the findings of this study.

  15. Hydraulic Actuators with Autonomous Hydraulic Supply for the Mainline Aircrafts

    Directory of Open Access Journals (Sweden)

    I. S. Shumilov

    2014-01-01

    Full Text Available Applied in the aircraft control systems, hydraulic servo actuators with autonomous hydraulic supply, so-called, hydraulic actuators of integrated configuration, i.e. combination of a source of hydraulic power and its load in the single unit, are aimed at increasing control system reliability both owing to elimination of the pipelines connecting the actuator to the hydraulic supply source, and owing to avoidance of influence of other loads failure on the actuator operability. Their purpose is also to raise control system survivability by eliminating the long pipeline communications and their replacing for the electro-conductive power supply system, thus reducing the vulnerability of systems. The main reason for a delayed application of the hydraulic actuators in the cutting-edge aircrafts was that such aircrafts require hydraulic actuators of considerably higher power with considerable heat releases, which caused an unacceptable overheat of the hydraulic actuators. Positive and negative sides of the hydraulic actuators, their alternative options of increased reliability and survivability, local hydraulic systems as an advanced alternative to independent hydraulic actuators are considered.Now to use hydraulic actuators in mainline aircrafts is inexpedient since there are the unfairly large number of the problems reducing, first and last, safety of flights, with no essential weight and operational advantages. Still works to create competitive hydraulic actuators ought to be continued.Application of local hydraulic systems (LHS will allow us to reduce length of pressure head and drain pipelines and mass of pipelines, as well as to raise their general fail-safety and survivability. Application of the LHS principle will allow us to use a majority of steering drive advantages. It is necessary to allocate especially the following:- ease of meeting requirements for the non-local spread of the engine weight;- essentially reducing length and weight of

  16. Hydraulic conductivity of organomodified soil

    Energy Technology Data Exchange (ETDEWEB)

    Wallace, R.B.; Grant, J.M.; Voice, T.C.; Rakhshandehroo, G.; Xu, S.; Boyd, S.A. [Michigan State Univ., East Lansing, MI (United States)

    1995-11-01

    The effects of organomodification on soil hydraulic conductivity were investigated. Hydraulic conductivity and porosity of treated and untreated samples of a sandy loam were measured as a function of effective stress. Batch treatment with hexadecyltrimethyl ammonium (HDTMA) and dry packing produced organomodified samples that were 79% less conducive than untreated samples prior to loading. Treated samples lost less hydraulic conductivity as a result of loading than untreated samples so that treated samples had higher conductivity at high loads. Observed differences in conductivity are explained in terms of the role of the treated and untreated clay in controlling initial effective pore size and its change during consolidation.

  17. Effects of hydraulic pressure on the performance of single chamber air-cathode microbial fuel cells.

    Science.gov (United States)

    Cheng, Shaoan; Liu, Weifeng; Guo, Jian; Sun, Dan; Pan, Bin; Ye, Yaoli; Ding, Weijun; Huang, Haobin; Li, Fujian

    2014-06-15

    Scaling up of microbial fuel cells (MFCs) without losing power density requires a thorough understanding of the effect of hydraulic pressure on MFC performance. In this work, the performance of an activated carbon air-cathode MFC was evaluated under different hydraulic pressures. The MFC under 100 mmH2O hydraulic pressure produced a maximum power density of 1260 ± 24 mW m(-2), while the power density decreased by 24.4% and 44.7% as the hydraulic pressure increased to 500 mmH2O and 2000 mmH2O, respectively. Notably, the performance of both the anode and the cathode had decreased under high hydraulic pressures. Electrochemical impedance spectroscopy tests of the cathode indicated that both charge transfer resistance and diffusion transfer resistance increased with the increase in hydraulic pressure. Denaturing gradient gel electrophoresis of PCR-amplified partial 16S rRNA genes demonstrated that the similarity among anodic biofilm communities under different hydraulic pressures was ≥ 90%, and the communities of all MFCs were dominated by Geobacter sp. These results suggested that the reduction in power output of the single chamber air-cathode MFC under high hydraulic pressures can be attributed to water flooding of the cathode and suppression the metabolism of anodic exoelectrogenic bacteria.

  18. HYDRAULICS, ATHENS COUNTY, OHIO, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydraulic data include spatial datasets and data tables necessary for documenting the hydrologic procedures for estimating flood discharges for a flood insurance...

  19. HYDRAULICS, JACKSON COUNTY, KENTUCKY, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydraulic data include spatial datasets and data tables necessary for documenting the hydrologic procedures for estimating flood discharges for a flood insurance...

  20. HYDRAULICS, MADISON COUNTY, ALABAMA, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — This Hydraulic data was reviewed and approved by FEMA during the initial MT-2 processing. Recent developments in digital terrain and geospatial database management...

  1. HYDRAULICS, HAMPDEN COUNTY, MA, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydraulic data in this submittal include spatial datasets and model outputs necessary for computation of the 1-percent flooding extent. The minimum requirement for...

  2. Hydraulic wind energy conversion system

    Energy Technology Data Exchange (ETDEWEB)

    1981-07-01

    The purpose of this research was to design, build and test a hydraulic wind energy system. This design used a three bladed turbine, which drove a hydraulic pump. The energy is transmitted from the pump through a long hose and into a hydraulic motor, where the energy is used. This wind system was built and tested during the winter of 1980-1981. The power train included a five meter, three bladed wind turbine, a 9.8:1 ratio gearbox, a 1.44 cubic inch displacement pump with a small supercharge gear pump attached. The hydraulic fluid was pumped through a 70', 3/4'' I-D-high pressure flexhose, then through a volume control valve and into a 1.44 cubic inch displacement motor. The fluid was returned through a 70', 1'' I-D-flexhose.

  3. 14 CFR 29.1435 - Hydraulic systems.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hydraulic systems. 29.1435 Section 29.1435... STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Equipment Miscellaneous Equipment § 29.1435 Hydraulic systems. (a) Design. Each hydraulic system must be designed as follows: (1) Each element of the hydraulic system...

  4. 14 CFR 23.1435 - Hydraulic systems.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hydraulic systems. 23.1435 Section 23.1435... § 23.1435 Hydraulic systems. (a) Design. Each hydraulic system must be designed as follows: (1) Each hydraulic system and its elements must withstand, without yielding, the structural loads expected...

  5. 46 CFR 28.405 - Hydraulic equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Hydraulic equipment. 28.405 Section 28.405 Shipping... Operate With More Than 16 Individuals on Board § 28.405 Hydraulic equipment. (a) Each hydraulic system... than four times the system maximum operating pressure. (c) Each hydraulic system must be equipped...

  6. Advanced Performance Hydraulic Wind Energy

    Science.gov (United States)

    Jones, Jack A.; Bruce, Allan; Lam, Adrienne S.

    2013-01-01

    The Jet Propulsion Laboratory, California Institute of Technology, has developed a novel advanced hydraulic wind energy design, which has up to 23% performance improvement over conventional wind turbine and conventional hydraulic wind energy systems with 5 m/sec winds. It also has significant cost advantages with levelized costs equal to coal (after carbon tax rebate). The design is equally applicable to tidal energy systems and has passed preliminary laboratory proof-of-performance tests, as funded by the Department of Energy.

  7. Technologies and Innovations for Hydraulic Pumps

    OpenAIRE

    Ivantysynova, Monika

    2016-01-01

    Positive displacement machines working as hydraulic pumps or hydraulic motors have always been, are and will be an essential part of any hydraulic system. Current trends and future demands on energy efficient systems will not only drastically increase the number of positive displacement machines needed for modern efficient hydraulic circuits but will significantly change the performance requirements of pumps and motors. Throttleless system configurations will change the landscape of hydraulic...

  8. On the application of reynolds theory to thermo-piezo-viscous lubrication in oil hydraulics

    DEFF Research Database (Denmark)

    Johansen, Per; Roemer, Daniel Beck; Andersen, Torben O.

    2015-01-01

    . In this paper the derivation of Reynolds equation from the continuum assumption is reviewed and it is shown that the validity of Reynolds theory based pressure field solutions in oil hydraulic thermo-piezo-viscous lubrication models are subject to maximum bounds on the pressure and temperature field gradients...

  9. Gradients are shaping up.

    Science.gov (United States)

    Bollenbach, Tobias; Heisenberg, Carl-Philipp

    2015-04-23

    In animal embryos, morphogen gradients determine tissue patterning and morphogenesis. Shyer et al. provide evidence that, during vertebrate gut formation, tissue folding generates graded activity of signals required for subsequent steps of gut growth and differentiation, thereby revealing an intriguing link between tissue morphogenesis and morphogen gradient formation.

  10. Controlling a negative loaded hydraulic cylinder using pressure feedback

    DEFF Research Database (Denmark)

    Hansen, M.R.; Andersen, T.O.

    2010-01-01

    the high pass filtered pressure gradient equal tozero is introduced. It yields lead compensation with a markedly improved performance. The sizing of the filter is described taking into account the bandwidth of the directional control valve. The suggested control scheme is implemented and examined......This paper is concerned with the inherent oscillatory nature of pressure compensated velocity control of a hydraulic cylinder subjected to a negative load and suspended by means of an over-center valve. Initially, a linearized stability analysis of such a hydraulic circuit is carried out clearly...... showing that without extra measures such a system will be unstable in a substantial part of the cylinder stroke. The stability criterion is expressed in hard quantities: Cylinder volumes, cylinder area ratio and overcenter valve pilot area ratio. A pressure feed back scheme that has as target to maintain...

  11. Fast Distributed Gradient Methods

    CERN Document Server

    Jakovetic, Dusan; Moura, Jose M F

    2011-01-01

    The paper proposes new fast distributed optimization gradient methods and proves convergence to the exact solution at rate O(\\log k/k), much faster than existing distributed optimization (sub)gradient methods with convergence O(1/\\sqrt{k}), while incurring practically no additional communication nor computation cost overhead per iteration. We achieve this for convex (with at least one strongly convex,) coercive, three times differentiable and with Lipschitz continuous first derivative (private) cost functions. Our work recovers for distributed optimization similar convergence rate gains obtained by centralized Nesterov gradient and fast iterative shrinkage-thresholding algorithm (FISTA) methods over ordinary centralized gradient methods. We also present a constant step size distributed fast gradient algorithm for composite non-differentiable costs. A simulation illustrates the effectiveness of our distributed methods.

  12. Experimental investigation of the dielectric properties of soil under hydraulic loading

    Science.gov (United States)

    Bittner, Tilman; Bore, Thierry; Wagner, Norman; Karlovšek, Jurij; Scheuermann, Alexander

    2017-04-01

    An experimental set-up was developed in order to determine the coupled hydraulic, dielectric and mechanical properties of granular media under hydraulic loading. The set-up consisted of a modified column for permeability tests involving a flow meter and pressure transducers along the sample to quantify the hydraulic gradient. A newly developed open-ended coaxial probe allowed the measurement of the frequency dependent dielectric permittivity of the material under test. The shear strength of the sample within the column was measured using a conventional vane shear device. In this paper, the overall set-up is introduced with focus on the open-ended coaxial probe. The design and calibration of the probe are introduced in detail. A numerical study showed that the sensitive cylindrical volume of the probe was approximately 150 mm in diameter with a depth of 65 mm. An investigation with glass beads showed that the set-up allowed the parameterization of the hydraulic, mechanic and dielectric parameters of granular materials under the influence of vertical flow. A satisfactorily good correlation between porosity and the real part of the dielectric permittivity was detected. The critical hydraulic gradient defining the transition of a fixed bed of particles to fluidization was characterized by a sharp peak in the evolution of the hydraulic conductivity and could easily be determined from the measurements. The shear strength of the material under test reduces linearly with increasing hydraulic gradient. Future investigations will be carried out to provide the required parameterizations for experimental and numerical investigations of the internal erosion of granular media.

  13. Comparison of Laboratory and Field Methods for Determining the Quasi-Saturated Hydraulic Conductivity of Soils

    Energy Technology Data Exchange (ETDEWEB)

    Faybishenko, Boris

    1997-08-01

    Laboratory and field ponded infiltration tests in quasi-saturated soils (containing entrapped air) exhibit the same three-stage temporal variability for the flow rate and hydraulic conductivity. However, the values for the hydraulic conductivity may differ by as much as two orders of magnitude due to differences in the geometry and physics of flow when different laboratory and field methods are applied. The purpose of this paper is to investigate this variability using a comparison of results of ponded infiltration tests conducted under laboratory conditions using confined cores, with results of field tests conducted using partially isolated cores and double-ring infiltrometers. Under laboratory conditions in confined cores, during the firs stage, the water flux decreases over time because entrapped air plugs the largest pores in the soils; during the second stage, the quasi-saturated hydraulic conductivity increases by one to two orders of magnitude, essentially reaching the saturated hydraulic conductivity, when entrapped air is discharged from the soils; during the third stage, the hydraulic conductivity decreases to minimum values due to sealing of the soil surface and the effect of biofilms sealing the pores within the wetted zone. Under field conditions, the second stage is only partially developed, and when the surface sealing process begins, the hydraulic pressure drops below the air entry value, thereby causing atmospheric air to enter the soils. As a result, the soils become unsaturated with a low hydraulic conductivity, and the infiltration rate consequently decreases. Contrary to the laboratory experiments in confined cores, the saturated hydraulic conductivity cannot be reached under field conditions. In computations of infiltration one has to take into account the variations in the quasi-saturated and unsaturated hydraulic conductivities, moisture and entrapped air content, and the hydraulic gradient in the quasi-saturated or unsaturated soils.

  14. Complex Fluids and Hydraulic Fracturing.

    Science.gov (United States)

    Barbati, Alexander C; Desroches, Jean; Robisson, Agathe; McKinley, Gareth H

    2016-06-07

    Nearly 70 years old, hydraulic fracturing is a core technique for stimulating hydrocarbon production in a majority of oil and gas reservoirs. Complex fluids are implemented in nearly every step of the fracturing process, most significantly to generate and sustain fractures and transport and distribute proppant particles during and following fluid injection. An extremely wide range of complex fluids are used: naturally occurring polysaccharide and synthetic polymer solutions, aqueous physical and chemical gels, organic gels, micellar surfactant solutions, emulsions, and foams. These fluids are loaded over a wide range of concentrations with particles of varying sizes and aspect ratios and are subjected to extreme mechanical and environmental conditions. We describe the settings of hydraulic fracturing (framed by geology), fracturing mechanics and physics, and the critical role that non-Newtonian fluid dynamics and complex fluids play in the hydraulic fracturing process.

  15. Hydraulic properties of ladle slags

    Directory of Open Access Journals (Sweden)

    J. Vlček

    2016-07-01

    Full Text Available The article presents results of examining of hydraulic properties of ladle slags formed during production of steel. The studied ladle slags were subjected to different cooling mode from the molten state. Based on the ability of the slag react with the water was assessed their hydraulic activity. The hydraulic properties are caused by the presence of minerals dicalcium silicate, tricalcium aluminate, mayenite, brownmillerite and dicalcium ferite. The emergence of required hydrating phases in the ladle slags is conditioned by a sufficient CaO content and their cooling rate. The contact the slag with water during processing and their ageing has a negative effect. The experiment has shown that the phase transformation of the mineral dicalcium silicate which occurs during cooling of the ladle slags cause their volume instability.

  16. RILL EROSION PROCESS AND RILL FLOW HYDRAULIC PARAMETERS

    Institute of Scientific and Technical Information of China (English)

    Fen-li ZHENG; Pei-qing XIAO; Xue-tian GAO

    2004-01-01

    In the rill erosion process,run-on water and sediment from upslope areas,and rill flow hydraulic parameters have significant effects on sediment detachment and transport.However,there is a lack of data to quantify the effects of run-on water and sediment and rill flow hydraulic parameters on rill erosion process at steep hillslopes,especially in the Loess Plateau of China.A dual-box system,consisting of a 2-m-long feeder box and a 5-m-long test box with 26.8% slope gradient was used to quantify the effects of upslope runoff and sediment,and of rill flow hydraulic parameters on the rill erosion process.The results showed that detachment-transport was dominated in rill erosion processes; upslope runoff always caused the net rill detachment at the downslope rill flow channel,and the net rill detachment caused by upslope runoff increased with a decrease of runoff sediment concentration from the feeder box or an increase of rainfall intensity.Upslope runoff discharging into the rill flow channel or an increase of rainfall intensity caused the rill flow to shift from a stratum flow into a turbulent flow.Upslope runoff had an important effect on rill flow hydraulic parameters,such as rill flow velocity,hydraulic radius,Reynolds number,Froude number and the Darcy-Weisbach resistance coefficient.The net rill detachment caused by upslope runoff increased as the relative increments of rill flow velocity,Reynolds number and Froude number caused by upslope runoff increased.In contrast,the net rill detachment decreased with an increase of the relative decrement of the Darcy-Weisbach resistance coefficient caused by upslope runoff.These findings will help to improve the understanding of the effects of run-on water and sediment on the erosion process and to find control strategies to minimize the impact of run-on water.

  17. Hydraulic resistance of biofilms

    KAUST Repository

    Dreszer, C.

    2013-02-01

    Biofilms may interfere with membrane performance in at least three ways: (i) increase of the transmembrane pressure drop, (ii) increase of feed channel (feed-concentrate) pressure drop, and (iii) increase of transmembrane passage. Given the relevance of biofouling, it is surprising how few data exist about the hydraulic resistance of biofilms that may affect the transmembrane pressure drop and membrane passage. In this study, biofilms were generated in a lab scale cross flow microfiltration system at two fluxes (20 and 100Lm-2h-1) and constant cross flow (0.1ms-1). As a nutrient source, acetate was added (1.0mgL-1 acetate C) besides a control without nutrient supply. A microfiltration (MF) membrane was chosen because the MF membrane resistance is very low compared to the expected biofilm resistance and, thus, biofilm resistance can be determined accurately. Transmembrane pressure drop was monitored. As biofilm parameters, thickness, total cell number, TOC, and extracellular polymeric substances (EPS) were determined, it was demonstrated that no internal membrane fouling occurred and that the fouling layer actually consisted of a grown biofilm and was not a filter cake of accumulated bacterial cells. At 20Lm-2h-1 flux with a nutrient dosage of 1mgL-1 acetate C, the resistance after 4 days reached a value of 6×1012m-1. At 100Lm-2h-1 flux under the same conditions, the resistance was 5×1013m-1. No correlation of biofilm resistance to biofilm thickness was found; Biofilms with similar thickness could have different resistance depending on the applied flux. The cell number in biofilms was between 4×107 and 5×108 cellscm-2. At this number, bacterial cells make up less than a half percent of the overall biofilm volume and therefore did not hamper the water flow through the biofilm significantly. A flux of 100Lm-2h-1 with nutrient supply caused higher cell numbers, more biomass, and higher biofilm resistance than a flux of 20Lm-2h-1. However, the biofilm thickness

  18. Controls of Hydraulic Wind Turbine

    Directory of Open Access Journals (Sweden)

    Zhang Yin

    2016-01-01

    Full Text Available In this paper a hydraulic wind turbine generator system was proposed based on analysis the current wind turbines technologies. The construction and principles were introduced. The mathematical model was verified using MATLAB and AMsim. A displacement closed loop of swash plate of motor and a speed closed loop of generator were setup, a PID control is introduced to maintain a constant speed and fixed frequency at wind turbine generator. Simulation and experiment demonstrated that the system can connect grid to generate electric and enhance reliability. The control system demonstrates a high performance speed regulation and effectiveness. The results are great significant to design a new type hydraulic wind turbine system.

  19. Laser textured surface gradients

    Science.gov (United States)

    Ta, Van Duong; Dunn, Andrew; Wasley, Thomas J.; Li, Ji; Kay, Robert W.; Stringer, Jonathan; Smith, Patrick J.; Esenturk, Emre; Connaughton, Colm; Shephard, Jonathan D.

    2016-05-01

    This work demonstrates a novel technique for fabricating surfaces with roughness and wettability gradients and their subsequent applications for chemical sensors. Surface roughness gradients on brass sheets are obtained directly by nanosecond laser texturing. When these structured surfaces are exposed to air, their wettability decreases with time (up to 20 days) achieving both spatial and temporal wettability gradients. The surfaces are responsive to organic solvents. Contact angles of a series of dilute isopropanol solutions decay exponentially with concentration. In particular, a fall of 132° in contact angle is observed on a surface gradient, one order of magnitude higher than the 14° observed for the unprocessed surface, when the isopropanol concentration increased from 0 to 15.6 wt%. As the wettability changes gradually over the surface, contact angle also changes correspondingly. This effect offers multi-sensitivity at different zones on the surface and is useful for accurate measurement of chemical concentration.

  20. Second gradient poromechanics

    CERN Document Server

    Sciarra, Giulio; Coussy, Olivier

    2010-01-01

    Second gradient theories have been developed in mechanics for treating different phenomena as capillarity in fluids, plasticity and friction in granular materials or shear band deformations. Here, there is an attempt of formulating a second gradient Biot like model for porous materials. In particular the interest is focused in describing the local dilatant behaviour of a porous material induced by pore opening elastic and capillary interaction phenomena among neighbouring pores and related micro-filtration phenomena by means of a continuum microstructured model. The main idea is to extend the classical macroscopic Biot model by including in the description second gradient effects. This is done by assuming that the surface contribution to the external work rate functional depends on the normal derivative of the velocity or equivalently assuming that the strain work rate functional depends on the porosity and strain gradients. According to classical thermodynamics suitable restrictions for stresses and second g...

  1. Integrating hydraulic equivalent sections into a hydraulic geometry study

    Science.gov (United States)

    Jia, Yanhong; Yi, Yujun; Li, Zhiwei; Wang, Zhaoyin; Zheng, Xiangmin

    2017-09-01

    Hydraulic geometry (HG) is an important geomorphic concept that has played an indispensable role in hydrological analyses, physical studies of streams, ecosystem and aquatic habitat studies, and sedimentology research. More than 60 years after Leopold and Maddock (1953) first introduced the concept of HG, researchers have still not uncovered the physical principles underlying HG behavior. One impediment is the complexity of the natural river cross section. The current study presents a new way to simplify the cross section, namely, the hydraulic equivalent section, which is generalized from the cross section in the ;gradually varied flow of an alluvial river; (GVFAR) and features hydrodynamic properties and bed-building laws similar to those of the GVFAR. Energy balance was used to derive the stage Z-discharge Q relationship in the GVFAR. The GVFAR in the Songhua River and the Yangtze River were selected as examples. The data, including measured discharge, river width, water stage, water depth, wet area, and cross section, were collected from the hydrological yearbooks of typical hydrological stations on the Songhua River and the Yangtze River from 1955 to 1987. The relationships between stage Z-discharge Q and cross-sectional area A-stage Z at various stations were analyzed, and ;at-a-station hydraulic geometry; (AHG) relationships were obtained in power-law forms. Based on derived results and observational data analysis, the Z-Q and Z-A relationships of AHG were similar to rectangular weir flows, thus the cross section of the GVFAR was generalized as a compound rectangular, hydraulic equivalent cross section. As to bed-building characteristics, the bankfull discharge method and the stage-discharge-relation method were used to calculate the dominant variables of the alluvial river. This hydraulic equivalent section has the same Z-Q relation, Z-A relation, dominant discharge, dominant river width, and dominant water depth as the cross section in the GVFAR. With the

  2. CRITICALITY CURVES FOR PLUTONIUM HYDRAULIC FLUID MIXTURES

    Energy Technology Data Exchange (ETDEWEB)

    WITTEKIND WD

    2007-10-03

    This Calculation Note performs and documents MCNP criticality calculations for plutonium (100% {sup 239}Pu) hydraulic fluid mixtures. Spherical geometry was used for these generalized criticality safety calculations and three geometries of neutron reflection are: {sm_bullet}bare, {sm_bullet}1 inch of hydraulic fluid, or {sm_bullet}12 inches of hydraulic fluid. This document shows the critical volume and critical mass for various concentrations of plutonium in hydraulic fluid. Between 1 and 2 gallons of hydraulic fluid were discovered in the bottom of HA-23S. This HA-23S hydraulic fluid was reported by engineering to be Fyrquel 220. The hydraulic fluid in GLovebox HA-23S is Fyrquel 220 which contains phosphorus. Critical spherical geometry in air is calculated with 0 in., 1 in., or 12 inches hydraulic fluid reflection.

  3. DCS Hydraulics Submittal, Butler County, Alabama, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydraulics data includes spatial datasets and data tables necessary for documenting the hydraulic procedures for computing flood elevations for a flood insurance...

  4. DCS Hydraulics Submittal, Bullock County, Alabama, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydraulics data includes spatial datasets and data tables necessary for documenting the hydraulic procedures for computing flood elevations for a flood insurance...

  5. DCS Hydraulics Submittal, Covington County, Alabama, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydraulics data includes spatial datasets and data tables necessary for documenting the hydraulic procedures for computing flood elevations for a flood insurance...

  6. High Pressure Hydraulic Distribution System

    Science.gov (United States)

    1991-05-20

    to 500 0 F. 5 cycles. 5000 F room temperature to 50001F; 45 ______________ Icycles The tesis planned for the distribution system demonstrator were...American Society for Testing and Materials ASTM D412 - Tension Testing of Vulcanized Rubber ASTM D571 - Testing Automotive Hydraulic Brake Hose Society of

  7. Hydraulic fracturing system and method

    Energy Technology Data Exchange (ETDEWEB)

    Ciezobka, Jordan; Salehi, Iraj

    2017-02-28

    A hydraulic fracturing system and method for enhancing effective permeability of earth formations to increase hydrocarbon production, enhance operation efficiency by reducing fluid entry friction due to tortuosity and perforation, and to open perforations that are either unopened or not effective using traditional techniques, by varying a pump rate and/or a flow rate to a wellbore.

  8. Hydraulic jumps in a channel

    DEFF Research Database (Denmark)

    Bonn, D.; Andersen, Anders Peter; Bohr, Tomas

    2009-01-01

    We present a study of hydraulic jumps with flow predominantly in one direction, created either by confining the flow to a narrow channel with parallel walls or by providing an inflow in the form of a narrow sheet. In the channel flow, we find a linear height profile upstream of the jump as expected...

  9. Hydraulic Fracture Containment in Sand

    NARCIS (Netherlands)

    Dong, Y.

    2010-01-01

    The mechanism of hydraulic fracturing in soft, high permeability material is considered fundamentally different from that in hard, low permeability rock, where a tensile fracture is created and conventional linear elastic fracture mechanics (LEFM) applies. The fracturing and associated modeling work

  10. Design of hydraulic recuperation unit

    Directory of Open Access Journals (Sweden)

    Jandourek Pavel

    2016-01-01

    Full Text Available This article deals with design and measurement of hydraulic recuperation unit. Recuperation unit consist of radial turbine and axial pump, which are coupled on the same shaft. Speed of shaft with impellers are 6000 1/min. For economic reasons, is design of recuperation unit performed using commercially manufactured propellers.

  11. Tree Hydraulics: How Sap Rises

    Science.gov (United States)

    Denny, Mark

    2012-01-01

    Trees transport water from roots to crown--a height that can exceed 100 m. The physics of tree hydraulics can be conveyed with simple fluid dynamics based upon the Hagen-Poiseuille equation and Murray's law. Here the conduit structure is modelled as conical pipes and as branching pipes. The force required to lift sap is generated mostly by…

  12. Tree Hydraulics: How Sap Rises

    Science.gov (United States)

    Denny, Mark

    2012-01-01

    Trees transport water from roots to crown--a height that can exceed 100 m. The physics of tree hydraulics can be conveyed with simple fluid dynamics based upon the Hagen-Poiseuille equation and Murray's law. Here the conduit structure is modelled as conical pipes and as branching pipes. The force required to lift sap is generated mostly by…

  13. A new linear type hydraulic motor

    Science.gov (United States)

    Jiang, Dong; Zhang, Tong; Li, Wenhua; Chen, Xinyang

    2017-08-01

    This paper proposes the design of liner type hydraulic motor on the base of inner curved radial piston hydraulic motor. The hydraulic cylinders of the new type motor are in the straight line which will improve the utilization of the axial space and different out power can be supplied by changes the number of cylinders. In this paper, the structure and working principle of the liner type hydraulic motor is introduced.

  14. Hydraulic characterization of " Furcraea andina

    Science.gov (United States)

    Rivera-Velasquez, M. F.; Fallico, C.; Molinari, A.; Santillan, P.; Salazar, M.

    2012-04-01

    The present level of pollution, increasingly involving groundwaters, constitutes a serious risk for environment and human health. Therefore the remediation of saturated and unsaturated soils, removing pollutant materials through innovative and economic bio-remediation techniques is more frequently required. Recent studies on natural fiber development have shown the effectiveness of these fibers for removal of some heavy metals, due to the lignin content in the natural fibers which plays an important role in the adsorption of metal cations (Lee et al., 2004; Troisi et al., 2008; C. Fallico, 2010). In the context of remediation techniques for unsaturated and/or saturated zone, an experimental approach for the hydraulic characterization of the "Furcraea andina" (i.e., Cabuya Blanca) fiber was carried out. This fiber is native to Andean regions and grows easily in wild or cultivated form in the valleys and hillsides of Colombia, Ecuador, and Peru. Fibers of "Furcraea andina" were characterized by experimental tests to determine their hydraulic conductivity or permeability and porosity in order to use this medium for bioremediation of contaminated aquifer exploiting the physical, chemical and microbial capacity of natural fiber in heavy metal adsorption. To evaluate empirically the hydraulic conductivity, laboratory tests were carried out at constant head specifically on the fibers manually extracted. For these tests we used a flow cell (used as permeameter), containing the "Furcraea andina" fibers to be characterized, suitably connected by a tygon pipe to a Marriott's bottle, which had a plastic tube that allow the adjustment of the hydraulic head for different tests to a constant value. By this experiment it was also possible to identify relationships that enable the estimation of permeability as a function of density, i.e. of the compaction degree of the fibers. Our study was carried out for three values of hydraulic head (H), namely 10, 18, and 25 cm and for each

  15. 14 CFR 25.1435 - Hydraulic systems.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hydraulic systems. 25.1435 Section 25.1435... STANDARDS: TRANSPORT CATEGORY AIRPLANES Equipment Miscellaneous Equipment § 25.1435 Hydraulic systems. (a) Element design. Each element of the hydraulic system must be designed to: (1) Withstand the proof...

  16. 14 CFR 27.1435 - Hydraulic systems.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hydraulic systems. 27.1435 Section 27.1435... STANDARDS: NORMAL CATEGORY ROTORCRAFT Equipment Safety Equipment § 27.1435 Hydraulic systems. (a) Design. Each hydraulic system and its elements must withstand, without yielding, any structural loads...

  17. High Gradient Accelerator Research

    Energy Technology Data Exchange (ETDEWEB)

    Temkin, Richard [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States). Dept. of Physics. Plasma Science and Fusion Center

    2016-07-12

    The goal of the MIT program of research on high gradient acceleration is the development of advanced acceleration concepts that lead to a practical and affordable next generation linear collider at the TeV energy level. Other applications, which are more near-term, include accelerators for materials processing; medicine; defense; mining; security; and inspection. The specific goals of the MIT program are: • Pioneering theoretical research on advanced structures for high gradient acceleration, including photonic structures and metamaterial structures; evaluation of the wakefields in these advanced structures • Experimental research to demonstrate the properties of advanced structures both in low-power microwave cold test and high-power, high-gradient test at megawatt power levels • Experimental research on microwave breakdown at high gradient including studies of breakdown phenomena induced by RF electric fields and RF magnetic fields; development of new diagnostics of the breakdown process • Theoretical research on the physics and engineering features of RF vacuum breakdown • Maintaining and improving the Haimson / MIT 17 GHz accelerator, the highest frequency operational accelerator in the world, a unique facility for accelerator research • Providing the Haimson / MIT 17 GHz accelerator facility as a facility for outside users • Active participation in the US DOE program of High Gradient Collaboration, including joint work with SLAC and with Los Alamos National Laboratory; participation of MIT students in research at the national laboratories • Training the next generation of Ph. D. students in the field of accelerator physics.

  18. Modeling soil detachment capacity by rill flow using hydraulic parameters

    Science.gov (United States)

    Wang, Dongdong; Wang, Zhanli; Shen, Nan; Chen, Hao

    2016-04-01

    The relationship between soil detachment capacity (Dc) by rill flow and hydraulic parameters (e.g., flow velocity, shear stress, unit stream power, stream power, and unit energy) at low flow rates is investigated to establish an accurate experimental model. Experiments are conducted using a 4 × 0.1 m rill hydraulic flume with a constant artificial roughness on the flume bed. The flow rates range from 0.22 × 10-3 m2 s-1 to 0.67 × 10-3 m2 s-1, and the slope gradients vary from 15.8% to 38.4%. Regression analysis indicates that the Dc by rill flow can be predicted using the linear equations of flow velocity, stream power, unit stream power, and unit energy. Dc by rill flow that is fitted to shear stress can be predicted with a power function equation. Predictions based on flow velocity, unit energy, and stream power are powerful, but those based on shear stress, especially on unit stream power, are relatively poor. The prediction based on flow velocity provides the best estimates of Dc by rill flow because of the simplicity and availability of its measurements. Owing to error in measuring flow velocity at low flow rates, the predictive abilities of Dc by rill flow using all hydraulic parameters are relatively lower in this study compared with the results of previous research. The measuring accuracy of experiments for flow velocity should be improved in future research.

  19. Variability of Darcian Flux in the Hyporheic Zone at a Natural Channel Bend

    Directory of Open Access Journals (Sweden)

    Shaofeng Xu

    2017-02-01

    Full Text Available Channel bends are one of the most important characteristic features of natural streams. These bends often create the conditions for a hyporheic zone, which has been recognized as a critical component of stream ecosystems. The streambed vertical hydraulic conductivity (Kv, vertical hydraulic gradient (VHG and Darcian flux (DF in the hyporheic zone were estimated at 61 locations along a channel bend of the Beiluo River during July 2015 and January 2016. All the streambed attributes showed great spatial variability along the channel bend. Both upward fluxes and downward fluxes occurred during the two test periods, most of studied stream sections were controlled by downwelling, indicating stream water discharge into the subsurface. The average downward flux was higher at the downstream side than at the upstream side of the channel bend, especially in July 2015. The distribution of streambed sediment grain size has a significant influence on the variability of Kv; high percentages of silt and clay sediments generally lead to low Kv values. Higher Kv at the depositional left bank at the upstream site shifted toward the erosional right bank at the downstream site, with Kv values positively correlated with the water depth. This study suggested that the variabilities of Kv and VHG were influenced by the stream geomorphology and that the distribution of Kv was inversely related, to a certain extent, to the distribution of VHG across the channel bend. Kv and VHG were found to have opposite effects on the DF, and the close relationship between Kv and DF indicated that the water fluxes were mainly controlled by Kv.

  20. Thermal Hydraulic Performance of Tight Lattice Bundle

    Science.gov (United States)

    Yamamoto, Yasushi; Akiba, Miyuki; Morooka, Shinichi; Shirakawa, Kenetsu; Abe, Nobuaki

    Recently, the reduced moderation spectrum BWR has been studied. The fast neutron spectrum is obtained through triangular tight lattice fuel. However, there are few thermal hydraulic test data and thermal hydraulic correlation applicable to critical power prediction in such a tight lattice bundle. This study aims to enhance the database of the thermal hydraulic performance of the tight lattice bundle whose rod gap is about 1mm. Therefore, thermal hydraulic performance measurement tests of tight lattice bundles for the critical power, the pressure drop and the counter current flow limiting were performed. Moreover, the correlations to evaluate the thermal-hydraulic performance of the tight lattice bundle were developed.

  1. Design of hydraulic output Stirling engine

    Science.gov (United States)

    Toscano, W. M.; Harvey, A. C.; Lee, K.

    1983-01-01

    A hydraulic output system for the RE-1000 free piston stirling engine (FPSE) was designed. The hydraulic output system can be readily integrated with the existing hot section of RE-1000 FPSE. The system has two simply supported diaphragms which separate the engine gas from the hydraulic fluid, a dynamic balance mechanism, and a novel, null center band hydraulic pump. The diaphragms are designed to endure more than 10 billion cycles, and to withstand the differential pressure load as high as 14 MPa. The projected thermodynamic performance of the hydraulic output version of RE-1000 FPSE is 1.87 kW at 29/7 percent brake efficiency.

  2. Uniform gradient expansions

    Directory of Open Access Journals (Sweden)

    Massimo Giovannini

    2015-06-01

    Full Text Available Cosmological singularities are often discussed by means of a gradient expansion that can also describe, during a quasi-de Sitter phase, the progressive suppression of curvature inhomogeneities. While the inflationary event horizon is being formed the two mentioned regimes coexist and a uniform expansion can be conceived and applied to the evolution of spatial gradients across the protoinflationary boundary. It is argued that conventional arguments addressing the preinflationary initial conditions are necessary but generally not sufficient to guarantee a homogeneous onset of the conventional inflationary stage.

  3. Uniform gradient expansions

    Energy Technology Data Exchange (ETDEWEB)

    Giovannini, Massimo, E-mail: massimo.giovannini@cern.ch [Department of Physics, Theory Division, CERN, 1211 Geneva 23 (Switzerland); INFN, Section of Milan-Bicocca, 20126 Milan (Italy)

    2015-06-30

    Cosmological singularities are often discussed by means of a gradient expansion that can also describe, during a quasi-de Sitter phase, the progressive suppression of curvature inhomogeneities. While the inflationary event horizon is being formed the two mentioned regimes coexist and a uniform expansion can be conceived and applied to the evolution of spatial gradients across the protoinflationary boundary. It is argued that conventional arguments addressing the preinflationary initial conditions are necessary but generally not sufficient to guarantee a homogeneous onset of the conventional inflationary stage.

  4. Gradient systems and mechanical systems

    Institute of Scientific and Technical Information of China (English)

    Fengxiang Mei; Huibin Wu

    2016-01-01

    All types of gradient systems and their properties are discussed. Two problems connected with gradient sys-tems and mechanical systems are studied. One is the direct problem of transforming a mechanical system into a gradi-ent system, and the other is the inverse problem, which is transforming a gradient system into a mechanical system.

  5. Hydraulic geometry of cohesive channels undergoing base level drop

    Science.gov (United States)

    Vachtman, Dina; Laronne, Jonathan B.

    2013-09-01

    This study extends earlier contributions on dynamic adjustments of fluvial channels to base level changes. We have investigated an in situ response of self-formed cohesive channels to a base level drop, conditions analogous to a gradual change in uplift and/or climate. Empirical hydraulic geometry equations for clayey-cohesive natural streams are presented using data from eight channels draining perennial brackish springs and discharge into the Dead Sea. Investigation of downstream variations in gradient and stream power relations suggests existence of three distinct reaches in which channel adjustment to base level drop is shared inequitably among hydraulic geometry variables. Values of the flow velocity exponent m are low (0.11 ≤ m ≤ 0.24), the mid-channel reach having the lowest exponent. The depth exponent f has the lowest value (f ≈ 0.3) for the uppermost channel reaches, the rest having higher values (f ≈ 0.4). The smallest width exponent (b = 0.35) characterizes the upper reaches. These values and their spatial distribution exhibit a regular pattern. We show that the lowermost channel reach adjusts by profile steepening and channel narrowing (f > b); the prevailing mechanism in the mid-channel reaches is lateral (width) adjustment, cross sections transiently transforming toward equilibrium; the uppermost reaches have wide and shallow channel cross sections because of series of bank collapses and resultant sediment aggradation, bringing rise to decreased local gradient, forcing further channel widening. The results of this study not only allow inference about how cohesive channels regulate their geometry, but also reveal the means by which hydraulic forces overcome substrate resistance, adjusting slope and channel dimensions and, as such, have implication for reach-scale channel morphology and models of stream power.

  6. Hydraulic fracture during epithelial stretching

    Science.gov (United States)

    Casares, Laura; Vincent, Romaric; Zalvidea, Dobryna; Campillo, Noelia; Navajas, Daniel; Arroyo, Marino; Trepat, Xavier

    2015-03-01

    The origin of fracture in epithelial cell sheets subject to stretch is commonly attributed to excess tension in the cells’ cytoskeleton, in the plasma membrane, or in cell-cell contacts. Here, we demonstrate that for a variety of synthetic and physiological hydrogel substrates the formation of epithelial cracks is caused by tissue stretching independently of epithelial tension. We show that the origin of the cracks is hydraulic; they result from a transient pressure build-up in the substrate during stretch and compression manoeuvres. After pressure equilibration, cracks heal readily through actomyosin-dependent mechanisms. The observed phenomenology is captured by the theory of poroelasticity, which predicts the size and healing dynamics of epithelial cracks as a function of the stiffness, geometry and composition of the hydrogel substrate. Our findings demonstrate that epithelial integrity is determined in a tension-independent manner by the coupling between tissue stretching and matrix hydraulics.

  7. Bio-based Hydraulic Fluids

    Science.gov (United States)

    2008-04-17

    currently formulated with vegetable oils (i.e., rapeseed , sun flower, corn, soybean, canola, coconut, etc.) and synthetic ester, such as polyol ester...2008 Vegetable Oil • Excellent lubrication • Nontoxic • Biodegradable • Derived from renewable resources such as rapeseed , sunflower, corn...Mineral Oil 100 SAE 15W-40 G Rapeseed 32 Commercial HF H Polyol ester 22 MIL-PRF-32073 Grade 2 I Canola - Cooking Oil *Hydraulic fluid 3717 April

  8. Fire Resistant Aircraft Hydraulic System.

    Science.gov (United States)

    1982-07-01

    and compounds based on new experimental elastomers as well as most commercially available elastomers were screened in seeking seals that were both...for hydraulic component testing. All of the available E6.5 stock was purchased for the screening tests. However, DuPont stated that other homologs of...with the lubricity and anti-wear additive olyvan A (molybdenum oxysulphide dithiocarbamate ) added in the quantity of less than one percent by weight

  9. Temporal and vertical variation of hydraulic head in aquifers in the Edgewood area, Aberdeen Proving Ground, Maryland

    Science.gov (United States)

    Donnelly, Colleen A.; Tenbus, Fredrick J.

    1998-01-01

    Water-level data and interpretations from previous hydrogeological studies conducted by the U.S. Geological Survey in the Edgewood Area of Aberdeen Proving Ground (APG), Maryland, were compared to determine similarities and differences among the aquifers. Because the sediments that comprise the shallow aquifers are discontinuous, the shallow ground-water-flow systems are local rather than extensive across the Edgewood Area. Hydrogeologic cross sections, hydrographs of water levels, and vertical gradients calculated from previous studies in the Canal Creek area, Graces Quarters, the O-Field area, Carroll Island, and the J-Field area, over periods of record ranging from 1 to 10 years during 1986-97, were used to determine recharge and discharge areas, connections between aquifers, and hydrologic responses of aquifers to natural and anthropogenic stress. Each of the aquifers in the study areas exhibited variation of hydraulic head that was attributed to seasonal changes in recharge. Upward hydraulic gradients and seasonal reversals of vertical hydraulic gradients between aquifers indicate the potential for local ground-water discharge from most of the aquifers that were studied in the Edgewood Area. Hydraulic head in individual aquifers in Graces Quarters and Carroll Island responded to offsite pumping during part of the period of record. Hydraulic head in most of the confined aquifers responded to tidal loading effects from nearby estuaries.

  10. Hydraulic conductivity of active layer soils in the McMurdo Dry Valleys, Antarctica: Geological legacy controls modern hillslope connectivity

    Science.gov (United States)

    Schmidt, Logan M.; Levy, Joseph S.

    2017-04-01

    Spatial variability in the hydraulic and physical properties of active layer soils influences shallow groundwater flow through cold-desert hydrological systems. This study measures the saturated hydraulic conductivity and grain-size distribution of 90 soil samples from the McMurdo Dry Valleys (MDV), Antarctica-primarily from Taylor Valley-to determine what processes affect the spatial distribution of saturated hydraulic conductivity in a simple, mineral-soil-dominated natural hillslope laboratory. We find that the saturated hydraulic conductivity and the grain-size distribution of soils are organized longitudinally within Taylor Valley. Soils sampled down-valley near the coast have a higher percentage of fine-sized sediments (fine sand, silt, clay) and lower saturated hydraulic conductivities than soils collected up-valley near Taylor Glacier (1.3 × 10- 2 vs. 1.2 × 10- 1 cm/s). Soils collected mid-valley have intermediate amounts of fines and saturated hydraulic conductivity values consistent with a hydrogeologic gradient spanning the valley from high inland to low near the coast. These results suggest the organization of modern soil properties within Taylor Valley is a relict signature from past glaciations that have deposited soils of decreasing age toward the mouth of the valley, modified by fluvial activity acting along temporal and microclimate gradients.

  11. Bigravity from gradient expansion

    Energy Technology Data Exchange (ETDEWEB)

    Yamashita, Yasuho [Yukawa Institute for Theoretical Physics, Kyoto University,606-8502, Kyoto (Japan); Tanaka, Takahiro [Yukawa Institute for Theoretical Physics, Kyoto University,606-8502, Kyoto (Japan); Department of Physics, Kyoto University,606-8502, Kyoto (Japan)

    2016-05-04

    We discuss how the ghost-free bigravity coupled with a single scalar field can be derived from a braneworld setup. We consider DGP two-brane model without radion stabilization. The bulk configuration is solved for given boundary metrics, and it is substituted back into the action to obtain the effective four-dimensional action. In order to obtain the ghost-free bigravity, we consider the gradient expansion in which the brane separation is supposed to be sufficiently small so that two boundary metrics are almost identical. The obtained effective theory is shown to be ghost free as expected, however, the interaction between two gravitons takes the Fierz-Pauli form at the leading order of the gradient expansion, even though we do not use the approximation of linear perturbation. We also find that the radion remains as a scalar field in the four-dimensional effective theory, but its coupling to the metrics is non-trivial.

  12. Increasing SLEDed Linac Gradient

    Energy Technology Data Exchange (ETDEWEB)

    Farkas, Zoltan D

    2001-11-08

    This note will show how to increase the SLED [1] gradient by varying Q{sub e}, the external Q of the SLED cavity, by increasing its Q{sub 0} and by increasing the compression ratio. If varying the external Q is to be effective, then the copper losses should be small so that Q{sub 0} >> Q{sub e}. Methods of varying Q{sub e} will be indicated but no experimental data will be presented. If we increase the klystron pulse width from 3.5 to 5 {micro}S and increase Q{sub 0} from the present 100000 to 300000, then the gradient increases by 19% and the beam energy increases from 50 to 60 GeV. This note will also discuss SLED operation at 11424 MHz, the NLC frequency. Without Q{sub e} switching, using SLED at 11424 MHz increases the SLAC gradient from 21 MV/m to 34 MV/m, and at the same repetition rate, uses about 1/5 of rf average power. If we also double the compression ratio, we reach 47 MV/m and over 100 GeV beam energy.

  13. Vibrations of hydraulic pump and their solution

    OpenAIRE

    Dobšáková Lenka; Nováková Naděžda; Habán Vladimír; Hudec Martin; Jandourek Pavel

    2017-01-01

    The vibrations of hydraulic pump and connected pipeline system are very problematic and often hardly soluble. The high pressure pulsations of hydraulic pump with the double suction inlet are investigated. For that reason the static pressure and accelerations are measured. The numerical simulations are carried out in order to correlate computed data with experimental ones and assess the main source of vibrations. Consequently the design optimization of the inner hydraulic part of pump is done ...

  14. Hydraulically Driven Grips For Hot Tensile Specimens

    Science.gov (United States)

    Bird, R. Keith; Johnson, George W.

    1994-01-01

    Pair of grips for tensile and compressive test specimens operate at temperatures up to 1,500 degrees F. Grips include wedges holding specimen inside furnace, where heated to uniform temperature. Hydraulic pistons drive wedges, causing them to exert clamping force. Hydraulic pistons and hydraulic fluid remain outside furnace, at room temperature. Cooling water flows through parts of grips to reduce heat transferred to external components. Advantages over older devices for gripping specimens in high-temperature tests; no need to drill holes in specimens, maintains constant gripping force on specimens, and heated to same temperature as that of specimen without risk of heating hydraulic fluid and acuator components.

  15. Reinforcement Learning by Value Gradients

    CERN Document Server

    Fairbank, Michael

    2008-01-01

    The concept of the value-gradient is introduced and developed in the context of reinforcement learning. It is shown that by learning the value-gradients exploration or stochastic behaviour is no longer needed to find locally optimal trajectories. This is the main motivation for using value-gradients, and it is argued that learning value-gradients is the actual objective of any value-function learning algorithm for control problems. It is also argued that learning value-gradients is significantly more efficient than learning just the values, and this argument is supported in experiments by efficiency gains of several orders of magnitude, in several problem domains. Once value-gradients are introduced into learning, several analyses become possible. For example, a surprising equivalence between a value-gradient learning algorithm and a policy-gradient learning algorithm is proven, and this provides a robust convergence proof for control problems using a value function with a general function approximator.

  16. Design and Analysis of Hydraulic Chassis with Obstacle Avoidance Function

    Science.gov (United States)

    Hong, Yingjie; Zhang, Xiang

    2017-07-01

    This article mainly expounds the design of hydraulic system for the hydraulic chassis with obstacle avoidance function. Including the selection of hydraulic motor wheels, hydraulic pump, digital hydraulic cylinder and the matching of engine power. And briefly introduces the principle of obstacle avoidance.

  17. Integration of Tracer Test Data to Refine Geostatistical Hydraulic Conductivity Fields Using Sequential Self-Calibration Method

    Institute of Scientific and Technical Information of China (English)

    Bill X Hu; Jiang Xiaowei; Wan Li

    2007-01-01

    On the basis of local measurements of hydraulic conductivity, geostatistical methods have been found to be useful in heterogeneity characterization of a hydraulic conductivity field on a regional scale. However, the methods are not suited to directly integrate dynamic production data, such as,hydraulic head and solute concentration, into the study of conductivity distribution. These data, which record the flow and transport processes in the medium, are closely related to the spatial distribution of hydraulic conductivity. In this study, a three-dimensional gradient-based inverse method-the sequential self-calibration (SSC) method-is developed to calibrate a hydraulic conductivity field,initially generated by a geostatistical simulation method, conditioned on tracer test results. The SSC method can honor both local hydraulic conductivity measurements and tracer test data. The mismatch between the simulated hydraulic conductivity field and the reference true one, measured by its mean square error (MSE), is reduced through the SSC conditional study. In comparison with the unconditional results, the SSC conditional study creates the mean breakthrough curve much closer to the reference true curve, and significantly reduces the prediction uncertainty of the solute transport in the observed locations. Further, the reduction of uncertainty is spatially dependent, which indicates that good locations, geological structure, and boundary conditions will affect the efficiency of the SSC study results.

  18. Helical coil thermal hydraulic model

    Science.gov (United States)

    Caramello, M.; Bertani, C.; De Salve, M.; Panella, B.

    2014-11-01

    A model has been developed in Matlab environment for the thermal hydraulic analysis of helical coil and shell steam generators. The model considers the internal flow inside one helix and its associated control volume of water on the external side, both characterized by their inlet thermodynamic conditions and the characteristic geometry data. The model evaluates the behaviour of the thermal-hydraulic parameters of the two fluids, such as temperature, pressure, heat transfer coefficients, flow quality, void fraction and heat flux. The evaluation of the heat transfer coefficients as well as the pressure drops has been performed by means of the most validated literature correlations. The model has been applied to one of the steam generators of the IRIS modular reactor and a comparison has been performed with the RELAP5/Mod.3.3 code applied to an inclined straight pipe that has the same length and the same elevation change between inlet and outlet of the real helix. The predictions of the developed model and RELAP5/Mod.3.3 code are in fairly good agreement before the dryout region, while the dryout front inside the helical pipes is predicted at a lower distance from inlet by the model.

  19. An ecological hydraulic radius approach to estimate the instream ecological water requirement

    Institute of Scientific and Technical Information of China (English)

    LIU Changming; MEN Baohui

    2007-01-01

    This essay defines the concepts of ecological flow velocity as well as ecological hydraulic radius (EHR) and proposes an ecological hydraulic radius approach (EHRA) which considers both the watercourse information (including hydraulic radius, roughness coefficient and hydraulic gradient) and the required stream velocity necessary for maintenance of certain ecological functions all together. The key parameter of EHRA is to fix the watercourse cross-sectional flow area corresponding to EHR, by which the relation between parabola shaped cross-sectional flow area and hydraulic radius is deduced. The EHRA not only meets the requirement of flow velocity for adequate fish spawning migration, but also is applicable to the ecological flows in regard with other ecological issues (such as the calculation of the instream flow requirements for transporting sediment and for pollution self-purification, etc. ). This essay has illuminated the computational process taking the estimation of ecological water requirement of Zhuba Hydrologyical Station watercourse in Niqu branch of the Yalong River as an example. Additionally, we compare EHRA with Tennant approach. The result shows that the Zhuba Hydrological Station ecological water requirement calculated by EHRA lies between the minimum and favorable ecological water requirement calculated by the Tennant approach. This is due to the fact that the ecological flow velocity (such as the fish spawning migration flow velocity) was taken into consideration, producing results applicable to the practical situation.

  20. STOCHASTIC ANALYSIS OF UNSATURATED FLOW WITH THE NORMAL DISTRIBUTION OF SOIL HYDRAULIC CONDUCTIVITY

    Institute of Scientific and Technical Information of China (English)

    Huang Guan-hua; Zhang Ren-duo

    2003-01-01

    Stochastic approaches are useful to quantitatively describe transport behavior over large temporal and spatial scales while accounting for the influence of small-scale variabilities. Numerous solutions have been developed for unsaturated soil water flow based on the lognormal distribution of soil hydraulic conductivity. To our knowledge, no available stochastic solutions for unsaturated flow have been derived on the basis of the normal distribution of hydraulic conductivity. In this paper, stochastic solutions were developed for unsaturated flow by assuming the normal distribution of saturated hydraulic conductivity (Ks). Under the assumption that soil hydraulic properties are second-order stationary, analytical expressions for capillary tension head variance (σ2h) and effective hydraulic conductivity (K*ii) in stratified soils were derived using the perturbation method. The dependence of σ2h and K*ii on soil variability and mean flow variables (the mean capillary tension head and its temporal and spatial gradients) and mean flow conditions (wetting and drying) were systematically analyzed. The calculated variance of capillary tension head with the analytical solution derived in this paper was compared with field experimental data. The good agreement indicates that the analytical solution is applicable to evaluate the variance of capillary tension head of field soils with moderate variability.

  1. WATER ENERGY IN HYDROAMELIORATIVE SYSTEMS USING THE HYDRAULIC TRANSFORMER TYPE A. BARGLAZAN AND THE HYDRAULIC HAMMER (HYDRAULIC PUMP

    Directory of Open Access Journals (Sweden)

    Teodor Eugen Man

    2010-01-01

    Full Text Available This paper presents two examples of exploitation of water energy that can be used in the irrigation field. First of theseexamples is the hydraulic transformer type A. Barglazan used for irrigation, pumped water is taken directly from theriver’s well, using a hydraulic pump which simultaneously carried out a double transformation in this way: hydraulicenergy into mechanic energy and mechanical energy into hydraulic energy. Technology preparation and devices designwas done in record time, seeing that this constructive solution is more robust, reliable and with improved energyperformance versus the laboratory prototype. The experimental research which was made at 1:1 scale proved theirgood function over time. Another example is the hydraulic hammer (hydraulic pump that uses low-head energy topump water, with a global efficiency of about 10 - 50%. Currently, the new situation of private ownership of landprovides conditions for new pumping microstations to be made where irrigation is necessary and optimal hydrauliclocations exist.

  2. Hydrologic and hydraulic analyses of Great Meadow wetland, Acadia National Park, Maine

    Science.gov (United States)

    Lombard, Pamela J.

    2017-01-26

    The U.S. Geological Survey completed hydrologic and hydraulic analyses of Cromwell Brook and the Sieur de Monts tributary in Acadia National Park, Maine, to better understand causes of flooding in complex hydrologic and hydraulic environments, like those in the Great Meadow wetland and Sieur de Monts Spring area. Regional regression equations were used to compute peak flows with from 2 to 100-year recurrence intervals at seven locations. Light detection and ranging data were adjusted for bias caused by dense vegetation in the Great Meadow wetland; and then combined with local ground surveys used to define the underwater topography and hydraulic structures in the study area. Hydraulic modeling was used to evaluate flood response in the study area to a variety of hydrologic and hydraulic scenarios.Hydraulic modeling indicates that enlarging the culvert at Park Loop Road could help mitigate flooding near the Sieur de Monts Nature Center that is caused by streamflows with large recurrence intervals; however, hydraulic modeling also indicates that the Park Loop Road culvert does not aggravate flooding near the Nature Center caused by the more frequent high intensity rainstorms. That flooding is likely associated with overland flow resulting from (1) quick runoff from the steep Dorr Mountain hitting the lower gradient Great Meadow wetland area and (2) poor drainage aggravated by beaver dams holding water in the wetland.Rapid geomorphic assessment data collected in June 2015 and again in April 2016 indicate that Cromwell Brook has evidence of aggradation, degradation, and channel widening throughout the drainage basin. Two of five reference cross sections developed for this report also indicate channel aggradation.

  3. HYDRAULIC CHARACTERISTICS OF VERTICAL VORTEX AT HYDRAULIC INTAKES

    Institute of Scientific and Technical Information of China (English)

    CHEN Yun-liang; WU Chao; YE Mao; JU Xiao-ming

    2007-01-01

    The trace of vertical vortex flow at hydraulic intakes is of the shape of spiral lines, which was observed in the presented experiments with the tracer technique. It represents the fluid particles flow spirally from the water surface to the underwater and rotate around the vortex-axis multi-cycle. This process is similar to the movement of screw. To describe the multi-circle spiral characteristics under the axisymmetric condition, the vertical vortex would change not only in the radial direction but also in the axial direction. The improved formulae for three velocity components for the vertical vortex flow were deduced by using the method of separation of variables in this article. In the improved formulae, the velocity components are the functions of the radial and axial coordinates, so the multi-circle spiral flow of vertical vortex could be simulated. The calculated and measured results for the vertical vortex flow were compared and the causes of errors were analyzed.

  4. Design of Pumps for Water Hydraulic Systems

    DEFF Research Database (Denmark)

    Klit, Peder; Olsen, Stefan; Bech, Thomas Nørgaard

    1999-01-01

    This paper considers the development of two pumps for water hydraulic applications. The pumps are based on two different working principles: The Vane-type pump and the Gear-type pump. Emphasis is put on the considerations that should be made to account for water as the hydraulic fluid.......KEYWORDS: water, pump, design, vane, gear....

  5. Hydraulic fracturing with distinct element method

    NARCIS (Netherlands)

    Pruiksma, J.P.; Bezuijen, A.

    2002-01-01

    In this report, hydraulic fracturing is investigated using the distinct element code PFC2D from Itasca. Special routines were written to be able to model hydraulic fracturing. These include adding fluid flow to PFC2D and updating the fluid flow domains when fractures appear. A brief description of t

  6. Hydraulic Actuator for Ganged Control Rods

    Science.gov (United States)

    Thompson, D. C.; Robey, R. M.

    1986-01-01

    Hydraulic actuator moves several nuclear-reactor control rods in unison. Electromagnetic pump pushes liquid lithium against ends of control rods, forcing them out of or into nuclear reactor. Color arrows show lithium flow for reactor startup and operation. Flow reversed for shutdown. Conceived for use aboard spacecraft, actuator principle applied to terrestrial hydraulic machinery involving motion of ganged rods.

  7. Control arrangement for the actuation of hydraulic consumers

    Energy Technology Data Exchange (ETDEWEB)

    Kussel, W.; Dettmers, M.; Weirich, W.

    1988-11-09

    An arrangement for controlling the actuation of hydraulic consumers, by selectively connecting the consumers to hydraulic pressure and return lines; the control arrangement comprising a respective hydraulically operated directional control valve associated with each of the hydraulic consumers, a respective electro-magnetically operated pre-control valve associated with each of the hydraulic directional control valves, and further electro-magnetically operated directional control valve means associated with the pre-control valves, each of the hydraulic consumers being connectible to the hydraulic pressure or return lines via the associated hydraulically operated directional control valve which is actuatable by a hydraulic control line leading from the output of the associated pre-control valve, wherein the inputs of the pre-control valves are connected directly to the hydraulic return line and indirectly, via the further control valve means, to the hydraulic return line or to a hydraulic control pressure line.

  8. Energy in density gradient

    CERN Document Server

    Vranjes, J

    2015-01-01

    Inhomogeneous plasmas and fluids contain energy stored in inhomogeneity and they naturally tend to relax into lower energy states by developing instabilities or by diffusion. But the actual amount of energy in such inhomogeneities has remained unknown. In the present work the amount of energy stored in a density gradient is calculated for several specific density profiles in a cylindric configuration. This is of practical importance for drift wave instability in various plasmas, and in particular in its application in models dealing with the heating of solar corona because the instability is accompanied with stochastic heating, so the energy contained in inhomogeneity is effectively transformed into heat. It is shown that even for a rather moderate increase of the density at the axis in magnetic structures in the corona by a factor 1.5 or 3, the amount of excess energy per unit volume stored in such a density gradient becomes several orders of magnitude greater than the amount of total energy losses per unit ...

  9. Energy in density gradient

    Energy Technology Data Exchange (ETDEWEB)

    Vranjes, J., E-mail: jvranjes@yahoo.com [Instituto de Astrofísica de Canarias, 38205 La Laguna, Tenerife (Spain); Departamento de Astrofísica, Universidad de La Laguna, 38205 La Laguna, Tenerife (Spain); Kono, M., E-mail: kono@fps.chuo-u.ac.jp [Faculty of Policy Studies, Chuo University, Tokyo (Japan)

    2015-01-15

    Inhomogeneous plasmas and fluids contain energy stored in inhomogeneity and they naturally tend to relax into lower energy states by developing instabilities or by diffusion. But the actual amount of energy in such inhomogeneities has remained unknown. In the present work, the amount of energy stored in a density gradient is calculated for several specific density profiles in a cylindrical configuration. This is of practical importance for drift wave instability in various plasmas, and, in particular, in its application in models dealing with the heating of solar corona because the instability is accompanied with stochastic heating, so the energy contained in inhomogeneity is effectively transformed into heat. It is shown that even for a rather moderate increase of the density at the axis in magnetic structures in the corona by a factor 1.5 or 3, the amount of excess energy per unit volume stored in such a density gradient becomes several orders of magnitude greater than the amount of total energy losses per unit volume (per second) in quiet regions in the corona. Consequently, within the life-time of a magnetic structure such energy losses can easily be compensated by the stochastic drift wave heating.

  10. Gravity-Driven Hydraulic Fractures

    Science.gov (United States)

    Germanovich, L. N.; Garagash, D.; Murdoch, L. C.; Robinowitz, M.

    2014-12-01

    This study is motived by a new method for disposing of nuclear waste by injecting it as a dense slurry into a hydraulic fracture that grows downward to great enough depth to permanently isolate the waste. Disposing of nuclear waste using gravity-driven hydraulic fractures is mechanically similar to the upward growth of dikes filled with low density magma. A fundamental question in both applications is how the injected fluid controls the propagation dynamics and fracture geometry (depth and breadth) in three dimensions. Analog experiments in gelatin [e.g., Heimpel and Olson, 1994; Taisne and Tait, 2009] show that fracture breadth (the short horizontal dimension) remains nearly stationary when the process in the fracture "head" (where breadth is controlled) is dominated by solid toughness, whereas viscous fluid dissipation is dominant in the fracture tail. We model propagation of the resulting gravity-driven (buoyant or sinking), finger-like fracture of stationary breadth with slowly varying opening along the crack length. The elastic response to fluid loading in a horizontal cross-section is local and can be treated similar to the classical Perkins-Kern-Nordgren (PKN) model of hydraulic fracturing. The propagation condition for a finger-like crack is based on balancing the global energy release rate due to a unit crack extension with the rock fracture toughness. It allows us to relate the net fluid pressure at the tip to the fracture breadth and rock toughness. Unlike the PKN fracture, where breadth is known a priori, the final breadth of a finger-like fracture is a result of processes in the fracture head. Because the head is much more open than the tail, viscous pressure drop in the head can be neglected leading to a 3D analog of Weertman's hydrostatic pulse. This requires relaxing the local elasticity assumption of the PKN model in the fracture head. As a result, we resolve the breadth, and then match the viscosity-dominated tail with the 3-D, toughness

  11. Elevational trends in hydraulic efficiency and safety of Pinus cembra roots.

    Science.gov (United States)

    Losso, Adriano; Nardini, Andrea; Nolf, Markus; Mayr, Stefan

    2016-04-01

    In alpine regions, elevational gradients in environmental parameters are reflected by structural and functional changes in plant traits. Elevational changes in plant water relations have also been demonstrated, but comparable information on root hydraulics is generally lacking. We analyzed the hydraulic efficiency (specific hydraulic conductivity k s, entire root system conductance K R) and vulnerability to drought-induced embolism (water potential at 50 % loss of conductivity Ψ 50) of the roots of Pinus cembra trees growing along an elevational transect of 600 m. Hydraulic parameters of the roots were compared with those of the stem and related to anatomical traits {mean conduit diameter (d), wall reinforcement [(t/b)(2)]}. We hypothesized that temperature-related restrictions in root function would cause a progressive limitation of hydraulic efficiency and safety with increasing elevation. We found that both root k s and K R decreased from low (1600 m a.s.l.: k s 5.6 ± 0.7 kg m(-1) s(-1) MPa(-1), K R 0.049 ± 0.005 kg m(-2) s (-1) MPa(-1)) to high elevation (2100 m a.s.l.: k s 4.2 ± 0.6 kg m(-1) s(-1) MPa(-1), K R 0.035 ± 0.006 kg m(-2) s(-1) MPa(-1)), with small trees showing higher K R than large trees. k s was higher in roots than in stems (0.5 ± 0.05 kg m(-1)s(-1)MPa(-1)). Ψ 50 values were similar across elevations and overall less negative in roots (Ψ 50 -3.6 ± 0.1 MPa) than in stems (Ψ 50 -3.9 ± 0.1 MPa). In roots, large-diameter tracheids were lacking at high elevation and (t/b)(2) increased, while d did not change. The elevational decrease in root hydraulic efficiency reflects a limitation in timberline tree hydraulics. In contrast, hydraulic safety was similar across elevations, indicating that avoidance of hydraulic failure is important for timberline trees. As hydraulic patterns can only partly be explained by the anatomical parameters studied, limitations and/or adaptations at the pit level are likely.

  12. Scaling hydraulic properties of a macroporous soil

    Science.gov (United States)

    Mohanty, Binayak P.

    1999-06-01

    Macroporous soils exhibit significant differences in their hydraulic properties for different pore domains. Multimodal hydraulic functions may be used to describe the characteristics of multiporosity media. I investigated the usefulness of scaling to describe the spatial variability of hydraulic conductivity (K(-h)) functions of a macroporous soil in Las Nutrias, New Mexico. Piecewise-continuous hydraulic conductivity functions suitable for macroporous soils in conjunction with a hybrid similar media-functional normalization scaling approach were used. Results showed that gravity-dominated flow and the related hydraulic conductivity (K(minus;h) functions of the macropore region are more readily scalable than capillary-dominated flow properties of the mesopore and micropore regions. A possible reason for this behavior is that gravity-dominated flow in the larger pores is mostly influenced by the pore diameter which remains more uniform as compared to tortuous mesopores and micropores with variable neck and body sizes along the pore length.

  13. Modeling and Simulation of Hydraulic Engine Mounts

    Institute of Scientific and Technical Information of China (English)

    DUAN Shanzhong; Marshall McNea

    2012-01-01

    Hydraulic engine mounts are widely used in automotive powertrains for vibration isolation.A lumped mechanical parameter model is a traditional approach to model and simulate such mounts.This paper presents a dynamical model of a passive hydraulic engine mount with a double-chamber,an inertia track,a decoupler,and a plunger.The model is developed based on analogy between electrical systems and mechanical-hydraulic systems.The model is established to capture both low and high frequency dynatmic behaviors of the hydraulic mount.The model will be further used to find the approximate pulse responses of the mounts in terms of the force transmission and top chamber pressure.The close form solution from the simplifiod linear model may provide some insight into the highly nonlinear behavior of the mounts.Based on the model,computer simulation has been carried out to study dynamic performance of the hydraulic mount.

  14. Hydraulic fracturing in cells and tissues: fracking meets cell biology.

    Science.gov (United States)

    Arroyo, Marino; Trepat, Xavier

    2016-12-06

    The animal body is largely made of water. A small fraction of body water is freely flowing in blood and lymph, but most of it is trapped in hydrogels such as the extracellular matrix (ECM), the cytoskeleton, and chromatin. Besides providing a medium for biological molecules to diffuse, water trapped in hydrogels plays a fundamental mechanical role. This role is well captured by the theory of poroelasticity, which explains how any deformation applied to a hydrogel causes pressure gradients and water flows, much like compressing a sponge squeezes water out of it. Here we review recent evidence that poroelastic pressures and flows can fracture essential biological barriers such as the nuclear envelope, the cellular cortex, and epithelial layers. This type of fracture is known in engineering literature as hydraulic fracturing or 'fracking'.

  15. Hydraulic test for evaluation of hydrophone VSP

    Energy Technology Data Exchange (ETDEWEB)

    Yabuuchi, Satoshi; Koide, Kaoru [Power Reactor and Nuclear Fuel Development Corp., Toki, Gifu (Japan). Tono Geoscience Center

    1997-12-01

    This hydraulic test was carried out at the test site of Tono Geoscience Center, Mizunami-shi, Gifu Pref. in order to evaluate the reliability of the hydraulic conductivity estimated from hydrophone VSP experiment. From March to April 1997, we carried out measurements of pore-water pressure at five depths and permeability tests at seven depths down to G.L.-300m, within a borehole drilled in granitic rock. We compared the results of hydraulic test with hydrophone VSP experiment on condition that a single open fracture existed, and we obtained two notable results. First, for the granitic rock at which a single open fracture was found by BTV and also detected by hydrophone VSP experiment, the hydraulic conductivity was 1.54 x 10{sup -7} cm/sec, while for the same granitic rock at which another single open fracture was found by BTV but not detected by hydrophone VSP experiment, the hydraulic conductivity was less than 6 x 10{sup -10} cm/sec. Second, we converted the hydraulic conductivity of 1.54 x 10{sup -7} cm/sec which was obtained in a hydraulic test section of length 2.5 m into an equivalent value for a single open fracture of width 1 mm. The converted value (3.8 x 10{sup -4} cm/sec) was similar to the hydraulic conductivity estimated from hydrophone VSP experiment. In conclusion, the hydraulic test result shows that hydrophone VSP is useful to estimate an approximate hydraulic conductivity of a single open fracture. (author)

  16. DLC coatings for hydraulic applications

    Institute of Scientific and Technical Information of China (English)

    Luca NOBILI; Luca MAGAGNIN

    2009-01-01

    Replacement of lubricating oils with water or low-viscosity fluids is highly desirable in many industrial fields, on account of the environmental and economical advantages. Low lubricity of water might be insufficient for proper operation of hydraulic components, and diamond-like carbon(DLC) coatings are very attractive as solid lubricant films. A remote-plasma PACVD process was utilized to deposit hydrogenated DLC coatings (a-C:H) on different substrates. Microindentation measurements show that the coating hardness is around 35 GPa. Tribological behavior was evaluated by block-on-ring tests performed in water and water with alumina. The wear rate was calculated after measuring the wear volume by a laser profilemeter. Morphological and compositional analysis of the wear tracks reveal that coating failure may occur by abrasive wear or delamination, depending on the substrate properties. Hard and smooth substrates give the best results and dispersed alumina particles increase the wear rate.

  17. Aircraft Hydraulic Systems Dynamic Analysis

    Science.gov (United States)

    1978-10-01

    4400 PSIG OUTLET PRESSURE ~’f UM5 S1 l .( FIF ~0RV lR 1 .I. AP (c R (V) IFWM) APPROX C ASE !VPý :iI S ReUN N•;MRF.. r p kN i t, isI A! f IN, I:E • ’l...and 1F.GI pump modelo were assumed from data supplied by CECO. 165 _ -- --- - SECTION V HYDRAULIC MOTOR MODEL DEVELOPMENT AND VERIFICATION A fixed...3 70 P.,0 601 ~4 M24.0 3 1p ’, 4 r I 1 1 ISIS 2411 APPENDIX E (CONT.) HSFR TECHNICAL MANUAL (AFAPL-TR-76-43, VOL. IV) 4.15 VANE PU`MP SUBROUTINE 4.15A

  18. Experimental Study For Pizometric Head Distribution Under Hydraulic Structures

    Directory of Open Access Journals (Sweden)

    Dr. Najm Obaid Salim Alghazali

    2015-04-01

    Full Text Available Abstract In this research the experimental method by using Hydraulic modeling used to determination the flow net in order to analyses seepage flow through single- layer soil foundation underneath hydraulic structure. as well as steady the consequence of the cut-off inclination angle on exit gradient factor of safety uplift pressure and quantity of seepage by using seepage tank were designed in the laboratory with proper dimensions with two cutoffs . The physical model seepage tank was designed in two downstream cutoff angles which are 90 and 120 and upstream cutoff angles 90 45 120. After steady state flow the flow line is constructed by dye injection in the soil from the upstream side in front view of the seepage tank and the equipotentials line can be constructed by pizometer fixed to measure the total head. From the result It is concluded that using downstream cut-off inclined towards the downstream side with amp1256 equal 120 that given value of redaction 25 is beneficial in increasing the safety factor against the piping phenomenon. using upstream cut-off inclined towards the downstream side with amp1256 equal 45 that given value of redaction 52 is beneficial in decreasing uplift pressure and quantity of seepage.

  19. Model based monitoring of wellbore hydraulics for abnormal event detection

    Energy Technology Data Exchange (ETDEWEB)

    Todorov, Dimitar; Fruhwirth, Rudolf K. [Thonhauser Data Engineering GmbH, Leoben (Austria); Thonhauser, Gerhard [Montanuniversitaet Leoben (Austria)

    2013-03-15

    With the increasing demand for energy in the last decades, the petroleum industry was forced to push the limits to levels that have never been reached before. Exploring very deep waters, drilling under varying conditions of extreme pressure and temperature and dealing with issues, which involve a new level of understanding, are challenges, which need to be overcome in order to safely and successfully accomplish the planned goals. Operating under such circumstances obligates the driller to be extremely precise in his actions. Even with the driller's extensive experience and training, the possible reaction time is in some cases extremely short. This article discusses the reasons for automatic trouble event recognition systems in the drilling process and how these affect the drilling operations and optimization processes. In this respect a concept of a real time hydraulic monitor will be developed helping the driller to visualize calculations in a plot, showing the pump limitations, the limitations due to the formation fracture gradient and the hole cleaning requirements. Additionally, taking into account the complete wellbore hydraulics and introducing various well behavior models and different algorithms, the system is capable of operating as a real-time indicator for undesired downhole events. (orig.)

  20. Generalized conjugate gradient squared

    Energy Technology Data Exchange (ETDEWEB)

    Fokkema, D.R.; Sleijpen, G.L.G. [Utrecht Univ. (Netherlands)

    1994-12-31

    In order to solve non-symmetric linear systems of equations, the Conjugate Gradient Squared (CGS) is a well-known and widely used iterative method. In practice the method converges fast, often twice as fast as the Bi-Conjugate Gradient method. This is what you may expect, since CGS uses the square of the BiCG polynomial. However, CGS may suffer from its erratic convergence behavior. The method may diverge or the approximate solution may be inaccurate. BiCGSTAB uses the BiCG polynomial and a product of linear factors in an attempt to smoothen the convergence. In many cases, this has proven to be very effective. Unfortunately, the convergence of BiCGSTAB may stall when a linear factor (nearly) degenerates. BiCGstab({ell}) is designed to overcome this degeneration of linear factors. It generalizes BiCGSTAB and uses both the BiCG polynomial and a product of higher order factors. Still, CGS may converge faster than BiCGSTAB or BiCGstab({ell}). So instead of using a product of linear or higher order factors, it may be worthwhile to look for other polynomials. Since the BiCG polynomial is based on a three term recursion, a natural choice would be a polynomial based on another three term recursion. Possibly, a suitable choice of recursion coefficients would result in method that converges faster or as fast as CGS, but less erratic. It turns out that an algorithm for such a method can easily be formulated. One particular choice for the recursion coefficients leads to CGS. Therefore one could call this algorithm generalized CGS. Another choice for the recursion coefficients leads to BiCGSTAB. It is therefore possible to mix linear factors and some polynomial based on a three term recursion. This way one may get the best of both worlds. The authors will report on their findings.

  1. DESIGN AND CONSTRUCTION OF A HYDRAULIC PISTON

    OpenAIRE

    Santos De La Cruz, Eulogio; Universidad Nacional Mayor de San Marcos; Rojas Lazo, Oswaldo; Universidad Nacional Mayor de San Marcos; Yenque Dedios, Julio; Universidad Nacional Mayor de San Marcos; Lavado Soto, Aurelio; Universidad Nacional Mayor de San Marcos

    2014-01-01

    A hydraulic system project includes the design, materials selection and construction of the hydraulic piston, hydraulic circuit and the joint with the pump and its accesories. This equiment will be driven by the force of moving fluid, whose application is in the devices of machines, tools, printing, perforation, packing and others. El proyecto de un sistema hidráulico, comprende el diseño, selección de materiales y construcción del pistón hidráulico, circuito hidráulico y el ensamble con l...

  2. Bubble visualization in a simulated hydraulic jump

    CERN Document Server

    Witt, Adam; Shen, Lian

    2013-01-01

    This is a fluid dynamics video of two- and three-dimensional computational fluid dynamics simulations carried out at St. Anthony Falls Laboratory. A transient hydraulic jump is simulated using OpenFOAM, an open source numerical solver. A Volume of Fluid numerical method is employed with a realizable k-epsilon turbulence model. The goal of this research is to model the void fraction and bubble size in a transient hydraulic jump. This fluid dynamics video depicts the air entrainment characteristics and bubble behavior within a hydraulic jump of Froude number 4.82.

  3. Improving large-scale groundwater models by considering fossil gradients

    Science.gov (United States)

    Schulz, Stephan; Walther, Marc; Michelsen, Nils; Rausch, Randolf; Dirks, Heiko; Al-Saud, Mohammed; Merz, Ralf; Kolditz, Olaf; Schüth, Christoph

    2017-05-01

    Due to limited availability of surface water, many arid to semi-arid countries rely on their groundwater resources. Despite the quasi-absence of present day replenishment, some of these groundwater bodies contain large amounts of water, which was recharged during pluvial periods of the Late Pleistocene to Early Holocene. These mostly fossil, non-renewable resources require different management schemes compared to those which are usually applied in renewable systems. Fossil groundwater is a finite resource and its withdrawal implies mining of aquifer storage reserves. Although they receive almost no recharge, some of them show notable hydraulic gradients and a flow towards their discharge areas, even without pumping. As a result, these systems have more discharge than recharge and hence are not in steady state, which makes their modelling, in particular the calibration, very challenging. In this study, we introduce a new calibration approach, composed of four steps: (i) estimating the fossil discharge component, (ii) determining the origin of fossil discharge, (iii) fitting the hydraulic conductivity with a pseudo steady-state model, and (iv) fitting the storage capacity with a transient model by reconstructing head drawdown induced by pumping activities. Finally, we test the relevance of our approach and evaluated the effect of considering or ignoring fossil gradients on aquifer parameterization for the Upper Mega Aquifer (UMA) on the Arabian Peninsula.

  4. Hydraulic Fracturing and the Environment

    Science.gov (United States)

    Ayatollahy Tafti, T.; Aminzadeh, F.; Jafarpour, B.; de Barros, F.

    2013-12-01

    In this presentation, we highlight two key environmental concerns of hydraulic fracturing (HF), namely induced seismicity and groundwater contamination (GC). We examine the induced seismicity (IS) associated with different subsurface fluid injection and production (SFIP) operations and the key operational parameters of SFIP impacting it. In addition we review the key potential sources for possible water contamination. Both in the case of IS and GC we propose modeling and data analysis methods to quantify the risk factors to be used for monitoring and risk reduction. SFIP include presents a risk in hydraulic fracturing, waste water injection, enhanced oil recovery as well as geothermal energy operations. Although a recent report (NRC 2012) documents that HF is not responsible for most of the induced seismicities, we primarily focus on HF here. We look into vaious operational parameters such as volume and rate of water injection, the direction of the well versus the natural fracture network, the depth of the target and the local stress field and fault system, as well as other geological features. The latter would determine the potential for triggering tectonic related events by small induced seismicity events. We provide the building blocks for IS risk assessment and monitoring. The system we propose will involve adequate layers of complexity based on mapped seismic attributes as well as results from ANN and probabilistic predictive modeling workflows. This leads to a set of guidelines which further defines 'safe operating conditions' and 'safe operating zones' which will be a valuable reference for future SFIP operations. We also illustrate how HF can lead to groundwater aquifer contamination. The source of aquifer contamination can be the hydrocarbon gas or the chemicals used in the injected liquid in the formation. We explore possible pathways of contamination within and discuss the likelihood of contamination from each source. Many of the chemical compounds used

  5. Detection of cavitation vortex in hydraulic turbines using acoustic techniques

    Science.gov (United States)

    Candel, I.; Bunea, F.; Dunca, G.; Bucur, D. M.; Ioana, C.; Reeb, B.; Ciocan, G. D.

    2014-03-01

    Cavitation phenomena are known for their destructive capacity in hydraulic machineries and are caused by the pressure decrease followed by an implosion when the cavitation bubbles find an adverse pressure gradient. A helical vortex appears in the turbine diffuser cone at partial flow rate operation and can be cavitating in its core. Cavity volumes and vortex frequencies vary with the under-pressure level. If the vortex frequency comes close to one of the eigen frequencies of the turbine, a resonance phenomenon may occur, the unsteady fluctuations can be amplified and lead to important turbine and hydraulic circuit damage. Conventional cavitation vortex detection techniques are based on passive devices (pressure sensors or accelerometers). Limited sensor bandwidths and low frequency response limit the vortex detection and characterization information provided by the passive techniques. In order to go beyond these techniques and develop a new active one that will remove these drawbacks, previous work in the field has shown that techniques based on acoustic signals using adapted signal content to a particular hydraulic situation, can be more robust and accurate. The cavitation vortex effects in the water flow profile downstream hydraulic turbines runner are responsible for signal content modifications. Basic signal techniques use narrow band signals traveling inside the flow from an emitting transducer to a receiving one (active sensors). Emissions of wide band signals in the flow during the apparition and development of the vortex embeds changes in the received signals. Signal processing methods are used to estimate the cavitation apparition and evolution. Tests done in a reduced scale facility showed that due to the increasing flow rate, the signal -- vortex interaction is seen as modifications on the received signal's high order statistics and bandwidth. Wide band acoustic transducers have a higher dynamic range over mechanical elements; the system's reaction time

  6. Study on Characteristics of Hydraulic Servo System for Force Control of Hydraulic Robots

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyo-gon; Han, Changsoo [Hanyang University, Seoul (Korea, Republic of); Lee, Jong-won [Korea University of Science and Technology, Seoul (Korea, Republic of); Park, Sangdeok [Korea Institute of Industrial Technology, Seoul (Korea, Republic of)

    2015-02-15

    Because a hydraulic actuator has high power and force densities, this allows the weight of the robot's limbs to be reduced. This allows for good dynamic characteristics and high energy efficiency. Thus, hydraulic actuators are used in some exoskeleton robots and quadrupedal robots that require high torque. Force control is useful for robot compliance with a user or environment. However, force control of a hydraulic robot is difficult because a hydraulic servo system is highly nonlinear from a control perspective. In this study, a nonlinear model was used to develop a simulation program for a hydraulic servo system consisting of a servo valve, transmission lines, and a cylinder. The problems and considerations with regard to the force control performance for a hydraulic servo system were investigated. A force control method using the nonlinear model was proposed, and its effect was evaluated with the simulation program.

  7. Hydraulic characteristics and sediment generation on slope erosion in the Three Gorges Reservoir Area, China

    Directory of Open Access Journals (Sweden)

    Qian Feng

    2016-09-01

    Full Text Available Hydrological processes play important roles in soil erosion processes of the hillslopes. This study was conducted to investigate the hydrological processes and the associated erosional responses on the purple soil slope. Based on a comprehensive survey of the Wangjiaqiao watershed in the Three Gorges Reservoir, four typical slope gradients (5°, 10°, 15°and 20° were applied to five rainfall intensities (0.6, 1.1, 1.61, 2.12 and 2.54 mm·min-1. The results showed that both surface and subsurface runoff varied greatly depending on the rainfall intensity and slope gradient. Surface runoff volume was 48.1 to 280.1 times of that for subsurface runoff. The critical slope gradient was about 10°. The sediment yield rate increased with increases in both rainfall intensity and slope gradient, while the effect of rainfall intensity on the sediment yield rate was greater than slope gradient. There was a good linear relationship between sediment yield rate and Reynolds numbers, flow velocity and stream power, while Froude numbers, Darcy-Weisbach and Manning friction coefficients were not good hydraulic indicators of the sediment yield rate of purple soil erosion. Among the three good indicators (Re, v and w, stream power was the best predictor of sediment yield rate (R2 = 0.884. Finally, based on the power regression relationship between sediment yield rate, runoff rate, slope gradient and rainfall intensity, an erosion model was proposed to predict the purple soil erosion (R2 = 0.897. The results can help us to understand the relationship between flow hydraulics and sediment generation of slope erosion and offer useful data for the building of erosion model in purple soil.

  8. Parker Hybrid Hydraulic Drivetrain Demonstration

    Energy Technology Data Exchange (ETDEWEB)

    Collett, Raymond [Parker-Hannifin Corporation, Cleveland, OH (United States); Howland, James [Parker-Hannifin Corporation, Cleveland, OH (United States); Venkiteswaran, Prasad [National Energy Technology Lab. (NETL), Morgantown, WV (United States)

    2014-03-31

    This report examines the benefits of Parker Hannifin hydraulic hybrid brake energy recovery systems used in commercial applications for vocational purposes. A detailed background on the problem statement being addressed as well as the solution set specific for parcel delivery will be provided. Objectives of the demonstration performed in high start & stop applications included opportunities in fuel usage reduction, emissions reduction, vehicle productivity, and vehicle maintenance. Completed findings during the demonstration period and parallel investigations with NREL, CALSTART, along with a literature review will be provided herein on this research area. Lastly, results identified in the study by third parties validated the savings potential in fuel reduction of on average of 19% to 52% over the baseline in terms of mpg (Lammert, 2014, p11), Parker data for parcel delivery vehicles in the field parallels this at a range of 35% - 50%, emissions reduction of 17.4% lower CO2 per mile and 30.4% lower NOx per mile (Gallo, 2014, p15), with maintenance improvement in the areas of brake and starter replacement, while leaving room for further study in the area of productivity in terms of specific metrics that can be applied and studied.

  9. Thermal hydraulics development for CASL

    Energy Technology Data Exchange (ETDEWEB)

    Lowrie, Robert B [Los Alamos National Laboratory

    2010-12-07

    This talk will describe the technical direction of the Thermal-Hydraulics (T-H) Project within the Consortium for Advanced Simulation of Light Water Reactors (CASL) Department of Energy Innovation Hub. CASL is focused on developing a 'virtual reactor', that will simulate the physical processes that occur within a light-water reactor. These simulations will address several challenge problems, defined by laboratory, university, and industrial partners that make up CASL. CASL's T-H efforts are encompassed in two sub-projects: (1) Computational Fluid Dynamics (CFD), (2) Interface Treatment Methods (ITM). The CFD subproject will develop non-proprietary, scalable, verified and validated macroscale CFD simulation tools. These tools typically require closures for their turbulence and boiling models, which will be provided by the ITM sub-project, via experiments and microscale (such as DNS) simulation results. The near-term milestones and longer term plans of these two sub-projects will be discussed.

  10. Transputer Control of Hydraulic Actuators and Robots

    DEFF Research Database (Denmark)

    Conrad, Finn

    1996-01-01

    Results from a Danish mechatronics research program entitled IMCIA - Intelligent Control and Intelligent Actuators. The objective is development of intelligent actuators for intelligent motion control. A mechatronics test facility with a transputer controlled hydraulic robot suiteable for real...

  11. Concept Evaluation for Hydraulic Yaw System

    DEFF Research Database (Denmark)

    Stubkier, Søren; Pedersen, Henrik C.; Andersen, Torben Ole

    2013-01-01

    a suspension system on a car, leading the loads away from the turbine structure. However, to realize a soft hydraulic yaw system a new design concept must be found. As a part of the development of the new concept a preliminary concept evaluation has been conducted, evaluating seven different hydraulic yaw...... concepts, ranging from a one-to-one copy of the electrical drive (electrical drives replaced by hydraulic dittos), to floating suspension systems mounted on hydraulic cylinders. Rough calculations of size and consequences of the different systems are presented ending up with the final concept for further...... investigation. Loads and yaw demands are based on the IEC 61400-1 standard for wind turbine design, and the loads for this examination are extrapolated from the HAWC2 aeroelastic design code. The concepts are based on a 5 MW off-shore turbine....

  12. HYDRAULICS, Des Moines COUNTY, IOWA, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydraulic data include spatial datasets and data tables necessary for documenting the hydrologic procedures for estimating flood discharges for a flood insurance...

  13. ON THE THEORIES OF HYDRAULIC GEOMETRY

    Institute of Scientific and Technical Information of China (English)

    Vijay P. SINGH

    2003-01-01

    Hydraulic geometry is of fundamental importance in planning, design, and management of river engineering and training works. Although some concepts of hydraulic geometry were proposed toward the end of the nineteenth century, the real impetus toward formulating a theory of hydraulic geometry was provided by the work of Leopold and Maddock (1953). A number of theories have since been proposed.Some of the theories are interrelated but others are based on quite different principles. All theories,however, assume that the river flow is steady and uniform and the river tends to attain a state of equilibrium or quasi-equilibrium. The differences are due to the differences in hydraulic mechanisms that the theories employ to explain the attainment of equilibrium by the river.

  14. Stream restoration hydraulic design course: lecture notes

    National Research Council Canada - National Science Library

    Newbury, R

    2002-01-01

    Steam restoration encompasses a broad range of activities and disciplines. This lecture series is designed for practitioners who must fit habitat improvement works in the hydraulics of degraded channels...

  15. Drawing a pictogram operator - hydraulic stowing assembly

    Energy Technology Data Exchange (ETDEWEB)

    Bukhgol' ts, V.P.; Dinershtein, V.A.

    1984-11-01

    Hydraulic stowing is widely used during the extraction of coal from seams prone to spontaneous ignition or from seams situated under preserved structures. Experience has shown that the presence of a considerable number of controlling and measuring devices on hydraulic stowing assemblies results in erratic operations. The authors, after examining the controls of the hydraulic stowing complexes, recommend that all functions which the operator might perform badly or not at all should be controlled automatically. The operator must, however, have access to manual controls which should be included in the system in order to achieve an effective and trouble free operation. The authors propose a pictogram to explain the relationship between the human operator and the hydraulic complex, based on structural diagrams. The system developed, which was tried out at the Koksovaya mine, increased the efficiency of the complex and reduced the work load of the operator. 3 references.

  16. HYDRAULICS, Des Moines COUNTY, IOWA, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydraulic data include spatial datasets and data tables necessary for documenting the hydrologic procedures for estimating flood discharges for a flood insurance...

  17. Hydraulic fracturing chemicals and fluids technology

    CERN Document Server

    Fink, Johannes

    2013-01-01

    When classifying fracturing fluids and their additives, it is important that production, operation, and completion engineers understand which chemical should be utilized in different well environments. A user's guide to the many chemicals and chemical additives used in hydraulic fracturing operations, Hydraulic Fracturing Chemicals and Fluids Technology provides an easy-to-use manual to create fluid formulations that will meet project-specific needs while protecting the environment and the life of the well. Fink creates a concise and comprehensive reference that enables the engineer to logically select and use the appropriate chemicals on any hydraulic fracturing job. The first book devoted entirely to hydraulic fracturing chemicals, Fink eliminates the guesswork so the engineer can select the best chemicals needed on the job while providing the best protection for the well, workers and environment. Pinpoints the specific compounds used in any given fracturing operation Provides a systematic approach to class...

  18. Transputer Control of Hydraulic Actuators and Robots

    DEFF Research Database (Denmark)

    Conrad, Finn

    1996-01-01

    Results from a Danish mechatronics research program entitled IMCIA - Intelligent Control and Intelligent Actuators. The objective is development of intelligent actuators for intelligent motion control. A mechatronics test facility with a transputer controlled hydraulic robot suiteable for real...

  19. 46 CFR 112.50-3 - Hydraulic starting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Hydraulic starting. 112.50-3 Section 112.50-3 Shipping... POWER SYSTEMS Emergency Diesel and Gas Turbine Engine Driven Generator Sets § 112.50-3 Hydraulic starting. A hydraulic starting system must meet the following: (a) The hydraulic starting system must be...

  20. 21 CFR 870.2780 - Hydraulic, pneumatic, or photoelectric plethysmographs.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Hydraulic, pneumatic, or photoelectric... § 870.2780 Hydraulic, pneumatic, or photoelectric plethysmographs. (a) Identification. A hydraulic... using hydraulic, pneumatic, or photoelectric measurement techniques. (b) Classification. Class...

  1. Response of Compacted Bentonites to Thermal and Thermo-Hydraulic Loadings at High Temperatures

    Directory of Open Access Journals (Sweden)

    Snehasis Tripathy

    2017-07-01

    Full Text Available The final disposal of high-level nuclear waste in many countries is preferred to be in deep geological repositories. Compacted bentonites are proposed for use as the buffer surrounding the waste canisters which may be subjected to both thermal and hydraulic loadings. A significant increase in the temperature is anticipated within the buffer, particularly during the early phase of the repository lifetime. In this study, several non-isothermal and non-isothermal hydraulic tests were carried on compacted MX80 bentonite. Compacted bentonite specimens (water content = 15.2%, dry density = 1.65 Mg/m3 were subjected to a temperature of either 85 or 150 °C at one end, whereas the temperature at the opposite end was maintained at 25 °C. During the non-isothermal hydraulic tests, water was supplied from the opposite end of the heat source. The temperature and relative humidity were monitored along predetermined depths of the specimens. The profiles of water content, dry density, and degree of saturation were established after termination of the tests. The test results showed that thermal gradients caused redistribution of the water content, whereas thermo-hydraulic gradients caused both redistribution and an increase in the water content within compacted bentonites, both leading to development of axial stress of various magnitudes. The applied water injection pressures (5 and 600 kPa and temperature gradients appeared to have very minimal impact on the magnitude of axial stress developed. The thickness of thermal insulation layer surrounding the testing devices was found to influence the temperature and relative humidity profiles thereby impacting the redistribution of water content within compacted bentonites. Under the influence of both the applied thermal and thermo-hydraulic gradients, the dry density of the bentonite specimens increased near the heat source, whereas it decreased at the opposite end. The test results emphasized the influence of

  2. RESEARCH OF THE DYNAMIC CHARACTERISTICS ON A NEW HYDRAULIC SYSTEM OF ELECTRO-HYDRAULIC HAMMER

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A new typed hydraulic system of electro-hydraulic hammer is researched and developed.By means of power bond graphs the modeling and simulation to the dynamic characteristics of the new hydraulic system are performed. The experimental research which is emphasized on the blowing stroke is also performed. It is proved from the result of simulation and experiment that this new hydraulic system possesses such advantages as simplification of structure,flexibleness of operation and reliability of working. Especially it possesses better dynamic characteristics.

  3. Design of a laboratory hydraulic device for testing of hydraulic pumps

    Directory of Open Access Journals (Sweden)

    Pavel Máchal

    2013-01-01

    Full Text Available The present contribution deals with solves problem of research of testing device to monitor of hydrostatic pumps durability about dynamic loading under laboratory conditions. When carrying out the design of testing device are based on load characteristics of tractor hydraulic circuit, the individual characteristics of hydraulic components and performed calculations. Load characteristics on the tractors CASE IH Magnum 310, JOHN DEERE 8100, ZETOR FORTERRA 114 41 and Fendt 926 Vario were measured. Design of a hydraulic laboratory device is based on the need for testing new types of hydraulic pumps or various types of hydraulic fluids. When creating of hydraulic device we focused on testing hydraulic pumps used in agricultural and forestry tractors. Proportional pressure control valve is an active member of the hydraulic device, which provides change of a continuous control signal into relative pressure of operating fluid. The advantage of a designed hydraulic system is possibility of simulation of dynamic operating loading, which is obtained by measurement under real conditions, and thereby creates laboratory conditions as close to real conditions as possible. The laboratory device is constructed at the Department of Transport and Handling, Faculty of Engineering, Slovak University of Agriculture in Nitra.

  4. Sobolev gradients and differential equations

    CERN Document Server

    Neuberger, J W

    2010-01-01

    A Sobolev gradient of a real-valued functional on a Hilbert space is a gradient of that functional taken relative to an underlying Sobolev norm. This book shows how descent methods using such gradients allow a unified treatment of a wide variety of problems in differential equations. For discrete versions of partial differential equations, corresponding Sobolev gradients are seen to be vastly more efficient than ordinary gradients. In fact, descent methods with these gradients generally scale linearly with the number of grid points, in sharp contrast with the use of ordinary gradients. Aside from the first edition of this work, this is the only known account of Sobolev gradients in book form. Most of the applications in this book have emerged since the first edition was published some twelve years ago. What remains of the first edition has been extensively revised. There are a number of plots of results from calculations and a sample MatLab code is included for a simple problem. Those working through a fair p...

  5. Characterization of a hydraulically induced bedrock fracture

    OpenAIRE

    2014-01-01

    Hydraulic fracturing is a controversial practice because of concerns about environmental impacts due to its widespread use in recovering unconventional petroleum and natural gas deposits. However, water-only hydraulic fracturing has been used safely and successfully for many years to increase the permeability of aquifers used for drinking and irrigation water supply. This process extends and widens existing bedrock fractures, allowing groundwater storage to increase. Researchers have studied ...

  6. FEEDBACK LINEARISATION APPLIED ON A HYDRAULIC

    DEFF Research Database (Denmark)

    Andersen, Torben Ole; Hansen, Michael Rygaard; Pedersen, Henrik C.;

    2005-01-01

    Generally most hydraulic systems are intrensically non-linear, why applying linear control techniques typically results in conservatively dimensioned controllers to obtain stable performance. Non-linear control techniques have the potential of overcoming these problems, and in this paper the focus...... is on developing and applying several different feedback linearisation (FL) controllers to the individual servo actuators in a hydraulically driven servo robot to evaluate and compare their possiblities and limitations. This is done based on both simulation and experimental results....

  7. Data Analytics of Hydraulic Fracturing Data

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Jovan Yang [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Viswanathan, Hari [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hyman, Jeffery [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Middleton, Richard [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-08-11

    These are a set of slides on the data analytics of hydraulic fracturing data. The conclusions from this research are the following: they proposed a permeability evolution as a new mechanism to explain hydraulic fracturing trends; they created a model to include this mechanism and it showed promising results; the paper from this research is ready for submission; they devised a way to identify and sort refractures in order to study their effects, and this paper is currently being written.

  8. Hydraulic Motor Driving Variable-Pitch System for Wind Turbine

    Directory of Open Access Journals (Sweden)

    Ye HUANG

    2013-11-01

    Full Text Available The present hydraulic variable-pitch mechanism of wind turbine uses three hydraulic cylinders to drive three crank and connecting rod mechanisms respectively; the blades are moved with the cranks. The hydraulic variable-pitch mechanism has complex structure, occupies a lot of space and its maintenance is trouble. In order to make up for the shortcomings of hydraulic cylinder variable-pitch system, the present hydraulic variable-pitch mechanism should be changed as follows: hydraulic motors are used to drive gears; gears drive blades; the electro-hydraulic proportional valves are used to control hydraulic motors. The hydraulic control part and electrical control part of variable-pitch system is redesigned. The new variable-pitch system is called hydraulic motor driving variable-pitch system. The new variable-pitch system meets the control requirements of blade pitch, makes the structure simple and its application effect is perfect.    

  9. Hydraulic responses of whole vines and individual roots of kiwifruit (Actinidia chinensis) following root severance.

    Science.gov (United States)

    Black, Marykate Z; Patterson, Kevin J; Minchin, Peter E H; Gould, Kevin S; Clearwater, Michael J

    2011-05-01

    Whole vine (K(plant)) and individual root (K(root)) hydraulic conductances were measured in kiwifruit (Actinidia chinensis Planch. var. chinensis 'Hort16A') vines to observe hydraulic responses following partial root system excision. Heat dissipation and compensation heat pulse techniques were used to measure sap flow in trunks and individual roots, respectively. Sap flux and measurements of xylem pressure potential (Ψ) were used to calculate K(plant) and K(root) in vines with zero and ∼80% of roots severed. Whole vine transpiration (E), Ψ and K(plant) were significantly reduced within 24 h of root pruning, and did not recover within 6 weeks. Sap flux in intact roots increased within 24 h of root pruning, driven by an increase in the pressure gradient between the soil and canopy and without any change in root hydraulic conductance. Photosynthesis (A) and stomatal conductance (g(s)) were reduced, without significant effects on leaf internal CO(2) concentration (c(i)). Shoot growth rates were maintained; fruit growth and dry matter content were increased following pruning. The woody roots of kiwifruit did not demonstrate a rapid dynamic response to root system damage as has been observed previously in monocot seedlings. Increased sap flux in intact roots with no change in K(root) and only a moderate decline in shoot A suggests that under normal growing conditions root hydraulic conductance greatly exceeds requirements for adequate shoot hydration.

  10. Evaluating temporal changes in hydraulic conductivities near karst-terrain dams: Dokan Dam (Kurdistan-Iraq)

    Science.gov (United States)

    Dafny, Elad; Tawfeeq, Kochar Jamal; Ghabraie, Kazem

    2015-10-01

    Dam sites provide an outstanding opportunity to explore dynamic changes in the groundwater flow regime because of the high hydraulic gradient rapidly induced in their surroundings. This paper investigates the temporal changes of the hydraulic conductivities of the rocks and engineered structures via a thorough analysis of hydrological data collected at the Dokam Dam, Iraq, and a numerical model that simulates the Darcian component of the seepage. Analysis of the data indicates increased seepage with time and suggests that the hydraulic conductivity of the rocks increased as the conductivity of the grout curtain decreased. Conductivity changes on the order of 10-8 m/s, in a 20-yr period were quantified using the numerical analysis. It is postulated that the changes in hydraulic properties in the vicinity of Dokan Dam are due to suspension of fine materials, interbedded in small fissures in the rocks, and re-settlement of these materials along the curtain. Consequently, the importance of the grout curtain to minimize the downstream seepage, not only as a result of the conductivity contrast with the rocks, but also as a barrier to suspended clay sediments, is demonstrated. The numerical analysis also helped us to estimate the proportion of the disconnected karstic conduit flow to the overall flow.

  11. Development of two-phase pipeline hydraulic analysis model based on Beggs-Brill correlation

    Science.gov (United States)

    Waluyo, Joko; Hermawan, Achilleus; Indarto

    2016-06-01

    The hydraulic analysis is an important stage in a reliable pipeline design. In the implementation, fluid distribution from a source to the sinks often occurs on parallel pipeline networks. The solution to the problem is complicated because of the iterative technique requirement. Regarding its solution effectiveness, there is a need for analysis related to the model and the solution method. This study aims to investigate pipeline hydraulic analysis on distributing of two-phase fluids flow. The model uses Beggs-Brill correlation to converse mass flow rates into pressure drops. In the solution technique, the Newton-Raphson iterative method is utilized. The iterative technique is solved using a computer program. The study is carried out using a certain pipeline network. The model is validated by comparing between Beggs-Brill towards Mukherjee-Brill correlation. The result reveals that the computer program enables solving of iterative calculation on the parallel pipeline hydraulic analysis. Convergence iteration is achieved by 50 iterations. The main results of the model are mass flow rate and pressure drop. The mass flow rate is obtained in the deviation up to 2.06%, between Beggs-Brill and Mukherjee-Brill correlation. On the other hand, the pressure gradient deviation is achieved on a higher deviation due to the different approach of the two correlations. The model can be further developed in the hydraulic pipeline analysis for two-phase flow.

  12. Gradient zone boundary control in salt gradient solar ponds

    Energy Technology Data Exchange (ETDEWEB)

    Hull, John R. (Downers Grove, IL)

    1984-01-01

    A method and apparatus for suppressing zone boundary migration in a salt gradient solar pond includes extending perforated membranes across the pond at the boundaries, between the convective and non-convective zones, the perforations being small enough in size to prevent individual turbulence disturbances from penetrating the hole, but being large enough to allow easy molecular diffusion of salt thereby preventing the formation of convective zones in the gradient layer. The total area of the perforations is a sizable fraction of the membrane area to allow sufficient salt diffusion while preventing turbulent entrainment into the gradient zone.

  13. Hydraulic Conductivity Anisotropy of Heterogeneous Unsaturated Soils

    Science.gov (United States)

    Sun, Dongmin; Zhu, Jianting

    2010-05-01

    The effects of saturation degree (or capillary pressure) on hydraulic conductivity anisotropy in unsaturated soils have not been fully understood. This study developed an approach based on a conceptualization of combining the neural network based pedo-transfer function (PTF) results with the thin layer concept to explore the capillary pressure-dependent anisotropy in relation to soil texture and soil bulk density. The main objective is to examine how anisotropy characteristics are related to the relationships between hydraulic parameters and the basic soil attributes such as texture and bulk density. The hydraulic parameters are correlated with the texture and bulk density based on the pedo-transfer function (PTF) results. It is demonstrated that non-monotonic behavior of the unsaturated soil anisotropy in relation to the capillary pressure is only observed when the saturated hydraulic conductivity and the shape parameter are both related to the mean particle diameter. When only one hydraulic parameter is related to the grain diameter or when both are not related to the same attribute simultaneously, the unsaturated soil anisotropy increases monotonically with the increasing capillary pressure head. Therefore, it is suggested that this behavior is mainly due to the coupled dependence of the layer saturated hydraulic conductivities and the shape factors on the texture and bulk density. The correlation between the soil grain diameter and bulk density decreases the anisotropy effects of the unsaturated layered soils. The study illustrates that the inter-relationships of soil texture, bulk density, and hydraulic properties may cause vastly different characteristics of anisotropic unsaturated soils.

  14. Hydraulic fracturing to enhance the remediation of DNAPL in low permeability soils

    Energy Technology Data Exchange (ETDEWEB)

    Murdoch, L. [Univ. of Cincinnati, OH (United States); Slack, B. [FRX Inc., Cincinnati, OH (United States)

    1996-08-01

    Meager rates of fluid flow are a major obstacle to in situ remediation of low permeability soils. This paper describes methods designed to avoid that obstacle by creating fractures and filling them with sand to increase well discharge and change paths of fluid flow in soil. Gently dipping fractures 10 m in maximum dimension and 1 to 2 cm thick can be created in some contaminated soils at depths of a few in or greater. Hydraulic fractures can also be used to create electrically conductive layers or to deliver granules of chemically or biologically active compounds that will degrade contaminants in place. Benefits of applying hydraulic fractures to DNAPL recovery include rates of fluid recovery, enhancing upward gradients to improve hydrodynamic stabilization, forming flat-lying reactive curtains to intersect compounds moving downward, or improving the performance of electrokinetics intended to recover compounds dissolved in water. 30 refs., 7 figs., 1 tab.

  15. Thermal-hydraulic modeling and analysis of hydraulic system by pseudo-bond graph

    Institute of Scientific and Technical Information of China (English)

    胡均平; 李科军

    2015-01-01

    To increase the efficiency and reliability of the thermodynamics analysis of the hydraulic system, the method based on pseudo-bond graph is introduced. According to the working mechanism of hydraulic components, they can be separated into two categories: capacitive components and resistive components. Then, the thermal-hydraulic pseudo-bond graphs of capacitive C element and resistance R element were developed, based on the conservation of mass and energy. Subsequently, the connection rule for the pseudo-bond graph elements and the method to construct the complete thermal-hydraulic system model were proposed. On the basis of heat transfer analysis of a typical hydraulic circuit containing a piston pump, the lumped parameter mathematical model of the system was given. The good agreement between the simulation results and experimental data demonstrates the validity of the modeling method.

  16. Sobolev gradients and differential equations

    CERN Document Server

    Neuberger, John William

    1997-01-01

    A Sobolev gradient of a real-valued functional is a gradient of that functional taken relative to the underlying Sobolev norm. This book shows how descent methods using such gradients allow a unified treatment of a wide variety of problems in differential equations. Equal emphasis is placed on numerical and theoretical matters. Several concrete applications are made to illustrate the method. These applications include (1) Ginzburg-Landau functionals of superconductivity, (2) problems of transonic flow in which type depends locally on nonlinearities, and (3) minimal surface problems. Sobolev gradient constructions rely on a study of orthogonal projections onto graphs of closed densely defined linear transformations from one Hilbert space to another. These developments use work of Weyl, von Neumann and Beurling.

  17. Conjugate Gradient with Subspace Optimization

    CERN Document Server

    Karimi, Sahar

    2012-01-01

    In this paper we present a variant of the conjugate gradient (CG) algorithm in which we invoke a subspace minimization subproblem on each iteration. We call this algorithm CGSO for "conjugate gradient with subspace optimization". It is related to earlier work by Nemirovsky and Yudin. We apply the algorithm to solve unconstrained strictly convex problems. As with other CG algorithms, the update step on each iteration is a linear combination of the last gradient and last update. Unlike some other conjugate gradient methods, our algorithm attains a theoretical complexity bound of $O(\\sqrt{L/l} \\log(1/\\epsilon))$, where the ratio $L/l$ characterizes the strong convexity of the objective function. In practice, CGSO competes with other CG-type algorithms by incorporating some second order information in each iteration.

  18. Flame Propagation Through Concentration Gradient

    Institute of Scientific and Technical Information of China (English)

    JunyaIINO; MitsuakiTANABE; 等

    2000-01-01

    The experiment was carried out in homogeneous propane-air mixture and in several concentration gradient of mixture.Igniter is put on the upper side of the combustion chamber,In concentration gradient experiment.ixture was ignited from lean side.An experimental study was conducted in a combustion chamber.The combustion chamber has glass windows for optical measurements at any side.For the measurement of distribution of fuel concentration,infraed absorption method using 3.39μm He-Ne laser was used,and for the observation of proagating flams,Schlieren method was employed.As a measurment result of flame propagation velocity and flammable limit,for a mixture of an identical local equivalence ratio.flame propagation velocity in concentration gradient is faster than that in homogeneous mixture,and rich flammable limit in concentration gradient shows a tendency to be higher than that in homogeneous mixture.

  19. Effect of Natural Fractures on Hydraulic Fracturing

    Science.gov (United States)

    Ben, Y.; Wang, Y.; Shi, G.

    2012-12-01

    Hydraulic Fracturing has been used successfully in the oil and gas industry to enhance oil and gas production in the past few decades. Recent years have seen the great development of tight gas, coal bed methane and shale gas. Natural fractures are believed to play an important role in the hydraulic fracturing of such formations. Whether natural fractures can benefit the fracture propagation and enhance final production needs to be studied. Various methods have been used to study the effect of natural fractures on hydraulic fracturing. Discontinuous Deformation Analysis (DDA) is a numerical method which belongs to the family of discrete element methods. In this paper, DDA is coupled with a fluid pipe network model to simulate the pressure response in the formation during hydraulic fracturing. The focus is to study the effect of natural fractures on hydraulic fracturing. In particular, the effect of rock joint properties, joint orientations and rock properties on fracture initiation and propagation will be analyzed. The result shows that DDA is a promising tool to study such complex behavior of rocks. Finally, the advantages of disadvantages of our current model and future research directions will be discussed.

  20. Microbial effect on soil hydraulic properties

    Science.gov (United States)

    Furman, Alex; Rosenzweig, Ravid; Volk, Elazar; Rosenkranz, Hella; Iden, Sascha; Durner, Wolfgang

    2014-05-01

    Although largely ignored, the soil contains large amount of biofilms (attached microbes) that can affect many processes. While biochemical processes are studied, biophysical processes receive only little attention. Biofilms may occupy some of the pore space, and by that affect the soil hydraulic properties. This effect on unsaturated soils, however, was not intensively studied. In this research we directly measure the hydraulic properties, namely the soil's unsaturated hydraulic conductivity function and retention curve, for soils containing real biofilm. To do that we inoculate soil with biofilm-forming bacteria and incubate it with sufficient amounts of nutrient until biofilm is formed. The hydraulic properties of the incubated soil are then measured using several techniques, including multi-step outflow and evaporation method. The longer measurements (evaporation method) are conducted under refrigeration conditions to minimize microbial activity during the experiment. The results show a clear effect of the biofilm, where the biofilm-affected soil (sandy loam in our case) behaves like a much finer soil. This qualitatively makes sense as the biofilm generates an effective pore size distribution that is characterized by smaller pores. However, the effect is much more complex and needs to be studied carefully considering (for example) dual porosity models. We compare our preliminary results with other experiments, including flow-through column experiments and experiments with biofilm analogues. Clearly a better understanding of the way microbial activity alters the hydraulic properties may help designing more efficient bioremediation, irrigation, and other soil-related processes.

  1. Vibration Isolation for Parallel Hydraulic Hybrid Vehicles

    Directory of Open Access Journals (Sweden)

    The M. Nguyen

    2008-01-01

    Full Text Available In recent decades, several types of hybrid vehicles have been developed in order to improve the fuel economy and to reduce the pollution. Hybrid electric vehicles (HEV have shown a significant improvement in fuel efficiency for small and medium-sized passenger vehicles and SUVs. HEV has several limitations when applied to heavy vehicles; one is that larger vehicles demand more power, which requires significantly larger battery capacities. As an alternative solution, hydraulic hybrid technology has been found effective for heavy duty vehicle because of its high power density. The mechanical batteries used in hydraulic hybrid vehicles (HHV can be charged and discharged remarkably faster than chemical batteries. This feature is essential for heavy vehicle hybridization. One of the main problems that should be solved for the successful commercialization of HHV is the excessive noise and vibration involving with the hydraulic systems. This study focuses on using magnetorheological (MR technology to reduce the noise and vibration transmissibility from the hydraulic system to the vehicle body. In order to study the noise and vibration of HHV, a hydraulic hybrid subsystem in parallel design is analyzed. This research shows that the MR elements play an important role in reducing the transmitted noise and vibration to the vehicle body. Additionally, locations and orientations of the isolation system also affect the efficiency of the noise and vibration mitigation. In simulations, a skyhook control algorithm is used to achieve the highest possible effectiveness of the MR isolation system.

  2. Long pendulums in gravitational gradients

    Energy Technology Data Exchange (ETDEWEB)

    Suits, B H [Physics Department, Michigan Technological University, Houghton, MI 49931 (United States)

    2006-03-01

    Previous results for long pendulums above a spherical Earth are generalized for arbitrary non-uniform gravitational fields in the limit of small oscillation. As is the case for the previous results, gravitational gradients are multiplied by the length of the string even though the string is assumed massless. The effect is shown to arise from the constraint on the motion imposed by the string. The significance of these results for real gradients is discussed. (letters and comments)

  3. Low-gradient aortic stenosis.

    Science.gov (United States)

    Clavel, Marie-Annick; Magne, Julien; Pibarot, Philippe

    2016-09-07

    An important proportion of patients with aortic stenosis (AS) have a 'low-gradient' AS, i.e. a small aortic valve area (AVA <1.0 cm(2)) consistent with severe AS but a low mean transvalvular gradient (<40 mmHg) consistent with non-severe AS. The management of this subset of patients is particularly challenging because the AVA-gradient discrepancy raises uncertainty about the actual stenosis severity and thus about the indication for aortic valve replacement (AVR) if the patient has symptoms and/or left ventricular (LV) systolic dysfunction. The most frequent cause of low-gradient (LG) AS is the presence of a low LV outflow state, which may occur with reduced left ventricular ejection fraction (LVEF), i.e. classical low-flow, low-gradient (LF-LG), or preserved LVEF, i.e. paradoxical LF-LG. Furthermore, a substantial proportion of patients with AS may have a normal-flow, low-gradient (NF-LG) AS: i.e. a small AVA-low-gradient combination but with a normal flow. One of the most important clinical challenges in these three categories of patients with LG AS (classical LF-LG, paradoxical LF-LG, and NF-LG) is to differentiate a true-severe AS that generally benefits from AVR vs. a pseudo-severe AS that should be managed conservatively. A low-dose dobutamine stress echocardiography may be used for this purpose in patients with classical LF-LG AS, whereas aortic valve calcium scoring by multi-detector computed tomography is the preferred modality in those with paradoxical LF-LG or NF-LG AS. Although patients with LF-LG severe AS have worse outcomes than those with high-gradient AS following AVR, they nonetheless display an important survival benefit with this intervention. Some studies suggest that transcatheter AVR may be superior to surgical AVR in patients with LF-LG AS.

  4. Graded/Gradient Porous Biomaterials

    Directory of Open Access Journals (Sweden)

    Xigeng Miao

    2009-12-01

    Full Text Available Biomaterials include bioceramics, biometals, biopolymers and biocomposites and they play important roles in the replacement and regeneration of human tissues. However, dense bioceramics and dense biometals pose the problem of stress shielding due to their high Young’s moduli compared to those of bones. On the other hand, porous biomaterials exhibit the potential of bone ingrowth, which will depend on porous parameters such as pore size, pore interconnectivity, and porosity. Unfortunately, a highly porous biomaterial results in poor mechanical properties. To optimise the mechanical and the biological properties, porous biomaterials with graded/gradient porosity, pores size, and/or composition have been developed. Graded/gradient porous biomaterials have many advantages over graded/gradient dense biomaterials and uniform or homogenous porous biomaterials. The internal pore surfaces of graded/gradient porous biomaterials can be modified with organic, inorganic, or biological coatings and the internal pores themselves can also be filled with biocompatible and biodegradable materials or living cells. However, graded/gradient porous biomaterials are generally more difficult to fabricate than uniform or homogenous porous biomaterials. With the development of cost-effective processing techniques, graded/gradient porous biomaterials can find wide applications in bone defect filling, implant fixation, bone replacement, drug delivery, and tissue engineering.

  5. A Computational Model of Hydraulic Volume Displacement Drive

    Directory of Open Access Journals (Sweden)

    V. N. Pil'gunov

    2014-01-01

    Full Text Available The paper offers a computational model of industrial-purpose hydraulic drive with two hydraulic volume adjustable working chamber machines (pump and motor. Adjustable pump equipped with the pressure control unit can be run together with several adjustable hydraulic motors on the principle of three-phase hydraulic socket-outlet with high-pressure lines, drain, and drainage system. The paper considers the pressure-controlled hydrostatic transmission with hydraulic motor as an output link. It shows a possibility to create a saving hydraulic drive using a functional tie between the adjusting parameters of the pump and hydraulic motor through the pressure difference, torque, and angular rate of the hydraulic motor shaft rotation. The programmable logic controller can implement such tie. The Coulomb and viscous frictions are taken into consideration when developing a computational model of the hydraulic volume displacement drive. Discharge balance considers external and internal leakages in equivalent clearances of hydraulic machines, as well as compression loss volume caused by hydraulic fluid compressibility and deformation of pipe walls. To correct dynamic properties of hydraulic drive, the paper offers that in discharge balance are included the additional regulated external leakages in the open circuit of hydraulic drive and regulated internal leakages in the closed-loop circuit. Generalized differential equations having functional multipliers and multilinked nature have been obtained to describe the operation of hydraulic positioning and speed drive with two hydraulic volume adjustable working chamber machines. It is shown that a proposed computational model of hydraulic drive can be taken into consideration in development of LS («Load-Sensing» drives, in which the pumping pressure is tuned to the value required for the most loaded slave motor to overcome the load. Results attained can be used both in designing the industrial-purpose heavy

  6. KRIGRADI: A cokriging program for estimating the gradient of spatial variables from sparse data

    Science.gov (United States)

    Pardo-Igúzquiza, Eulogio; Chica-Olmo, Mario

    2007-05-01

    KRIGRADI is a universal cokriging program for estimating the directional derivatives of a spatial variable from sparse measurements of the variable and gradient measurements (if available). Then, the gradient vector field can be estimated because the components of the gradient vector are the directional derivatives along the main axis of coordinates. A typical example is the estimation of the hydraulic gradient from head data in groundwater hydrology. The only inferential requirement is the covariance (or semi-variogram) from the measurements of the variable and any other necessary covariance or cross-covariance is obtained by linear systems theory. There is, then, the possibility of including direct measurements of the gradient (if available, and no matter how few) in the estimation of a directional derivative or in the estimation of the gradient field. This is therefore an application of kriging for estimating a vector field from scalars and where experimental vector values could be used in the estimation. The program implements a number of possibilities for estimating the gradient as described in the appropriate section. The program, written in Fortran, can be easily modified for particular needs if desired. A case study is provided to illustrate the performance and implementation of the program.

  7. Measurement and evaluation of static characteristics of rotary hydraulic motor

    Directory of Open Access Journals (Sweden)

    Hružík Lumír

    2014-03-01

    Full Text Available The paper describes experimental equipment for measurement of static characteristics of rotary hydraulic motor. It is possible to measure flow, pressure, temperature, speed and torque by means of this equipment. It deals with measurement of static characteristics of a gear rotary hydraulic motor. Mineral oil is used as hydraulic liquid in this case. Flow, torque and speed characteristics are evaluated from measured parameters. Measured mechanical-hydraulic, flow and total efficiencies of the rotary hydraulic motor are adduced in the paper. It is possible to diagnose technical conditions of the hydraulic motor (eventually to recommend its exchange from the experimental measurements.

  8. Promoting water hydraulics in Malaysia: A green educational approach

    Science.gov (United States)

    Yusof, Ahmad Anas; Zaili, Zarin Syukri; Hassan, Siti Nor Habibah; Tuan, Tee Boon; Saadun, Mohd Noor Asril; Ibrahim, Mohd Qadafie

    2014-10-01

    In promoting water hydraulics in Malaysia, this paper presents research development of water hydraulics educational training system for secondary and tertiary levels in Malaysia. Water hydraulics trainer with robotic attachment has been studied in order to promote the usefulness of such educational tools in promoting sustainability and green technology in the country. The trainer is being developed in order to allow constructive curriculum development and continuous marketing research for the effectiveness and usefulness of using water in hydraulic power trainer. The research on water-based hydraulic trainer is now possible with the current development in water hydraulics technology.

  9. Hydraulic characterization of hydrothermally altered Nopal tuff

    Energy Technology Data Exchange (ETDEWEB)

    Green, R.T.; Meyer-James, K.A. [Southwest Research Institute, San Antonio, TX (United States); Rice, G. [George Rice and Associates, San Antonio, TX (United States)

    1995-07-01

    Understanding the mechanics of variably saturated flow in fractured-porous media is of fundamental importance to evaluating the isolation performance of the proposed high-level radioactive waste repository for the Yucca Mountain site. Developing that understanding must be founded on the analysis and interpretation of laboratory and field data. This report presents an analysis of the unsaturated hydraulic properties of tuff cores from the Pena Blanca natural analog site in Mexico. The basic intent of the analysis was to examine possible trends and relationships between the hydraulic properties and the degree of hydrothermal alteration exhibited by the tuff samples. These data were used in flow simulations to evaluate the significance of a particular conceptual (composite) model and of distinct hydraulic properties on the rate and nature of water flow.

  10. Simulation of a Hydraulic Pump Control Valve

    Science.gov (United States)

    Molen, G. Vander; Akers, A.

    1987-01-01

    This paper describes the mode of operation of a control valve assembly that is used with a hydraulic pump. The operating system of the valve is modelled in a simplified form, and an analogy for hydraulic resonance of the pressure sensing system is presented. For the control valve investigated, air entrainment, length and diameter of the resonator neck, and valve mass produced the greatest shift in resonant frequency. Experimental work was conducted on the hydraulic system so that the resonance levels and frequencies could be measured and the accuracy of the theory verified. The results obtained make it possible to evaluate what changes to any of the variables considered would be most effective in driving the second harmonic frequency above the operating range.

  11. Soil Structure and Saturated Hydraulic Conductivity

    Science.gov (United States)

    Houskova, B.; Nagy, V.

    The role of soil structure on saturated hydraulic conductivity changes is studied in plough layers of texturally different soils. Three localities in western part of Slovakia in Zitny ostrov (Corn Island) were under investigation: locality Kalinkovo with light Calcaric Fluvisol (FAO 1970), Macov with medium heavy Calcari-mollic Fluvisol and Jurova with heavy Calcari-mollic Fluvisol. Soil structure was determined in dry as well as wet state and in size of macro and micro aggregates. Saturated hydraulic conductivity was measured by the help of double ring method. During the period of ring filling the soil surface was protected against aggregates damage by falling water drops. Spatial and temporal variability of studied parameters was evaluated. Cultivated crops were ensilage maize at medium heavy and heavy soil and colza at light soil. Textural composition of soil and actual water content at the beginning of measurement are one of major factor affecting aggregate stability and consequently also saturated hydraulic conductivity.

  12. Universal asymptotic umbrella for hydraulic fracture modeling

    CERN Document Server

    Linkov, Aleksandr M

    2014-01-01

    The paper presents universal asymptotic solution needed for efficient modeling of hydraulic fractures. We show that when neglecting the lag, there is universal asymptotic equation for the near-front opening. It appears that apart from the mechanical properties of fluid and rock, the asymptotic opening depends merely on the local speed of fracture propagation. This implies that, on one hand, the global problem is ill-posed, when trying to solve it as a boundary value problem under a fixed position of the front. On the other hand, when properly used, the universal asymptotics drastically facilitates solving hydraulic fracture problems (both analytically and numerically). We derive simple universal asymptotics and comment on their employment for efficient numerical simulation of hydraulic fractures, in particular, by well-established Level Set and Fast Marching Methods.

  13. Influence of Concentration and Salinity on the Biodegradability of Organic Additives in Hydraulic Fracturing Fluid

    Science.gov (United States)

    Mouser, P. J.; Kekacs, D.

    2014-12-01

    One of the risks associated with the use of hydraulic fracturing technologies for energy development is the potential release of hydraulic fracturing-related fluids into surface waters or shallow aquifers. Many of the organic additives used in hydraulic fracturing fluids are individually biodegradable, but little is know on how they will attenuate within a complex organic fluid in the natural environment. We developed a synthetic hydraulic fracturing fluid based on disclosed recipes used by Marcellus shale operators to evaluate the biodegradation potential of organic additives across a concentration (25 to 200 mg/L DOC) and salinity gradient (0 to 60 g/L) similar to Marcellus shale injected fluids. In aerobic aqueous solutions, microorganisms removed 91% of bulk DOC from low SFF solutions and 57% DOC in solutions having field-used SFF concentrations within 7 days. Under high SFF concentrations, salinity in excess of 20 g/L inhibited organic compound biodegradation for several weeks, after which time the majority (57% to 75%) of DOC remained in solution. After SFF amendment, the initially biodiverse lake or sludge microbial communities were quickly dominated (>79%) by Pseudomonas spp. Approximately 20% of added carbon was converted to biomass while the remainder was respired to CO2 or other metabolites. Two alcohols, isopropanol and octanol, together accounted for 2-4% of the initial DOC, with both compounds decreasing to below detection limits within 7 days. Alcohol degradation was associated with an increase in acetone at mg/L concentrations. These data help to constrain the biodegradation potential of organic additives in hydraulic fracturing fluids and guide our understanding of the microbial communities that may contribute to attenuation in surface waters.

  14. A model for hydraulic redistribution incorporating coupled soil-root moisture transport

    Directory of Open Access Journals (Sweden)

    G. G. Amenu

    2007-10-01

    Full Text Available One of the adaptive strategies of vegetation, particularly in water limited ecosystems, is the development of deep roots and the use of hydraulic redistribution which enables them to make optimal use of resources available throughout the soil column. Hydraulic redistribution refers to roots acting as a preferential pathway for the movement of water from wet to dry soil layers driven by the moisture gradient – be it from the shallow to deep layers or vice versa. This occurs during the nighttime while during the daytime moisture movement is driven to fulfill the transpiration demand at the canopy. In this study, we develop a model to investigate the effect of hydraulic redistribution by deep roots on the terrestrial climatology. Sierra Nevada eco-region is chosen as the study site which has wet winters and dry summers. Hydraulic redistribution enables the movement of moisture from the upper soil layers to deeper zones during the wet months and this moisture is then available to meet the transpiration demand during the late dry season. It results in significant alteration of the profiles of soil moisture and water uptake as well as increase in the canopy transpiration, carbon assimilation, and the associated water-use-efficiency during the dry summer season. This also makes the presence of roots in deeper soil layers much more important than their proportional abundance would otherwise dictate. Comparison with observations of latent heat from a flux tower demonstrates improved predictability and provides validation of the model results. Hydraulic redistribution serves as a mechanism for the interaction between the variability of deep layer soil-moisture and the land-surface climatology and could have significant implications for seasonal and sub-seasonal climate prediction.

  15. A model for hydraulic redistribution incorporating coupled soil-root moisture transport

    Directory of Open Access Journals (Sweden)

    G. G. Amenu

    2008-01-01

    Full Text Available One of the adaptive strategies of vegetation, particularly in water limited ecosystems, is the development of deep roots and the use of hydraulic redistribution which enables them to make optimal use of resources available throughout the soil column. Hydraulic redistribution refers to roots acting as a preferential pathway for the movement of water from wet to dry soil layers driven by the moisture gradient – be it from the shallow to deep layers or vice versa. This occurs during the nighttime while during the daytime moisture movement is driven to fulfill the transpiration demand at the canopy. In this study, we develop a model to investigate the effect of hydraulic redistribution by deep roots on the terrestrial climatology. Sierra Nevada eco-region is chosen as the study site which has wet winters and dry summers. Hydraulic redistribution enables the movement of moisture from the upper soil layers to deeper zones during the wet months and this moisture is then available to meet the transpiration demand during the late dry season. It results in significant alteration of the profiles of soil moisture and water uptake as well as increase in the canopy transpiration, carbon assimilation, and the associated water-use-efficiency during the dry summer season. This also makes the presence of roots in deeper soil layers much more important than their proportional abundance would otherwise dictate. Comparison with observations of latent heat from a flux tower demonstrates improved predictability and provides validation of the model results. Hydraulic redistribution serves as a mechanism for the interaction between the variability of deep layer soil-moisture and the land-surface climatology and could have significant implications for seasonal and sub-seasonal climate prediction.

  16. Self-potential observations during hydraulic fracturing

    Energy Technology Data Exchange (ETDEWEB)

    Moore, Jeffrey R.; Glaser, Steven D.

    2007-09-13

    The self-potential (SP) response during hydraulic fracturing of intact Sierra granite was investigated in the laboratory. Excellent correlation of pressure drop and SP suggests that the SP response is created primarily by electrokinetic coupling. For low pressures, the variation of SP with pressure drop is linear, indicating a constant coupling coefficient (Cc) of -200 mV/MPa. However for pressure drops >2 MPa, the magnitude of the Cc increases by 80% in an exponential trend. This increasing Cc is related to increasing permeability at high pore pressures caused by dilatancy of micro-cracks, and is explained by a decrease in the hydraulic tortuosity. Resistivity measurements reveal a decrease of 2% prior to hydraulic fracturing and a decrease of {approx}35% after fracturing. An asymmetric spatial SP response created by injectate diffusion into dilatant zones is observed prior to hydraulic fracturing, and in most cases this SP variation revealed the impending crack geometry seconds before failure. At rupture, injectate rushes into the new fracture area where the zeta potential is different than in the rock porosity, and an anomalous SP spike is observed. After fracturing, the spatial SP distribution reveals the direction of fracture propagation. Finally, during tensile cracking in a point load device with no water flow, a SP spike is observed that is caused by contact electrification. However, the time constant of this event is much less than that for transients observed during hydraulic fracturing, suggesting that SP created solely from material fracture does not contribute to the SP response during hydraulic fracturing.

  17. Measurement and modeling of unsaturated hydraulic conductivity

    Science.gov (United States)

    Perkins, Kim S.; Elango, Lakshmanan

    2011-01-01

    The unsaturated zone plays an extremely important hydrologic role that influences water quality and quantity, ecosystem function and health, the connection between atmospheric and terrestrial processes, nutrient cycling, soil development, and natural hazards such as flooding and landslides. Unsaturated hydraulic conductivity is one of the main properties considered to govern flow; however it is very difficult to measure accurately. Knowledge of the highly nonlinear relationship between unsaturated hydraulic conductivity (K) and volumetric water content is required for widely-used models of water flow and solute transport processes in the unsaturated zone. Measurement of unsaturated hydraulic conductivity of sediments is costly and time consuming, therefore use of models that estimate this property from more easily measured bulk-physical properties is common. In hydrologic studies, calculations based on property-transfer models informed by hydraulic property databases are often used in lieu of measured data from the site of interest. Reliance on database-informed predicted values with the use of neural networks has become increasingly common. Hydraulic properties predicted using databases may be adequate in some applications, but not others. This chapter will discuss, by way of examples, various techniques used to measure and model hydraulic conductivity as a function of water content, K. The parameters that describe the K curve obtained by different methods are used directly in Richards’ equation-based numerical models, which have some degree of sensitivity to those parameters. This chapter will explore the complications of using laboratory measured or estimated properties for field scale investigations to shed light on how adequately the processes are represented. Additionally, some more recent concepts for representing unsaturated-zone flow processes will be discussed.

  18. Thermal Hydraulic Stability in a Coaxial Thermosyphon

    Institute of Scientific and Technical Information of China (English)

    YANG Jianhui; LU Wenqiang; LI Qing; LI Qiang; ZHOU Yuan

    2005-01-01

    The heat transfer and thermal hydraulic stability in a two-phase thermosyphon with coaxial riser and down-comer has been experimentally investigated and theoretically analyzed to facilitate its application in cold neutron source. The flow in a coaxial thermosyphon was studied experimentally for a variety of heating rates, transfer tube lengths, charge capacities, and area ratios. A numerical analysis of the hydraulic balance between the driving pressure head and the resistance loss has also been performed. The results show that the presented coaxial thermosyphon has dynamic performance advantages relative to natural circulation in a boiling water reactor.

  19. Large-eddy simulation in hydraulics

    CERN Document Server

    Rodi, Wolfgang

    2013-01-01

    Complex turbulence phenomena are of great practical importance in hydraulics, including environmental flows, and require advanced methods for their successful computation. The Large Eddy Simulation (LES), in which the larger-scale turbulent motion is directly resolved and only the small-scale motion is modelled, is particularly suited for complex situations with dominant large-scale structures and unsteadiness. Due to the increasing computer power, LES is generally used more and more in Computational Fluid Dynamics. Also in hydraulics, it offers great potential, especially for near-field probl

  20. Mineral resource of the month: hydraulic cement

    Science.gov (United States)

    van Oss, Hendrik G.

    2012-01-01

    Hydraulic cements are the binders in concrete and most mortars and stuccos. Concrete, particularly the reinforced variety, is the most versatile of all construction materials, and most of the hydraulic cement produced worldwide is portland cement or similar cements that have portland cement as a basis, such as blended cements and masonry cements. Cement typically makes up less than 15 percent of the concrete mix; most of the rest is aggregates. Not counting the weight of reinforcing media, 1 ton of cement will typically yield about 8 tons of concrete.

  1. Mechatronic Hydraulic Drive with Regulator, Based on Artificial Neural Network

    Science.gov (United States)

    Burennikov, Y.; Kozlov, L.; Pyliavets, V.; Piontkevych, O.

    2017-06-01

    Mechatronic hydraulic drives, based on variable pump, proportional hydraulics and controllers find wide application in technological machines and testing equipment. Mechatronic hydraulic drives provide necessary parameters of actuating elements motion with the possibility of their correction in case of external loads change. This enables to improve the quality of working operations, increase the capacity of machines. The scheme of mechatronic hydraulic drive, based on the pump, hydraulic cylinder, proportional valve with electrohydraulic control and programmable controller is suggested. Algorithm for the control of mechatronic hydraulic drive to provide necessary pressure change law in hydraulic cylinder is developed. For the realization of control algorithm in the controller artificial neural networks are used. Mathematical model of mechatronic hydraulic drive, enabling to create the training base for adjustment of artificial neural networks of the regulator is developed.

  2. DCS Hydraulics Submittal, Valencia County, New Mexico, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydraulics data includes spatial datasets and data tables necessary for documenting the hydraulic procedures for computing flood elevations for a flood insurance...

  3. Chapter 12. Pure Tap Water Hydraulic Systems and Applications

    DEFF Research Database (Denmark)

    Conrad, Finn; Adelstorp, Anders

    1997-01-01

    Presentation of developed a modern pure tap water hydraulic components (Nessie), systems and industrial applications.......Presentation of developed a modern pure tap water hydraulic components (Nessie), systems and industrial applications....

  4. A tensor approach to the estimation of hydraulic conductivities in ...

    African Journals Online (AJOL)

    2006-07-03

    Jul 3, 2006 ... The HC values computed from the data measured on the weathered or ... Keywords: hydraulic conductivity tensor, roughness, combined stress, hydraulic aperture, Table Mountain ... the anisotropic nature of studied media.

  5. Gradient expansion for anisotropic hydrodynamics

    Science.gov (United States)

    Florkowski, Wojciech; Ryblewski, Radoslaw; Spaliński, Michał

    2016-12-01

    We compute the gradient expansion for anisotropic hydrodynamics. The results are compared with the corresponding expansion of the underlying kinetic-theory model with the collision term treated in the relaxation time approximation. We find that a recent formulation of anisotropic hydrodynamics based on an anisotropic matching principle yields the first three terms of the gradient expansion in agreement with those obtained for the kinetic theory. This gives further support for this particular hydrodynamic model as a good approximation of the kinetic-theory approach. We further find that the gradient expansion of anisotropic hydrodynamics is an asymptotic series, and the singularities of the analytic continuation of its Borel transform indicate the presence of nonhydrodynamic modes.

  6. Gradient expansion for anisotropic hydrodynamics

    CERN Document Server

    Florkowski, Wojciech; Spaliński, Michał

    2016-01-01

    We compute the gradient expansion for anisotropic hydrodynamics. The results are compared with the corresponding expansion of the underlying kinetic-theory model with the collision term treated in the relaxation time approximation. We find that a recent formulation of anisotropic hydrodynamics based on an anisotropic matching principle yields the first three terms of the gradient expansion in agreement with those obtained for the kinetic theory. This gives further support for this particular hydrodynamic model as a good approximation of the kinetic-theory approach. We further find that the gradient expansion of anisotropic hydrodynamics is an asymptotic series, and the singularities of the analytic continuation of its Borel transform indicate the presence of non-hydrodynamic modes.

  7. The use of asphalt in hydraulic engineering

    NARCIS (Netherlands)

    Van de Velde, P.A.; Ebbens, E.H.; Van Herpen, J.A.

    1985-01-01

    Asphalt products have been used in the Netherlands in hydraulic engineering for a long time on a large scale, especially after the great disaster in 1953 when a large part of western Holland was flooded by the sea. After the disaster a great number of dikes had to be repaired very quickly and this w

  8. Elevator and hydraulics; Elevator to yuatsu

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, I. [Hitachi, Ltd., Tokyo (Japan)

    1994-07-15

    A hydraulic type elevator is installed in relatively lower buildings as compared with a rope type elevator, but the ratio in the number of installation of the former elevator is increasing. This paper explains from its construction and features to especially various control systems for the riding comfort and safety. A direct push-up system with hydraulic jacks arranged beneath a car, and an indirect push-up system that has hydraulic jacks arranged on flank of a car and transmits the movement of a plunger via a rope are available. The latter system eliminates the need of large holes to embed hydraulic jacks. While the speed is controlled by controlling flow rates of high-pressure oil, the speed, position, acceleration and even time differential calculus of the acceleration must be controlled severely. The system uses two-step control for the through-speed and the landing speed. Different systems that have been realized may include compensation for temperatures in flow rate control valves, load pressures, and oil viscosity, from learning control to fuzzy control for psychological effects, or control of inverters in motors. 13 refs., 12 figs., 1 tab.

  9. Hydraulic adjustment of Scots pine across Europe

    NARCIS (Netherlands)

    Martínez-Vilalta, J.; Cochard, H.; Mencuccini, M.; Sterck, F.J.; Herrero, A.; Korhonen, J.F.J.; Llorens, P.; Nikinmaa, E.; Nolè, A.; Poyatos, R.; Ripullone, F.; Sass-Klaassen, U.; Zweifel, R.

    2009-01-01

    The variability of branch-level hydraulic properties was assessed across 12 Scots pine populations covering a wide range of environmental conditions, including some of the southernmost populations of the species. The aims were to relate this variability to differences in climate, and to study the po

  10. Influence of tray hydraulics on tray column

    NARCIS (Netherlands)

    Betlem, Bernardus H.L.; Rijnsdorp, J.E.; Rijnsdorp, J.E.; Azink, R.F.

    1998-01-01

    To column control, in contrast to column design, tray hold-up and dependencies of tray hold-up on the operating conditions play an important role. The essence of this article is the development of an improved model of tray hydraulics over a broad operating range and its experimental validation by

  11. Design of a hydraulic bending machine

    Science.gov (United States)

    Steven G. Hankel; Marshall Begel

    2004-01-01

    To keep pace with customer demands while phasing out old and unserviceable test equipment, the staff of the Engineering Mechanics Laboratory (EML) at the USDA Forest Service, Forest Products Laboratory, designed and assembled a hydraulic bending test machine. The EML built this machine to test dimension lumber, nominal 2 in. thick and up to 12 in. deep, at spans up to...

  12. Sustainable hydraulic engineering through building with nature

    NARCIS (Netherlands)

    Vriend, de H.J.; Koningsveld, van M.; Aarninkhof, S.G.J.; Vries, de M.B.; Baptist, M.J.

    2015-01-01

    Hydraulic engineering infrastructures are of concern to many people and are likely to interfere with the environment. Moreover, they are supposed to keep on functioning for many years. In times of rapid societal and environmental change this implies that sustainability and adaptability are important

  13. The use of asphalt in hydraulic engineering

    NARCIS (Netherlands)

    Van de Velde, P.A.; Ebbens, E.H.; Van Herpen, J.A.

    1985-01-01

    Asphalt products have been used in the Netherlands in hydraulic engineering for a long time on a large scale, especially after the great disaster in 1953 when a large part of western Holland was flooded by the sea. After the disaster a great number of dikes had to be repaired very quickly and this w

  14. International Institute for Hydraulic and Environmental Engineering

    Science.gov (United States)

    Mostertman, L. J.

    1977-01-01

    Describes the activities of the International Institute for Hydraulic and Environmental Engineering (IHE), whose primary function is the promotion of the better use of water resources as a vehicle of development by the transfer of knowledge and experience. (Author/RK)

  15. Digital hydraulic valving system. [design and development

    Science.gov (United States)

    1973-01-01

    The design and development are reported of a digital hydraulic valving system that would accept direct digital inputs. Topics include: summary of contractual accomplishments, design and function description, valve parameters and calculations, conclusions, and recommendations. The electrical control circuit operating procedure is outlined in an appendix.

  16. Sustainable hydraulic engineering through building with nature

    NARCIS (Netherlands)

    Vriend, de H.J.; Koningsveld, van M.; Aarninkhof, S.G.J.; Vries, de M.B.; Baptist, M.J.

    2015-01-01

    Hydraulic engineering infrastructures are of concern to many people and are likely to interfere with the environment. Moreover, they are supposed to keep on functioning for many years. In times of rapid societal and environmental change this implies that sustainability and adaptability are important

  17. Reactive barriers: hydraulic performance and design enhancements.

    Science.gov (United States)

    Painter, B D M

    2004-01-01

    The remediation of contaminated ground water is a multibillion-dollar global industry. Permeable reactive barriers (PRBs) are one of the leading technologies being developed in the search for alternatives to the pump-and-treat method. Improving the hydraulic performance of these PRBs is an important part of maximizing their potential to the industry. Optimization of the hydraulic performance of a PRB can be defined in terms of finding the balance between capture, residence time, and PRB longevity that produces a minimum-cost acceptable design. Three-dimensional particle tracking was used to estimate capture zone and residence time distributions. Volumetric flow analysis was used for estimation of flow distribution across a PRB and in the identification of flow regimes that may affect the permeability or reactivity of portions of the PRB over time. Capture zone measurements extended below the base of partially penetrating PRBs and were measured upgradient from the portion of aquifer influenced by PRB emplacement. Hydraulic performance analysis of standard PRB designs confirmed previously presented research that identified the potential for significant variation in residence time and capture zone. These variations can result in the need to oversize the PRB to ensure that downgradient contaminant concentrations do not exceed imposed standards. The most useful PRB design enhancements for controlling residence time and capture variation were found to be customized downgradient gate faces, velocity equalization walls, deeper emplacement of the funnel than the gate, and careful manipulation of the hydraulic conductivity ratio between the gate and the aquifer.

  18. SITMILARITY LAW FOR HYDRAULIC DISTORTED MODEL

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    Newton's general similarity criterion was applied to the distorted model. The results for the similarities of gravity force, drag force and pressure force are identical with those derived from relevant differential equations of fluid flow. And the selected limits of the distorted ratio were studied and the simulation of roughness coefficient of distorted model was conducted by means of hydraulic test.

  19. Separation and pattern formation in hydraulic jumps

    DEFF Research Database (Denmark)

    Bohr, Tomas; Ellegaard, C.; Hansen, A. Espe;

    1998-01-01

    We present theory and experiments on the circular hydraulic jump in the stationary regime. The theory can handle the situation in which the fluid flows over an edge far away from the jump. In the experiments the external height is controlled, and a series of transitions in the flow structure appe...

  20. HYDRAULIC CONDUCTIVITY OF THREE GEOSYNTHETIC CLAY LINERS

    Science.gov (United States)

    The hydraulic conductivity of three 2.9 m2 (32 sq ft) geosynthetic clay liners (GCLs) was measured. Tests were performed on individual sheets of the GCLs, on overlapped pieces of GCLs, and on composite liners consisting of a punctured geomembrane overlying a GCL. Hyd...

  1. Towards Autonomous Control of Hydraulic Actuator Systems

    DEFF Research Database (Denmark)

    Hansen, Poul Erik; Conrad, Finn

    1998-01-01

    Presentation of new developed control algorithms to increase autonomy and intelligence of hydraulic control systems. A refinement of relaytuning method is used to determine the control parameters of a lag/lead controller and a poleplacement controller. Further, a fail-safe function is developed t...

  2. Power management in hydraulically actuated mobile equipment

    DEFF Research Database (Denmark)

    Pedersen, Henrik Clemmensen; Andersen, Torben Ole; Hansen, Michael Rygaard

    2008-01-01

    The focus of the current paper is on the control of hydraulic systems when utilizing the advances that electronic control may bring with regard to power management, prioritized flow sharing and anti-stall, arising from being able to control both pump, valves and engine electronically. A simple mo...

  3. Dentin permeability: determinants of hydraulic conductance.

    Science.gov (United States)

    Reeder, O W; Walton, R E; Livingston, M J; Pashley, D H

    1978-02-01

    A technique is described which permits measurements of the ease with which fluid permeates dentin. This value, the hydraulic conductance of dentin, increased as surface area increases and/or as dentin thickness decreases. It increased 32-fold when dentin was acid etched due to removal of surface debris occluding the tubules.

  4. Analysis of Innovative Design of Energy Efficient Hydraulic Actuators

    OpenAIRE

    M Osman Abdalla

    2013-01-01

    Hydraulic cylinder actuators are used extensively in industrial, construction and agricultural works. The small sized outlet ports of the cylinders resist the flow of discharged oil; and as a result the piston motion is slowed down. This causes a lot of heat generation and energy loss within the actuators. The study investigates and analyzes the possibilities of reducing the hydraulic resistance and increasing efficiency of the hydraulic actuator. Conventional hydraulic cylinders are simulate...

  5. DISCONTINUOUS FLOW OF TURBID DENSITY CURRENTS Ⅱ. INTERNAL HYDRAULIC JUMP

    Institute of Scientific and Technical Information of China (English)

    Jiahua FAN

    2005-01-01

    Traveling and stationary internal hydraulic jumps in density currents with positive or negative entrainment coefficients were analyzed based on simple assumptions. An expression of internal hydraulic jumps with entrainment coefficients was derived. Experimental data, published in literature, of stationary internal hydraulic jumps in turbid, thermal and saline density currents including measured values of water entrainment were used to compare with theory. Comparison was also made of traveling internal hydraulic jumps between measured data and theory.

  6. OPTIMAL HYDRAULIC DESIGN AND CAD APPLICATIONS OF AXIAL FLOW HYDRAULIC TURBINE'S RUNNER

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    A method of the optimal hydraulic design and CAD application of runner blades of axial-flow hydraulic turbines are discussed on the basis of optimization principle and CAD technique in this paper. Based on the theory of fluid dynamics, the blade′s main geometrical parameter, working parameters and performances index of the blades and the relationship between them are analysed, and the mathematical model of optimal hydraulic design of axial-flow runners has been established. Through nonlinear programming, the problems can be solved. By making use of the calculation geometry and computer graphics, the distribution method of the singular points, and an CAD applied software, an optimal hydraulic design are presented.

  7. Hydraulic Bureaucracy in a Modern Hydraulic Society – Strategic Group Formation in the Mekong Delta, Vietnam

    Directory of Open Access Journals (Sweden)

    Hans-Dieter Evers

    2009-10-01

    Among these strategic groups, the hydraulic bureaucracy and hydraulic construction business are the most crucial in terms of the specific role they play in the hydraulic landscape of the Mekong delta. Both groups exert considerable influence on water resources management and strive for the same resources, namely public funds (including Overseas Development Aid that is directed to hydraulic infrastructure development. This paper illustrates how both groups have emerged due to the growing need for water resources management in the delta and how they have set up alliances for mutually sharing resources in the long run. Furthermore, it is shown how both groups have adapted their resource-oriented strategies and actions to respond to the changes in the economic and political environment in Vietnam’s recent history.

  8. Bond Growth under Temperature Gradient.

    Directory of Open Access Journals (Sweden)

    P.K. Satyawali

    1999-12-01

    Full Text Available Grain and bond growth for dry snow are determined by the distribution of temperature andtemperature gradient in the snow matrix. From the standpoint of particle approach and based oncubic packing structure, a bond growth model has been developed for TG metamorphism. The paper.highlights the importance of bond formation and its effect on snow viscosity and finally on the rateof settlement. This is very important for developing a numerical snow pack model if microstructureis considered to be a basic parameter. A few experiments have been carried out to validate bond formation under temperature gradient.

  9. Hydraulic power take-off for wave energy systems

    DEFF Research Database (Denmark)

    Christensen, Georg Kronborg

    2001-01-01

    Investigation and laboratory experiments with a hydraulic power conversion system for converting forces from a 2.5m diamter float to extract energy from seawaves. The test rig consists of a hydraulic wave simulator and a hydraulic point absorber. The absorber converts the incomming forces...

  10. 21 CFR 880.5110 - Hydraulic adjustable hospital bed.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Hydraulic adjustable hospital bed. 880.5110... (CONTINUED) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5110 Hydraulic adjustable hospital bed. (a) Identification. A hydraulic adjustable...

  11. 14 CFR 33.72 - Hydraulic actuating systems.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hydraulic actuating systems. 33.72 Section... AIRWORTHINESS STANDARDS: AIRCRAFT ENGINES Design and Construction; Turbine Aircraft Engines § 33.72 Hydraulic actuating systems. Each hydraulic actuating system must function properly under all conditions in which...

  12. 7 CFR 2902.10 - Mobile equipment hydraulic fluids.

    Science.gov (United States)

    2010-01-01

    ... Comprehensive Procurement Guideline, 40 CFR 247.11. ... 7 Agriculture 15 2010-01-01 2010-01-01 false Mobile equipment hydraulic fluids. 2902.10 Section... PROCUREMENT Designated Items § 2902.10 Mobile equipment hydraulic fluids. (a) Definition. Hydraulic...

  13. Comparison of four methods to assess hydraulic conductivity

    Energy Technology Data Exchange (ETDEWEB)

    Benson, C.H. [Univ. of Wisconsin, Madison, WI (United States). Dept. of Civil and Environmental Engineering; Gunter, J.A. [Gunter (John A.), Round Rock, TX (United States); Boutwell, G.P. [STE, Inc., Baton Rouge, LA (United States); Trautwein, S.J. [Trautwein Soil Testing Equipment Co., Houston, TX (United States); Berzanskis, P.H. [Hoechst-Celanese, Inc., Pampa, TX (United States)

    1997-10-01

    A hydraulic conductivity assessment that was conducted on four test pads constructed to the same specifications with soil from the same source by four different contractors is described. The test pads had distinctly different field hydraulic conductivities, even though they were constructed with similar soil, to similar compaction conditions, and with similar machinery. Adequate hydration time was key in achieving low field hydraulic conductivity. More extensive processing was another factor responsible for low field hydraulic conductivity. Four different test methods were used to assess the hydraulic conductivity of each test pad: (1) sealed double-ring infiltrometers (SDRIs); (2) two-stage borehole permeameters; (3) laboratory hydraulic conductivity tests on large block specimens; and (4) laboratory hydraulic conductivity tests on small specimens collected in thin-wall sampling tubes. The tests were conducted independently by each of the writers. After the tests were completed, the results were submitted and compared. Analysis of the test results show that the three large-scale test methods generally yield similar hydraulic conductivities. For two of the test pads, however, the hydraulic conductivities of the specimens collected in sampling tubes were significantly lower than the field hydraulic conductivities. Both of these test pads had high field hydraulic conductivity. Thus, there is little value in using small specimens to assess field hydraulic conductivity.

  14. 23 CFR 650.111 - Location hydraulic studies.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Location hydraulic studies. 650.111 Section 650.111 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS BRIDGES, STRUCTURES, AND HYDRAULICS Location and Hydraulic Design of Encroachments on Flood Plains §...

  15. Hydraulic risk assessment of bridges using UAV photogrammetry

    Science.gov (United States)

    Hackl, Jürgen; Adey, Bryan T.; Woźniak, Michał; Schümperlin, Oliver

    2017-04-01

    Road networks are essential for economic growth and development. Of the objects within a road network, bridges are of special interest, because their failure often results in relatively large interruptions to how the network is used, their replacement costs are generally large, and it usually takes a considerable amount of time to restore them once they have failed. Of the different types of bridges, bridges in mountainous regions are of special interest because their failure could cause severe societal consequences, for example, if it renders an area inaccessible. One of the main causes of the failure of bridges in mountainous regions is the occurrence of a hydraulic event, for example, flood waters above a certain level, scour below a certain depth or debris build up beyond a certain level. An assessment of risk related to a bridge in a mountainous region is challenging. The probability of occurrence of these events, and the resulting consequences, depend greatly on the characteristics (e.g. slope, soil, vegetation, precipitation, …) of the specific regions where the bridges are located. An indication of the effect of these characteristics can be seen in the sediment deposition during floods in mountain catchments. Additionally, there is often no, or no recent, topological information that can be used to develop terrain models to be used for realistic water flow simulations in mountain regions, and most hydrology and hydraulic models have been developed for lower gradient rivers and can often not be directly used to model water flow in mountain rivers. In an effort to improve the assessment of risk related to bridges in mountainous regions, using the setting for risk assessments established by Hackl et al. (2015) and Adey et al. (2016), an investigation was undertaken to determine whether unmanned aerial vehicles (UAVs) and photogrammetry could be used to generate the topological information required to run realistic water flow simulations. The process

  16. A LiDAR based analysis of hydraulic hazard mapping

    Science.gov (United States)

    Cazorzi, F.; De Luca, A.; Checchinato, A.; Segna, F.; Dalla Fontana, G.

    2012-04-01

    Mapping hydraulic hazard is a ticklish procedure as it involves technical and socio-economic aspects. On the one hand no dangerous areas should be excluded, on the other hand it is important not to exceed, beyond the necessary, with the surface assigned to some use limitations. The availability of a high resolution topographic survey allows nowadays to face this task with innovative procedures, both in the planning (mapping) and in the map validation phases. The latter is the object of the present work. It should be stressed that the described procedure is proposed purely as a preliminary analysis based on topography only, and therefore does not intend in any way to replace more sophisticated analysis methods requiring based on hydraulic modelling. The reference elevation model is a combination of the digital terrain model and the digital building model (DTM+DBM). The option of using the standard surface model (DSM) is not viable, as the DSM represents the vegetation canopy as a solid volume. This has the consequence of unrealistically considering the vegetation as a geometric obstacle to water flow. In some cases the topographic model construction requires the identification and digitization of the principal breaklines, such as river banks, ditches and similar natural or artificial structures. The geometrical and topological procedure for the validation of the hydraulic hazard maps is made of two steps. In the first step the whole area is subdivided into fluvial segments, with length chosen as a reasonable trade-off between the need to keep the hydrographical unit as complete as possible, and the need to separate sections of the river bed with significantly different morphology. Each of these segments is made of a single elongated polygon, whose shape can be quite complex, especially for meandering river sections, where the flow direction (i.e. the potential energy gradient associated to the talweg) is often inverted. In the second step the segments are analysed

  17. The geomagnetic field gradient tensor

    DEFF Research Database (Denmark)

    Kotsiaros, Stavros; Olsen, Nils

    2012-01-01

    We develop the general mathematical basis for space magnetic gradiometry in spherical coordinates. The magnetic gradient tensor is a second rank tensor consisting of 3 × 3 = 9 spatial derivatives. Since the geomagnetic field vector B is always solenoidal (∇ · B = 0) there are only eight independe...... of the small-scale structure of the Earth’s lithospheric field....

  18. Surface gradients under electrochemical control

    NARCIS (Netherlands)

    Krabbenborg, Sven Olle

    2014-01-01

    Gradients are systems in which the physicochemical properties of a solution and/or surface change gradually in space and/or time. They are used for a myriad of technological and biological applications, for example for high-throughput screening, or for the investigation of biological systems. The de

  19. Compositional gradients in Gramineae genes

    DEFF Research Database (Denmark)

    Wong, Gane Ka-Shu; Wang, Jun; Tao, Lin

    2002-01-01

    In this study, we describe a property of Gramineae genes, and perhaps all monocot genes, that is not observed in eudicot genes. Along the direction of transcription, beginning at the junction of the 5'-UTR and the coding region, there are gradients in GC content, codon usage, and amino-acid usage...

  20. GOCE level 2 gravity gradients

    NARCIS (Netherlands)

    Bouman, J.; Fiorot, S.; Fuchs, M.; Gruber, T.; Schrama, E.J.O.; Tscherning, C.C.; Veicherts, M.; Visser, P.N.A.M.

    2011-01-01

    Two of the GOCE Level 2 products are the gravity gradients (GGs) in the Gradiometer Reference Frame (GRF) and the GGs in the Local North-Oriented Frame (LNOF). The GRF is an instrument frame and the GGs are derived from the L1b GGs. The L1b to L2 GG processing involves corrections for temporal gravi

  1. Reinforcement Learning Through Gradient Descent

    Science.gov (United States)

    1999-05-14

    Reinforcement learning is often done using parameterized function approximators to store value functions. Algorithms are typically developed for...practice of existing types of algorithms, the gradient descent approach makes it possible to create entirely new classes of reinforcement learning algorithms

  2. Diversity of hydraulic traits in nine Cordia species growing in tropical forests with contrasting precipitation.

    Science.gov (United States)

    Choat, Brendan; Sack, Lawren; Holbrook, N Michele

    2007-01-01

    Inter- and intraspecific variation in hydraulic traits was investigated in nine Cordia (Boraginaceae) species growing in three tropical rainforests differing in mean annual precipitation (MAP). Interspecific variation was examined for the different Cordia species found at each site, and intraspecific variation was studied in populations of the widespread species Cordia alliodora across the three sites. Strong intra- and interspecific variation were observed in vulnerability to drought-induced embolism. Species growing at drier sites were more resistant to embolism than those growing at moister sites; the same pattern was observed for populations of C. alliodora. By contrast, traits related to hydraulic capacity, including stem xylem vessel diameter, sapwood specific conductivity (K(s)) and leaf specific conductivity (K(L)), varied strongly but independently of MAP. For C. alliodora, xylem anatomy, K(s), K(L) and Huber value varied little across sites, with K(s) and K(L) being consistently high relative to other Cordia species. A constitutively high hydraulic capacity coupled with plastic or genotypic adjustment in vulnerability to embolism and leaf water relations would contribute to the ability of C. alliodora to establish and compete across a wide precipitation gradient.

  3. Design of a Resistively Heated Thermal Hydraulic Simulator for Nuclear Rocket Reactor Cores

    Science.gov (United States)

    Litchford, Ron J.; Foote, John P.; Ramachandran, Narayanan; Wang, Ten-See; Anghaie, Samim

    2007-01-01

    A preliminary design study is presented for a non-nuclear test facility which uses ohmic heating to replicate the thermal hydraulic characteristics of solid core nuclear reactor fuel element passages. The basis for this testing capability is a recently commissioned nuclear thermal rocket environments simulator, which uses a high-power, multi-gas, wall-stabilized constricted arc-heater to produce high-temperature pressurized hydrogen flows representative of reactor core environments, excepting radiation effects. Initially, the baseline test fixture for this non-nuclear environments simulator was configured for long duration hot hydrogen exposure of small cylindrical material specimens as a low cost means of evaluating material compatibility. It became evident, however, that additional functionality enhancements were needed to permit a critical examination of thermal hydraulic effects in fuel element passages. Thus, a design configuration was conceived whereby a short tubular material specimen, representing a fuel element passage segment, is surrounded by a backside resistive tungsten heater element and mounted within a self-contained module that inserts directly into the baseline test fixture assembly. With this configuration, it becomes possible to create an inward directed radial thermal gradient within the tubular material specimen such that the wall-to-gas heat flux characteristics of a typical fuel element passage are effectively simulated. The results of a preliminary engineering study for this innovative concept are fully summarized, including high-fidelity multi-physics thermal hydraulic simulations and detailed design features.

  4. Hydraulics and pneumatics a technician's and engineer's guide

    CERN Document Server

    Parr, Andrew

    1991-01-01

    Hydraulics and Pneumatics: A Technician's and Engineer's Guide provides an introduction to the components and operation of a hydraulic or pneumatic system. This book discusses the main advantages and disadvantages of pneumatic or hydraulic systems.Organized into eight chapters, this book begins with an overview of industrial prime movers. This text then examines the three different types of positive displacement pump used in hydraulic systems, namely, gear pumps, vane pumps, and piston pumps. Other chapters consider the pressure in a hydraulic system, which can be quickly and easily controlled

  5. The Application Strategy of Iterative Solution Methodology to Matrix Equations in Hydraulic Solver Package, SPACE

    Energy Technology Data Exchange (ETDEWEB)

    Na, Y. W.; Park, C. E.; Lee, S. Y. [KOPEC, Daejeon (Korea, Republic of)

    2009-10-15

    As a part of the Ministry of Knowledge Economy (MKE) project, 'Development of safety analysis codes for nuclear power plants', KOPEC has been developing the hydraulic solver code package applicable to the safety analyses of nuclear power plants (NPP's). The matrices of the hydraulic solver are usually sparse and may be asymmetric. In the earlier stage of this project, typical direct matrix solver packages MA48 and MA28 had been tested as matrix solver for the hydraulic solver code, SPACE. The selection was based on the reasonably reliable performance experience from their former version MA18 in RELAP computer code. In the later stage of this project, the iterative methodologies have been being tested in the SPACE code. Among a few candidate iterative solution methodologies tested so far, the biconjugate gradient stabilization methodology (BICGSTAB) has shown the best performance in the applicability test and in the application to the SPACE code. Regardless of all the merits of using the direct solver packages, there are some other aspects of tackling the iterative solution methodologies. The algorithm is much simpler and easier to handle. The potential problems related to the robustness of the iterative solution methodologies have been resolved by applying pre-conditioning methods adjusted and modified as appropriate to the application in the SPACE code. The application strategy of conjugate gradient method was introduced in detail by Schewchuk, Golub and Saad in the middle of 1990's. The application of his methodology to nuclear engineering in Korea started about the same time and is still going on and there are quite a few examples of application to neutronics. Besides, Yang introduced a conjugate gradient method programmed in C++ language. The purpose of this study is to assess the performance and behavior of the iterative solution methodology compared to those of the direct solution methodology still being preferred due to its robustness and

  6. Dicty_cDB: VHG688 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YXVTESLEPVLNIENEPLGEFKPSLMTAPESAEEDDDQYDNDDNGYDNYDSV GDYVSADQYQDQMDYSDEDDYEGG*kpinyieeeddeeedddirfqqqqqqqqql...thf*h qksyvwifnlslrqctemiyiynnymnf*--- ---LQNGEYXVTESLEPVLNIENEPLGEFKPSLMTAPESAEEDDDQYDNDDNGYDNYDSV GDYVSADQYQDQMDYSDEDDYEGG*kpinyiee

  7. Dicty_cDB: VHG702 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 680( CP001146 |pid:none) Dictyoglomus thermophilum H-6-12... 105 4e-21 CP000383_2...239( CP000383 |pid:none) Cytophaga hutchinsonii ATCC 334... 104 6e-21 CP001251_792( CP001251 |pid:none) Dictyoglomus

  8. Dicty_cDB: VHG292 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available g24, 5' ... 42 4e-04 2 ( CF181845 ) ISO1D7F Iso cDNA Isotricha sp. BBF-2003 cDNA simi... 38 0.001 3 ( BV255991 ) S235P6260RB9.T0 Ital...ianGreyhound Canis familiaris... 52 0.024 1 ( CU928594 ) Pig DNA sequence *** SEQUE

  9. Dicty_cDB: VHG856 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tlsdfeppvqidtysinll*liifqlhqrqntrn* nlf*lksikidqvlkllvfi*h*mlkeilkvlhllniqkknqqlmqqlh*iiih*inhih *kliy*mil...anlpilkklinhqlekilnqnqitingyqiqkh*kvmtnl*hvmviiqifv gmrcmlvnqw*rnhrfh*phhtfngqtlvvi

  10. Dicty_cDB: VHG547 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C: tatnykw*ctkscein*fnythfkiiwciwtfw*****ytiidisnysskw*kytnak** wysfikcrwindysrfirftifkqftictiircfkystlysyt...lium discoideum cDNA clone:dda53e21, 5' ... 1191 0.0 1 ( AC116984 ) Dictyostelium discoideum chromosome 2 ma

  11. Dicty_cDB: VHG360 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CATCATCATCATTATTTCAACXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence vkccstinptfmink*KR...LFQ--- Translated Amino Acid sequence (All Frames) Frame A: vkccstinptfmink*KRRERKMNVKEMDFNDLSNKSNQIINRISSFS

  12. Dicty_cDB: VHG830 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ATCATCATCATTATTTCAACAAAGCGTTCGTGGTGXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence kccstinptfmink...stkrsw--- Frame C: kccstinptfmink*KRREKKMNVKEMDFNDLSNKSNQIINRISSFSSPIGLSSFNIERN L

  13. Dicty_cDB: VHG855 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pSGR-JF... 33 9.2 FJ393024_1( FJ393024 |pid:none) Recombinant Hepatitis C Virus SA13... 33 9.2 FJ230884_1( FJ230884 |pid:none) Recomb...inant Hepatitis C virus QC69... 33 9.2 FJ230883_1( FJ230883 |pid:none) Recombinan...t Hepatitis C virus HK6a... 33 9.2 EU204645_1( EU204645 |pid:none) Recombinant Hepa

  14. Dicty_cDB: VHG390 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Arabidopsis thaliana DNA chromoso... 180 3e-44 AK221976_1( AK221976 |pid:none) Arabidopsis thaliana mRNA for hypo...... 180 3e-44 AK227321_1( AK227321 |pid:none) Arabidopsis thaliana mRNA for hypo... 180 3e-44 AK230210..._1( AK230210 |pid:none) Arabidopsis thaliana mRNA for hypo... 179 5e-44 AK101151_

  15. Dicty_cDB: VHG394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dttkgvsslrqqdgghg sryplrsv*qltcqmd*p*kwmtlavdgrcpivkrsdntfnv*egvkvt*klecefewsc l*crs*w**qifkriyfegrsgegfhnngihlwvsrs*glg*lslirllghwie...seggfn tsdfigrkgsglkflhhrmgy*gnrs*sgtsiggrgrvifsc--- ---SQALIATLLFDPSMSALLIIVKQNSQS

  16. Dicty_cDB: VHG264 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available crgnv*ks**sifsfi**r*ekei**iwfrfs**ngy*sn *fv*ndiwwwiisklfwrfiil*siyktskw*ntnsrgsnkgtrgsskkk--- ---ASGGGSYASC...*iwfrfs**ngy *sn*fv*ndiwwwiisklfwrfiil*siyktskgkhqxqrik*rxqxgs Homology vs CSM-cD...--qwgw*lckll*kk*fcrks*nytffnasisktip*nci*rkn*ll*iigctihsnke *nyksil*iskrissr*kqk*ficrgnv*ks**sifsfi**r*ekei*

  17. Dicty_cDB: VHG423 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence ---FTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICT CDNEHIGNGCEIKFIECKHKCSTKHGICDNDSGNCKCDT...*vpisr*knknlkniercncwyccwlccccfin Frame C: ---FTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGIC

  18. Dicty_cDB: VHG158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mklilqlqensknwlkavqtmi*pq*mvfqssksyqelfngqlmlkl stkliqllvhmk*pllhtklirllakmvmtlfn...cqfqnllhqixkllai*qfvkxihhmx ml*mevftlntpqqlaklqllkkmxhsqri*llhkmiihlss Frame B: lnkfqk*kv*y*klknvc*ck*skillw

  19. Dicty_cDB: VHG647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKIQVYSIFPSYTDGGEVIFYGWFTANSPISILIGSQTCTPTLVTTDQIKC NIGAGNGVKDISITQAGYTWFSPNSYEYVIXPTTPANCPTNCSNX--- ---ELNKLGY*inkfkkknee...KIQVYSIFPSYTDGGEVIFYGWFTANSPISILIGSQTCTPTLVTTDQIKC NIGAGNGVKDISITQAGYTWFSPNSYEYVIXPTTPANCPTNCSNX--- ---ELNKLGY*inkfkkknee...disitqagytwfspnsyeyvirpttpancptncsnrgycgagrcv Frame C: lnklgy*inkfkkkneensfnnfnfnfynfyk*lycrnmwkwlfkwxyl*fk*

  20. Dicty_cDB: VHG877 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value... E Sequences producing significant alignments: (bits) Value N ( BJ440834 ) Dictyo... Sequences producing significant alignments: (bits) Value CP000687_912( CP000687 |pid:none) Actinobacillus p

  1. Dicty_cDB: VHG350 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *riskwsscgdrpkvhqrikfshqyyvqcivlqmvstlskvmtqfkm tqiysiit*tqelnsslkwhlnmqliivpimy*fhlvvisltltlkcitktltn*shisi... qirinmv*icyiqlhqfi*vl*mmpi*ygk*klmisshmlimnlviglvislvvqh*kat fvkimlyym*lnkcw---

  2. Dicty_cDB: VHG483 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.0 1 ( BJ442780 ) Dictyostelium discoideum cDNA clone:ddv50o20, 3' ... 1247 0.0 1 ( BJ442687 ) Dictyosteliu...m discoideum cDNA clone:ddv50m18, 3' ... 1247 0.0 1 ( BJ442548 ) Dictyostelium discoideum cDNA clone:ddv50a1

  3. Dicty_cDB: VHG187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available No hits found ****** Lambda K H 1.37 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existe... 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension:

  4. Dicty_cDB: VHG407 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lpvivvgg*ixiyilvplnssivddyqmn*vl*a se*rsvtrg*gfsiss*klkkqyrnsiyt*kfyiyninnifffvlsyihnhcplqtdhl* itskphtlshsp...ifffvlsyihnhcplqtdhl* itskphtlshspthq*hntxlykx Frame B: fnxlnwilklnctcamknrss*waifgkqnwrcglnqilg*dv*hslidttk

  5. Dicty_cDB: VHG330 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KAVEDKQYFESTQAEFLKLHREVHDRNVTEKARLNRIVPEYQKFTQAV IEERKKQLPALQKEQEKRFQEFLIQQEQDVPSRERQRERKXRIAA Frame C: k*kn...vnttsissg**tcfkpsk*fn*swikiksikclkrfik*s*smafkfrtnyviirf imc*tirlsiikrwyssfqsfnhvtkgilnctirkyl*rnhytn*tksrri

  6. Dicty_cDB: VHG430 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LRRILTTQVSSITSLKFLDSTRLVSVSNDRSLIVWNF STSSMKMNLSINHQ*lqwifikiklllr*kgniis*is* Tra...KIFSPLNDKPVTHQTSSSYVTSLSFSP NDKYLAIGTFDGTVELLDIASGKLRRILTTQVSSITSLKFLDSTRLVSVSNDRSLIVWNF STSSMKMNLSINHQ*lqwifi

  7. Comparison of laboratory, in situ, and rock mass measurements of the hydraulic conductivity of metamorphic rock at the Savannah River Plant near Aiken, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Marine, I W

    1980-01-01

    In situ testing of exploratory wells in metamorphic rock indicates that two types of fracturing occur in the rock mass. Rock containing small openings that permit only extremely slow movement of water is termed virtually impermeable rock. Rock containing openings of sufficient size to permit transmission of water at a significantly faster rate is termed hydraulically transmissive rock. Laboratory methods are unsuitable for measuring hydraulic conductivity in hydraulically transmissive rock; however, for the virtually impermeable rock, values comparable to the in situ tests are obtained. The hydraulic conductivity of the rock mass over a large region is calculated by using the hydraulic gradient, porosity, and regional velocity. This velocity is determined by dividing the inferred travel distance by the age of water which is determined by the helium content of the water. This rock mass hydraulic conductivity value is between the values measured for the two types of fractures, but is closer to the measured value for the virtually impermeable rock. This relationship is attributed to the control of the regional flow rate by the virtually impermeable rock where the discrete fractures do not form a continuous open connection through the entire rock mass. Thus, laboratory methods of measuring permeability in metamorphic rock are of value if they are properly applied.

  8. Comparison of Laboratory, in Situ, and Rock Mass Measurements of the Hydraulic Conductivity of Metamorphic Rock at the Savannah River Plant Near Aiken, South Carolina

    Science.gov (United States)

    Marine, I. Wendell

    1981-06-01

    In situ testing of exploratory wells in metamorphic rock indicates that two types of fracturing occur in the rock mass. Rock containing small openings that permit only extremely slow movement of water is termed virtually impermeable rock. Rock containing openings of sufficient size to permit transmission of water at a significantly faster rate is termed hydraulically transmissive rock. Laboratory methods are unsuitable for measuring hydraulic conductivity in hydraulically transmissive rock; however, for the virtually impermeable rock, values comparable to those of the in situ tests are obtained. The hydraulic conductivity of the rock mass over a large region is calculated by using the hydraulic gradient, porosity, and regional velocity. This velocity is determined by dividing the inferred travel distance by the age of water, which is determined by the helium content of the water. This rock mass hydraulic conductivity value is between the values measured for the two types of fractures but is closer to the measured value for the virtually impermeable rock. This relationship is attributed to the control of the regional flow rate by the virtually impermeable rock where the discrete fractures do not form a continuous open connection through the entire rock mass. Thus laboratory methods of measuring permeability in metamorphic rock are of value if they are properly applied.

  9. A novel energy recovery system for parallel hybrid hydraulic excavator.

    Science.gov (United States)

    Li, Wei; Cao, Baoyu; Zhu, Zhencai; Chen, Guoan

    2014-01-01

    Hydraulic excavator energy saving is important to relieve source shortage and protect environment. This paper mainly discusses the energy saving for the hybrid hydraulic excavator. By analyzing the excess energy of three hydraulic cylinders in the conventional hydraulic excavator, a new boom potential energy recovery system is proposed. The mathematical models of the main components including boom cylinder, hydraulic motor, and hydraulic accumulator are built. The natural frequency of the proposed energy recovery system is calculated based on the mathematical models. Meanwhile, the simulation models of the proposed system and a conventional energy recovery system are built by AMESim software. The results show that the proposed system is more effective than the conventional energy saving system. At last, the main components of the proposed energy recovery system including accumulator and hydraulic motor are analyzed for improving the energy recovery efficiency. The measures to improve the energy recovery efficiency of the proposed system are presented.

  10. Technology of load-sensitivity used in the hydraulic system of an all-hydraulic core rig

    Institute of Scientific and Technical Information of China (English)

    XIN De-zhong; CHEN Song-ling; WANG Qing-feng

    2009-01-01

    The existing hydraulic system always have problems of temperature rise, run-ning stability and anti-interference of the implementation components, reliability of hydrau-lic components, maintenance difficulties, and other issues. With high efficiency, energy saving, reliability, easy operating, stable running, anti-interference ability, and other ad-vantages, the load-sensitive hydraulic system is more suitable for coal mine all-hydraulic core rig. Therefore, for the technical development of the coal mine all-hydraulic core rig, the load-sensitive technology employed by the rig should be of great significance.

  11. Trends in Design of Water Hydraulics

    DEFF Research Database (Denmark)

    Conrad, Finn

    2005-01-01

    The paper presents and discusses a R&D-view on trends in development and best practise in design of both low-pressure and high-pressure tap water hydraulic components and systems for motion control as well as open-ended solutions various industrial applications. The focus is on the advantages using...... ordinary tap water and the range of application areas are illustrated with examples, in particular within the food processing industry, humidification operations, water mist systems for fire fighting, high water pressure cleaners, water moisturising systems for wood processing, lumber drying process...... operate with pure water from the tap without additives of any kind. Hence water hydraulics takes the benefit of pure water as fluid being environmentally friendly, easy to clean sanitary design, non-toxic, non-flammable, inexpensive, readily available and easily disposable. The low-pressure tap water...

  12. The hydraulic fracturing of geothermal formations

    Energy Technology Data Exchange (ETDEWEB)

    Naceur, K. Ben; Economides, M.J.; Schlumberger, Dowell

    1988-01-01

    Hydraulic fracturing has been attempted in geothermal formations as a means to stimulate both production and injection wells. Since most geothermal formations contain fissures and on occasion massive natural fissures, the production behavior of the man-made fractures results in certain characteristic trends. A model is offered that allows the presence of a finite or infinite conductivity fracture intercepting a fissured medium. The method is based on a numerical discretization of the formation allowing transient interporosity flow. Type curves for pressure drawdown and cumulative production are given for infinite acting and closed reservoirs. Since most of the fissured formations exhibit a degree of anisotropy, the effects of the orientation of the hydraulic fracture with respect to the fissure planes, and of the ratio between the directional permeabilities are then discussed. Guidelines are offered as to the size of appropriate stimulation treatments based on the observed fissured behavior of the reservoir.

  13. Plug & Play Control of Hydraulic Networks

    DEFF Research Database (Denmark)

    Jensen, Tom Nørgaard

    2012-01-01

    Process Control research program, which the work presented here is a part of. An industrial case study involving a large-scale hydraulic network with non-linear dynamics is studied. The hydraulic network underlies a district heating system, which provides heating water to a number of end-users in a city...... structure has the additional benefit that structural changes such as the addition or removal of end-users are easily implementable. In this work, the problem of controlling the pressure drop at the end-users to a constant reference value is considered. This is done by the use of pumps located both...... are considered. Some of the work considers control actions which are constrained to non-negative values only. This is due to the fact that the actuators in this type of system typically consist of centrifugal pumps which are only able to deliver non-negative actuation. Other parts of the work consider control...

  14. Mechanization of hydraulic testing of chemical equipment

    Energy Technology Data Exchange (ETDEWEB)

    Bannikov, M.T.; Fridman, R.N.; Petrovnin, A.I.

    1982-09-01

    The Institute VNIIPTKhimmash has worked out a comprehensive list of equipment for testing for strength and tightness containers and heat exchangers with jackets, with mixers, also of individual parts and subassemblies for this equipment. Points out that in the test stands developed for hydraulic testing of vessels both individual and centralized recirculating water supply can be used. Concludes that a reduction in labor consumption in hydraulic testing and in servicing of all the equipment used, an increase in the mechanization of this kind of chemical equipment, and the solution of the problem of standardization not only with regard to dimensions and parameters, but also with regard to the makes and types of the materials used, will make possible a considerable increase in labor productivity and product quality.

  15. Concept Evaluation for Hydraulic Yaw System

    DEFF Research Database (Denmark)

    Stubkier, Søren; Pedersen, Henrik C.; Andersen, Torben Ole

    2013-01-01

    a suspension system on a car, leading the loads away from the turbine structure. However, to realize a soft hydraulic yaw system a new design concept must be found. As a part of the development of the new concept a preliminary concept evaluation has been conducted, evaluating seven different hydraulic yaw......The yaw system is the subsystem on a wind turbine which ensures that the rotor plane of the turbine always is facing the wind direction. Studies from [1] show that a soft yaw system may be utilized to dampen the loads in the wind turbine structure. The soft yaw system operates much like...... investigation. Loads and yaw demands are based on the IEC 61400-1 standard for wind turbine design, and the loads for this examination are extrapolated from the HAWC2 aeroelastic design code. The concepts are based on a 5 MW off-shore turbine....

  16. New parameters influencing hydraulic runner lifetime

    Science.gov (United States)

    Sabourin, M.; Thibault, D.; Bouffard, D. A.; Lévesque, M.

    2010-08-01

    Traditionally, hydraulic runner mechanical design is based on calculation of static stresses. Today, validation of hydraulic runner design in terms of reliability requires taking into account the fatigue effect of dynamics loads. A damage tolerant approach based on fracture mechanics is the method chosen by Alstom and Hydro-Québec to study fatigue damage in runners. This requires a careful examination of all factors influencing material fatigue behavior. Such material behavior depends mainly on the chemical composition, microstructure and thermal history of the component, and on the resulting residual stresses. Measurement of fracture mechanics properties of various steels have demonstrated that runner lifetime can be significantly altered by differences in the manufacturing process, although remaining in accordance with agreed practices and standards such as ASTM. Carbon content and heat treatment are suspected to influence fatigue lifetime. This will have to be investigated by continuing the current research.

  17. Pilot testing of a hydraulic bridge exciter

    Directory of Open Access Journals (Sweden)

    Andersson Andreas

    2015-01-01

    Full Text Available This paper describes the development of a hydraulic bridge exciter and its first pilot testing on a full scale railway bridge in service. The exciter is based on a hydraulic load cylinder with a capacity of 50 kN and is intended for controlled dynamic loading up to at least 50 Hz. The load is applied from underneath the bridge, enabling testing while the railway line is in service. The system is shown to produce constant load amplitude even at resonance. The exciter is used to experimentally determine frequency response functions at all sensor locations, which serve as valuable input for model updating and verification. An FE-model of the case study bridge has been developed that is in good agreement with the experimental results.

  18. NEW HYDRAULIC ACTUATOR'S POSITION SERVOCONTROL STRATEGY

    Institute of Scientific and Technical Information of China (English)

    KE Zunrong; ZHU Yuquan; LING Xuan

    2007-01-01

    A new hydraulic actuator-hydraulic muscle (HM) is described, and the actuator's features and applications are analyzed, then a position servocontrol system in which HM is main actuator is set up. The mathematical model of the system is built up and several control strategies are discussed. Based on the mathematical model, simulation research and experimental investigation with subsection PID control, neural network self-adaptive PID control and single neuron self-adaptive PID control adopted respectively are carried out, and the results indicate that compared with PID control, neural network self-adaptive PID control and single neuron self-adaptive PID control don't need controlled system's accurate model and have fast response, high control accuracy and strong robustness, they are very suitable for HM position servo control system.

  19. Advanced Hydraulic Studies on Enhancing Particle Removal

    DEFF Research Database (Denmark)

    He, Cheng

    The removal of suspended solids and attached pollutants is one of the main treatment processes in wastewater treatment. This thesis presents studies on the hydraulic conditions of various particle removal facilities for possible ways to increase their treatment capacity and performance by utilizing...... and improving hydraulic conditions. Unlike most traditional theses which usually focus only on one particular subject of study, this thesis contains four relatively independent studies which cover the following topics: a newly proposed particle settling enhancement plate, the redesign of the inlet zone......, introduction and conclusions as well as the study results. All studies were carried out with a combination of numerical model and measurements. In the first part of the thesis a new concept of using a vortex to increase particle removal from liquid was proposed and the new particle settling enhancement plates...

  20. Thermal Hydraulic Design of PWT Accelerating Structures

    CERN Document Server

    Yu, David; Chen Ping; Lundquist, Martin; Luo, Yan

    2005-01-01

    Microwave power losses on the surfaces of accelerating structures will transform to heat which will deform the structures if it is not removed in time. Thermal hydraulic design of the disk and cooling rods of a Plane Wave Transformer (PWT) structure is presented. Experiments to measure the hydraulic (pressure vs flow rate) and cooling (heat removed vs flow rate) properties of the PWT disk are performed, and results compared with simulations using Mathcad models and the COSMOSM code. Both experimental and simulation results showed that the heat deposited on the structure could be removed effectively using specially designed water-cooling circuits and the temperature of the structure could be controlled within the range required.

  1. Hydraulic conductivity and diffusion characterization of GCLs

    Energy Technology Data Exchange (ETDEWEB)

    Mukunoki, T.; Rowe, R.K.; Li, H.M.; Sangam, H.P.; Hurst, P.; Bathurst, R.J. [Queen' s Univ., Kingston, ON (Canada)]|[Royal Military Coll. of Canada, Kingston, ON (Canada); Badv, K. [Urmia Univ. (Iran, Islamic Republic of)

    2003-07-01

    This paper reports on the characterization of the hydraulic conductivity and diffusion of a geosynthetic clay liner (GCL) installed at a site off the southeast coast of Baffin Island, in the Canadian Arctic, following different levels of freeze-thaw exposure and under low temperature conditions. The authors presented a summary of the results obtained for hydraulic conductivity tests on GCLs subjected to freeze-thaw cycles, and specimens permeated with jet fuel (Arctic diesel). They also reported on diffusion tests conducted at 22 Celsius and 5 Celsius, followed by a discussion of the effect of temperature. The results indicate that there is no significant impact on GCL performance due to freeze-thaw cycles, permeation by jet fuel or diffusion at the lower temperatures expected in the north for the short term (up to approximately four years). Additional studies are needed to confirm long term behaviour. 24 refs., 2 tabs., 4 figs.

  2. Thermal-hydraulic analysis of nuclear reactors

    CERN Document Server

    Zohuri, Bahman

    2015-01-01

    This text covers the fundamentals of thermodynamics required to understand electrical power generation systems and the application of these principles to nuclear reactor power plant systems. It is not a traditional general thermodynamics text, per se, but a practical thermodynamics volume intended to explain the fundamentals and apply them to the challenges facing actual nuclear power plants systems, where thermal hydraulics comes to play.  Written in a lucid, straight-forward style while retaining scientific rigor, the content is accessible to upper division undergraduate students and aimed at practicing engineers in nuclear power facilities and engineering scientists and technicians in industry, academic research groups, and national laboratories. The book is also a valuable resource for students and faculty in various engineering programs concerned with nuclear reactors. This book also: Provides extensive coverage of thermal hydraulics with thermodynamics in nuclear reactors, beginning with fundamental ...

  3. The Hydraulic Ram (Or Impulse) Pump

    Science.gov (United States)

    Mills, Allan

    2014-01-01

    The hydraulic impulse pump utilizes a fraction of the momentum of a flowing stream to lift a small portion of that water to a higher level. There it may be accumulated in an elevated cistern to provide sufficient water for several families, for the pump works 24 h a day with no additional source of energy. The operation of the pump is described,…

  4. Hydraulic Aspects of Vegetation Maintanence in Streams

    DEFF Research Database (Denmark)

    Larsen, Torben; Vestergaard, Kristian

    1991-01-01

    This paper describes the importance of the underwater vegetation on Danish streams and some of the consequences of vegetation maintenance. the influence of the weed on the hydraulic conditions is studied through experiments in a smaller stream and the effect of cutting channels through the weed...... is measured. A method for predicting the Manning's n as a function of the discharge conditions is suggested, and also a working hypothesis for predictions of the effect of channel cutting is presented....

  5. Rapid Hydraulic Assessment for Stream Restoration

    Science.gov (United States)

    2016-02-01

    account the hydraulic conditions of the stream being restored. This is true whether the project involves a few feet of bank stabilization or several...coefficient, α, expresses a correction for nonuniformity in the velocity distribution, and in most applications this value is assumed to be 1 or read from...a table (e.g., Chow 1959, p.28). The depth and slope angle terms can be replaced by a vertical expression of the depth, y, because in most rivers

  6. Estimation of ground water hydraulic parameters

    Energy Technology Data Exchange (ETDEWEB)

    Hvilshoej, Soeren

    1998-11-01

    The main objective was to assess field methods to determine ground water hydraulic parameters and to develop and apply new analysis methods to selected field techniques. A field site in Vejen, Denmark, which previously has been intensively investigated on the basis of a large amount of mini slug tests and tracer tests, was chosen for experimental application and evaluation. Particular interest was in analysing partially penetrating pumping tests and a recently proposed single-well dipole test. Three wells were constructed in which partially penetrating pumping tests and multi-level single-well dipole tests were performed. In addition, multi-level slug tests, flow meter tests, gamma-logs, and geologic characterisation of soil samples were carried out. In addition to the three Vejen analyses, data from previously published partially penetrating pumping tests were analysed assuming homogeneous anisotropic aquifer conditions. In the present study methods were developed to analyse partially penetrating pumping tests and multi-level single-well dipole tests based on an inverse numerical model. The obtained horizontal hydraulic conductivities from the partially penetrating pumping tests were in accordance with measurements obtained from multi-level slug tests and mini slug tests. Accordance was also achieved between the anisotropy ratios determined from partially penetrating pumping tests and multi-level single-well dipole tests. It was demonstrated that the partially penetrating pumping test analysed by and inverse numerical model is a very valuable technique that may provide hydraulic information on the storage terms and the vertical distribution of the horizontal and vertical hydraulic conductivity under both confined and unconfined aquifer conditions. (EG) 138 refs.

  7. Monitoring hydraulic fracturing with seismic emission volume

    Science.gov (United States)

    Niu, F.; Tang, Y.; Chen, H.; TAO, K.; Levander, A.

    2014-12-01

    Recent developments in horizontal drilling and hydraulic fracturing have made it possible to access the reservoirs that are not available for massive production in the past. Hydraulic fracturing is designed to enhance rock permeability and reservoir drainage through the creation of fracture networks. Microseismic monitoring has been proven to be an effective and valuable technology to image hydraulic fracture geometry. Based on data acquisition, seismic monitoring techniques have been divided into two categories: downhole and surface monitoring. Surface monitoring is challenging because of the extremely low signal-to-noise ratio of the raw data. We applied the techniques used in earthquake seismology and developed an integrated monitoring system for mapping hydraulic fractures. The system consists of 20 to 30 state-of-the-art broadband seismographs, which are generally about hundreds times more sensible than regular geophones. We have conducted two experiments in two basins with very different geology and formation mechanism in China. In each case, we observed clear microseismic events, which may correspond to the induced seismicity directly associated with fracturing and the triggered ones at pre-existing faults. However, the magnitude of these events is generally larger than magnitude -1, approximately one to two magnitudes larger than those detected by downhole instruments. Spectrum-frequency analysis of the continuous surface recordings indicated high seismic energy associated with injection stages. The seismic energy can be back-projected to a volume that surrounds each injection stage. Imaging seismic emission volume (SEV) appears to be an effective way to map the stimulated reservior volume, as well as natural fractures.

  8. Partially decoupled modeling of hydraulic fracturing processes

    Energy Technology Data Exchange (ETDEWEB)

    Settari, A.; Puchyr, P.J.; Bachman, R.C. (Simtech Consulting Services, Calgary (CA))

    1990-02-01

    A new method of partial decoupling of the problem of modeling a hydraulic fracture in a reservoir is described. According to the authors this approach has significant advantages over previous methods with fully coupled or completely uncoupled models. Better accuracy can be achieved in modeling the fracture propagation, and the new system is very efficient and versatile. Virtually any reservoir model can be used for predicting postfracture productivity. Examples of single- and multiphase applications for modeling fractured wells are discussed.

  9. Quantifying Age-Related Hydraulic and Biochemical Constraints on Tree Photosynthesis in the Southern Appalachian Mountains

    Science.gov (United States)

    Missik, J.; Benson, M. C.; Oishi, A. C.; Novick, K. A.; Miniat, C.

    2015-12-01

    Forest carbon accumulation generally declines with age, a trend largely attributed to reductions in gross primary production (GPP). However, for many species, uncertainty remains about the specific mechanisms limiting GPP. We examine both tree hydraulic and biochemical parameters affecting carbon uptake across a successional gradient in the southern Appalachian Mountains, utilizing a chronosequence approach with 5-, 10-, and 85-year old forest stands. We conducted measurements on four of the dominant species in the region: Liriodendron tulipifera, Betula lenta, Acer rubrum, and Quercus alba. To assess biochemical photosynthetic capacity, we estimated Vcmax and Jmax from over 140 gas exchange A/Ci curves. We determined that leaf gas exchange measurements performed on excised branches of A. saccharum, L. tulipifera, and Q. alba significantly underestimated assimilation by 35, 26, and 63% on average, respectively. Therefore, A/Ci measurements were performed on in situ canopy branches, using an 18 m boom lift to access the tallest trees. We examine how these photosynthetic parameters vary with age, height, and foliar nitrogen content among tree species and canopy positions. In order to investigate hydraulic factors driving stomatal behavior and therefore carbon uptake, we collected measurements of mid-day and pre-dawn leaf water potential (ψmd and ψpd) and xylem cavitation vulnerability. Preliminary results suggest that ψmd-ψpd decreases with along the chronosequence in anisohydric species, whereas ψmd-ψpd increases or remains stable with age/height in isohydric species. These data will be analyzed together with site- and species-specific hydraulic vulnerability data to assess whether the hydraulic safety margin changes with tree age/height, and explore how these patterns vary among species representing different xylem anatomies and a range of isohydric/anisohydric water management strategies. These results will provide improved estimates of common parameters in

  10. Flow characteristics of variable hydraulic transformer

    Institute of Scientific and Technical Information of China (English)

    杨冠中; 姜继海

    2015-01-01

    A new kind of hydraulic transformer, called variable hydraulic transformer (VHT), is proposed to control its load flow rate. The hydraulic transformer evolves from a pressure transducer to a power transducer. The flow characteristics of VHT, such as its instantaneous flow rates, average flow rates, and flow pulsations in the ports, are investigated. Matlab software is used to simulate and calculate. There are five controlled angles of the port plate that can help to define the flow characteristics of VHT. The relationships between the flow characteristics and the structure in VHT are shown. Also, the plus−minus change of the average flow rates and the continuity of the instantaneous flow rates in the ports are presented. The results demonstrate the performance laws of VHT when the controlled angles of the port plate and of the swash plate change. The results also reveal that the special principle of the flow pulsation in the ports and the jump points of the instantaneous curves are the two basic causes of its loud noise, and that the control angles of the port plate and the swash plate and the pressures in the ports are the three key factors of the noise.

  11. Measuring Disturbance Impact on Soil Hydraulic Properties

    Science.gov (United States)

    Hinshaw, S.; Mirus, B. B.

    2014-12-01

    Disturbances associated with land cover change such as forest clearing and mono-cropping can have a substantial impact on soil-hydraulic properties, which in turn have a cascading impact on surface and near-surface hydrologic response. Although disturbances and vegetation change can alter soil-water retention and conductivity relations, hydrologic models relying on traditional soil-texture based pedotransfer functions would not be able to capture the disturbance impact on infiltration and soil-moisture storage. Therefore, in-situ estimates of characteristic curves of soil water retention and hydraulic conductivity relations are needed to understand and predict hydrologic impacts of land cover change. We present a method for in-situ estimates of effective characteristic curves that capture hysteretic soil-water retention properties at the plot scale. We apply this method to two different forest treatments and in urban settings to investigate the impact of land-use disturbances on soil-hydraulic properties. We compare our in-situ estimation method to results for simple pedotransfer functions to illustrate how this approach can improve understanding of disturbance impacts on hydrologic processes and function.

  12. On the Dynamic Measurements of Hydraulic Characteristics

    Science.gov (United States)

    Hasmatuchi, Vlad; Bosioc, Alin; Münch-Alligné, Cécile

    2016-11-01

    The present work introduces the implementation and validation of a faster method to measure experimentally the efficiency characteristics of hydraulic turbomachines at a model scale on a test rig. The case study is represented by a laboratory prototype of an in-line axial microturbine for water supply networks. The 2.65 kW one-stage variable speed turbine, composed by one upstream 5-blade runner followed by one counter-rotating downstream 7-blade runner, has been installed on the HES-SO Valais/Wallis universal test rig dedicated to assess performances of small hydraulic machinery following the IEC standard recommendations. In addition to the existing acquisition/control system of the test rig used to measure the 3D hill-chart of a turbine by classical static point-by-point method, a second digitizer has been added to acquire synchronized dynamic signals of the employed sensors. The optimal acceleration/deceleration ramps of the electrical drives have been previously identified in order to cope with the purpose of a reduced measurement time while avoiding errors and hysteresis on the acquired hydraulic characteristics. Finally, the comparison between the turbine efficiency hill-charts obtained by dynamic and static point-by-point methods shows a very good agreement in terms of precision and repeatability. Moreover, the applied dynamic method reduces significantly (by a factor of up to ten) the time necessary to measure the efficiency characteristics on model testing.

  13. Determining the Conditions for the Hydraulic Impacts Emergence at Hydraulic Systems

    Directory of Open Access Journals (Sweden)

    Mazurenko A.S.

    2017-08-01

    Full Text Available This research aim is to develop a method for modeling the conditions for the critical hydrau-lic impacts emergence on thermal and nuclear power plants’ pipeline systems pressure pumps depart-ing from the general provisions of the heat and hydrodynamic instability theory. On the developed method basis, the conditions giving rise to the reliability-critical hydraulic impacts emergence on pumps for the thermal and nuclear power plants’ typical pipeline system have been determined. With the flow characteristic minimum allowable (critical sensitivity, the flow velocity fluctuations ampli-tude reaches critical values at which the pumps working elements’ failure occurs. The critical hydrau-lic impacts emergence corresponds to the transition of the vibrational heat-hydrodynamic instability into an aperiodic one. As research revealed, a highly promising approach as to the preventing the criti-cal hydraulic impacts related to the foreground use of pumps having the most sensitive consumption (at supply network performance (while other technical characteristics corresponding to that parame-ter. The research novelty refers to the suggested method elaborated by the authors’ team, which, in contrast to traditional approaches, is efficient in determining the pump hydraulic impact occurrence conditions when the vibrational heat-hydrodynamic instability transition to the aperiodic instability.

  14. Rapid hydraulic recovery in Eucalyptus pauciflora after drought: linkages between stem hydraulics and leaf gas exchange.

    Science.gov (United States)

    Martorell, Sebastià; Diaz-Espejo, Antonio; Medrano, Hipólito; Ball, Marilyn C; Choat, Brendan

    2014-03-01

    In woody plants, photosynthetic capacity is closely linked to rates at which the plant hydraulic system can supply water to the leaf surface. Drought-induced embolism can cause sharp declines in xylem hydraulic conductivity that coincide with stomatal closure and reduced photosynthesis. Recovery of photosynthetic capacity after drought is dependent on restored xylem function, although few data exist to elucidate this coordination. We examined the dynamics of leaf gas exchange and xylem function in Eucalyptus pauciflora seedlings exposed to a cycle of severe water stress and recovery after re-watering. Stomatal closure and leaf turgor loss occurred at water potentials that delayed the extensive spread of embolism through the stem xylem. Stem hydraulic conductance recovered to control levels within 6 h after re-watering despite a severe drought treatment, suggesting an active mechanism embolism repair. However, stomatal conductance did not recover after 10 d of re-watering, effecting tighter control of transpiration post drought. The dynamics of recovery suggest that a combination of hydraulic and non-hydraulic factors influenced stomatal behaviour post drought.

  15. Bacterial accumulation in viscosity gradients

    Science.gov (United States)

    Waisbord, Nicolas; Guasto, Jeffrey

    2016-11-01

    Cell motility is greatly modified by fluid rheology. In particular, the physical environments in which cells function, are often characterized by gradients of viscous biopolymers, such as mucus and extracellular matrix, which impact processes ranging from reproduction to digestion to biofilm formation. To understand how spatial heterogeneity of fluid rheology affects the motility and transport of swimming cells, we use hydrogel microfluidic devices to generate viscosity gradients in a simple, polymeric, Newtonian fluid. Using video microscopy, we characterize the random walk motility patterns of model bacteria (Bacillus subtilis), showing that both wild-type ('run-and-tumble') cells and smooth-swimming mutants accumulate in the viscous region of the fluid. Through statistical analysis of individual cell trajectories and body kinematics in both homogeneous and heterogeneous viscous environments, we discriminate passive, physical effects from active sensing processes to explain the observed cell accumulation at the ensemble level.

  16. Vertebrate pressure-gradient receivers

    DEFF Research Database (Denmark)

    Christensen-Dalsgaard, Jakob

    2011-01-01

    The eardrums of all terrestrial vertebrates (tetrapods) are connected through Eustachian tubes or interaural canals. In some of the animals, these connections create pressure-gradient directionality, an enhanced directionality by interaction of sound arriving at both sides of the eardrum and stro......The eardrums of all terrestrial vertebrates (tetrapods) are connected through Eustachian tubes or interaural canals. In some of the animals, these connections create pressure-gradient directionality, an enhanced directionality by interaction of sound arriving at both sides of the eardrum....... Recent vertebrates form a continuum from perfect interaural transmission (0 dB in a certain frequency band) and pronounced eardrum directionality (30-40 dB) in the lizards, over somewhat attenuated transmission and limited directionality in birds and frogs, to the strongly attenuated interaural...

  17. Computational Strain Gradient Crystal Plasticity

    DEFF Research Database (Denmark)

    Niordson, Christian Frithiof; Kysar, Jeffrey W.

    2011-01-01

    A model for strain gradient crystal visco-plasticity is formulated along the lines proposed by Fleck andWillis (2009) for isotropic plasticity. Size-effects are included in the model due to the addition of gradient terms in both the free energy as well as through a dissipation potential. A finite...... element solution method is presented, which delivers the slip-rate field and the velocity-field based on two minimum principles. Some plane deformation problems relevant for certain specific orientations of a face centered cubic crystal under plane loading conditions are studied, and effective in......-plane parameters are developed based on the crystallographic properties of the material. The problem of cyclic shear of a single crystal between rigid platens is studied as well as void growth of a cylindrical void....

  18. Biomimetic Gradient Index (GRIN) Lenses

    Science.gov (United States)

    2006-01-01

    optics include single lenses inspired by cephalopod (octopus) eyes and a three-lens, wide field of view, optical system for a surveillance sensor...camera. Details are easily resolv- able with the polymer lens. This lens system was installed on an Evolution unmanned aerial vehicle (UAV) with a...lens system was installed in an NRL Evolution UAV and used to record video images at a height of up to 1000 ft. The index gradients in the polymer

  19. Multilayer coating for high gradients

    CERN Document Server

    Kubo, Takayuki

    2016-01-01

    The multilayer coating for high gradients is reviewed. Not only the S-I-S structure, but also the S-S bilayer structure are also treated. This is an incomplete manuscript of an invited article which will be submitted to a journal. I have uploaded this version in order to help the understanding on my talk at the TESLA Technology Collaboration meeting at Saclay, France.

  20. Future of gradient index optics

    Science.gov (United States)

    Hashizume, Hideki; Hamanaka, Kenjiro; Graham, Alan C., III; Zhu, X. Frank

    2001-11-01

    First developed over 30 years ago, gradient index lenses play an important role not only in telecommunications technology, but also in applications such as information interface and biomedical technology. Traditional manufacturing consists of doping a certain ion, A+ into the mother glass, drawing the glass into rods and then immersing the rods into s molten salt bath containing another certain ion B+. During a thermal ion exchange process, the original ion migrates out of the mother glass, and is replaced by the alternate ion, creating a refractive index variation. Current research is being conducted to improve the thermal ion exchange technology, and open new applications. This research includes extending working distances to greater than 100mm, decreasing the lens diameter, increasing the effective radius, and combining the technology with other technologies such as photolithographically etched masks to produce arrays of gradient index lenses. As a result of this ongoing research, the gradient index lens is expected to continue to be the enabling optical technology in the first decade of the new millennium and beyond.

  1. Primordial vorticity and gradient expansion

    Science.gov (United States)

    Giovannini, Massimo; Rezaei, Zahra

    2012-02-01

    The evolution equations of the vorticities of the electrons, ions and photons in a pre-decoupling plasma are derived, in a fully inhomogeneous geometry, by combining the general relativistic gradient expansion and the drift approximation within the Adler-Misner-Deser decomposition. The vorticity transfer between the different species is discussed in this novel framework and a set of general conservation laws, connecting the vorticities of the three-component plasma with the magnetic field intensity, is derived. After demonstrating that a source of large-scale vorticity resides in the spatial gradients of the geometry and of the electromagnetic sources, the total vorticity is estimated to lowest order in the spatial gradients and by enforcing the validity of the momentum constraint. By acknowledging the current bounds on the tensor to scalar ratio in the (minimal) tensor extension of the ΛCDM paradigm, the maximal comoving magnetic field induced by the total vorticity turns out to be, at most, of the order of 10-37 G over the typical comoving scales ranging between 1 and 10 Mpc. While the obtained results seem to be irrelevant for seeding a reasonable galactic dynamo action, they demonstrate how the proposed fully inhomogeneous treatment can be used for the systematic scrutiny of pre-decoupling plasmas beyond the conventional perturbative expansions.

  2. Primordial vorticity and gradient expansion

    CERN Document Server

    Giovannini, Massimo

    2012-01-01

    The evolution equations of the vorticities of the electrons, ions and photons in a pre-decoupling plasma are derived, in a fully inhomogeneous geometry, by combining the general relativistic gradient expansion and the drift approximation within the Adler-Misner-Deser decomposition. The vorticity transfer between the different species is discussed in this novel framework and a set of general conservation laws, connecting the vorticities of the three-component plasma with the magnetic field intensity, is derived. After demonstrating that a source of large-scale vorticity resides in the spatial gradients of the geometry and of the electromagnetic sources, the total vorticity is estimated to lowest order in the spatial gradients and by enforcing the validity of the momentum constraint. By acknowledging the current bounds on the tensor to scalar ratio in the (minimal) tensor extension of the $\\Lambda$CDM paradigm the maximal comoving magnetic field induced by the total vorticity turns out to be, at most, of the or...

  3. Multivariate distributions of soil hydraulic parameters

    Science.gov (United States)

    Qu, Wei; Pachepsky, Yakov; Huisman, Johan Alexander; Martinez, Gonzalo; Bogena, Heye; Vereecken, Harry

    2014-05-01

    Statistical distributions of soil hydraulic parameters have to be known when synthetic fields of soil hydraulic properties need to be generated in ensemble modeling of soil water dynamics and soil water content data assimilation. Pedotransfer functions that provide statistical distributions of water retention and hydraulic conductivity parameters for textural classes are most often used in the parameter field generation. Presence of strong correlations can substantially influence the parameter generation results. The objective of this work was to review and evaluate available data on correlations between van Genuchten-Mualem (VGM) model parameters. So far, two different approaches were developed to estimate these correlations. The first approach uses pedotransfer functions to generate VGM parameters for a large number of soil compositions within a textural class, and then computes parameter correlations for each of the textural classes. The second approach computes the VGM parameter correlations directly from parameter values obtained by fitting VGM model to measured water retention and hydraulic conductivity data for soil samples belonging to a textural class. Carsel and Parish (1988) used the Rawls et al. (1982) pedotransfer functions, and Meyer et al. (1997) used the Rosetta pedotransfer algorithms (Schaap, 2002) to develop correlations according to the first approach. We used the UNSODA database (Nemes et al. 2001), the US Southern Plains database (Timlin et al., 1999), and the Belgian database (Vereecken et al., 1989, 1990) to apply the second approach. A substantial number of considerable (>0.7) correlation coefficients were found. Large differences were encountered between parameter correlations obtained with different approaches and different databases for the same textural classes. The first of the two approaches resulted in generally higher values of correlation coefficients between VGM parameters. However, results of the first approach application depend

  4. How adaptable is the hydraulic system of European beech in the face of climate change-related precipitation reduction?

    Science.gov (United States)

    Schuldt, Bernhard; Knutzen, Florian; Delzon, Sylvain; Jansen, Steven; Müller-Haubold, Hilmar; Burlett, Régis; Clough, Yann; Leuschner, Christoph

    2016-04-01

    Climate warming will increase the drought exposure of many forests world-wide. It is not well understood how trees adapt their hydraulic architecture to a long-term decrease in water availability. We examined 23 traits characterizing the hydraulic architecture and growth rate of branches and the dependent foliage of mature European beech (Fagus sylvatica) trees along a precipitation gradient (855-594 mm yr(-1) ) on uniform soil. A main goal was to identify traits that are associated with xylem efficiency, safety and growth. Our data demonstrate for the first time a linear increase in embolism resistance with climatic aridity (by 10%) across populations within a species. Simultaneously, vessel diameter declined by 7% and pit membrane thickness (Tm ) increased by 15%. Although specific conductivity did not change, leaf-specific conductivity declined by 40% with decreasing precipitation. Of eight plant traits commonly associated with embolism resistance, only vessel density in combination with pathway redundancy and Tm were related. We did not confirm the widely assumed trade-off between xylem safety and efficiency but obtained evidence in support of a positive relationship between hydraulic efficiency and growth. We conclude that the branch hydraulic system of beech has a distinct adaptive potential to respond to a precipitation reduction as a result of the environmental control of embolism resistance.

  5. Solving thermal-hydraulic tasks in the context of structure-mechanical analysis; Loesung thermohydraulischer Aufgaben im Rahmen strukturmechanischer Analysen

    Energy Technology Data Exchange (ETDEWEB)

    Hermsmeyer, S.

    1999-06-01

    The thermomechanical analysis of fluid-cooled structures depends critically on local coolant temperatures. This is particularly true for transient analyses of fusion reactor blankets that are exposed to large radial and temporal power gradients in power cycling reactors and see large thermal-mechanical loads. This report is concerned with the issue of thermal-hydraulic modelling and analysis that is an integral part of structure-mechanical analyses yet has to be treated separately because of differing needs regarding the finite element code and structure discretisation. This report presents a simplified thermal no-momentum fluid model that poses acceptable icomputational cost even for extended and branched cooling systems. The implementation of this model in the finite element codes FIDAP and ABAQUS is described. A comparison of the codes finds advantages for thermal-hydraulic modelling in FIDAP, stressing however, that unified computer-aided-design-based grid generation would be desirable. Two examples serve the purpose of demonstrating the methodology of the thermal-hydraulic analysis. Key parts of this methodology are the use of symmetry conditions when modelling a representative blanket section, the partitioning into submodels, the simplification of geometrical model features and the feeding thermal-hydraulic results into the structure-mechanic analysis. Part of the appendix is a description and manual for a computer code that has been written to simplify the design of three-dimensional FIDAP models. The code automates the successive rotation and/or translation of surfaces defined in FIDAP.

  6. Analysis of Innovative Design of Energy Efficient Hydraulic Actuators

    Directory of Open Access Journals (Sweden)

    M Osman Abdalla

    2013-01-01

    Full Text Available Hydraulic cylinder actuators are used extensively in industrial, construction and agricultural works. The small sized outlet ports of the cylinders resist the flow of discharged oil; and as a result the piston motion is slowed down. This causes a lot of heat generation and energy loss within the actuators. The study investigates and analyzes the possibilities of reducing the hydraulic resistance and increasing efficiency of the hydraulic actuator. Conventional hydraulic cylinders are simulated in FLUENT. Results show that the small outlet ports are the sources of energy loss in hydraulic cylinders. A new hydraulic system was proposed as a solution to relieve the hydraulic resistance in the actuators. The proposed system is a four ports hydraulic cylinder fitted with a novel flow control valve. The proposed four ports cylinder was simulated and parameters such as ports sizes, loads and pressures are varied during the simulation. The hydraulic resisting forces, piston speed and mass flow rates are computed. Results show that the hydraulic resistance is significantly reduced in the proposed four ports actuators; and the proposed cylinders run faster than the conventional cylinders and a considerable amount of energyis saved as well.

  7. Variation in reach-scale hydraulic conductivity of streambeds

    Science.gov (United States)

    Stewardson, M. J.; Datry, T.; Lamouroux, N.; Pella, H.; Thommeret, N.; Valette, L.; Grant, S. B.

    2016-04-01

    Streambed hydraulic conductivity is an important control on flow within the hyporheic zone, affecting hydrological, ecological, and biogeochemical processes essential to river ecosystem function. Despite many published field measurements, few empirical studies examine the drivers of spatial and temporal variations in streambed hydraulic conductivity. Reach-averaged hydraulic conductivity estimated for 119 surveys in 83 stream reaches across continental France, even of coarse bed streams, are shown to be characteristic of sand and finer sediments. This supports a model where processes leading to the accumulation of finer sediments within streambeds largely control hydraulic conductivity rather than the size of the coarse bed sediment fraction. After describing a conceptual model of relevant processes, we fit an empirical model relating hydraulic conductivity to candidate geomorphic and hydraulic drivers. The fitted model explains 72% of the deviance in hydraulic conductivity (and 30% using an external cross-validation). Reach hydraulic conductivity increases with the amplitude of bedforms within the reach, the bankfull channel width-depth ratio, stream power and upstream catchment erodibility but reduces with time since the last streambed disturbance. The correlation between hydraulic conductivity and time since a streambed mobilisation event is likely a consequence of clogging processes. Streams with a predominantly suspended load and less frequent streambed disturbances are expected to have a lower streambed hydraulic conductivity and reduced hyporheic fluxes. This study suggests a close link between streambed sediment transport dynamics and connectivity between surface water and the hyporheic zone.

  8. Geostatistical Estimations of Regional Hydraulic Conductivity Fields

    Science.gov (United States)

    Patriarche, D.; Castro, M. C.; Goovaerts, P.

    2004-12-01

    Direct and indirect measurements of hydraulic conductivity (K) are commonly performed, providing information on the magnitude of this parameter at the local scale (tens of centimeters to hundreds of meters) and at shallow depths. By contrast, field information on hydraulic conductivities at regional scales of tens to hundreds of kilometers and at greater depths is relatively scarce. Geostatistical methods allow for sparsely sampled observations of a variable (primary information) to be complemented by a more densely sampled secondary attribute. Geostatistical estimations of the hydraulic conductivity field in the Carrizo aquifer, a major groundwater flow system extending along Texas, are performed using available primary (e.g., transmissivity, hydraulic conductivity) and secondary (specific capacity) information, for depths up to 2.2 km, and over three regional domains of increasing extent: 1) the domain corresponding to a three-dimensional groundwater flow model previously built (model domain); 2) the area corresponding to the ten counties encompassing the model domain (County domain), and; 3) the full extension of the Carrizo aquifer within Texas (Texas domain). Two different approaches are used: 1) an indirect approach are transmissivity (T) is estimated first and (K) is retrieved through division of the T estimate by the screening length of the wells, and; 2) a direct approach where K data are kriged directly. Prediction performances of the tested geostatistical procedures (kriging combined with linear regression, kriging with known local means, kriging of residuals, and cokriging) are evaluated through cross validation for both log-transformed variables and back-transformed ones. For the indirect approach, kriging of log T residuals yields the best estimates for both log-transformed and back-transformed variables in the model domain. For larger regional scales (County and Texas domains), cokriging performs generally better than univariate kriging procedures

  9. Review of Hydraulic Fracturing for Preconditioning in Cave Mining

    Science.gov (United States)

    He, Q.; Suorineni, F. T.; Oh, J.

    2016-12-01

    Hydraulic fracturing has been used in cave mining for preconditioning the orebody following its successful application in the oil and gas industries. In this paper, the state of the art of hydraulic fracturing as a preconditioning method in cave mining is presented. Procedures are provided on how to implement prescribed hydraulic fracturing by which effective preconditioning can be realized in any in situ stress condition. Preconditioning is effective in cave mining when an additional fracture set is introduced into the rock mass. Previous studies on cave mining hydraulic fracturing focused on field applications, hydraulic fracture growth measurement and the interaction between hydraulic fractures and natural fractures. The review in this paper reveals that the orientation of the current cave mining hydraulic fractures is dictated by and is perpendicular to the minimum in situ stress orientation. In some geotechnical conditions, these orientation-uncontrollable hydraulic fractures have limited preconditioning efficiency because they do not necessarily result in reduced fragmentation sizes and a blocky orebody through the introduction of an additional fracture set. This implies that if the minimum in situ stress orientation is vertical and favors the creation of horizontal hydraulic fractures, in a rock mass that is already dominated by horizontal joints, no additional fracture set is added to that rock mass to increase its blockiness to enable it cave. Therefore, two approaches that have the potential to create orientation-controllable hydraulic fractures in cave mining with the potential to introduce additional fracture set as desired are proposed to fill this gap. These approaches take advantage of directional hydraulic fracturing and the stress shadow effect, which can re-orientate the hydraulic fracture propagation trajectory against its theoretical predicted direction. Proppants are suggested to be introduced into the cave mining industry to enhance the

  10. Hydrodynamic evaluation of a hydraulic clarifier through hydraulic behaviour indicators and simplified flow models

    Directory of Open Access Journals (Sweden)

    Paola Patiño

    2012-04-01

    Full Text Available Hydrodynamic phenomena take place within water treatment plants associated with physical, operational and environmental factors which can affect the water quality. This study evaluated a hydraulic clarifier’s hydrodynamic pattern using sludge recirculation through continuous tracer test leading to determining hydraulic behaviour indicators and simplified flow models. The clarifier had dual flow with a predominantly complete mixture during the hours in which higher temperatures were reported for affluent water compared to those reported inside the reactor, causing the formation of density currents promoting mixing in the reactor and increased turbidity in the effluent. The hydraulic indicators and the Wolf-Resnick model had higher sensitivity to the influence of temperature on reactor hydrodynamics.

  11. Power Management in Mobile Hydraulic Applications - An Approach for Designing Hydraulic Power Supply Systems

    DEFF Research Database (Denmark)

    Pedersen, Henrik Clemmensen

    2004-01-01

    in a project to develop rules and methods for designing and controlling mobile hydraulic systems in the most energy efficient way, when also considering the operational aspects of the system. The paper first describes the thoughts and ideas behind the project and then focus on an automated approach to design......Throughout the last three decades energy consumption has become one of the primary design aspects in hydraulic systems, especially for mobile hydraulic systems, as power and cooling capacity here is at limited disposal. Considering the energy usage, this is dependent on component efficiency......, but even more important is the system topology. However, there are no rules or guidelines for what system topology to choose for a given application, in order to obtain the most energy efficient system, nor for how the energy should be distributed in the system. This paper describes the approach taken...

  12. On the structure of gradient Yamabe solitons

    CERN Document Server

    Cao, Huai-Dong; Zhang, Yingying

    2011-01-01

    We show that every complete nontrivial gradient Yamabe soliton admits a special global warped product structure with a one-dimensional base. Based on this, we prove a general classification theorem for complete nontrivial locally conformally flat gradient Yamabe solitons.

  13. Community and ecosystem responses to elevational gradients

    DEFF Research Database (Denmark)

    Sundqvist, Maja K.; Sanders, Nate; Wardle, David A.

    2013-01-01

    Community structure and ecosystem processes often vary along elevational gradients. Their responses to elevation are commonly driven by changes in temperature, and many community- and ecosystem-level variables therefore frequently respond similarly to elevation across contrasting gradients. There...

  14. Gradient Flow Convolutive Blind Source Separation

    DEFF Research Database (Denmark)

    Pedersen, Michael Syskind; Nielsen, Chinton Møller

    2004-01-01

    Experiments have shown that the performance of instantaneous gradient flow beamforming by Cauwenberghs et al. is reduced significantly in reverberant conditions. By expanding the gradient flow principle to convolutive mixtures, separation in a reverberant environment is possible. By use of a circ......Experiments have shown that the performance of instantaneous gradient flow beamforming by Cauwenberghs et al. is reduced significantly in reverberant conditions. By expanding the gradient flow principle to convolutive mixtures, separation in a reverberant environment is possible. By use...

  15. An education gradient in health, a health gradient in education, or a confounded gradient in both?

    Science.gov (United States)

    Lynch, Jamie L; von Hippel, Paul T

    2016-04-01

    There is a positive gradient associating educational attainment with health, yet the explanation for this gradient is not clear. Does higher education improve health (causation)? Do the healthy become highly educated (selection)? Or do good health and high educational attainment both result from advantages established early in the life course (confounding)? This study evaluates these competing explanations by tracking changes in educational attainment and Self-rated Health (SRH) from age 15 to age 31 in the National Longitudinal Study of Youth, 1997 cohort. Ordinal logistic regression confirms that high-SRH adolescents are more likely to become highly educated. This is partly because adolescent SRH is associated with early advantages including adolescents' academic performance, college plans, and family background (confounding); however, net of these confounders adolescent SRH still predicts adult educational attainment (selection). Fixed-effects longitudinal regression shows that educational attainment has little causal effect on SRH at age 31. Completion of a high school diploma or associate's degree has no effect on SRH, while completion of a bachelor's or graduate degree have effects that, though significant, are quite small (less than 0.1 points on a 5-point scale). While it is possible that educational attainment would have greater effect on health at older ages, at age 31 what we see is a health gradient in education, shaped primarily by selection and confounding rather than by a causal effect of education on health.

  16. Derivation of site-specific relationships between hydraulic parameters and p-wave velocities based on hydraulic and seismic tomography

    Energy Technology Data Exchange (ETDEWEB)

    Brauchler, R.; Doetsch, J.; Dietrich, P.; Sauter, M.

    2012-01-10

    In this study, hydraulic and seismic tomographic measurements were used to derive a site-specific relationship between the geophysical parameter p-wave velocity and the hydraulic parameters, diffusivity and specific storage. Our field study includes diffusivity tomograms derived from hydraulic travel time tomography, specific storage tomograms, derived from hydraulic attenuation tomography, and p-wave velocity tomograms, derived from seismic tomography. The tomographic inversion was performed in all three cases with the SIRT (Simultaneous Iterative Reconstruction Technique) algorithm, using a ray tracing technique with curved trajectories. The experimental set-up was designed such that the p-wave velocity tomogram overlaps the hydraulic tomograms by half. The experiments were performed at a wellcharacterized sand and gravel aquifer, located in the Leine River valley near Göttingen, Germany. Access to the shallow subsurface was provided by direct-push technology. The high spatial resolution of hydraulic and seismic tomography was exploited to derive representative site-specific relationships between the hydraulic and geophysical parameters, based on the area where geophysical and hydraulic tests were performed. The transformation of the p-wave velocities into hydraulic properties was undertaken using a k-means cluster analysis. Results demonstrate that the combination of hydraulic and geophysical tomographic data is a promising approach to improve hydrogeophysical site characterization.

  17. Nonlinear cross Gramians and gradient systems

    NARCIS (Netherlands)

    Ionescu, T. C.; Scherpen, J. M. A.

    2007-01-01

    We study the notion of cross Gramians for nonlinear gradient systems, using the characterization in terms of prolongation and gradient extension associated to the system. The cross Gramian is given for the variational system associated to the original nonlinear gradient system. We obtain

  18. 40 CFR 230.25 - Salinity gradients.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Salinity gradients. 230.25 Section 230... Physical and Chemical Characteristics of the Aquatic Ecosystem § 230.25 Salinity gradients. (a) Salinity... fresh or salt water may change existing salinity gradients. For example, partial blocking of...

  19. Effects of variations in hydraulic conductivity and flow conditions on groundwater flow and solute transport in peatlands

    Energy Technology Data Exchange (ETDEWEB)

    Kellner, Erik [Dept. of Forest Ecology, Univ. of Helsinki (Finland)

    2007-02-15

    In this report it is examined to what extent the variation in hydraulic conductivity within a peatland and adjoining sediments would affect the flow patterns within it under some certain hydraulic-head gradients and other certain border conditions. The first part of the report contains a short review of organic and mineral-soil sediment types and characteristics and what we know about present peatlands and underlying sediments in the SKB investigation areas today. In the next part, a 2-dimensional model is used to simulate flows and transports in different settings of a peatland, with the objective of studying the effects of some particular factors: 1. The magnitude of the hydraulic conductivity of the peat and of underlying layers. 2. Presence and positions of cracks in underlying clay layers. 3. Anisotropy and heterogeneity in peat hydraulic conductivity. 4. The size of the water recharge at the peatland surface. 5. The seasonal variation of the water recharge. The modelling results show that the importance of flow direction decreases with decreasing hydraulic conductivity in the peatland. This occurs as the convective flux is slowed down and the transport is taken over by the diffusive flux. Because the lowest hydraulic conductivity layer to large extent determines the size of the flow, presence of a low-conductivity layer, such as a layer of clay, is an important factor. Presence of cracks in such tight layers can increase the transport of solutes into the peat. The highest inflow rates are reached when such cracks occur in discharge areas with strong upward flow. On the other hand, a conservative solute can spread efficiently if there is a crack in low-flow locations. The effect of anisotropy is found to be small, partly because the horizontal gradients become smaller as distances are larger. The effect of layers with high or low permeability varies depending on the location and the prevailing gradients. One tight layer has a strong effect on the flow pattern

  20. Soil hydraulic properties near saturation, an improved conductivity model

    DEFF Research Database (Denmark)

    Børgesen, Christen Duus; Jacobsen, Ole Hørbye; Hansen, Søren;

    2006-01-01

    The hydraulic properties near saturation can change dramatically due to the presence of macropores that are usually difficult to handle in traditional pore size models. The purpose of this study is to establish a data set on hydraulic conductivity near saturation, test the predictive capability...... of commonly used hydraulic conductivity models and give suggestions for improved models. Water retention and near saturated and saturated hydraulic conductivity were measured for a variety of 81 top and subsoils. The hydraulic conductivity models by van Genuchten [van Genuchten, 1980. A closed-form equation...... for predicting the hydraulic conductivity of unsaturated soils. Soil Sci. Soc. Am. J. 44, 892–898.] (vGM) and Brooks and Corey, modified by Jarvis [Jarvis, 1991. MACRO—A Model of Water Movement and Solute Transport in Macroporous Soils. Swedish University of Agricultural Sciences. Department of Soil Sciences...

  1. Stringy bounces and gradient instabilities

    CERN Document Server

    Giovannini, Massimo

    2017-01-01

    Bouncing solutions are obtained from a generally covariant action characterized by a potential which is a nonlocal functional of the dilaton field at two separated space-time points. Gradient instabilities are shown to arise in this context but they are argued to be nongeneric. After performing a gauge-invariant and frame-invariant derivation of the evolution equations of the fluctuations, a heuristic criterium for the avoidance of pathological instabilities is proposed and corroborated by a number of explicit examples that turn out to be compatible with a quasi-flat spectrum of curvature inhomogeneities for typical wavelengths larger than the Hubble radius.

  2. Temperature Gradient in Hall Thrusters

    Energy Technology Data Exchange (ETDEWEB)

    D. Staack; Y. Raitses; N.J. Fisch

    2003-11-24

    Plasma potentials and electron temperatures were deduced from emissive and cold floating probe measurements in a 2 kW Hall thruster, operated in the discharge voltage range of 200-400 V. An almost linear dependence of the electron temperature on the plasma potential was observed in the acceleration region of the thruster both inside and outside the thruster. This result calls into question whether secondary electron emission from the ceramic channel walls plays a significant role in electron energy balance. The proportionality factor between the axial electron temperature gradient and the electric field is significantly smaller than might be expected by models employing Ohmic heating of electrons.

  3. South Davis Sewer District Pump Station Hydraulic Capacity Evaluation

    OpenAIRE

    Dixon, James W

    2011-01-01

    In 2010, South Davis Sewer District (SDSD) determined that possible hydraulic problems existed in their various pump stations operating within their treatment plants. A hydraulic analysis was conducted for the pump stations to diagnose the problems and provide possible alternative solutions. This analysis was conducted by using hydraulic minor loss equations to determine the amount of flow that the pumps were capable of producing and then comparing those results to the required demands in the...

  4. Predictive Maintenance of Hydraulic Lifts through Lubricating Oil Analysis

    OpenAIRE

    Stamatios S. Kalligeros

    2013-01-01

    This article examines the possibility of measuring lift maintenance through analysis of used hydraulic oil. Hydraulic oils have proved to be a reliable indicator for the maintenance performed on elevators. It has also been proved that the end users or the maintenance personnel do not always conform to the instructions of the elevators’ hydraulic machine manufacturer. Furthermore, by examining the proportion of the metals, an estimation of the corrosion and the wear resistance of the joined mo...

  5. M1078 Hybrid Hydraulic Vehicle Fuel Economy Evaluation

    Science.gov (United States)

    2012-09-01

    PLEASE DO NOT RETURN YOUR FORM TO THE ABOVE ADDRESS. 1. REPORT DATE (DD-MM-YYYY) 28-09-2012 2. REPORT TYPE Interim Report 3. DATES COVERED (From...system shakedown and developmental testing. During developmental testing, a hydraulic motor failure occurred. Although not catastrophic, the motor...main hydraulic hybrid system control module to request the TCM to shift the transmission. Clutch Operation with engine- off (hydraulic-only power) or

  6. Research on hydraulic-powered roof supports test problems

    Institute of Scientific and Technical Information of China (English)

    SUN Hong-bo; JIANG Jin-qiu; MA Qiang

    2011-01-01

    The load-bearing characters of hydraulic-powered roof support with dual telescopic legs were analyzed. With a specific type hydraulic-powered roof support with dual telescopic legs for research object, the inside load test problems in factories was analyzed, and the correct test methods were given, which can enhance the test efficiency and make the factories away from the error design of hydraulic-powered roof supports and legs.

  7. Hydraulics national laboratory; Laboratoire national d`hydraulique

    Energy Technology Data Exchange (ETDEWEB)

    Chabard, J.P.

    1995-12-31

    The hydraulics national laboratory is a department of the service of applications of electric power and environment from the direction of studies and researches of Electricite de France. It has to solve the EDF problems concerning the fluids mechanics and hydraulics. Problems in PWR type reactors, fossil fuel power plants, circulating fluidized bed power plants, hydroelectric power plants relative to fluid mechanics and hydraulics studied and solved in 1995 are explained in this report. (N.C.)

  8. Effect of hydraulic parameters on sediment transport capacity in overland flow over erodible beds

    Science.gov (United States)

    Ali, M.; Sterk, G.; Seeger, M.; Boersema, M.; Peters, P.

    2012-02-01

    Sediment transport is an important component of the soil erosion process, which depends on several hydraulic parameters like unit discharge, mean flow velocity, and slope gradient. In most of the previous studies, the impact of these hydraulic parameters on transport capacity was studied for non-erodible bed conditions. Hence, this study aimed to examine the influence of unit discharge, mean flow velocity and slope gradient on sediment transport capacity for erodible beds and also to investigate the relationship between transport capacity and composite force predictors, i.e. shear stress, stream power, unit stream power and effective stream power. In order to accomplish the objectives, experiments were carried out in a 3.0 m long and 0.5 m wide flume using four well sorted sands (0.230, 0.536, 0.719, 1.022 mm). Unit discharges ranging from 0.07 to 2.07 × 10-3 m2 s-1 were simulated inside the flume at four slopes (5.2, 8.7, 13.2 and 17.6%) to analyze their impact on sediment transport rate. The sediment transport rate measured at the bottom end of the flume by taking water and sediment samples was considered equal to sediment transport capacity, because the selected flume length of 3.0 m was found sufficient to reach the transport capacity. The experimental result reveals that the slope gradient has a stronger impact on transport capacity than unit discharge and mean flow velocity due to the fact that the tangential component of gravity force increases with slope gradient. Our results show that unit stream power is an optimal composite force predictor for estimating transport capacity. Stream power and effective stream power can also be successfully related to the transport capacity, however the relations are strongly dependent on grain size. Shear stress showed poor performance, because part of shear stress is dissipated by bed irregularities, bed form evolution and sediment detachment. An empirical transport capacity equation was derived, which illustrates that

  9. A New Type of Hydraulic Muscle

    Directory of Open Access Journals (Sweden)

    Nitai Drimer

    2016-01-01

    Full Text Available This paper presents the invention and development of a new fundamental type of hydraulic actuator, aimed at delivering better actuation efficiency. This actuator is a flexible tube, composed of two different materials, which deflects while applying inner pressure. This concept is simple to produce, and allows adaptation of the deflected shape by the design parameters (radius, wall thickness, geometry, etc.. Among other applications, it is mostly suitable for the activation of fins of nature-like marine robots. Theoretical formulation, production of prototypes and actuation experiments are presented, as well as material hysteresis research and an application example.

  10. Hydraulic characteristics of HANARO fuel bundles

    Energy Technology Data Exchange (ETDEWEB)

    Cho, S.; Chung, H. J.; Chun, S. Y.; Yang, S. K.; Chung, M. K. [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

    1997-12-31

    This paper presents the hydraulic characteristics measured by using LDV (Laser Doppler Velocimetry) in subchannels of HANARO, KAERI research reactor, fuel bundle. The fuel bundle consists of 18 axially finned rods with 3 spacer grids, which are arranged in cylindrical configuration. The effects of the spacer grids on the turbulent flow were investigated by the experimental results. Pressure drops for each component of the fuel bundle were measured, and the friction factors of fuel bundle and loss coefficients for the spacer grids were estimated from the measured pressure drops. Implications regarding the turbulent thermal mixing were discussed. Vibration test results measured by using laser vibrometer were presented. 9 refs., 12 figs. (Author)

  11. Analyses of hydraulic performance of velocity caps

    DEFF Research Database (Denmark)

    Christensen, Erik Damgaard; Degn Eskesen, Mark Chr.; Buhrkall, Jeppe

    2014-01-01

    The hydraulic performance of a velocity cap has been investigated. Velocity caps are often used in connection with offshore intakes. CFD (computational fluid dynamics) examined the flow through the cap openings and further down into the intake pipes. This was combined with dimension analyses...... in order to analyse the effect of different layouts on the flow characteristics. In particular, flow configurations going all the way through the structure were revealed. A couple of suggestions to minimize the risk for flow through have been tested....

  12. Mercury Thermal Hydraulic Loop (MTHL) Summary Report

    Energy Technology Data Exchange (ETDEWEB)

    Felde, David K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Crye, Jason Michael [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wendel, Mark W. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Yoder, Jr, Graydon L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Farquharson, George [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Jallouk, Philip A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); McFee, Marshall T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Pointer, William David [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ruggles, Art E. [Univ. of Tennessee, Knoxville, TN (United States); Carbajo, Juan J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-03-01

    The Spallation Neutron Source (SNS) is a high-power linear accelerator built at Oak Ridge National Laboratory (ORNL) which incorporates the use of a flowing liquid mercury target. The Mercury Thermal Hydraulic Loop (MTHL) was constructed to investigate and verify the heat transfer characteristics of liquid mercury in a rectangular channel. This report provides a compilation of previously reported results from the water-cooled and electrically heated straight and curved test sections that simulate the geometry of the window cooling channel in the target nose region.

  13. Hydraulic Power Plant Machine Dynamic Diagnosis

    Directory of Open Access Journals (Sweden)

    Hans Günther Poll

    2006-01-01

    Full Text Available A method how to perform an entire structural and hydraulic diagnosis of prototype Francis power machines is presented and discussed in this report. Machine diagnosis of Francis units consists on a proper evaluation of acquired mechanical, thermal and hydraulic data obtained in different operating conditions of several rotary and non rotary machine components. Many different physical quantities of a Francis machine such as pressure, strains, vibration related data, water flow, air flow, position of regulating devices and displacements are measured in a synchronized way so that a relation of cause an effect can be developed for each operating condition and help one to understand all phenomena that are involved with such kind of machine. This amount of data needs to be adequately post processed in order to allow correct interpretation of the machine dynamics and finally these data must be compared with the expected calculated data not only to fine tuning the calculation methods but also to accomplish fully understanding of the influence of the water passages on such machines. The way how the power plant owner has to operate its Francis machines, many times also determined by a central dispatcher, has a high influence on the fatigue life time of the machine components. The diagnostic method presented in this report helps one to understand the importance of adequate operation to allow a low maintenance cost for the entire power plant. The method how to acquire these quantities is discussed in details together with the importance of correct sensor balancing, calibration and adequate correlation with the physical quantities. Typical results of the dynamic machine behavior, with adequate interpretation, obtained in recent measurement campaigns of some important hydraulic turbines were presented. The paper highlights the investigation focus of the hydraulic machine behavior and how to tailor the measurement strategy to accomplish all goals. Finally some

  14. Micromechanical Aspects of Hydraulic Fracturing Processes

    Science.gov (United States)

    Galindo-torres, S. A.; Behraftar, S.; Scheuermann, A.; Li, L.; Williams, D.

    2014-12-01

    A micromechanical model is developed to simulate the hydraulic fracturing process. The model comprises two key components. Firstly, the solid matrix, assumed as a rock mass with pre-fabricated cracks, is represented by an array of bonded particles simulated by the Discrete Element Model (DEM)[1]. The interaction is ruled by the spheropolyhedra method, which was introduced by the authors previously and has been shown to realistically represent many of the features found in fracturing and communition processes. The second component is the fluid, which is modelled by the Lattice Boltzmann Method (LBM). It was recently coupled with the spheropolyhedra by the authors and validated. An advantage of this coupled LBM-DEM model is the control of many of the parameters of the fracturing fluid, such as its viscosity and the injection rate. To the best of the authors' knowledge this is the first application of such a coupled scheme for studying hydraulic fracturing[2]. In this first implementation, results are presented for a two-dimensional situation. Fig. 1 shows one snapshot of the LBM-DEM coupled simulation for the hydraulic fracturing where the elements with broken bonds can be identified and the fracture geometry quantified. The simulation involves a variation of the underground stress, particularly the difference between the two principal components of the stress tensor, to explore the effect on the fracture path. A second study focuses on the fluid viscosity to examine the effect of the time scales of different injection plans on the fracture geometry. The developed tool and the presented results have important implications for future studies of the hydraulic fracturing process and technology. references 1. Galindo-Torres, S.A., et al., Breaking processes in three-dimensional bonded granular materials with general shapes. Computer Physics Communications, 2012. 183(2): p. 266-277. 2. Galindo-Torres, S.A., A coupled Discrete Element Lattice Boltzmann Method for the

  15. Hydraulics and Stability of Five Texas Inlets.

    Science.gov (United States)

    1981-01-01

    8217~~r 0.38 .. , q . P . I Pleasure Pier 7 Morgan’s Point 2 South Jetty 8 Railroad Causeway N 1. 3 Teuas City Dike 9 Chocolate Bayou A 4 Manna Reel 10 Son...Range and Level.............15 III HYDRAULICS AND STABILITY OF SPECIFIC INLETS...................... 15 1. Brazos River-Freeport Harbor Entrance...g acceleration of gravity K Keulegan repletion coefficient k wave number L channel length Le effective channel length n Manning’s coefficient P

  16. HYDRAULIC CONCRETE COMPOSITION AND PROPERTIES CONTROL SYSTEM

    Directory of Open Access Journals (Sweden)

    O. M. Pshinko

    2015-08-01

    Full Text Available Purpose. Scientific work aims at the development and testing of information system to meet the challenges of concrete composition design and control (for railway structures and buildings based on the physico-analytical method algorithm for hydraulic concrete composition calculation. Methodology. The proposed algorithm of hydraulic concrete composition calculation is based on the physicochemical mechanics and in particular on the rheology of elastic–viscous–plastic bodies. The system of canonical equations consists of the equations for concrete strength, absolute volume, concrete mix consistency as well as the equation for optimal concrete saturation with aggregates while minimizing cement content. The joint solution of these four equations related to composition allows determining for the materials the concrete composition of required strength, concrete workability with minimum cement content. The procedure for calculation of hydraulic concrete composition according to the physico-analytical method consists of two parts: 1 physical, which is laboratory testing of concrete mix components in different concrete compositions; 2 analytical, which represents the calculation algorithm for concrete compositions equivalent in concrete strength and workability that comply with the specific conditions of concrete placing. Findings. To solve the problem of designing the concrete composition with the desired properties for railway structures and buildings it was proposed to use the information technology in the form of a developed computer program whose algorithm includes the physico-analytical method for hydraulic concrete composition determination. Originality. The developed concrete composition design method takes into account the basic properties of raw materials, concrete mix and concrete, which are pre-determined. The distinctive feature of physico-analytical method is obtaining of a set of equivalent compositions with a certain concrete mix

  17. Hydraulic Robotic Surgical Tool Changing Manipulator.

    Science.gov (United States)

    Pourghodrat, Abolfazl; Nelson, Carl A; Oleynikov, Dmitry

    2017-03-01

    Natural orifice transluminal endoscopic surgery (NOTES) is a surgical technique to perform "scarless" abdominal operations. Robotic technology has been exploited to improve NOTES and circumvent its limitations. Lack of a multitasking platform is a major limitation. Manual tool exchange can be time consuming and may lead to complications such as bleeding. Previous multifunctional manipulator designs use electric motors. These designs are bulky, slow, and expensive. This paper presents design, prototyping, and testing of a hydraulic robotic tool changing manipulator. The manipulator is small, fast, low-cost, and capable of carrying four different types of laparoscopic instruments.

  18. Mechanisms of FGF gradient formation during embryogenesis.

    Science.gov (United States)

    Balasubramanian, Revathi; Zhang, Xin

    2016-05-01

    Fibroblast growth factors (FGFs) have long been attributed to influence morphogenesis in embryonic development. Signaling by FGF morphogen encodes positional identity of tissues by creating a concentration gradient over the developing embryo. Various mechanisms that influence the development of such gradient have been elucidated in the recent past. These mechanisms of FGF gradient formation present either as an extracellular control over FGF ligand diffusion or as a subcellular control of FGF propagation and signaling. In this review, we describe our current understanding of FGF as a morphogen, the extracellular control of FGF gradient formation by heparan sulfate proteoglycans (HSPGs) and mechanisms of intracellular regulation of FGF signaling that influence gradient formation.

  19. Tidal current turbine based on hydraulic transmission system

    Institute of Scientific and Technical Information of China (English)

    Hong-wei LIU; Wei LI; Yong-gang LIN; Shun MA

    2011-01-01

    Tidal current turbines (TCTs) are newly developed electricity generating devices.Aiming at the stabilization of the power output of TCTs,this paper introduces the hydraulic transmission technologies into TCTs.The hydrodynamics of the turbine was analyzed at first and its power output characteristics were predicted.A hydraulic power transmission system and a hydraulic pitch-controlled system were designed.Then related simulations were conducted.Finally,a TCT prototype was manufactured and tested in the workshop.The test results have confirmed the correctness of the current design and availability of installation of the hydraulic system in TCTs.

  20. Hydrological and hydraulic modelling of the Nyl River floodplain Part ...

    African Journals Online (AJOL)

    2007-01-01

    Jan 1, 2007 ... Keywords: Nyl River floodplain, Nylsvlei, Nylsvley Nature Reserve, modelling wetland hydraulics, wetland evapotranspiration ..... A review of suitable methods for estimating evapotranspira- ..... ingum routing. J. Hydrol.

  1. Strategies for Creating Prescribed Hydraulic Fractures in Cave Mining

    Science.gov (United States)

    He, Q.; Suorineni, F. T.; Oh, J.

    2017-04-01

    The cave mining method was traditionally applied to massive low-grade, weak orebodies at shallow depths (less than 500 m) that favour cave propagation under gravity. Currently, this method is being applied to stronger orebodies and is taking place at depths of up to 2000 m below the surface. To ensure continuous cave propagation, preconditioning of the orebody is essential in this latter caving environment to improve rock mass caveability and to decrease fragmentation sizes. Hydraulic fracturing was initiated in the oil industry and is now being used in the cave mining industry as a preconditioning method and for stalled caves reactivation. A limitation of conventional hydraulic fracturing in the cave mining industry is that the hydraulic fracture orientation is uncontrollable and is dictated by the minimum in situ stress orientation. The preconditioning effectiveness of orientation-uncontrollable hydraulic fractures is limited in some geotechnical conditions, and the concept of creating orientation-controllable hydraulic fractures, here termed prescribed hydraulic fractures, is proposed to fill this gap. In this paper, the feasibility of the proposed approaches to creating prescribed hydraulic fractures is presented based on previous studies and numerical modelling. The numerical modelling code reliability in simulating the hydraulic fracture propagation and reorientation process was validated by comparing with laboratory results in the reported literature. In addition, the sensitivity of the prescribed hydraulic fracturing to the in situ stress condition and rock mass properties is examined.

  2. VIRTUAL DESIGN OF A NEW TYPE OF HYDRAULIC SUPPORT

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Using virtual reality to design a new type of hydraulic support is discussed. That is how to make use of the virtual design to develop coal mining machine in practice. The advantages of virtual design are studied and the simple virtual reality system is built. The 3D parts and elements of hydraulic support are modeled with parametric design in CAD software, then exported to VR environment, in which the virtual hydraulic support is assembled, operated and tested. With the method, the errors and faults of design can be fined easily, many improvements are made and the new hydraulic support is developed successfully.

  3. Predictive Maintenance of Hydraulic Lifts through Lubricating Oil Analysis

    Directory of Open Access Journals (Sweden)

    Stamatios S. Kalligeros

    2013-12-01

    Full Text Available This article examines the possibility of measuring lift maintenance through analysis of used hydraulic oil. Hydraulic oils have proved to be a reliable indicator for the maintenance performed on elevators. It has also been proved that the end users or the maintenance personnel do not always conform to the instructions of the elevators’ hydraulic machine manufacturer. Furthermore, by examining the proportion of the metals, an estimation of the corrosion and the wear resistance of the joined moving parts can be observed. Additionally, the presence of chlorine and calcium in hydraulic oils demonstrates their function in a highly corrosive environment.

  4. Quantifying the Efficiency Advantages of High Viscosity Index Hydraulic Fluids

    Institute of Scientific and Technical Information of China (English)

    Christian D. Neveu; Michael D. Zink; Alex Tsay

    2006-01-01

    By providing higher in- use viscosity at elevated operating temperatures, hydraulic fluids with high viscosity index improve the efficiency of the hydraulic system. For mobile hydraulic equipment this efficiency can be quantified as an increase in fuel economy. This paper reviews the research that demonstrates these efficiency advantages in gear, vane and piston pumps and presents a method for predicting the overall fuel economy for a fleet of hydraulic equipment in opquipment operator to easily improve the performance of the system and reduce fuel consumption.

  5. Singular perturbation approach for control of hydraulically driven flexible manipulator

    Institute of Scientific and Technical Information of China (English)

    LI Guang; WU Min

    2005-01-01

    The hydraulic flexible manipulator system is divided into two parts: flexible arm dynamics and hydraulic servomechanism, a driving Jacobian is derived to connect these two parts. Taking hydraulic actuator force as virtual input, a singular perturbed composite model is formulated and used to design composite controllers for the flexible link, in which the slow subsystem controller dominates the trajectory tracking, and then a fast controller is designed to damp out the vibration of the flexible structure. Moreover, the backstepping technique is applied to regulate the spool position of a hydraulic valve to provide the required force. Simulation results are provided to show the effectiveness of the presented approach.

  6. Hydraulic Fracturing and Drinking Water Resources: Update on EPA Hydraulic Fracturing Study

    Science.gov (United States)

    Natural gas plays a key role in our nation's energy future and the process known as hydraulic fracturing (HF) is one way of accessing that resource. Over the past few years, several key technical, economic, and energy developments have spurred increased use of HF for gas extracti...

  7. Development of A Hydraulic Drive for a novel Diesel-Hydraulic system for Large commercial Vehicles

    DEFF Research Database (Denmark)

    Stecki, J. S.; Conrad, Finn; Matheson, P.;

    2002-01-01

    The objectives and results of the research project Hybrid Diesel-Hydraulic System for Large commercial vehicles, e.g. urban freight delivery, buses or garbage trucks. The paper presents and discusses the research and development of the system, modelling approach and results from preliminary...

  8. Development of A Hydraulic Drive for a novel Diesel-Hydraulic system for Large commercial Vehicles

    DEFF Research Database (Denmark)

    Stecki, J. S.; Conrad, Finn; Matheson, P.

    2002-01-01

    The objectives and results of the research project Hybrid Diesel-Hydraulic System for Large commercial vehicles, e.g. urban freight delivery, buses or garbage trucks. The paper presents and discusses the research and development of the system, modelling approach and results from preliminary...... performance tests on a 10 ton vehicle....

  9. NIF optics phase gradient specfication

    Energy Technology Data Exchange (ETDEWEB)

    Williams, W.; Auerbach, J.; Hunt, J.; Lawson, L.; Manes, K.; Orth, C.; Sacks, R.; Trenholme, J.; Wegner, P.

    1997-05-02

    A root-mean-square (rms) phase gradient specification seems to allow a good connection between the NIP optics quality and focal spot requirements. Measurements on Beamlet optics individually, and as a chain, indicate they meet the assumptions necessary to use this specification, and that they have a typical rms phase gradient of {approximately}80 {angstrom}/cm. This may be sufficient for NIP to meet the proposed Stockpile Stewardship Management Program (SSMP) requirements of 80% of a high- power beam within a 200-250 micron diameter spot. Uncertainties include, especially, the scale length of the optics phase noise, the ability of the adaptive optic to correct against pump-induced distortions and optics noise, and the possibility of finding mitigation techniques against whole-beam self-focusing (e.g. a pre- correction optic). Further work is needed in these areas to better determine the NIF specifications. This memo is a written summary of a presentation on this topic given by W. Williams 24 April 1997 to NIP and LS&T personnel.

  10. [Hydraulic fracturing - a hazard for drinking water?].

    Science.gov (United States)

    Ewers, U; Gordalla, B; Frimmel, F

    2013-11-01

    Hydraulic fracturing (fracking) is a technique used to release and promote the extraction of natural gas (including shale gas, tight gas, and coal bed methane) from deep natural gas deposits. Among the German public there is great concern with regard to the potential environmental impacts of fracking including the contamination of ground water, the most important source of drinking water in Germany. In the present article the risks of ground water contamination through fracking are discussed. Due to the present safety requirements and the obligatory geological and hydrogeological scrutiny of the underground, which has to be performed prior to fracking, the risk of ground water contamination by fracking can be regarded as very low. The toxicity of chemical additives of fracking fluids is discussed. It is recommended that in the future environmental impact assessment and approval of fracs should be performed by the mining authorities in close cooperation with the water authorities. Furthermore, it is recommended that hydraulic fracturing in the future should be accompanied by obligatory ground water monitoring.

  11. Thermal Hydraulic Tests for Reactor Core Safety

    Energy Technology Data Exchange (ETDEWEB)

    Moon, S. K.; Baek, W. P.; Chun, S. Y. (and others)

    2007-06-15

    The main objectives of the present project are to resolve the current issues of reactor core thermal hydraulics, to develop an advanced measurement and analytical techniques, and to perform reactor core safety verification tests. 6x6 reflood experiments, various heat transfer experiments using Freon, and experiments on the spacer grids effects on the post-dryout are carried out using spacer grids developed in Korea in order to resolve the current issues of the reactor core thermal hydraulics. In order to develop a reflood heat transfer model, the detailed reflood phenomena are visualized and measured using round tube and 2x2 rod bundle. A detailed turbulent mixing phenomenon for subchannels is measured using advanced measurement techniques such as LDV and PIV. MARS and MATRA codes developed in Korea are assessed, verified and improved using the obtained experimental data. Finally, a systematic quality assurance program and experimental data generation system has been constructed in order to increase the reliability of the experimental data.

  12. Smart magnetic markers use in hydraulic fracturing.

    Science.gov (United States)

    Zawadzki, Jarosław; Bogacki, Jan

    2016-11-01

    One of the main challenges and unknowns during shale gas exploration is to assess the range and efficiency of hydraulic fracturing. It is also essential to assess the distribution of proppant, which keeps the fracture pathways open. Solving these problems may considerably increase the efficiency of the shale gas extraction. Because of that, the idea of smart magnetic marker, which can be detected when added to fracturing fluid, has been considered for a long time. This study provides overview of the possibilities of magnetic marker application for shale gas extraction. The imaging methods using electromagnetic markers, are considered or developed in two directions. The first possibility is the markers' electromagnetic activity throughout the whole volume of the fracturing fluid. Thus, it can be assumed that the whole fracturing fluid is the marker. Among these type of hydraulic fracturing solutions, ferrofluid could be considered. The second possibility is marker, which is just one of many components of the fracturing fluid. In this case feedstock magnetic materials, ferrites and nanomaterials could be considered. Magnetic properties of magnetite could be too low and ferrofluids' or nanomaterials' price is unacceptably high. Because of that, ferrites, especially ZnMn ferrites seems to be the best material for magnetic marker. Because of the numerous applications in electronics, it is cheap and easily available, although the price is higher, then that of magnetite. The disadvantage of using ferrite, could be too small mechanical strength. It creates an essential need for combining magnetic marker with proppant into magnetic-ceramic composite.

  13. USE OF GEOSYNTHETIC CASINGS IN HYDRAULIC ENGINEERING

    Directory of Open Access Journals (Sweden)

    Piyavskiy Semen Avraamovich

    2012-10-01

    Full Text Available The article covers the use of geosynthetic casings in hydraulic engineering. The authors describe the structure of earth dams that have geosynthetic casings used as the reinforcement of downstream slopes. Results of stability calculations are provided. The authors consider several examples of effective application of advanced geosynthetic materials used in combination with local building materials as structural elements of hydraulic engineering facilities. Their analysis has demonstrated a strong potential and expediency of application of geosynthetic casings in the course of construction and renovation of low-pressure earth dams. The authors have also developed a new structure of an earth dam. The new earth dam has geosynthetic casings used as structural reinforcing elements of the crown and the downstream slope. The dam structure contemplates the overflow of high water. The structural strengths of the proposed solution include a smaller material consumption rate, lower labour intensiveness and cost of the slope reinforcement due to the application of local building materials used to fill the casings, fast and easy depositing of slope reinforcing elements, and high workability of its dismantling for repair purposes. The authors have also completed the analysis of stability of geosynthetic casings of downstream slopes of an earth dam. The analysis has proven high efficiency of a small slope ratio in combination with its anchorage and reinforcement of the downstream toe with the help of high-strength geogrids.

  14. Laminar circular hydraulic jumps without separation

    Science.gov (United States)

    Dasgupta, Ratul; Tomar, Gaurav; Govindarajan, Rama

    2009-11-01

    The traditional inviscid criterion for the occurrence of a planar, standing hydraulic jump is to have the Froude number decrease downstream and go through a value of 1 at some location. Here, upstream propagating, small-amplitude, long, non-dispersive gravity waves are trapped, and non-linear steepening is said to result in a near-discontinuous height profile, but it is not clear how. Such a condition on the Froude number is shown in the present axisymmetric Navier-Stokes computations to hold for a circular jump as well. The relevance of non-linear steepening to a circular jump is therefore a question we wish to answer. In circular jumps, moreover, a region of recirculation is usually observed underneath the jump, underlining the importance of viscosity in this process. This led Tani (J. Phys. Soc. Japan, 1949) to hypothesise that boundary-layer separation was the cause of the circular jump. This hypothesis has been debated extensively and the possibility of circular jumps without separation hinted at. In our simulations, we are able to obtain circular hydraulic jumps without any flow separation. This, and the necessity or otherwise of viscosity in jump formation will be discussed.

  15. Drainage hydraulics of permeable friction courses

    Science.gov (United States)

    Charbeneau, Randall J.; Barrett, Michael E.

    2008-04-01

    This paper describes solutions to the hydraulic equations that govern flow in permeable friction courses (PFC). PFC is a layer of porous asphalt approximately 50 mm thick that is placed as an overlay on top of an existing conventional concrete or asphalt road surface to help control splash and hydroplaning, reduce noise, and enhance quality of storm water runoff. The primary objective of this manuscript is to present an analytical system of equations that can be used in design and analysis of PFC systems. The primary assumptions used in this analysis are that the flow can be modeled as one-dimensional, steady state Darcy-type flow and that slopes are sufficiently small so that the Dupuit-Forchheimer assumptions apply. Solutions are derived for cases where storm water drainage is confined to the PFC bed and for conditions where the PFC drainage capacity is exceeded and ponded sheet flow occurs across the pavement surface. The mathematical solutions provide the drainage characteristics (depth and residence time) as a function of rainfall intensity, PFC hydraulic conductivity, pavement slope, and maximum drainage path length.

  16. Hydraulic fracture model comparison study: Complete results

    Energy Technology Data Exchange (ETDEWEB)

    Warpinski, N.R. [Sandia National Labs., Albuquerque, NM (United States); Abou-Sayed, I.S. [Mobil Exploration and Production Services (United States); Moschovidis, Z. [Amoco Production Co. (US); Parker, C. [CONOCO (US)

    1993-02-01

    Large quantities of natural gas exist in low permeability reservoirs throughout the US. Characteristics of these reservoirs, however, make production difficult and often economic and stimulation is required. Because of the diversity of application, hydraulic fracture design models must be able to account for widely varying rock properties, reservoir properties, in situ stresses, fracturing fluids, and proppant loads. As a result, fracture simulation has emerged as a highly complex endeavor that must be able to describe many different physical processes. The objective of this study was to develop a comparative study of hydraulic-fracture simulators in order to provide stimulation engineers with the necessary information to make rational decisions on the type of models most suited for their needs. This report compares the fracture modeling results of twelve different simulators, some of them run in different modes for eight separate design cases. Comparisons of length, width, height, net pressure, maximum width at the wellbore, average width at the wellbore, and average width in the fracture have been made, both for the final geometry and as a function of time. For the models in this study, differences in fracture length, height and width are often greater than a factor of two. In addition, several comparisons of the same model with different options show a large variability in model output depending upon the options chosen. Two comparisons were made of the same model run by different companies; in both cases the agreement was good. 41 refs., 54 figs., 83 tabs.

  17. Formed Core Sampler Hydraulic Conductivity Testing

    Energy Technology Data Exchange (ETDEWEB)

    Miller, D. H.; Reigel, M. M.

    2012-09-25

    A full-scale formed core sampler was designed and functionally tested for use in the Saltstone Disposal Facility (SDF). Savannah River National Laboratory (SRNL) was requested to compare properties of the formed core samples and core drilled samples taken from adjacent areas in the full-scale sampler. While several physical properties were evaluated, the primary property of interest was hydraulic conductivity. Differences in hydraulic conductivity between the samples from the formed core sampler and those representing the bulk material were noted with respect to the initial handling and storage of the samples. Due to testing conditions, the site port samples were exposed to uncontrolled temperature and humidity conditions prior to testing whereas the formed core samples were kept in sealed containers with minimal exposure to an uncontrolled environment prior to testing. Based on the results of the testing, no significant differences in porosity or density were found between the formed core samples and those representing the bulk material in the test stand.

  18. Borehole Heat Exchanger Systems: Hydraulic Conductivity and Frost-Resistance of Backfill Materials

    Science.gov (United States)

    Anbergen, Hauke; Sass, Ingo

    2016-04-01

    Ground source heat pump (GSHP) systems are economic solutions for both, domestic heating energy supply, as well as underground thermal energy storage (UTES). Over the past decades the technology developed to complex, advanced and highly efficient systems. For an efficient operation of the most common type of UTES, borehole heat exchanger (BHE) systems, it is necessary to design the system for a wide range of carrier fluid temperatures. During heat extraction, a cooled carrier fluid is heated up by geothermal energy. This collected thermal energy is energetically used by the heat pump. Thereby the carrier fluid temperature must have a lower temperature than the surrounding underground in order to collect heat energy. The steeper the thermal gradient, the more energy is transferred to the carrier fluid. The heat injection case works vice versa. For fast and sufficient heat extraction, even over long periods of heating (winter), it might become necessary to run the BHE with fluid temperatures below 0°C. As the heat pump runs periodically, a cyclic freezing of the pore water and corresponding ice-lens growth in the nearfield of the BHE pipes becomes possible. These so called freeze-thaw-cycles (FTC) are a critical state for the backfill material, as the sealing effect eventually decreases. From a hydrogeological point of view the vertical sealing of the BHE needs to be secured at any time (e.g. VDI 4640-2, Draft 2015). The vertical hydraulic conductivity of the BHE is influenced not only by the permeability of the grouting material itself, but by the contact area between BHE pipes and grout. In order to assess the sealing capacity of grouting materials a laboratory testing procedure was developed that measures the vertical hydraulic conductivity of the system BHE pipe and grout. The key features of the procedure are: • assessment of the systeḿs hydraulic conductivity • assessment of the systeḿs hydraulic conductivity after simulation of freeze-thaw-cycle

  19. Wnt Secretion and Gradient Formation

    Directory of Open Access Journals (Sweden)

    Vladimir L. Katanaev

    2013-03-01

    Full Text Available Concentration gradients formed by the lipid-modified morphogens of the Wnt family are known for their pivotal roles during embryogenesis and adult tissue homeostasis. Wnt morphogens are also implicated in a variety of human diseases, especially cancer. Therefore, the signaling cascades triggered by Wnts have received considerable attention during recent decades. However, how Wnts are secreted and how concentration gradients are formed remains poorly understood. The use of model organisms such as Drosophila melanogaster has provided important advances in this area. For instance, we have previously shown that the lipid raft-associated reggie/flotillin proteins influence Wnt secretion and spreading in Drosophila. Our work supports the notion that producing cells secrete Wnt molecules in at least two pools: a poorly diffusible one and a reggie/flotillin-dependent highly diffusible pool which allows morphogen spreading over long distances away from its source of production. Here we revise the current views of Wnt secretion and spreading, and propose two models for the role of the reggie/flotillin proteins in these processes: (i reggies/flotillins regulate the basolateral endocytosis of the poorly diffusible, membrane-bound Wnt pool, which is then sorted and secreted to apical compartments for long-range diffusion, and (ii lipid rafts organized by reggies/flotillins serve as “dating points” where extracellular Wnt transiently interacts with lipoprotein receptors to allow its capture and further spreading via lipoprotein particles. We further discuss these processes in the context of human breast cancer. A better understanding of these phenomena may be relevant for identification of novel drug targets and therapeutic strategies.

  20. Maintaining Optimum Pump Performance with Specially- Formulated Hydraulic Fluids

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    This paper describes a battery of tests, and related results, that were performed under normal and severe conditions designed to demonstrate that hydraulic fluids formulated with Lubrizol' s high quality anti - wear hydraulic fluid technology can stand up to today's increasing demands for longer life and provide excellent performance under higher operating temperatures and pressures.

  1. THE THEORETICAL MODEL FOR PREDICTING CIRCULATION VELOCITY OF HYDRAULIC BRAKE

    Institute of Scientific and Technical Information of China (English)

    刘英林; 侯春生

    1997-01-01

    By rational hypothesis of fluid flow pattern, applied the law of conservation of energy and integrated the laboratory test results, finished the prediction by the theoretical model of circulation velocity of hydraulic brake which is important parameter. Thus provide the theoritical basis for hydraulic brake of belt conveyor whose research has just been started.

  2. 49 CFR 570.55 - Hydraulic brake system.

    Science.gov (United States)

    2010-10-01

    ... parking brake and turn the ignition to start to verify that the brake system failure indicator lamp is... 49 Transportation 6 2010-10-01 2010-10-01 false Hydraulic brake system. 570.55 Section 570.55... 10,000 Pounds § 570.55 Hydraulic brake system. The following requirements apply to vehicles...

  3. Design of Transputer Controllers for Hydraulic Actuator Systems

    DEFF Research Database (Denmark)

    Conrad, Finn

    1996-01-01

    The paper deals with how transputers can be applied for fast controllers for hydraulic actuator systems. A general transputer-based control systems including a data acquisition transputer subsystem is presented. An application case: development of a mechatronic test facility with a fast hydraulic...

  4. Hydraulic Systems with Tap Water versus Bio-oils

    DEFF Research Database (Denmark)

    Conrad, Finn

    1997-01-01

    Deals with the advantages of using pure tap water hydraulics versus bio-oils for suiteable applications. Focus is in particular on food processing industry.......Deals with the advantages of using pure tap water hydraulics versus bio-oils for suiteable applications. Focus is in particular on food processing industry....

  5. 46 CFR 58.30-10 - Hydraulic fluid.

    Science.gov (United States)

    2010-10-01

    ... manufacturers and ANSI B93.5 (incorporated by reference; see 46 CFR 58.03-1) shall be considered in the... 46 Shipping 2 2010-10-01 2010-10-01 false Hydraulic fluid. 58.30-10 Section 58.30-10 Shipping... AND RELATED SYSTEMS Fluid Power and Control Systems § 58.30-10 Hydraulic fluid. (a) The...

  6. Hydraulic analysis of cell-network treatment wetlands

    Science.gov (United States)

    Wang, Huaguo; Jawitz, James W.

    2006-11-01

    SummaryWhen individual cells of a multiple-cell treatment wetland are hydraulically connected, the wetland has a cell-network structure. The hydraulic performance of treatment wetlands is often characterized using tracer residence time distributions (RTDs) measured between the wetland inlet and outlet, such that the wetland is considered as a single hydraulic unit, regardless of the extent of networking between individual internal cells. This work extends the single hydraulic unit approach to enable the specification of moments and RTD parameters for individual cells, or clusters of cells, within the cell-network based on inert tracer tests with injection only at the network inlet. Hydraulic performance is quantified in terms of hydraulic efficiency and travel time dimensionless variance using both the method of moments and RTD modeling. Cell-network analysis was applied to a case study from the Orlando Easterly Wetland (OEW), demonstrating the improvement in hydraulic performance of individual wetland cells following wetland restoration activities. Furthermore, cell-network analysis indicated that the location of water quality sampling station locations within the cell network can significantly affect the accuracy of pollutant removal effectiveness estimation when the individual sample station RTD does not represent the hydraulic unit RTD. At the OEW, it was determined that historical nutrient removal effectiveness estimation may be underestimated for one area and overestimated for another, and recommendations were provided for sample station locations to minimize future performance estimation errors.

  7. Modeling and parameter estimation for hydraulic system of excavator's arm

    Institute of Scientific and Technical Information of China (English)

    HE Qing-hua; HAO Peng; ZHANG Da-qing

    2008-01-01

    A retrofitted electro-bydraulic proportional system for hydraulic excavator was introduced firstly. According to the principle and characteristic of load independent flow distribution(LUDV)system, taking boom hydraulic system as an example and ignoring the leakage of hydraulic cylinder and the mass of oil in it,a force equilibrium equation and a continuous equation of hydraulic cylinder were set up.Based On the flow equation of electro-hydraulic proportional valve, the pressure passing through the valve and the difference of pressure were tested and analyzed.The results show that the difference of pressure does not change with load, and it approximates to 2.0 MPa. And then, assume the flow across the valve is directly proportional to spool displacement andis not influenced by load, a simplified model of electro-hydraulic system was put forward. At the same time, by analyzing the structure and load-bearing of boom instrument, and combining moment equivalent equation of manipulator with rotating law, the estimation methods and equations for such parameters as equivalent mass and bearing force of hydraulic cylinder were set up. Finally, the step response of flow of boom cylinder was tested when the electro-hydraulic proportional valve was controlled by the stepcurrent. Based on the experiment curve, the flow gain coefficient of valve is identified as 2.825×10-4m3/(s·A)and the model is verified.

  8. Application of Ferrography to Fault Diagnosis of Hydraulic Systems

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    This paper deals with research on the successful use of ferrography as a wear measurement method for condition monitoring and fault diagnosis of hydraulic systems.The analysis program and progression is discussed, and a case study for condition monitoring and fault diagnosis of hydraulic systems by means of ferrography is also reviewed.

  9. Hydraulic drive and control system of the cone collecting robot

    Institute of Scientific and Technical Information of China (English)

    Kong Qinghua; Liu Jinhao; Lu Huaimin

    1999-01-01

    This paper describes the basic structure and design and operation principle of the hydraulic drive and control system with two pumps and two circuits. The manipulator of the cone collecting robot designed is full driven by hydraulic, which has five freedoms. The computer and electrohydraulic proportion velocity regulating valve were installed to realize open loop serve control for reducing cost and easy application.

  10. Performances of a balanced hydraulic motor with planetary gear train

    Science.gov (United States)

    Yu, Hongying; Luo, Changjie; Wang, Huimin

    2012-07-01

    The current research of a balanced hydraulic motor focuses on the characteristics of the motor with three planet gears. References of a balanced hydraulic motor with more than three planet gears are hardly found. In order to study the characteristics of a balanced hydraulic motor with planetary gear train that includes more than three planet gears, on the basis of analysis of the structure and working principle of a balanced hydraulic motor with planetary gear train, formulas are deduced for calculating the hydraulic motor's primary performance indexes such as displacement, unit volume displacement, flowrate fluctuation ratio, etc. Influences of the gears' tooth number on displacement and flowrate characteristics are analyzed. In order to guarantee the reliability of sealing capability, the necessary conditions that tooth number of the sun gear and the planet gears should satisfy are discussed. Selecting large unit volume displacement and small displacement fluctuation ratio as designing objectives, a balanced hydraulic motor with three planet gears and a common gear motor are designed under the conditions of same displacement, tooth addendum coefficien and clearance coefficient. By comparing the unit volume displacement and fluctuation ratio of the two motors, it can be seen that the balanced hydraulic motor with planetary gear train has the advantages of smaller fluctuation ratio and larger unit volume displacement. The results provide theoretical basis for choosing gear tooth-number of this kind of hydraulic motor.

  11. Tap Water Hydraulic Systems for Medium Power Applications

    DEFF Research Database (Denmark)

    Conrad, Finn; Adelstorp, Anders

    1998-01-01

    Presentation of new range of developed tap water hydraulic componets and applications for medium power up to 4 kW and 50 bar.......Presentation of new range of developed tap water hydraulic componets and applications for medium power up to 4 kW and 50 bar....

  12. FEASIBILITY OF HYDRAULIC FRACTURING OF SOILS TO IMPROVE REMEDIAL ACTIONS

    Science.gov (United States)

    Hydraulic fracturing, a technique commonly used to increase the yields of oil wells, could improve the effectiveness of several methods of in situ remediation. This project consisted of laboratory and field tests in which hydraulic fractures were created in soil. Laboratory te...

  13. 14 CFR 35.43 - Propeller hydraulic components.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Propeller hydraulic components. 35.43 Section 35.43 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: PROPELLERS Tests and Inspections § 35.43 Propeller hydraulic components....

  14. Efficiency limit factor analysis for the Francis-99 hydraulic turbine

    Science.gov (United States)

    Zeng, Y.; Zhang, L. X.; Guo, J. P.; Guo, Y. K.; Pan, Q. L.; Qian, J.

    2017-01-01

    The energy loss in hydraulic turbine is the most direct factor that affects the efficiency of the hydraulic turbine. Based on the analysis theory of inner energy loss of hydraulic turbine, combining the measurement data of the Francis-99, this paper calculates characteristic parameters of inner energy loss of the hydraulic turbine, and establishes the calculation model of the hydraulic turbine power. Taken the start-up test conditions given by Francis-99 as case, characteristics of the inner energy of the hydraulic turbine in transient and transformation law are researched. Further, analyzing mechanical friction in hydraulic turbine, we think that main ingredients of mechanical friction loss is the rotation friction loss between rotating runner and water body, and defined as the inner mechanical friction loss. The calculation method of the inner mechanical friction loss is given roughly. Our purpose is that explore and research the method and way increasing transformation efficiency of water flow by means of analysis energy losses in hydraulic turbine.

  15. Geomorphic Segmentation, Hydraulic Geometry, and Hydraulic Microhabitats of the Niobrara River, Nebraska - Methods and Initial Results

    Science.gov (United States)

    Alexander, Jason S.; Zelt, Ronald B.; Schaepe, Nathaniel J.

    2009-01-01

    The Niobrara River of Nebraska is a geologically, ecologically, and economically significant resource. The State of Nebraska has recognized the need to better manage the surface- and ground-water resources of the Niobrara River so they are sustainable in the long term. In cooperation with the Nebraska Game and Parks Commission, the U.S. Geological Survey is investigating the hydrogeomorphic settings and hydraulic geometry of the Niobrara River to assist in characterizing the types of broad-scale physical habitat attributes that may be of importance to the ecological resources of the river system. This report includes an inventory of surface-water and ground-water hydrology data, surface water-quality data, a longitudinal geomorphic segmentation and characterization of the main channel and its valley, and hydraulic geometry relations for the 330-mile section of the Niobrara River from Dunlap Diversion Dam in western Nebraska to the Missouri River confluence. Hydraulic microhabitats also were analyzed using available data from discharge measurements to demonstrate the potential application of these data and analysis methods. The main channel of the Niobrara was partitioned into three distinct fluvial geomorphic provinces: an upper province characterized by open valleys and a sinuous, equiwidth channel; a central province characterized by mixed valley and channel settings, including several entrenched canyon reaches; and a lower province where the valley is wide, yet restricted, but the river also is wide and persistently braided. Within the three fluvial geomorphic provinces, 36 geomorphic segments were identified using a customized, process-orientated classification scheme, which described the basic physical characteristics of the Niobrara River and its valley. Analysis of the longitudinal slope characteristics indicated that the Niobrara River longitudinal profile may be largely bedrock-controlled, with slope inflections co-located at changes in bedrock type at

  16. ANALYSIS AND ESTIMATION OF HYDRAULIC STABILITY OF FRANCIS HYDRO TURBINE

    Institute of Scientific and Technical Information of China (English)

    LAI Xi-de

    2004-01-01

    With the development of large-capacity hydro turbines, the hydraulic instability of bydro turbines has become one of the most important problems that affect the stable operation of the hydro-electric units. The hydraulic vibration and unstable operation of Francis hydro turbines are primarily caused by the unsteady pressure pulsations inside draft tubes.The forced rotating vortex core at the runner exit and the channel vortices inside Francis turbine runners are origins of the unsteady pressure pulsations when operating at partial load. This paper briefly analyzes the hydraulic instability of operation caused by the vortex core and channel vortices at partial load, then, presents a way to estimate the hydraulic stability by calculation of the flow behavior at the runner exit.The validity of estimation is examined by comparison with experimental data. This will be helpful to evaluate the alternative design and predict the hydraulic stability for both the prototype and model hydro turbines.

  17. Determining the Porosity and Saturated Hydraulic Conductivity of Binary Mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Z. F.; Ward, Anderson L.; Keller, Jason M.

    2009-09-27

    Gravels and coarse sands make up significant portions of some environmentally important sediments, while the hydraulic properties of the sediments are typically obtained in the laboratory using only the fine fraction (e.g., <2 mm or 4.75 mm). Researchers have found that the content of gravel has significant impacts on the hydraulic properties of the bulk soils. Laboratory experiments were conducted to measure the porosity and the saturated hydraulic conductivity of binary mixtures with different fractions of coarse and fine components. We proposed a mixing-coefficient model to estimate the porosity and a power-averaging method to determine the effective particle diameter and further to predict the saturated hydraulic conductivity of binary mixtures. The proposed methods could well estimate the porosity and saturated hydraulic conductivity of the binary mixtures for the full range of gravel contents and was successfully applied to two data sets in the literature.

  18. Microfluidic parallel circuit for measurement of hydraulic resistance.

    Science.gov (United States)

    Choi, Sungyoung; Lee, Myung Gwon; Park, Je-Kyun

    2010-08-31

    We present a microfluidic parallel circuit that directly compares the test channel of an unknown hydraulic resistance with the reference channel with a known resistance, thereby measuring the unknown resistance without any measurement setup, such as standard pressure gauges. Many of microfluidic applications require the precise transport of fluid along a channel network with complex patterns. Therefore, it is important to accurately characterize and measure the hydraulic resistance of each channel segment, and determines whether the device principle works well. However, there is no fluidic device that includes features, such as the ability to diagnose microfluidic problems by measuring the hydraulic resistance of a microfluidic component in microscales. To address the above need, we demonstrate a simple strategy to measure an unknown hydraulic resistance, by characterizing the hydraulic resistance of microchannels with different widths and defining an equivalent linear channel of a microchannel with repeated patterns of a sudden contraction and expansion.

  19. A review on hydraulic fracturing of unconventional reservoir

    Directory of Open Access Journals (Sweden)

    Quanshu Li

    2015-03-01

    Full Text Available Hydraulic fracturing is widely accepted and applied to improve the gas recovery in unconventional reservoirs. Unconventional reservoirs to be addressed here are with very low permeability, complicated geological settings and in-situ stress field etc. All of these make the hydraulic fracturing process a challenging task. In order to effectively and economically recover gas from such reservoirs, the initiation and propagation of hydraulic fracturing in the heterogeneous fractured/porous media under such complicated conditions should be mastered. In this paper, some issues related to hydraulic fracturing have been reviewed, including the experimental study, field study and numerical simulation. Finally the existing problems that need to be solved on the subject of hydraulic fracturing have been proposed.

  20. Investigation of Valve Plate in Water Hydraulic Axial Piston Motor

    Institute of Scientific and Technical Information of China (English)

    聂松林; 李壮云; 等

    2002-01-01

    This paper has introduced the developments of water hydraulic axial piston equipments.According to the effects of physicochemical properties of water on water hydraulic components,a novel valve plate for water hydraulic axial motor has been put forward,whose moment exerted by the fluid field between valve plate and bearing plate is balanced entirely.The material screening experiment of valve plate is done on the test rig.Through numerical simulation the effects of some geometry parameters on the performance of water hydraulic motor have been studied.The silencing grooves on the valve plate in water hydraulic motor can reduce the pressure shock and the occurrence of cavitation effectively.It is evident that the appropriate structure should change the wear status between matching paris and reduces the wear and specific pressure of the matching pairs.The specimen with the new type valve plate is used in a tool system.

  1. Effect of cavitation bubble collapse on hydraulic oil temperature

    Institute of Scientific and Technical Information of China (English)

    沈伟; 张健; 孙毅; 张迪嘉; 姜继海

    2016-01-01

    Cavitation bubble collapse has a great influence on the temperature of hydraulic oil. Herein, cone-type throttle valve experiments are carried out to study the thermodynamic processes of cavitation. First, the processes of growth and collapse are analysed, and the relationships between the hydraulic oil temperature and bubble growth and collapse are deduced. The effect of temperature is then considered on the hydraulic oil viscosity and saturated vapour pressure. Additionally, an improved form of the Rayleigh–Plesset equation is developed. The effect of cavitation on the hydraulic oil temperature is experimentally studied and the effects of cavitation bubble collapse in the hydraulic system are summarised. Using the cone-type throttle valve as an example, a method to suppress cavitation is proposed.

  2. Pedotransfer functions estimating soil hydraulic properties using different soil parameters

    DEFF Research Database (Denmark)

    Børgesen, Christen Duus; Iversen, Bo Vangsø; Jacobsen, Ole Hørbye;

    2008-01-01

    Estimates of soil hydraulic properties using pedotransfer functions (PTF) are useful in many studies such as hydrochemical modelling and soil mapping. The objective of this study was to calibrate and test parametric PTFs that predict soil water retention and unsaturated hydraulic conductivity...... parameters. The PTFs are based on neural networks and the Bootstrap method using different sets of predictors and predict the van Genuchten/Mualem parameters. A Danish soil data set (152 horizons) dominated by sandy and sandy loamy soils was used in the development of PTFs to predict the Mualem hydraulic...... of the hydraulic properties of the studied soils. We found that introducing measured water content as a predictor generally gave lower errors for water retention predictions and higher errors for conductivity predictions. The best of the developed PTFs for predicting hydraulic conductivity was tested against PTFs...

  3. Lubrication and tribology in seawater hydraulic piston pump

    Institute of Scientific and Technical Information of China (English)

    WANG Dong; LI Zhuang-yun; ZHU Yu-quan

    2003-01-01

    Water hydraulic systems have provoked major interest because of the human friendly and environmental safety aspects. Piston pump is one of the most frequently used hydraulic units in recent engineering technique. In water hydraulic piston pump, poor lubrication is more likely to happen than in oil hydraulic one because of difference in properties between water and oil. So there are some key problems such as corrosive wear and erosion, which are investigated briefly. Many new materials have been developed, which give longer life expectancies with water without corrosion and erosion. A new type of seawater hydraulic piston pumps with better suction characteristics had been developed at HUST. Much of this research has concentrated on new materials, structure and experiments, which are also specially introduced.

  4. COHESIVE ZONE FINITE ELEMENT-BASED MODELING OF HYDRAULIC FRACTURES

    Institute of Scientific and Technical Information of China (English)

    Zuorong Chen; A.P. Bunger; Xi Zhang; Robert G. Jeffrey

    2009-01-01

    Hydraulic fracturing is a powerful technology used to stimulate fluid production from reservoirs. The fully 3-D numerical simulation of the hydraulic fracturing process is of great importance to the efficient application of this technology, but is also a great challenge because of the strong nonlinear coupling between the viscous flow of fluid and fracture propagation. By taking advantage of a cohesive zone method to simulate the fracture process, a finite element model based on the existing pore pressure cohesive finite elements has been established to investigate the propagation of a penny-shaped hydraulic fracture in an infinite elastic medium. The effect of cohesive material parameters and fluid viscosity on the hydraulic fracture behaviour has been investigated. Excellent agreement between the finite element results and analytical solutions for the limiting case where the fracture process is dominated by rock fracture toughness demonstrates the ability of the cohesive zone finite element model in simulating the hydraulic fracture growth for this case.

  5. Disclosure of hydraulic fracturing fluid chemical additives: analysis of regulations.

    Science.gov (United States)

    Maule, Alexis L; Makey, Colleen M; Benson, Eugene B; Burrows, Isaac J; Scammell, Madeleine K

    2013-01-01

    Hydraulic fracturing is used to extract natural gas from shale formations. The process involves injecting into the ground fracturing fluids that contain thousands of gallons of chemical additives. Companies are not mandated by federal regulations to disclose the identities or quantities of chemicals used during hydraulic fracturing operations on private or public lands. States have begun to regulate hydraulic fracturing fluids by mandating chemical disclosure. These laws have shortcomings including nondisclosure of proprietary or "trade secret" mixtures, insufficient penalties for reporting inaccurate or incomplete information, and timelines that allow for after-the-fact reporting. These limitations leave lawmakers, regulators, public safety officers, and the public uninformed and ill-prepared to anticipate and respond to possible environmental and human health hazards associated with hydraulic fracturing fluids. We explore hydraulic fracturing exemptions from federal regulations, as well as current and future efforts to mandate chemical disclosure at the federal and state level.

  6. COMPUTATIONAL FLOW RATE FEEDBACK AND CONTROL METHOD IN HYDRAULIC ELEVATORS

    Institute of Scientific and Technical Information of China (English)

    Xu Bing; Ma Jien; Lin Jianjie

    2005-01-01

    The computational flow rate feedback and control method, which can be used in proportional valve controlled hydraulic elevators, is discussed and analyzed. In a hydraulic elevator with this method, microprocessor receives pressure information from the pressure transducers and computes the flow rate through the proportional valve based on pressure-flow conversion real time algorithm. This hydraulic elevator is of lower cost and energy consumption than the conventional closed loop control hydraulic elevator whose flow rate is measured by a flow meter. Experiments are carried out on a test rig which could simulate the load of hydraulic elevator. According to the experiment results, the means to modify the pressure-flow conversion algorithm are pointed out.

  7. Issues Related To Troubleshooting Of Avionic Hydraulic Units

    Directory of Open Access Journals (Sweden)

    Jastrzębski Grzegorz

    2014-12-01

    Full Text Available The paper outlines workflows associated with troubleshooting of avionic hydraulic systems with detailed description of the troubleshooting algorithm and classification of diagnostic signals provided by avionic hydraulic systems and their subassemblies. Attention is paid to measurement sequences for diagnostic signals from hydraulic systems, circuits and units. Detailed description is dedicated to an innovative design of a troubleshooting device intended for direct measurements of internal leaks from avionic hydraulic units. Advantages of the proposed measurement method are summarized with benefits from use of the presented device and compared against the methods that are currently in use. Subsequent phases of the troubleshooting process are described with examples of measurement results that have been acquired from subassemblies of hydraulic systems of SU-22 aircrafts currently in service at Polish Air Forces with consideration given to cases when the permissible threshold of diagnostic signals were exceeded. Finally, all results from investigations are subjected to thorough analysis.

  8. Parameter Designing for Heave Compensation Hydraulic System Installed in Deepwater

    Directory of Open Access Journals (Sweden)

    Zhao Teng

    2013-01-01

    Full Text Available The function diagram of active heave compensation hydraulic system has been given, besides, the mathematics model for the principal hydraulic components of the compensation system has been built, and the input-output relation between components has been made clear. Aimed at compensating work capacity for the system, design and research on parameters as the bearing pressure, the initial state and the maximum flow of hydraulic cylinder, accumulator and other principal components have been made separately, and standardized design has been accomplished in accordance with relevant standards. Furthermore, calculus and verification for the capacity of the hydraulic system in different working stages have been made in order to calculate the pressure lose of the system and provide objective data for the hardware system design of the hydraulic components of the heave compensation system.

  9. Biomimetic Gradient Polymers with Enhanced Damping Capacities.

    Science.gov (United States)

    Wang, Dong; Zhang, Huan; Guo, Jing; Cheng, Beichen; Cao, Yuan; Lu, Shengjun; Zhao, Ning; Xu, Jian

    2016-04-01

    Designing gradient structures, mimicking biological materials, such as pummelo peels and tendon, is a promising strategy for developing advanced materials with superior energy damping capacities. Here a facile and effective approach for fabricating polymers with composition gradients at millimeter length scale is presented. The gradient thiol-ene polymers (TEPs) are created by the use of density difference of ternary thiol-ene-ene precursors and the subsequent photo-crosslinking via thiol-ene reaction. The compositional gradients are analyzed via differential scanning calorimeter (DSC), compressive modulus testing, atomic force microscopy (AFM) indentation, and swelling measurements. In contrast to homogeneous TEPs networks, the resultant gradient polymer shows a broader effective damping temperature range combining with good mechanical properties. The present result provides an effective route toward high damping materials by the fabrication of gradient structures.

  10. Strain gradient effects on cyclic plasticity

    DEFF Research Database (Denmark)

    Niordson, Christian Frithiof; Legarth, Brian Nyvang

    2010-01-01

    hardening materials it is quantified how dissipative and energetic gradient effects promote hardening above that of conventional predictions. Usually, increased hardening is attributed to energetic gradient effects, but here it is found that also dissipative gradient effects lead to additional hardening...... in the presence of conventional material hardening. Furthermore, it is shown that dissipative gradient effects can lead to both an increase and a decrease in the dissipation per load cycle depending on the magnitude of the dissipative length parameter, whereas energetic gradient effects lead to decreasing...... dissipation for increasing energetic length parameter. For dissipative gradient effects it is found that dissipation has a maximum value for some none zero value of the material length parameter, which depends on the magnitude of the deformation cycles....

  11. Mathematics of Experimentally Generated Chemoattractant Gradients.

    Science.gov (United States)

    Postma, Marten; van Haastert, Peter J M

    2016-01-01

    Many eukaryotic cells move in the direction of a chemical gradient. Several assays have been developed to measure this chemotactic response, but no complete mathematical models of the spatial and temporal gradients are available to describe the fundamental principles of chemotaxis. Here we provide analytical solutions for the gradients formed by release of chemoattractant from a point source by passive diffusion or forced flow (micropipettes) and gradients formed by laminar diffusion in a Zigmond chamber. The results show that gradients delivered with a micropipette are formed nearly instantaneously, are very steep close to the pipette, and have a steepness that is strongly dependent on the distance from the pipette. In contrast, gradients in a Zigmond chamber are formed more slowly, are nearly independent of the distance from the source, and resemble the temporal and spatial properties of the natural cAMP wave that Dictyostelium cells experience during cell aggregation.

  12. May We Identify The Spatial Variability of Soil Hydraulic Properties Based On Measurements With "spatial Tdr"? A) Model Study

    Science.gov (United States)

    Zehe, E.; Becker, R.; Schädel, W.

    A dynamic system left without external disturbances, will always tend to a stable equilibrium state that is consistent with the internal physics. For natural soils such an equilibrium state is reached when the gradients of the total hydraulic potential tend to zero. This statement is still valid for heterogeneous soils, because the hydraulic po- tential is an intensive state variable and therefore continuous at discontinuities of the pore space. In contrary the soil water content is as an extensive property discontinu- ous at discontinuities of the pore space. Hence, a small scale soil moisture pattern that persists if the soil state tends to hydraulic equilibrium, reflects the lateral small scale variability of the pore space. The objectives of our study are to show a) whether and how we could use TDR observations to identify the small scale variability of the pore space. For that purpose we analyse artificial TDR measurements, taken from physi- cally based simulations of soil water dynamics in heterogeneous media. b) We want to introduce a new TDR technology which we call "Spatial TDR", that is suitable for that purposes. To produce the artificial TDR-datasets we generate random fields of soil porosity and saturated hydraulic conductivity with different statistical properties based on field data in a Luvisol and simulate artificial water dynamics in this model soil based on Richards-equation. Within this model soil we define several hypothetical "Spatial TDR" clusters, that differ in the lateral spacing and the number of the probes, in the temporal resolution of the hypothetical measurements and in the assumed mea- surement accuracy. If the model soil approaches hydraulic equilibrium, the remaining soil moisture pattern will be dominated by the statistical properties of the porosity. In contrary the variability of the hydraulic conductivity will dominate the soil moisture patterns during infiltration events. The hypothetical Spatial TDR measurements within the

  13. Hydraulic Monitoring of Low-Permeability Argillite at the Meuse/Haute Marne Underground Research Laboratory

    Science.gov (United States)

    Delay, Jacques; Cruchaudet, Martin

    ANDRA (Agence Nationale pour la Gestion de Déchets Radioactifs) has developed an electromagnetic permanent gauge (EPG) for long term monitoring of pore pressures in low permeability Callovo-Oxfordian argillites. The EPG is a pressure gauge that is permanently cemented into a borehole with no wire or tubing connections. The EPG transmits its data electromagnetically through the rock. Improvements in batteries have extended the life of the EPG to six years or more. Data from EPG installations in two holes near ANDRAs underground laboratory provide information on hydraulic conductivity and head. The heads in the argillites of the laboratory site are higher than heads in the two encasing carbonate units. These anomalous overpressures provide evidence for the very low permeability of the rock. Possible mechanisms for the overpressure include osmotic flows due to chemical potential gradients or delayed responses to the evolution of the regional groundwater hydrodynamics.

  14. Thermal-hydraulic analysis techniques for axisymmetric pebble bed nuclear reactor cores. [PEBBLE code

    Energy Technology Data Exchange (ETDEWEB)

    Stroh, K.R.

    1979-03-01

    The pebble bed reactor's cylindrical core volume contains a random bed of small, spherical fuel-moderator elements. These graphite spheres, containing a central region of dispersed coated-particle fissile and fertile material, are cooled by high pressure helium flowing through the connected interstitial voids. A mathematical model and numerical solution technique have been developed which allow calculation of macroscopic values of thermal-hydraulic variables in an axisymmetric pebble bed nuclear reactor core. The computer program PEBBLE is based on a mathematical model which treats the bed macroscopically as a generating, conducting porous medium. The steady-state model uses a nonlinear Forchheimer-type relation between the coolant pressure gradient and mass flux, with newly derived coefficients for the linear and quadratic resistance terms. The remaining equations in the model make use of mass continuity, and thermal energy balances for the solid and fluid phases.

  15. Transition of effective hydraulic properties from low to high Reynolds number flow in porous media

    Science.gov (United States)

    Sivanesapillai, R.; Steeb, H.; Hartmaier, A.

    2014-07-01

    We numerically analyze fluid flow through porous media up to a limiting Reynolds number of O(103). Due to inertial effects, such processes exhibit a gradual transition from laminar to turbulent flow for increasing magnitudes of Re. On the macroscopic scale, inertial transition implies nonlinearities in the relationship between the effective macroscopic pressure gradient and the filter velocity, typically accounted for in terms of the quadratic Forchheimer equation. However, various inertia-based extensions to the linear Darcy equation have been discussed in the literature; most prominently cubic polynomials in velocity. The numerical results presented in this contribution indicate that inertial transition, as observed in the apparent permeability, hydraulic tortuosity, and interfacial drag, is inherently of sigmoidal shape. Based on this observation, we derive a novel filtration law which is consistent with Darcy's law at small Re, reproduces Forchheimer's law at large Re, and exhibits higher-order leading terms in the weak inertia regime.

  16. The hydraulic jump in radially spreading flow: A new model and new experimental data

    Science.gov (United States)

    Blackford, B. L.

    1996-02-01

    A new model for the hydraulic jump in radially spreading flow is presented. The equation of motion for a liquid annulus spreading out under the influence of hydrostatic pressure gradient and Frictional drag is developed. The resulting nonlinear differential equation for the liquid depth, h(r), is solved by computer simulation. The jump is assumed to begin when the laminar flow is engulfed by the underlying boundary layer liquid, as suggested recently in the literature. This complicated mixing process is crudely modeled by a drag term which slows the flow and initiates a positive feedback mechanism culminating at a new critical depth, beyond which the depth increases asymptotically to a final value. The model predicts a new relationship between the laminar flow depth just before the jump and the final depth. An experimental apparatus was built to make detailed measurements of the depth h(r), both in the region before the jump and beyond the jump. The theoretical predictions were compared to the experimental data, and gave surprisingly good agreement by suitable adjustment of the two parameters k and C of the model. The parameter k determines the growth rate of the boundary layer thickness, and C determines the drag force. The results suggest that the usual textbook assumption of zero momentum loss across the jump is not appropriate for this type of hydraulic jump. The case of a hydraulic jump in the absence of gravity is considered also and a much different behavior is predicted, which could be tested by experiment in a microgravity environment.

  17. Growth model for large branched three-dimensional hydraulic crack system in gas or oil shale.

    Science.gov (United States)

    Chau, Viet T; Bažant, Zdeněk P; Su, Yewang

    2016-10-13

    Recent analysis of gas outflow histories at wellheads shows that the hydraulic crack spacing must be of the order of 0.1 m (rather than 1 m or 10 m). Consequently, the existing models, limited to one or several cracks, are unrealistic. The reality is 10(5)-10(6) almost vertical hydraulic cracks per fracking stage. Here, we study the growth of two intersecting near-orthogonal systems of parallel hydraulic cracks spaced at 0.1 m, preferably following pre-existing rock joints. One key idea is that, to model lateral cracks branching from a primary crack wall, crack pressurization, by viscous Poiseuille-type flow, of compressible (proppant-laden) frac water must be complemented with the pressurization of a sufficient volume of micropores and microcracks by Darcy-type water diffusion into the shale, to generate tension along existing crack walls, overcoming the strength limit of the cohesive-crack or crack-band model. A second key idea is that enforcing the equilibrium of stresses in cracks, pores and water, with the generation of tension in the solid phase, requires a new three-phase medium concept, which is transitional between Biot's two-phase medium and Terzaghi's effective stress and introduces the loading of the solid by pressure gradients of diffusing pore water. A computer program, combining finite elements for deformation and fracture with volume elements for water flow, is developed to validate the new model.This article is part of the themed issue 'Energy and the subsurface'.

  18. Alterations of hydraulic soil properties influenced by land-use changes and agricultural management systems

    Science.gov (United States)

    Weninger, Thomas; Kreiselmeier, Janis; Chandrasekhar, Parvathy; Jülich, Stefan; Schwärzel, Kai; Schwen, Andreas

    2016-04-01

    Estimation and modeling of soil water movement and the hydrologic balance of soils requires sound knowledge about hydraulic soil properties (HSP). The soil water characteristics, the hydraulic conductivity function and the pore size distribution (PSD) are commonly used instruments for the mathematical representation of HSP. Recent research highlighted the temporal variability of these functions caused by meteorological or land-use influences. State of the art modeling software for the continuous simulation of soil water movement uses a stationary approach for the HSP which means that their time dependent alterations and the subsequent effects on soil water balance is not considered. Mathematical approaches to describe the evolution of PSD are nevertheless known, but there is a lack of sound data basis for parameter estimation. Based on extensive field and laboratory measurements at 5 locations along a climatic gradient across Austria and Germany, this study will quantify short-term changes in HSP, detect driving forces and introduce a method to predict the effects of soil and land management actions on the soil water balance. Amongst several soil properties, field-saturated and unsaturated hydraulic conductivities will be determined using a hood infiltration experiments in the field as well as by evaporation and dewpoint potentiometer method in the lab. All measurements will be carried out multiple times over a span of 2 years which will allow a detailed monitoring of changes in HSP. Experimental sites where we expect significant inter-seasonal changes will be equipped with sensors for soil moisture and matric potential. The choice of experimental field sites follows the intention to involve especially the effects of tillage operations, different cultivation strategies, microclimatically effective structures and land-use changes. The international project enables the coverage of a broad range of soil types as well as climate conditions and hence will have broad

  19. Numerical Investigation into the Effect of Natural Fracture Density on Hydraulic Fracture Network Propagation

    Directory of Open Access Journals (Sweden)

    Zhaohui Chong

    2017-07-01

    Full Text Available Hydraulic fracturing is an important method to enhance permeability in oil and gas exploitation projects and weaken hard roofs of coal seams to reduce dynamic disasters, for example, rock burst. It is necessary to fully understand the mechanism of the initiation, propagation, and coalescence of hydraulic fracture network (HFN caused by fluid flow in rock formations. In this study, a coupled hydro-mechanical model was built based on synthetic rock mass (SRM method to investigate the effects of natural fracture (NF density on HFN propagation. Firstly, the geometrical structures of NF obtained from borehole images at the field scale were applied to the model. Secondly, the micro-parameters of the proposed model were validated against the interaction between NF and hydraulic fracture (HF in physical experiments. Finally, a series of numerical simulations were performed to study the mechanism of HFN propagation. In addition, confining pressure ratio (CPR and injection rate were also taken into consideration. The results suggested that the increase of NF density drives the growth of stimulated reservoir volume (SRV, concentration area of injection pressure (CAIP, and the number of cracks caused by NF. The number of tensile cracks caused by rock matrix decrease gradually with the increase of NF density, and the number of shear cracks caused by rock matrix are almost immune to the change of NF density. The propagation orientation of HFN and the breakdown pressure in rock formations are mainly controlled by CPR. Different injection rates would result in a relatively big difference in the gradient of injection pressure, but this difference would be gradually narrowed with the increase of NF density. Natural fracture density is the key factor that influences the percentages of different crack types in HFN, regardless of the value of CPR and injection rate. The proposed model may help predict HFN propagation and optimize fracturing treatment designs in

  20. Analytical solutions for the flow fields near funnel-and-gate reactive barriers with hydraulic losses

    Science.gov (United States)

    Klammler, Harald; Hatfield, Kirk

    2009-02-01

    Permeable reactive barriers (PRBs) are a passive in situ technology that is based on the interception and physical, chemical, and/or biological remediation of a contaminant plume through installation of reactive material in an aquifer. The present work is an extension and generalization of a previous paper and derives analytical expressions for flow fields toward PRBs in two dimensions on the basis of the conformal mapping approach. Considered is the classic funnel-and-gate configuration with perpendicular funnel arms (PFGs) as well as PRBs with velocity equalization walls. While the aquifer is assumed to be homogeneous in a uniform far field, the hydraulic conductivity of the reactive material is allowed to take arbitrary values above or below the aquifer conductivity. At the up- and down-gradient interfaces between reactor and aquifer, highly permeable gravel packs are assumed to establish constant head conditions. The flow fields are analyzed regarding the widths and shapes of respective capture zones as functions of PRB type and dimensions, reactor hydraulic resistance (including flow divergence and longevity), and ambient groundwater flow direction. Expressions for discharge fields are developed as needed for particle-tracking algorithms. Charts of relative capture width are given to facilitate PRB design and may be included in more comprehensive PRB design/optimization approaches. An efficient approach is presented to estimate reactor conductivity and capture flow from monitoring the hydraulic loss at the reactor. Inherent assumptions and results are validated against numerical flow field solutions and water level field data for the PFG PRB at the Moffett Federal Airfield, California.

  1. Nonlinear cross Gramians and gradient systems

    OpenAIRE

    Ionescu, T. C.; Scherpen, J.M.A.

    2007-01-01

    We study the notion of cross Gramians for nonlinear gradient systems, using the characterization in terms of prolongation and gradient extension associated to the system. The cross Gramian is given for the variational system associated to the original nonlinear gradient system. We obtain linearization results that precisely correspond to the notion of a cross Gramian for symmetric linear systems. Furthermore, first steps towards relations with the singular value functions of the nonlinear Han...

  2. Energy Efficiency Comparison between Hydraulic Hybrid and Hybrid Electric Vehicles

    Directory of Open Access Journals (Sweden)

    Jia-Shiun Chen

    2015-05-01

    Full Text Available Conventional vehicles tend to consume considerable amounts of fuel, which generates exhaust gases and environmental pollution during intermittent driving cycles. Therefore, prospective vehicle designs favor improved exhaust emissions and energy consumption without compromising vehicle performance. Although pure electric vehicles feature high performance and low pollution characteristics, their limitations are their short driving range and high battery costs. Hybrid electric vehicles (HEVs are comparatively environmentally friendly and energy efficient, but cost substantially more compared with conventional vehicles. Hydraulic hybrid vehicles (HHVs are mainly operated using engines, or using alternate combinations of engine and hydraulic power sources while vehicles accelerate. When the hydraulic system accumulator is depleted, the conventional engine reengages; concurrently, brake-regenerated power is recycled and reused by employing hydraulic motor–pump modules in circulation patterns to conserve fuel and recycle brake energy. This study adopted MATLAB Simulink to construct complete HHV and HEV models for backward simulations. New European Driving Cycles were used to determine the changes in fuel economy. The output of power components and the state-of-charge of energy could be retrieved. Varying power component models, energy storage component models, and series or parallel configurations were combined into seven different vehicle configurations: the conventional manual transmission vehicle, series hybrid electric vehicle, series hydraulic hybrid vehicle, parallel hybrid electric vehicle, parallel hydraulic hybrid vehicle, purely electric vehicle, and hydraulic-electric hybrid vehicle. The simulation results show that fuel consumption was 21.80% lower in the series hydraulic hybrid vehicle compared to the series hybrid electric vehicle; additionally, fuel consumption was 3.80% lower in the parallel hybrid electric vehicle compared to the

  3. Concrete decontamination by electro-hydraulic scabbling

    Energy Technology Data Exchange (ETDEWEB)

    Goldfarb, V.; Gannon, R. [Textron Defense System, Everett, MA (United States)

    1995-10-01

    Textron Defense Systems (TDS) is developing an electro-hydraulic device that has the potential for faster, safer, and less expensive scabbling of contaminated concrete surfaces. In the device, shock waves and cavitating bubbles are produced in water by the electric pulses, and the direct and reflected shock waves impinging on the concrete surface result in the crushing and cracking of the concrete. Pulse energy, frequency, and traverse speed control the depth of the scabbling action. Performance thus far has demonstrated the capability of a prototype unit to process a swath 24 inches wide, up to 3/4 inch deep at a linear velocity of up to 6 feet per hour, i.e., at a scabbling rate of 12 sq. ft. per hour.

  4. Pressure Characteristic Analysis of a Hydraulic System

    Science.gov (United States)

    Cho, H. Y.; Yang, H. J.

    2017-02-01

    EPPR(ElectroProportional Pressure Reducing) valve control the MCV(Main Control Valve) built on the mobile heavy machine. The EPPR valve was tested in the experimental setup and the performance of the valve was compared with that of the existing EPPR valve. On thisstudy, electromagnetic properties analysis using AMESim program was performed to optimize the designing of EPPR Valve (Electric Proportional Pressure Reducing Valve) and by applying its results to the hydraulic system analytical model, performance of the valve could be predicted. Also by comparing the results of the actual experiment and the simulation, The results of thisstudy is that the 3 factor(cone angle, tip width, clearance between sleeve and plunger) have much effectiveness than other components in the EPPR valve.

  5. Adaptive Sliding Mode Control for Hydraulic Drives

    DEFF Research Database (Denmark)

    Schmidt, Lasse; Andersen, Torben Ole; Pedersen, Henrik C.

    2013-01-01

    This paper presents a new adaptive sliding mode controller generally applicable for position tracking control of electro-hydraulic valve-cylinder drives (VCD’s). The proposed control scheme requires limited knowledge on system parameters, and employs only piston- and valve spool position feedback....... The main target is to overcome problems with linear controllers deteriorating performance due to the inherent nonlinear nature of such systems, without requiring extensive knowledge on system parameters nor advanced control theory. In order to accomplish this task, an integral sliding mode controller...... employing parameter adaption through a recursive algorithm is presented. This is based on a reduced order model approximation of a VCD with unmatched valve flow- and cylinder asymmetries. Bounds on parameters are obtained despite lack of parameter knowledge, and the proposed controller demonstrates improved...

  6. Nonlinear regimes on polygonal hydraulic jumps

    Science.gov (United States)

    Rojas, Nicolas

    2016-11-01

    This work extends previous leading and higher order results on the polygonal hydraulic jump in the framework of inertial lubrication theory. The rotation of steady polygonal jumps is observed in the transition from one wavenumber to the next one, induced by a change in height of an external obstacle near the outer edge. In a previous publication, the study of stationary polygons is considered under the assumption that the reference frame rotates with the polygons when the number of corners change, in order to preserve their orientation. In this research work I provide a Hamiltonian approach and the stability analysis of the nonlinear oscillator that describe the polygonal structures at the jump interface, in addition to a perturbation method that enables to explain, for instance, the diversity of patterns found in experiments. GRASP, Institute of Physics, University of Liege, Belgium.

  7. Neutron Imaging Reveals Internal Plant Hydraulic Dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Warren, Jeffrey [ORNL; Bilheux, Hassina Z [ORNL; Kang, Misun [ORNL; Voisin, Sophie [ORNL; Cheng, Chu-Lin [ORNL; Horita, Jusuke [ORNL; Perfect, Edmund [ORNL

    2013-01-01

    Many terrestrial ecosystem processes are constrained by water availability and transport within the soil. Knowledge of plant water fluxes is thus critical for assessing mechanistic processes linked to biogeochemical cycles, yet resolution of root structure and xylem water transport dynamics has been a particularly daunting task for the ecologist. Through neutron imaging, we demonstrate the ability to non-invasively monitor individual root functionality and water fluxes within Zea mays L. (maize) and Panicum virgatum L. (switchgrass) seedlings growing in a sandy medium. Root structure and growth were readily imaged by neutron radiography and neutron computed tomography. Seedlings were irrigated with water or deuterium oxide and imaged through time as a growth lamp was cycled on to alter leaf demand for water. Sub-millimeter scale resolution reveals timing and magnitudes of root water uptake, redistribution within the roots, and root-shoot hydraulic linkages, relationships not well characterized by other techniques.

  8. Control Reconfigurability of Bilinear Hydraulic Drive Systems

    DEFF Research Database (Denmark)

    Shaker, Hamid Reza; Tahavori, Maryamsadat

    2011-01-01

    be effective if sufficient redundancy does not exist in the process. A measure for control reconfigurability which reveals the level of redundancy in connection with feedback control is proposed in this paper for bilinear systems. The proposed control reconfigurability measure is the extension of its gramian......The objective of the methods within the framework of the plug and play process control and particularly fault tolerant control is to establish control techniques which guarantee a certain performance through control reconfiguration at the occurrence of the faults or changes. These methods cannot......-based analogous counterpart, which has been previously proposed for the linear processes. The control reconfigurability is calculated for the bilinear models of an electro-hydraulic drive to show its relevance to redundant actuating capabilities in the models....

  9. Hydraulic hammer drilling technology: Developments and capabilities

    Energy Technology Data Exchange (ETDEWEB)

    Melamed, Y.; Kiselev, A. [SKB Geotechnika, Moscow (Russian Federation); Gelfgat, M. [Aquatic Co., Moscow (Russian Federation); Dreesen, D.; Blacic, J. [Los Alamos National Lab., NM (United States). GeoEngineering Group

    1996-12-31

    Percussion drilling technology was considered many years ago as one of the best approaches for hard rock drilling. Unfortunately the efficiency of most hydraulic hammer (HH) designs was very low (8% maximum), so they were successfully used in shallow boreholes only. Thirty years of research and field drilling experience with HH application in Former Soviet Union (FSU) countries led to the development of a new generation of HH designs with a proven efficiency of 40%. That advance achieved good operational results in hard rock at depths up to 2,000 m and more. The most recent research has shown that there are opportunities to increase HH efficiency up to 70%. This paper presents HH basic design principles and operational features. The advantages of HH technology for coiled-tubing drilling is shown on the basis of test results recently conducted in the US.

  10. Valorization of phosphogypsum as hydraulic binder.

    Science.gov (United States)

    Kuryatnyk, T; Angulski da Luz, C; Ambroise, J; Pera, J

    2008-12-30

    Phosphogypsum (calcium sulfate) is a naturally occurring part of the process of creating phosphoric acid (H(3)PO(4)), an essential component of many modern fertilizers. For every tonne of phosphoric acid made, from the reaction of phosphate rock with acid, commonly sulfuric acid, about 3t of phosphogypsum are created. There are three options for managing phosphogypsum: (i) disposal or dumping, (ii) stacking, (iii) use-in, for example, agriculture, construction, or landfill. This paper presents the valorization of two Tunisian phosphogypsums (referred as G and S) in calcium sulfoaluminate cement in the following proportions: 70% phosphogypsum-30% calcium sulfoaluminate clinker. The use of sample G leads to the production of a hydraulic binder which means that it is not destroyed when immersed in water. The binder including sample S performs very well when cured in air but is not resistant in water. Formation of massive ettringite in a rigid body leads to cracking and strength loss.

  11. Development of a hydraulic turbine design method

    Science.gov (United States)

    Kassanos, Ioannis; Anagnostopoulos, John; Papantonis, Dimitris

    2013-10-01

    In this paper a hydraulic turbine parametric design method is presented which is based on the combination of traditional methods and parametric surface modeling techniques. The blade of the turbine runner is described using Bezier surfaces for the definition of the meridional plane as well as the blade angle distribution, and a thickness distribution applied normal to the mean blade surface. In this way, it is possible to define parametrically the whole runner using a relatively small number of design parameters, compared to conventional methods. The above definition is then combined with a commercial CFD software and a stochastic optimization algorithm towards the development of an automated design optimization procedure. The process is demonstrated with the design of a Francis turbine runner.

  12. Multiphase Flow Dynamics 5 Nuclear Thermal Hydraulics

    CERN Document Server

    Kolev, Nikolay Ivanov

    2012-01-01

    The present Volume 5 of the successful book package "Multiphase Flow Dynamics" is devoted to nuclear thermal hydraulics which is a substantial part of nuclear reactor safety. It provides knowledge and mathematical tools for adequate description of the process of transferring the fission heat released in materials due to nuclear reactions into its environment. It step by step introduces into the heat release inside the fuel, temperature fields in the fuels, the "simple" boiling flow in a pipe described using ideas of different complexity like equilibrium, non equilibrium, homogeneity, non homogeneity. Then the "simple" three-fluid boiling flow in a pipe is described by gradually involving the mechanisms like entrainment and deposition, dynamic fragmentation, collisions, coalescence, turbulence. All heat transfer mechanisms are introduced gradually discussing their uncertainty. Different techniques are introduced like boundary layer treatments or integral methods. Comparisons with experimental data at each step...

  13. Multiphase flow dynamics 5 nuclear thermal hydraulics

    CERN Document Server

    Kolev, Nikolay Ivanov

    2015-01-01

    This Volume 5 of the successful book package "Multiphase Flow Dynamics" is devoted to nuclear thermal hydraulics which is a substantial part of nuclear reactor safety. It provides knowledge and mathematical tools for adequate description of the process of transferring the fission heat released in materials due to nuclear reactions into its environment. It step by step introduces into the heat release inside the fuel, temperature fields in the fuels, the "simple" boiling flow in a pipe described using ideas of different complexity like equilibrium, non equilibrium, homogeneity, non homogeneity. Then the "simple" three-fluid boiling flow in a pipe is described by gradually involving the mechanisms like entrainment and deposition, dynamic fragmentation, collisions, coalescence, turbulence. All heat transfer mechanisms are introduced gradually discussing their uncertainty. Different techniques are introduced like boundary layer treatments or integral methods. Comparisons with experimental data at each step demons...

  14. Blade-shaped (PKN) Hydraulic Fracture Driven By A Turbulent Fluid In An Impermeable Rock

    CERN Document Server

    Zolfaghari, Navid; Bunger, Andrew P

    2016-01-01

    High flow rate, water-driven hydraulic fractures are more common now than ever in the oil and gas industry. Although the fractures are small, the high injection rate and low viscosity of the water, lead to high Reynolds numbers and potentially turbulence in the fracture. Here we present a semi-analytical solution for a blade-shaped (PKN) geometry hydraulic fracture driven by a turbulent fluid in the limit of zero fluid leak-off to the formation. We model the turbulence in the PKN fracture using the Gaukler-Manning-Strickler parametrization, which relates the the flow rate of the water to the pressure gradient along the fracture. The key parameter in this relation is the Darcy-Weisbach friction factor for the roughness of the crack wall. Coupling this turbulence parametrization with conservation of mass allows us to write a nonlinear pde for the crack width as a function of space and time. By way of a similarity ansatz, we obtain a semi-analytical solution using an orthogonal polynomial series. Embedding the a...

  15. Hydraulic conductance of Acacia phyllodes (foliage) is driven by primary nerve (vein) conductance and density.

    Science.gov (United States)

    Sommerville, Katy E; Sack, Lawren; Ball, Marilyn C

    2012-01-01

    We determined effects of venation traits on hydraulic conductance of phyllodes (foliage), using an array of Acacia s.str. species with diverse phyllode morphologies as the source of variation. Measurements were made on phyllodes from 44 species, grown in common gardens but originating from different positions along a precipitation gradient. K(phyllode) varied 18-fold and was positively correlated with primary nerve hydraulic conductance, and with primary nerve (vein) density but not with minor nerve density, in contrast with previous studies of true leaves in other dicotyledons. Phyllodes with higher primary nerve density also had greater mass per area (PMA) and larger bundle sheath extensions (BSEs) from their minor nerves. We suggest that higher primary nerve conductivity and density may decrease the distance travelled in the high-resistance extra-xylem pathways of the phyllode. Further, larger BSEs may increase the area available for dispersion of water from the xylem to the extra-xylem tissue. High PMA phyllodes were more common in acacias from areas receiving lower annual precipitation. Maximizing efficient water movement through phyllodes may be more important where rainfall is meagre and infrequent, explaining relationships between nerve patterns and the climates of origin in Australian phyllodinous Acacia.

  16. Numerical Research on Flow Characteristics around a Hydraulic Turbine Runner at Small Opening of Cylindrical Valve

    Directory of Open Access Journals (Sweden)

    Zhenwei Mo

    2016-01-01

    Full Text Available We use the continuity equation and the Reynolds averaged Navier-Stokes equations to study the flow-pattern characteristics around a turbine runner for the small-opening cylindrical valve of a hydraulic turbine. For closure, we adopt the renormalization-group k-ε two-equation turbulence model and use the computational fluid dynamics (CFD software FLUENT to numerically simulate the three-dimensional unsteady turbulent flow through the entire passage of the hydraulic turbine. The results show that a low-pressure zone develops around the runner blades when the cylindrical valve is closed in a small opening; cavitation occurs at the blades, and a vortex appears at the outlet of the runner. As the cylindrical valve is gradually closed, the flow velocity over the runner area increases, and the pressure gradient becomes more significant as the discharge decreases. In addition, the fluid flow velocity is relatively high between the lower end of the cylindrical valve and the base, so that a high-velocity jet is easily induced. The calculation and analysis provide a theoretical basis for improving the performance of cylindrical-valve operating systems.

  17. Wireless SAW Based Temperature Gradient Sensor Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Prime Photonics proposes design and development of a surface acoustic wave (SAW) based temperature gradient sensor for instrumentation of thermal protection systems...

  18. On lower order strain gradient plasticity theories

    DEFF Research Database (Denmark)

    Niordson, Christian Frithiof; Hutchinson, J. W.

    2003-01-01

    the tangent moduli governing increments of stress and strain. It is shown that the modification is far from benign from a mathematical standpoint, changing the qualitative character of solutions and leading to a new type of localization that is at odds with what is expected from a strain gradient theory......By way of numerical examples, this paper explores the nature of solutions to a class of strain gradient plasticity theories that employ conventional stresses, equilibrium equations and boundary conditions. Strain gradients come into play in these modified conventional theories only to alter....... The findings raise questions about the physical acceptability of this class of strain gradient theories....

  19. INFLUENCES OF SLOPE GRADIENT ON SOIL EROSION

    Institute of Scientific and Technical Information of China (English)

    刘青泉; 陈力; 李家春

    2001-01-01

    The main factors influencing soil erosion include the net rain excess, the water depth, the velocity, the shear stress of overland flows , and the erosion-resisting capacity of soil. The laws of these factors varying with the slope gradient were investigated by using the kinematic wave theory. Furthermore, the critical slope gradient of erosion was driven. The analysis shows that the critical slope gradient of soil erosion is dependent on grain size , soil bulk density , surface roughness, runoff length, net rain excess, and the friction coefficient of soil, etc. The critical slope gradient has been estimated theoretically with its range between 41. 5 °~ 50°.

  20. Hydraulic Lifting Mechanisms for the Erection Equipment

    Directory of Open Access Journals (Sweden)

    B. M. Novozhilov

    2016-01-01

    Full Text Available In erection equipment of space launch complexes the hydraulic lifting mechanisms (HLM are solely and exclusively used to accomplish changing the space-mission vehicle (SMV position from horizontal to the vertical one. Existing designs of lifting mechanisms are diverse, but all of them basically contain a basic mechanism comprising one hydro-cylinder. With increasing SMV size and weight a task to design the more complicated lifting mechanisms, comprising more kinematic links and using several hydro-cylinders becomes urgent.The article conducts a detailed analysis of the basic HLM schemes and defines the features of their arrangement in erection equipment. Gives basic calculation relationships, allowing us to determine design parameters of mechanisms for stationary and transport units. Via examples of available erection equipment shows the embodiment of lifting mechanisms using basic schemes.The ways for development of HLM schemes to erect a SMV of the large size and weight are shown. Two options of the double-cylinder HLM are described. Both schemes are based on dividing a lift cycle into two parts, in each of which only one of the cylinders is in operation. The first option contains an additional, intermediate boom, with respect to which the main boom is erected. In such a mechanism the cylinders start running sequentially: at first, one of the cylinders erects the intermediate boom, then the other cylinder does the main one. The second HLM embodiment comprises a single carrier boom with the swing arm, which allows to swing the boom at a certain angle of less than 90 ° using one of the cylinders, also sequentially operating. The second cylinder allows the boom to fall into vertical position. Such schemes can reduce a stroke length of used hydraulic cylinders, which are the most expensive devices of the lifting mechanism.The analysis results are of interest to designers of erection equipment for the space launch complexes.

  1. Gas Test Loop Booster Fuel Hydraulic Testing

    Energy Technology Data Exchange (ETDEWEB)

    Gas Test Loop Hydraulic Testing Staff

    2006-09-01

    The Gas Test Loop (GTL) project is for the design of an adaptation to the Advanced Test Reactor (ATR) to create a fast-flux test space where fuels and materials for advanced reactor concepts can undergo irradiation testing. Incident to that design, it was found necessary to make use of special booster fuel to enhance the neutron flux in the reactor lobe in which the Gas Test Loop will be installed. Because the booster fuel is of a different composition and configuration from standard ATR fuel, it is necessary to qualify the booster fuel for use in the ATR. Part of that qualification is the determination that required thermal hydraulic criteria will be met under routine operation and under selected accident scenarios. The Hydraulic Testing task in the GTL project facilitates that determination by measuring flow coefficients (pressure drops) over various regions of the booster fuel over a range of primary coolant flow rates. A high-fidelity model of the NW lobe of the ATR with associated flow baffle, in-pile-tube, and below-core flow channels was designed, constructed and located in the Idaho State University Thermal Fluids Laboratory. A circulation loop was designed and constructed by the university to provide reactor-relevant water flow rates to the test system. Models of the four booster fuel elements required for GTL operation were fabricated from aluminum (no uranium or means of heating) and placed in the flow channel. One of these was instrumented with Pitot tubes to measure flow velocities in the channels between the three booster fuel plates and between the innermost and outermost plates and the side walls of the flow annulus. Flow coefficients in the range of 4 to 6.5 were determined from the measurements made for the upper and middle parts of the booster fuel elements. The flow coefficient for the lower end of the booster fuel and the sub-core flow channel was lower at 2.3.

  2. Horizontal roof gap of backfill hydraulic support

    Institute of Scientific and Technical Information of China (English)

    张强; 张吉雄; 邰阳; 方坤; 殷伟

    2015-01-01

    For the backfill hydraulic support as the key equipment for achieving integration of backfilling and coal mining simultaneously in the practical process, its characteristics will directly influence the backfill body’s compression ratio. Horizontal roof gap, as a key parameter of backfilling characteristics, may impact the backfilling effect from the aspects of control of roof subsidence in advance, support stress, backfilling process and the support design. Firstly, the reason why horizontal roof gap exists was analyzed and its definition, causes and connotation were introduced, then adopting the Pro/E 3D simulation software, three typical 3D entity models of backfill hydraulic supports were built, based on the influence of horizontal roof gap on backfilling effect, and influence rules of four factors, i.e. support height, suspension height, suspension angle and tamping angle, were emphatically analyzed on horizontal roof gap. The results indicate that, the four factors all have significant impacts on horizontal roof gap, but show differences in influence trend and degree, showing negative linear correlation, positive linear correlation, positive semi-parabolic correlation and negative semi-parabolic correlation, respectively. Four legs type is the most adaptive to the four factors, while six legs (II) type has the poorest adaptability, and the horizontal roof gap is small under large support height, small suspension height, small suspension angle and large tamping angle situation. By means of optimizing structure components and their positional relation and suspension height of backfill scrape conveyor in the process of support design and through controlling working face deployment, roof subsidence in advance, mining height and backfilling during engineering application, the horizontal roof gap is optimized. The research results can be served as theoretical basis for support design and guidance for backfill support to have better performance in backfilling.

  3. Hydraulic Tomography and High-Resolution Slug Testing to Determine Hydraulic Conductivity Distributions - Year 1

    Science.gov (United States)

    2005-12-01

    the addition into a well of a known volume of water or a physical slug. More recently, pneumatic methods have become popular ( Zemansky and McElwee...and Zemansky , 2000), (Sellwood, 2001) and (Ross, 2004)]. The aquifer material at GEMS exhibits linear and non-linear responses to slug testing...1976; Zurbuchen et al., 2002; and Zemansky and McElwee, 2005). Slug tests have been a common method for obtaining information about the hydraulic

  4. Rapid shoot‐to‐root signalling regulates root hydraulic conductance via aquaporins

    National Research Council Canada - National Science Library

    VANDELEUR, REBECCA K; SULLIVAN, WENDY; ATHMAN, ASMINI; JORDANS, CHARLOTTE; GILLIHAM, MATTHEW; KAISER, BRENT N; TYERMAN, STEPHEN D

    2014-01-01

    Investigating the relationship between transpiration and root hydraulic conductance Vandeleur et al report that leaf area reduction reduces root hydraulic conductance in grapevine, soybean and maize...

  5. Hydraulic Bureaucracies and the Hydraulic Mission: Flows of Water, Flows of Power

    Directory of Open Access Journals (Sweden)

    François Molle

    2009-10-01

    Full Text Available Anchored in 19th century scientism and an ideology of the domination of nature, inspired by colonial hydraulic feats, and fuelled by technological improvements in high dam constructions and power generation and transmission, large-scale water resources development has been a defining feature of the 20th century. Whether out of a need to increase food production, raise rural incomes, or strengthen state building and the legitimacy of the state, governments – North and South, East and West – embraced the 'hydraulic mission' and entrusted it to powerful state water bureaucracies (hydrocracies. Engaged in the pursuit of iconic and symbolic projects, the massive damming of river systems, and the expansion of large-scale public irrigation these hydrocracies have long remained out of reach. While they have enormously contributed to actual welfare, including energy and food generation, flood protection and water supply to urban areas, infrastructural development has often become an end in itself, rather than a means to an end, fuelling rent-seeking and symbolising state power. In many places projects have been challenged on the basis of their economic, social or environmental impacts. Water bureaucracies have been challenged internally (within the state bureaucracies or through political changes and externally (by critiques from civil society and academia, or by reduced funding. They have endeavoured to respond to these challenges by reinventing themselves or deflecting reforms. This paper analyses these transformations, from the emergence of the hydraulic mission and associated water bureaucracies to their adjustment and responses to changing conditions.

  6. Hydraulic response and nitrogen retention in bioretention mesocosms with regulated outlets: part I--hydraulic response.

    Science.gov (United States)

    Lucas, William C; Greenway, Margaret

    2011-08-01

    In bioretention systems used for stormwater treatment, runoff interception improves with increased infiltration rates. However, nitrogen retention improves with increased retention time or decreasing infiltration rates. These contrasting responses were analyzed in 240-L experimental mesocosms using a variety of media treatments. The mesocosms were vegetated, except for one barren control. Dual-stage outlets were installed to extend retention time and equalize hydraulic responses. One unregulated treatment was free-draining. This part 1 paper presents the media properties and hydraulic responses. The highly aggregated media had saturated hydraulic conductivities ranging from 20.7 to 59.6 cm/h in August 2008 (austral winter), which increased to 42.8 to 110.6 cm/h in March 2009 (austral summer). The outlet regulated mesocosms provided retention over 8 times longer than the free-draining mesocosms, while still being able to capture large events. The outlets provide adaptive management for bioretention design to improve both runoff capture and nitrogen retention.

  7. Improving hydraulic excavator performance through in line hydraulic oil contamination monitoring

    Science.gov (United States)

    Ng, Felix; Harding, Jennifer A.; Glass, Jacqueline

    2017-01-01

    It is common for original equipment manufacturers (OEMs) of high value products to provide maintenance or service packages to customers to ensure their products are maintained at peak efficiency throughout their life. To quickly and efficiently plan for maintenance requirements, OEMs require accurate information about the use and wear of their products. In recent decades, the aerospace industry in particular has become expert in using real time data for the purpose of product monitoring and maintenance scheduling. Significant quantities of real time usage data from product monitoring are commonly generated and transmitted back to the OEMs, where diagnostic and prognostic analysis will be carried out. More recently, other industries such as construction and automotive, are also starting to develop capabilities in these areas and condition based maintenance (CBM) is increasing in popularity as a means of satisfying customers' demands. CBM requires constant monitoring of real time product data by the OEMs, however the biggest challenge for these industries, in particular construction, is the lack of accurate and real time understanding of how their products are being used possibly because of the complex supply chains which exist in construction projects. This research focuses on current dynamic data acquisition techniques for mobile hydraulic systems, in this case the use of a mobile inline particle contamination sensor; the aim was to assess suitability to achieve both diagnostic and prognostic requirements of Condition Based Maintenance. It concludes that hydraulic oil contamination analysis, namely detection of metallic particulates, offers a reliable way to measure real time wear of hydraulic components.

  8. An Integrated View of Whole-Tree Hydraulic Architecture. Does Stomatal or Hydraulic Conductance Determine Whole Tree Transpiration?

    Directory of Open Access Journals (Sweden)

    Juan Rodríguez-Gamir

    Full Text Available Hydraulic conductance exerts a strong influence on many aspects of plant physiology, namely: transpiration, CO2 assimilation, growth, productivity or stress response. However we lack full understanding of the contribution of root or shoot water transport capacity to the total water balance, something which is difficult to study in trees. Here we tested the hypothesis that whole plant hydraulic conductance modulates plant transpiration using two different seedlings of citrus rootstocks, Poncirus trifoliata (L. Raf. and Cleopatra mandarin (Citrus reshni Hort ex Tan.. The two genotypes presented important differences in their root or shoot hydraulic conductance contribution to whole plant hydraulic conductance but, even so, water balance proved highly dependent on whole plant conductance. Further, we propose there is a possible equilibrium between root and shoot hydraulic conductance, similar to that between shoot and root biomass production, which could be related with xylem anatomy.

  9. An Integrated View of Whole-Tree Hydraulic Architecture. Does Stomatal or Hydraulic Conductance Determine Whole Tree Transpiration?

    Science.gov (United States)

    Rodríguez-Gamir, Juan; Primo-Millo, Eduardo; Forner-Giner, María Ángeles

    2016-01-01

    Hydraulic conductance exerts a strong influence on many aspects of plant physiology, namely: transpiration, CO2 assimilation, growth, productivity or stress response. However we lack full understanding of the contribution of root or shoot water transport capacity to the total water balance, something which is difficult to study in trees. Here we tested the hypothesis that whole plant hydraulic conductance modulates plant transpiration using two different seedlings of citrus rootstocks, Poncirus trifoliata (L.) Raf. and Cleopatra mandarin (Citrus reshni Hort ex Tan.). The two genotypes presented important differences in their root or shoot hydraulic conductance contribution to whole plant hydraulic conductance but, even so, water balance proved highly dependent on whole plant conductance. Further, we propose there is a possible equilibrium between root and shoot hydraulic conductance, similar to that between shoot and root biomass production, which could be related with xylem anatomy.

  10. INFORMATION-MEASURING TEST SYSTEM OF DIESEL LOCOMOTIVE HYDRAULIC TRANSMISSIONS

    Directory of Open Access Journals (Sweden)

    I. V. Zhukovytskyy

    2015-08-01

    Full Text Available Purpose. The article describes the process of developing the information-measuring test system of diesel locomotives hydraulic transmission, which gives the possibility to obtain baseline data to conduct further studies for the determination of the technical condition of diesel locomotives hydraulic transmission. The improvement of factory technology of post-repair tests of hydraulic transmissions by automating the existing hydraulic transmission test stands according to the specifications of the diesel locomotive repair enterprises was analyzed. It is achieved based on a detailed review of existing foreign information-measuring test systems for hydraulic transmission of diesel locomotives, BelAZ earthmover, aircraft tug, slag car, truck, BelAZ wheel dozer, some brands of tractors, etc. The problem for creation the information-measuring test systems for diesel locomotive hydraulic transmission is being solved, starting in the first place from the possibility of automation of the existing test stand of diesel locomotives hydraulic transmission at Dnipropetrovsk Diesel Locomotive Repair Plant "Promteplovoz". Methodology. In the work the researchers proposed the method to create a microprocessor automated system of diesel locomotives hydraulic transmission stand testing in the locomotive plant conditions. It acts by justifying the selection of the necessary sensors, as well as the application of the necessary hardware and software for information-measuring systems. Findings. Based on the conducted analysis there was grounded the necessity of improvement the plant hydraulic transmission stand testing by creating a microprocessor testing system, supported by the experience of developing such systems abroad. Further research should be aimed to improve the accuracy and frequency of data collection by adopting the more modern and reliable sensors in tandem with the use of filtering software for electromagnetic and other interference. Originality. The

  11. Simultaneous measurement of reactions in microdroplets filled by concentration gradients.

    Science.gov (United States)

    Damean, Nicolae; Olguin, Luis F; Hollfelder, Florian; Abell, Chris; Huck, Wilhelm T S

    2009-06-21

    This work describes a technology for performing and monitoring simultaneously several reactions confined in strings of microdroplets having identical volumes but different composition, and travelling with the same speed in parallel channels of a microfluidic device. This technology, called parallel microdroplets technology (PmicroD), uses an inverted optical microscope and a charge-coupled device (CCD) camera to collect images and analyze them so as to report on the reactions occurring in these microdroplets. A concentration gradient of one reactant is created in the microfluidic device. In each channel, a different concentration of this reactant is mixed with a fixed amount of a second reactant. Using planar flow-focusing methodology, these mixtures are confined in microdroplets of pL size which travel in oil as continuous medium, avoiding laminar dispersion. By analyzing the images of parallel strings of microdroplets, the time courses of several reactions with different reagent compositions are investigated simultaneously. In order to design the microfluidic device that consists in a complex network of channels having well-defined geometries and restricted positions, the theoretical concept of equivalent channels (i.e. channels having identical hydraulic resistance) is exploited and developed. As a demonstration of the PmicroD technology, an enzyme activity assay was carried out and the steady-state kinetic constants were determined.

  12. Vertebrate pressure-gradient receivers.

    Science.gov (United States)

    Christensen-Dalsgaard, Jakob

    2011-03-01

    The eardrums of all terrestrial vertebrates (tetrapods) are connected through Eustachian tubes or interaural canals. In some of the animals, these connections create pressure-gradient directionality, an enhanced directionality by interaction of sound arriving at both sides of the eardrum and strongly dependent on interaural transmission attenuation. Even though the tympanic middle ear has originated independently in the major tetrapod groups, in each group the ancestral condition probably was that the two middle ears were exposed in the mouth cavity with relatively high interaural transmission. Recent vertebrates form a continuum from perfect interaural transmission (0 dB in a certain frequency band) and pronounced eardrum directionality (30-40 dB) in the lizards, over somewhat attenuated transmission and limited directionality in birds and frogs, to the strongly attenuated interaural transmission and functionally isolated pressure receiver ears in the mammals. Since some of the binaural interaction already takes place at the eardrum in animals with strongly coupled ears, producing enhanced interaural time and level differences, the subsequent neural processing may be simpler. In robotic simulations of lizards, simple binaural subtraction (EI cells, found in brainstem nuclei of both frogs and lizards) produces strongly lateralized responses that are sufficient for steering the animal robustly to sound sources.

  13. Hydraulic forces contribute to left ventricular diastolic filling

    Science.gov (United States)

    Maksuti, Elira; Carlsson, Marcus; Arheden, Håkan; Kovács, Sándor J.; Broomé, Michael; Ugander, Martin

    2017-03-01

    Myocardial active relaxation and restoring forces are known determinants of left ventricular (LV) diastolic function. We hypothesize the existence of an additional mechanism involved in LV filling, namely, a hydraulic force contributing to the longitudinal motion of the atrioventricular (AV) plane. A prerequisite for the presence of a net hydraulic force during diastole is that the atrial short-axis area (ASA) is smaller than the ventricular short-axis area (VSA). We aimed (a) to illustrate this mechanism in an analogous physical model, (b) to measure the ASA and VSA throughout the cardiac cycle in healthy volunteers using cardiovascular magnetic resonance imaging, and (c) to calculate the magnitude of the hydraulic force. The physical model illustrated that the anatomical difference between ASA and VSA provides the basis for generating a hydraulic force during diastole. In volunteers, VSA was greater than ASA during 75-100% of diastole. The hydraulic force was estimated to be 10-60% of the peak driving force of LV filling (1-3 N vs 5-10 N). Hydraulic forces are a consequence of left heart anatomy and aid LV diastolic filling. These findings suggest that the relationship between ASA and VSA, and the associated hydraulic force, should be considered when characterizing diastolic function and dysfunction.

  14. Pulsating hydraulic fracturing technology in low permeability coal seams

    Institute of Scientific and Technical Information of China (English)

    Wang Wenchao; Li Xianzhong; Lin Baiquan; Zhai Cheng

    2015-01-01

    Based on the difficult situation of gas drainage in a single coal bed of high gas content and low perme-ability, we investigate the technology of pulsating hydraulic pressure relief, the process of crank plunger movement and the mechanism of pulsating pressure formation using theoretical research, mathematical modeling and field testing. We analyze the effect of pulsating pressure on the formation and growth of fractures in coal by using the pulsating hydraulic theory in hydraulics. The research results show that the amplitude of fluctuating pressure tends to increase in the case where the exit is blocked, caused by pulsating pressure reflection and frictional resistance superposition, and it contributes to the growth of fractures in coal. The crack initiation pressure of pulsating hydraulic fracturing is 8 MPa, which is half than that of normal hydraulic fracturing;the pulsating hydraulic fracturing influence radius reaches 8 m. The total amount of gas extraction is increased by 3.6 times, and reaches 50 L/min at the highest point. The extraction flow increases greatly, and is 4 times larger than that of drilling without fracturing and 1.2 times larger than that of normal hydraulic fracturing. The technology provides a technical measure for gas drainage of high gas content and low permeability in the single coal bed.

  15. Motion Planning Based Coordinated Control for Hydraulic Excavators

    Institute of Scientific and Technical Information of China (English)

    GAO Yingjie; JIN Yanchao; ZHANG Qin

    2009-01-01

    Hydraulic excavator is one type of the most widely applied construction equipment for various applications mainly because of its versatility and mobility. Among the tasks performed by a hydraulic excavator, repeatable level digging or flat surface finishing may take a large percentage. Using automated functions to perform such repeatable and tedious jobs will not only greatly increase the overall productivity but more importantly also improve the operation safety. For the purpose of investigating the technology without loss of generality, this research is conducted to create a coordinate control method for the boom, arm and bucket cylinders on a hydraulic excavator to perform accurate and effective works. On the basis of the kinematic analysis of the excavator linkage system, the tip trajectory of the end-effector can be determined in terms of three hydraulic cylinders coordinated motion with a visualized method. The coordination of those hydraulic cylinders is realized by controlling three electro-hydranlic proportional valves coordinately. Therefore,the complex control algorithm of a hydraulic excavator can be simplified into coordinated motion control of three individual systems.This coordinate control algorithm was validated on a wheeled hydraulic excavator, and the validation results indicated that this developed control method could satisfaetorily accomplish the auto-digging function for level digging or flat surface finishing.

  16. Nonlinear Control of Hydraulic Manipulator for Decommissioning Nuclear Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Myoung-Ho; Lee, Sung-Uk; Kim, Chang-Hoi; Choi, Byung-Seon; Moon, Jei-Kwon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-10-15

    Robot technique is need to decommission nuclear reactor because of high radiation environment. Especially, Manipulator systems are useful for dismantling complex structure in a nuclear facility. In addition, Hydraulic system is applied to handle heavy duty object. Since hydraulic system can demonstrate high power. The manipulator with hydraulic power is already developed. To solve this problem, various nonlinear control method includes acceleration control. But, it is difficult because acceleration value is highly noisy. In this paper, the nonlinear control algorithm without acceleration control is studied. To verify, the hydraulic manipulator model had been developed. Furthermore, the numerical simulation is carried out. The nonlinear control without acceleration parameter method is developed for hydraulic manipulator. To verify control algorithm, the manipulator is modeled by MBD and the hydraulic servo system is also derived. In addition, the numerical simulation is also carried out. Especially, PID gain is determined though TDC algorithm. In the result of numerical simulation, tracking performance is good without acceleration control. Thus, the PID though TDC with SMC is good for hydraulic manipulator control.

  17. Hydraulic Jump and Energy Dissipation with Sluice Gate

    Directory of Open Access Journals (Sweden)

    Youngkyu Kim

    2015-09-01

    Full Text Available Movable weirs have been developed to address the weaknesses of conventional fixed weirs. However, the structures for riverbed protection downstream of movable weirs are designed using the criteria of fixed weirs in most cases, and these applications cause problems, such as scour and deformation of structures, due to misunderstanding the difference between different types of structures. In this study, a hydraulic experiment was conducted to examine weir type-specific hydraulic phenomena, compare hydraulic jumps and downstream flow characteristics according to different weir types, and analyze hydraulic characteristics, such as changes in water levels, velocities and energy. Additionally, to control the flow generated by a sluice gate, energy dissipators were examined herein for their effectiveness in relation to different installation locations and heights. As a result, it was found that although sluice gates generated hydraulic jumps similar to those of fixed weirs, their downstream supercritical flow increased to eventually elongate the overall hydraulic jumps. In energy dissipator installation, installation heights were found to be sensitive to energy dissipation. The most effective energy dissipator height was 10% of the downstream free surface water depth in this experiment. Based on these findings, it seems desirable to use energy dissipators to reduce energy, as such dissipators were found to be effective in reducing hydraulic jumps and protecting the riverbed under sluice gates.

  18. Hydraulic elements in reduction of vibrations in mechanical systems

    Science.gov (United States)

    Białas, K.; Buchacz, A.

    2017-08-01

    This work presents non-classical method of design of mechanic systems with subsystem reducing vibrations. The purpose of this paper is also introduces synthesis of mechanic system with reducing vibrations understand as design of this type of systems. The synthesis may be applied to modify the already existing systems in order to achieve a desired result. Elements which reduce vibrations can be constructed with passive, semi-active or active components. These considerations systems have selected active items. A hallmark of active elements it is possible to change the parameters on time of these elements and their power from an external source. The implementation of active elements is very broad. These elements can be implemented through the use of components of electrical, pneumatic, hydraulic, etc. The system was consisted from mechanical and hydraulic elements. Hydraulic elements were used as subsystem reducing unwanted vibration of mechanical system. Hydraulic elements can be realized in the form of hydraulic cylinder. In the case of an active vibration reduction in the form of hydraulic cylinder it is very important to find the corresponding values of hydraulic components. The values of these elements affect the frequency of vibrations of this sub-system which is related to the effective vibration reduction [7,11].

  19. Physico-empirical approach for mapping soil hydraulic behaviour

    Directory of Open Access Journals (Sweden)

    G. D'Urso

    1997-01-01

    Full Text Available Abstract: Pedo-transfer functions are largely used in soil hydraulic characterisation of large areas. The use of physico-empirical approaches for the derivation of soil hydraulic parameters from disturbed samples data can be greatly enhanced if a characterisation performed on undisturbed cores of the same type of soil is available. In this study, an experimental procedure for deriving maps of soil hydraulic behaviour is discussed with reference to its application in an irrigation district (30 km2 in southern Italy. The main steps of the proposed procedure are: i the precise identification of soil hydraulic functions from undisturbed sampling of main horizons in representative profiles for each soil map unit; ii the determination of pore-size distribution curves from larger disturbed sampling data sets within the same soil map unit. iii the calibration of physical-empirical methods for retrieving soil hydraulic parameters from particle-size data and undisturbed soil sample analysis; iv the definition of functional hydraulic properties from water balance output; and v the delimitation of soil hydraulic map units based on functional properties.

  20. Hydraulic Conductivity of Compacted Laterite Treated with Iron Ore Tailings

    Directory of Open Access Journals (Sweden)

    Umar Sa’eed Yusuf

    2016-01-01

    Full Text Available The objective of this study was to investigate the effect of iron ore tailings (IOT on hydraulic conductivity of compacted laterite. The IOT conforms to ASTM C 618-15 Type F designations. In the present study, soil was admixed with 0–20% IOT and compacted at moulding water content ranging from 10 to 25% using four types of compactive efforts. Hydraulic conductivities of the compacted soil-IOT mixtures were determined using deionized water and municipal solid waste leachate as the permeant fluids, respectively. Deionized water was the reference permeant fluid. Results of this study showed that hydraulic conductivity decreased with increase in IOT content as a result of improvement in mechanical properties of the soil. Permeation of the soil-IOT mixtures with leachate caused the hydraulic conductivity to drop to less than 1 × 10−9 m/s especially at higher compactive efforts. Also, bioclogging of the soil pores due to accumulation of biomass from bacteria and yeast present in the leachate tends to significantly reduce the hydraulic conductivity. From an economic point of view, it has been found from the results of this study that soil specimens treated with up to 20% IOT and compacted at the British Standard Light (BSL compactive effort met the maximum regulatory hydraulic conductivity of less than or equal to 1 × 10−9 m/s for hydraulic barrier system.

  1. Hydraulic characteristics of converse curvature section and aerator in high-head and large discharge spillway tunnel

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    The hydraulic characteristics and cavitation erosion near the converse curvature section in the high-head and large discharge spillway tunnel have been important issues of concern to the hydropower project.In this paper,the evolutions of hydraulic elements such as pressure,flow velocity,wall shear stress,etc.in the converse curvature section are analyzed and the impacts of bottom aerator on hydraulic characteristics are discussed,with the commercial software FLUENT6.3 as a platform and combining the k-model and VOF method.The flow pattern in the converse curvature section of spillway tunnel is given by the three-dimensional numerical simulation.It indicates that the pressure changes rapidly with great pressure gradient from the beginning to the end of the curve.It also shows that the shear stress on side wall just downstream the end of the converse curvature curve is still increasing;the aeration cavity formed downstream the bottom aerator may cause the side wall pressure decreased to worsen the cavitation characteristics near the side wall.By means of the physical model experiment,the three-dimensional aerator composed of side wall baffling aerator and bottom aerator is studied,the baffling aerator suitable for the water flow conditions with water depth of 6.0 to 8.0 m and flow velocity of 35 to 50 m/s is proposed.

  2. Spatial Estimation of Saturated Hydraulic Conductivity from Terrain Attributes Using Regression, Kriging, and Artificial Neural Networks*1

    Institute of Scientific and Technical Information of China (English)

    H. R. MOTAGHIAN; J. MOHAMMADI

    2011-01-01

    Several methods, including stepwise regression, ordinary kriging, cokriging, kriging with external drift, kriging with varying local means, regression-kriging, ordinary artificial neural networks, and kriging combined with artificial neural networks, were compared to predict spatial variation of saturated hydraulic conductivity from environmental covariates. All methods except ordinary kriging allow for inclusion of secondary variables. The secondary spatial information used was terrain attributes including elevation, slope gradient,slope aspect, profile curvature and contour curvature. A multiple jackknifing procedure was used as a validation method. Root mean square error (RMSE) and mean absolute error (MAE) were used as the validation indices, with the mean RMSE and mean MAE used to judge the prediction quality. Prediction performance by ordinary kriging was poor, indicating that prediction of saturated hydraulic conductivity can be improved by incorporating ancillary data such as terrain variables. Kriging combined with artificial neural networks performed best. These prediction models made better use of ancillary information in predicting saturated hydraulic conductivity compared with the competing models. The combination of geostatistical predictors with neural computing techniques offers more capability for incorporating ancillary information in predictive soil mapping. There is great potential for further research and development of hybrid methods for digital soil mapping.

  3. Natural Attenuation of Fuel Hydrocarbon Contaminants:Correlation of Biodegradation with Hydraulic Conductivity in a Field Case Study

    Institute of Scientific and Technical Information of China (English)

    LU Guo-ping; ZHENG Chun-miao

    2004-01-01

    Two biodegradation models are developed to represent natural attenuation of fuel-hydrocarbon contaminants as observed in a comprehensive natural-gradient tracer test in a heterogeneous aquifer on the Columbus Air Force Base in Mississippi, USA. The first, a first-order mass loss model, describes the irreversible losses of BTEX and its individual components, i.e., benzene (B), toluene (T), ethyl benzene (E), and xylene (X). The second, a reactive pathway model, describes sequential degradation pathways for BTEX utilizing multiple electron acceptors, including oxygen, nitrate, iron and sulfate, and via methanogenesis. The heterogeneous aquifer is represented by multiple hydraulic conductivity (K) zones delineated on the basis of numerous flowmeter K measurements. A direct propagation artificial neural network (DPN) is used as an inverse modeling tool to estimate the biodegradation rate constants associated with each of the K zones. In both the mass loss model and the reactive pathway model, the biodegradation rate constants show an increasing trend with the hydraulic conductivity. The finding of correlation between biodegradation kinetics and hydraulic conductivity distributions is of general interest and relevance to characterization and modeling of natural attenuation of hydrocarbons in other petroleum-product contaminated sites.

  4. Newton's method in the context of gradients

    Directory of Open Access Journals (Sweden)

    John W. Neuberger

    2007-09-01

    Full Text Available This paper gives a common theoretical treatment for gradient and Newton type methods for general classes of problems. First, for Euler-Lagrange equations Newton's method is characterized as an (asymptotically optimal variable steepest descent method. Second, Sobolev gradient type minimization is developed for general problems using a continuous Newton method which takes into account a "boundary condition" operator.

  5. An Inexpensive Digital Gradient Controller for HPLC.

    Science.gov (United States)

    Brady, James E.; Carr, Peter W.

    1983-01-01

    Use of gradient elution techniques in high performance liquid chromatography (HPLC) is often essential for direct separation of complex mixtures. Since most commercial controllers have features that are of marginal value for instructional purposes, a low-cost controller capable of illustrating essential features of gradient elution was developed.…

  6. NUMERICAL METHODS IN MARINE ECOLOGY 2. GRADIENT ...

    African Journals Online (AJOL)

    GRADIENT ANALYSIS OF ROCKY SHORE SAMPL~S FROM FALSE BAY ... could be applied to marine studies and it showed quantitatively that the fauna varied with changes ... tigator and the computational facilities at his disposal. ... the major environmental gradients affecting distribution in a more complex situation with.

  7. An Inexpensive Digital Gradient Controller for HPLC.

    Science.gov (United States)

    Brady, James E.; Carr, Peter W.

    1983-01-01

    Use of gradient elution techniques in high performance liquid chromatography (HPLC) is often essential for direct separation of complex mixtures. Since most commercial controllers have features that are of marginal value for instructional purposes, a low-cost controller capable of illustrating essential features of gradient elution was developed.…

  8. Hydraulic Hybrid Parcel Delivery Truck Deployment, Testing & Demonstration

    Energy Technology Data Exchange (ETDEWEB)

    Gallo, Jean-Baptiste [Calstart Incorporated, Pasadena, CA (United States)

    2014-03-07

    Although hydraulic hybrid systems have shown promise over the last few years, commercial deployment of these systems has primarily been limited to Class 8 refuse trucks. In 2005, the Hybrid Truck Users Forum initiated the Parcel Delivery Working Group including the largest parcel delivery fleets in North America. The goal of the working group was to evaluate and accelerate commercialization of hydraulic hybrid technology for parcel delivery vehicles. FedEx Ground, Purolator and United Parcel Service (UPS) took delivery of the world’s first commercially available hydraulic hybrid parcel delivery trucks in early 2012. The vehicle chassis includes a Parker Hannifin hydraulic hybrid drive system, integrated and assembled by Freightliner Custom Chassis Corp., with a body installed by Morgan Olson. With funding from the U.S. Department of Energy, CALSTART and its project partners assessed the performance, reliability, maintainability and fleet acceptance of three pre-production Class 6 hydraulic hybrid parcel delivery vehicles using information and data from in-use data collection and on-road testing. This document reports on the deployment of these vehicles operated by FedEx Ground, Purolator and UPS. The results presented provide a comprehensive overview of the performance of commercial hydraulic hybrid vehicles in parcel delivery applications. This project also informs fleets and manufacturers on the overall performance of hydraulic hybrid vehicles, provides insights on how the technology can be both improved and more effectively used. The key findings and recommendations of this project fall into four major categories: -Performance, -Fleet deployment, -Maintenance, -Business case. Hydraulic hybrid technology is relatively new to the market, as commercial vehicles have been introduced only in the past few years in refuse and parcel delivery applications. Successful demonstration could pave the way for additional purchases of hydraulic hybrid vehicles throughout the

  9. Density Gradient Stabilization of Electron Temperature Gradient Driven Turbulence in a Spherical Tokamak

    Energy Technology Data Exchange (ETDEWEB)

    Ren, Y; Mazzucato, E; Guttenfelder, W; Bell, R E; Domier, C W; LeBlanc, B P; Lee, K C; Luhmann Jr, N C; Smith, D R

    2011-03-21

    In this letter we report the first clear experimental observation of density gradient stabilization of electron temperature gradient driven turbulence in a fusion plasma. It is observed that longer wavelength modes, k⊥ρs ≤10, are most stabilized by density gradient, and the stabilization is accompanied by about a factor of two decrease in the plasma effective thermal diffusivity.

  10. High order compact schemes for gradient approximation

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    In this paper, we propose three gradient recovery schemes of higher order for the linear interpolation. The first one is a weighted averaging method based on the gradients of the linear interpolation on the uniform mesh, the second is a geometric averaging method constructed from the gradients of two cubic interpolation on macro element, and the last one is a local least square method on the nodal patch with cubic polynomials. We prove that these schemes can approximate the gradient of the exact solution on the symmetry points with fourth order. In particular, for the uniform mesh, we show that these three schemes are the same on the considered points. The last scheme is more robust in general meshes. Consequently, we obtain the superconvergence results of the recovered gradient by using the aforementioned results and the supercloseness between the finite element solution and the linear interpolation of the exact solution. Finally, we provide several numerical experiments to illustrate the theoretical results.

  11. Dual fuel gradients in uranium silicide plates

    Energy Technology Data Exchange (ETDEWEB)

    Pace, B.W. [Babock and Wilcox, Lynchburg, VA (United States)

    1997-08-01

    Babcock & Wilcox has been able to achieve dual gradient plates with good repeatability in small lots of U{sub 3}Si{sub 2} plates. Improvements in homogeneity and other processing parameters and techniques have allowed the development of contoured fuel within the cladding. The most difficult obstacles to overcome have been the ability to evaluate the bidirectional fuel loadings in comparison to the perfect loading model and the different methods of instilling the gradients in the early compact stage. The overriding conclusion is that to control the contour of the fuel, a known relationship between the compact, the frames and final core gradient must exist. Therefore, further development in the creation and control of dual gradients in fuel plates will involve arriving at a plausible gradient requirement and building the correct model between the compact configuration and the final contoured loading requirements.

  12. A new family of conjugate gradient methods

    Science.gov (United States)

    Shi, Zhen-Jun; Guo, Jinhua

    2009-02-01

    In this paper we develop a new class of conjugate gradient methods for unconstrained optimization problems. A new nonmonotone line search technique is proposed to guarantee the global convergence of these conjugate gradient methods under some mild conditions. In particular, Polak-Ribiére-Polyak and Liu-Storey conjugate gradient methods are special cases of the new class of conjugate gradient methods. By estimating the local Lipschitz constant of the derivative of objective functions, we can find an adequate step size and substantially decrease the function evaluations at each iteration. Numerical results show that these new conjugate gradient methods are effective in minimizing large-scale non-convex non-quadratic functions.

  13. Non-stationary flow of hydraulic oil in long pipe

    Directory of Open Access Journals (Sweden)

    Hružík Lumír

    2014-03-01

    Full Text Available The paper deals with experimental evaluation and numerical simulation of non-stationary flow of hydraulic oil in a long hydraulic line. Non-stationary flow is caused by a quick closing of valves at the beginning and the end of the pipe. Time dependence of pressure is measured by means of pressure sensors at the beginning and the end of the pipe. A mathematical model of a given circuit is created using Matlab SimHydraulics software. The long line is simulated by means of segmented pipe. The simulation is verified by experiment.

  14. Robust control of a hydraulically driven flexible arm

    Institute of Scientific and Technical Information of China (English)

    Guang LI; Khajepour AMIR

    2004-01-01

    A new robust controller is proposed to regulate both flexural vibrations and rigid body motion of a hydraulically driven flexible arm. The controller combines backstepping control and sliding mode to arrive at a controller capable of dealing with a nonlinear system with uncertainties. The sliding mode technique is used to achieve an asymptotic joint angle and vibration regulation in the presence of payload uncertainty by providing a virtual torque input at the joint while the backstepping technique is used to regulate the spool position of a hydraulic valve to provide the required torque. It is shown that there is no chatter in the hydraulic valve, which results in smoother operation of the system.

  15. Hydraulics and pneumatics a technician's and engineer's guide

    CERN Document Server

    Parr, Andrew

    2011-01-01

    Nearly all industrial processes require objects to be moved, manipulated or subjected to some sort of force. Such movements and manipulations are frequently accomplished by means of devices driven by liquids (hydraulics) or air (pneumatics), the subject of this book. Hydraulics and Pneumatics is written by a practicing process control engineer as a guide to the successful operation of hydraulic and pneumatic systems for all engineers and technicians working with them. Keeping mathematics and theory to a minimum, this practical guide is thorough but accessible to technicians without a

  16. Representing plant hydraulics in a global Earth system model.

    Science.gov (United States)

    Kennedy, D.; Gentine, P.

    2015-12-01

    Earth system models need improvement to reproduce observed seasonal and diurnal cycles of photosynthesis and respiration. Model water stress parameterizations lag behind the plant physiology literature. A plant hydraulics model is developed and deployed in a global Earth system model (NCAR CESM 1.2.2 with CLM 4.5). Assimilation and transpiration are attenuated according to literature cavitation curves. Water stress is evaluated based on plant functional type hydraulic parameters forced by soil moisture and atmospheric conditions. Resolving the plant water status allows for modelling divergent strategies for water stress. The case of isohydric versus anisohydric species is presented, showing that including plant hydraulic traits alter modelled photosynthesis and transpiration.

  17. Problems associated with the use of rapid yielding hydraulic props.

    CSIR Research Space (South Africa)

    Glisson, FJ

    1998-08-01

    Full Text Available required to constantly move consumable support elements from surface to the stope face. This latter operation does not cease with the introduction of RYHP’s as pack timber or elongates are still transported. The effect is as such seldom quantified. Each... ton hydraulic props.10 Figure 1.2 Flow chart of the life of a hydraulic prop; from assembly to usage and repair when damaged. . . . . . . . . . . . . . . . . . 11 Figure 3.1 Performance of 10 hydraulic props that were batch tested prior...

  18. KJRR-FAI Hydraulic Flow Testing Input Package

    Energy Technology Data Exchange (ETDEWEB)

    N.E. Woolstenhulme; R.B. Nielson; D.B. Chapman

    2013-12-01

    The INL, in cooperation with the KAERI via Cooperative Research And Development Agreement (CRADA), undertook an effort in the latter half of calendar year 2013 to produce a conceptual design for the KJRR-FAI campaign. The outcomes of this effort are documented in further detail elsewhere [5]. The KJRR-FAI was designed to be cooled by the ATR’s Primary Coolant System (PCS) with no provision for in-pile measurement or control of the hydraulic conditions in the irradiation assembly. The irradiation assembly was designed to achieve the target hydraulic conditions via engineered hydraulic losses in a throttling orifice at the outlet of the irradiation vehicle.

  19. Considerations for Stationary Ice Covered Flows in Adaptive Hydraulics (ADH)

    Science.gov (United States)

    2009-05-01

    Flows in Adaptive Hydraulics (ADH) by Gary L. Brown, Gaurav Savant , Charlie Berger, and David S. Smith Report Documentation Page Form ApprovedOMB No...Road, Vicksburg, MS 39180 at 601-634-3628, e-mail: Gary.L.Brown@usace.army.mil, or Dr. Gaurav Savant , P.E., Coastal and Hydraulics Laboratory, U.S...L., G. Savant , C.; Berger, and D. S. Smith. 2009. Considerations for stationary ice covered flows in ADaptive Hydraulics (ADH) ERDC TN-SWWRP- 09-4

  20. Aired-time and chamotte hydraulic mortars

    Directory of Open Access Journals (Sweden)

    González Cortina, M.

    2002-06-01

    Full Text Available The aim of this research project has been to obtain aired-li me based hydraulic mortars with the addition of chamotte or burnt clay powder obtained from the ceramic industry waste. By doing this, hydraulic properties have been included into lime and hydraulic mortars with a great improvement in mechanical properties. In order to achieve this, different types of chamotte obtained from clay burnt at different temperatures have been tested, changing, at the same time, the proportions of lime, sand, chamotte and water. All the tests have been performed preparing a double set of test pieces to be kept at room temperature or to be immersed in water, determining the Shore C hardness and the mechanical compressive and tensile strengths. Further on, X-ray diffraction analysis have been developed to determine the qualitative composition of the crystalline structure, as well as micro structural analysis, using stereomicroscope and electric microscope scanning, with X-ray microanalysis have been used. As a conclusion, several types of mortars have been created with different proportions, which can be used, due to its characteristics, as keying mortars in brickwork, for restoration works as well as for new constructions.

    El objetivo de éste trabajo es el conseguir morteros hidráulicos, a partir de la cal aérea, con adición de chamota o polvo de arcilla cocida, obtenida de los residuos-desechos de la industria cerámica. De este modo se pretende infundir propiedades hidráulicas a la cal y obtener morteros hidráulicos, con una mejora sustancial de sus propiedades mecánicas. Para ello, se ha experimentado con diversos tipos de chamotas, obtenidas a partir de arcillas cocidas a diferentes temperaturas, y con diversas granulometrías, y se han realizado morteros con distintas dosificaciones, variando las proporciones de cal, arena, chamota y agua. En todos los casos se ha preparado una doble serie de probetas, para conservarlas al aire o