WorldWideScience

Sample records for hybridization ssh technique

  1. Suppression subtraction hybridization (SSH) and macroarray techniques reveal differential gene expression profiles in brain of sea bream infected with nodavirus.

    Science.gov (United States)

    Dios, S; Poisa-Beiro, L; Figueras, A; Novoa, B

    2007-03-01

    Despite of the impact that viruses have on aquatic organisms, relatively little is known on how fish fight against these infections. In this work, the brain gene expression pattern of sea bream (Sparus aurata) in response to nodavirus infection was investigated. We used the suppression subtractive hybridization (SSH) method to generate a subtracted cDNA library enriched with gene transcripts differentially expressed after 1 day post-infection. Some of the ESTs from the infected tissues fell in gene categories related to stress and immune responses. For the reverse library (ESTs expressed in controls compared with infected tissues) the most abundant transcripts were of ribosomal and mitochondrial nature. Several ESTs potentially induced by virus exposure were selected for in vivo expression studies. We observed a clear difference in expression between infected and control samples for two candidate genes, ubiquitin conjugating enzyme 7 interacting protein, which seems to play an important role in apoptosis and the interferon induced protein with helicase C domain 1 (mda-5) that contributes to apoptosis and regulates the type I IFN production, a key molecule of the antiviral innate response in most organisms.

  2. Suppression Subtractive Hybridization (SSH) and its modifications in microbiological research.

    Science.gov (United States)

    Huang, Xiaowei; Li, Yunxia; Niu, Qiuhong; Zhang, Keqin

    2007-09-01

    Suppression subtractive hybridization (SSH) is an effective approach to identify the genes that vary in expression levels during different biological processes. It is often used in higher eukaryotes to study the molecular regulation in complex pathogenic progress, such as tumorigenesis and other chronic multigene-associated diseases. Because microbes have relatively smaller genomes compared with eukaryotes, aside from the analysis at the mRNA level, SSH as well as its modifications have been further employed to isolate specific chromosomal locus, study genomic diversity related with exceptional bacterial secondary metabolisms or genes with special microbial function. This review introduces the SSH and its associated methods and focus on their applications to detect specific functional genes or DNA markers in microorganisms.

  3. [Gene expression profiling by suppression subtractive hybridization (SSH): a example for its application to the study of lymphomas].

    Science.gov (United States)

    Villalva, C; Trempat, P; Zenou, R C; Delsol, G; Brousset, P

    2001-03-01

    Suppression subtractive hybridization (SSH) was used to isolate genes that were differentially expressed in anaplastic lymphoma kinase (ALK)-positive and ALK-negative anaplastic large cell lymphoma. In addition, this approach was applied to Hodgkin's disease cases with different clinical outcomes. SSH combines a normalization step that equalizes the abundance of cDNAs within the sequences to be tested and a subtraction step that excludes the common sequences between the target and the control. In a model system, the SSH technique enriches for rare sequences up to 5,000-fold in one round. We have isolated several genes whose expression varied significantly with regard to the tumour subtypes. There were different genes with known or unknown functions. We aim to compare the results of the SSH approach with those obtained with high density filters. In a near future, we would like to design DNA chips specific of each pathology that could be used for clinical purposes (evaluation of prognosis and therapeutic response).

  4. Instrumented SSH

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, Scott; Campbell, Scott

    2009-05-27

    NERSC recently undertook a project to access and analyze Secure Shell (SSH) related data. This includes authentication data such as user names and key fingerprints, interactive session data such as keystrokes and responses, and information about noninteractive sessions such as commands executed and files transferred. Historically, this data has been inaccessible with traditional network monitoring techniques, but with a modification to the SSH daemon, this data can be passed directly to intrusion detection systems for analysis. The instrumented version of SSH is now running on all NERSC production systems. This paper describes the project, details about how SSH was instrumented, and the initial results of putting this in production.

  5. cDNA amplification by SMART-PCR and suppression subtractive hybridization (SSH)-PCR.

    Science.gov (United States)

    Hillmann, Andrew; Dunne, Eimear; Kenny, Dermot

    2009-01-01

    The comparison of two RNA populations that differ from the effects of a single-independent variable, such as a drug treatment or a specific genetic defect, can identify differences in the abundance of specific transcripts that vary in a population-dependent manner. There are a variety of methods for identifying differentially expressed genes, including microarray, SAGE, qRT-PCR, and DDGE. This protocol describes a potentially less sensitive yet relatively easy and cost-effective alternative that does not require prior knowledge of the transcriptomes under investigation and is particularly applicable when minimal levels of starting material, RNA, are available. RNA input can often be a limiting factor when analyzing RNA from, for example, rigorously purified blood cells. This protocol describes the use of SMART-PCR to amplify cDNA from sub-microgram levels of RNA. The amplified cDNA populations under comparison are then subjected to suppression subtractive hybridization (SSH-PCR), a technique that couples subtractive hybridization with suppression PCR to selectively amplify fragments of differentially expressed genes. The final products are cDNA populations enriched for significantly over-represented transcripts in either of the two input RNA preparations. These cDNA populations may then be cloned to make subtracted cDNA libraries and/or used as probes to screen subtracted cDNA, global cDNA, or genomic DNA libraries.

  6. Suppression subtractive hybridization (SSH) for isolation and characterization of genes related to testicular development in the giant tiger shrimp Penaeus monodon.

    Science.gov (United States)

    Leelatanawit, Rungnapa; Klinbunga, Sirawut; Aoki, Takashi; Hirono, Ikuo; Valyasevi, Rudd; Menasveta, Piamsak

    2008-11-30

    Suppression subtractive hybridization (SSH) cDNA libraries of the giant tiger shrimp, Penaeus monodon, were constructed. In total, 178 and 187 clones from the forward and reverse SSH libraries, respectively, of P. monodon were unidirectionally sequenced. From these, 37.1% and 53.5% Expressed Sequence Tags (ESTs) significantly matched known genes (E-value 0.05).

  7. [Construction of suppression subtractive hybridization (SSH) library of copepod Pseudodiaptomous annandalei and its ferritin cDNA cloning and differential expression under nickel stress].

    Science.gov (United States)

    Jiang, Jie-Lan; Wang, Gui-Zhong; Wu, Li-Sheng; Li, Shao-Jing

    2012-07-01

    To study the molecular response mechanisms of copepod to nickel stress, a suppression subtractive hybridization (SSH) cDNA library of Pseudodiaptomous annandalei under nickel stress was constructed by using SSH technique, and a total of 140 clones were randomly picked from the growing colonies and identified by PCR. The recombinant rate of the library was 98.6%, and the volume of the library was 1.12 x 10(6) cfu. After the recombinant plasmids were sequenced, a partial cDNA fragment of ferritin was recognized based on BLAST searches in NCBI, with a size of 859 bp and continuously encoding 170 amino acid residues. The semi-quantitative PCR results showed that the ferritin cDNA under 24 h nickel stress was distinctly up-regulated. The successful construction of the SSH library and the obtaining of ferritin cDNA fragment would supply basis for the further study of the molecular response mechanisms of copepod to nickel stress.

  8. Suppression subtractive hybridization (SSH) combined with bioinformatics method: an integrated functional annotation approach for analysis of differentially expressed immune-genes in insects.

    Science.gov (United States)

    Badapanda, Chandan

    2013-01-01

    The suppression subtractive hybridization (SSH) approach, a PCR based approach which amplifies differentially expressed cDNAs (complementary DNAs), while simultaneously suppressing amplification of common cDNAs, was employed to identify immuneinducible genes in insects. This technique has been used as a suitable tool for experimental identification of novel genes in eukaryotes as well as prokaryotes; whose genomes have been sequenced, or the species whose genomes have yet to be sequenced. In this article, I have proposed a method for in silico functional characterization of immune-inducible genes from insects. Apart from immune-inducible genes from insects, this method can be applied for the analysis of genes from other species, starting from bacteria to plants and animals. This article is provided with a background of SSH-based method taking specific examples from innate immune-inducible genes in insects, and subsequently a bioinformatics pipeline is proposed for functional characterization of newly sequenced genes. The proposed workflow presented here, can also be applied for any newly sequenced species generated from Next Generation Sequencing (NGS) platforms.

  9. Identification of Botrytis cinerea genes up-regulated during infection and controlled by the Galpha subunit BCG1 using suppression subtractive hybridization (SSH).

    Science.gov (United States)

    Schulze Gronover, Christian; Schorn, Corinna; Tudzynski, Bettina

    2004-05-01

    The Galpha subunit BCG1 plays an important role during the infection of host plants by Botrytis cinerea. Delta bcg1 mutants are able to conidiate, penetrate host leaves, and produce small primary lesions. However, in contrast to the wild type, the mutants completely stop invasion of plant tissue at this stage; secondary lesions have never been observed. Suppression subtractive hybridization (SSH) was used to identify fungal genes whose expression on the host plant is specifically affected in bcg1 mutants. Among the 22 differentially expressed genes, we found those which were predicted to encode proteases, enzymes involved in secondary metabolism, and others encoding cell wall-degrading enzymes. All these genes are highly expressed during infection in the wild type but not in the mutant. However, the genes are expressed in both the wild type and the mutant under certain conditions in vitro. Most of the BCG1-controlled genes are still expressed in adenylate cyclase (bac) mutants in planta, suggesting that BCG1 is involved in at least one additional signaling cascade in addition to the cAMP-depending pathway. In a second SSH approach, 1,500 clones were screened for those that are specifically induced by the wild type during the infection of bean leaves. Of the 22 BCG1-controlled genes, 11 also were found in the in planta SSH library. Therefore, SSH technology can be successfully applied to identify target genes of signaling pathways and differentially expressed genes in planta.

  10. Identification of genes involved in the response of haemocytes of Penaeus japonicus by suppression subtractive hybridization (SSH) following microbial challenge.

    Science.gov (United States)

    He, Nanhai; Liu, Haipeng; Xu, Xun

    2004-08-01

    Penaeus japonicus were injected with a heat-killed microorganism suspension and 291 randomly selected cDNA fragments generated by suppression subtractive hybridization (SSH) were sequenced. A total of 71 cDNA clones corresponding to 25 genes were found to have enhanced expression, of which eight are found for the first time in shrimp. The most abundant gene in the subtractive library was Kunitz-type protease inhibitor, clearly indicating this protease inhibitor in the response. A number of genes encoding signaling molecules, such as Ras-related nuclear protein (Ran), growth factor receptor bound protein (Grb), TGF-beta receptor interacting protein, integrin binding protein and interferon receptor bound protein were found for the first time in the shrimp, and they may be involved in the regulation of the host defense against the injected microbes. Furthermore, cDNAs of chaperonin, proteasome, antioxidant as well as genes associated with actin reorganization, which may be necessary for phagocytosis and encapsulation, were also expressed at a higher level after the challenge. These results may facilitate the understanding of shrimp immune responses.

  11. Gene expression profiling of osteoclast differentiation by combined suppression subtractive hybridization (SSH) and cDNA microarray analysis.

    Science.gov (United States)

    Rho, Jaerang; Altmann, Curtis R; Socci, Nicholas D; Merkov, Lubomir; Kim, Nacksung; So, Hongseob; Lee, Okbok; Takami, Masamichi; Brivanlou, Ali H; Choi, Yongwon

    2002-08-01

    Bone homeostasis is maintained by the balanced action of bone-forming osteoblasts and bone-resorbing osteoclasts. Multinucleated, mature osteoclasts develop from hematopoietic stem cells via the monocyte-macrophage lineage, which also give rise to macrophages and dendritic cells. Despite their distinct physiologic roles in bone and the immune system, these cell types share many molecular and biochemical features. To provide insights into how osteoclasts differentiate and function to control bone metabolism, we employed a systematic approach to profile patterns of osteoclast-specific gene expression by combining suppression subtractive hybridization (SSH) and cDNA microarray analysis. Here we examined how gene expression profiles of mature osteoclast differ from macrophage or dendritic cells, how gene expression profiles change during osteoclast differentiation, and how Mitf, a transcription factor critical for osteoclast maturation, affects the gene expression profile. This approach revealed a set of genes coordinately regulated for osteoclast function, some of which have previously been implicated in several bone diseases in humans.

  12. Comparison of RNA expression profiles on generations of Porphyra yezoensis (Rhodophyta, based on suppression subtractive hybridization (SSH

    Directory of Open Access Journals (Sweden)

    Shen Songdong

    2011-10-01

    Full Text Available Abstract Background Porphyra yezoensis Ueda is one of the most important edible seaweed, with a dimorphic life cycle which consists of gametophyte as macroscopical blade and sporophyte as microscopic filamentous. Conspicuous differences exist in the two generations, such as morphology, cell structure, biochemistry, physiology, and so on. The developmental process of Porphyra yezoensis has been studied thoroughly, but the mechanism is still ambiguous and few studies on genetic expression have been carried out. In this study, the suppression subtractive hybridization (SSH method conducted to generate large-scale expressed sequence tags (EST is designed to identify gene candidates related to the morphological and physiological differences between the gametophytic and sporophytic generations of Porphyra yezoensis Ueda. Findings Each 300 clones of sporophyte and gametophyte cells were dipped onto the membrane for hybridization. The result of dot-blot suggested there were 222 positive clones in gametophyte library and 236 positive clones in sporophyte library. 383 positive clones of strongest signals had been sequenced, and 191 EST sequences of gametophyte and 192 of sporophyte were obtained. A total of 196 genes were obtained, within which 104 genes were identified from the gametophyte and 92 from the sporophyte. Thirty-nine genes of the gametophyte and 62 genes of the sporophyte showed sequence similarity to those genes with known or putative functions which were classified according to their putative biological roles and molecular functions. The GO annotation showed about 58% of the cellular component of sporophyte and gametophyte cells were mainly located in cytoplasm and nucleus. The special genes were located in Golgi apparatus, and high expression in plastid, ribosome and endoplasmic reticulum. The main biological functions of gametophyte cells contributed to DNA repair/replication, carbohydrate metabolism, transport and transcription

  13. Pro OpenSSH

    CERN Document Server

    Stahnke, Michael

    2006-01-01

    SSH, acronym for Secure Socket Shell, is for users and administrators wishing to establish secure communication between disparate networks. 'Pro OpenSSH', authored by two Fortune 100 system administrators, provides readers with a highly practical reference for configuring and deploying OpenSSH in their own environment.

  14. Extraction of high quality of RNA and construction of a suppression subtractive hybridization (SSH) library from chestnut rose (Rosa roxburghii Tratt).

    Science.gov (United States)

    Xu, Qiang; Wen, Xiaopeng; Tao, Nengguo; Hu, Zhiyong; Yue, Hailin; Deng, Xiuxin

    2006-04-01

    Chestnut rose (Rosa roxburghii Tratt) is a rare fruit crop of promising economical importance in fruit and ornamental exploitation in China. Isolation of high quality RNA from chestnut rose is difficult due to its high levels of polyphenols, polysaccharides and other compounds, but a modified CTAB extraction procedure without phenol gave satisfactory results. High concentrations of PVP (2%, w/v), CTAB (2%, w/v) and beta-mercaptoethanol (4%, v/v) were used in the extraction buffer to improve RNA quality. The average yield was about 200 microg RNA g(-1) fresh leaves. The isolated RNA was of sufficient quality for construction of suppression subtraction hybridization (SSH) library, which allowed the isolation of several pathogen-induced defense genes.

  15. Isolation and characterization of genes functionally involved in ovarian development of the giant tiger shrimp Penaeus monodon by suppression subtractive hybridization (SSH).

    Science.gov (United States)

    Preechaphol, Rachanimuk; Klinbunga, Sirawut; Khamnamtong, Bavornlak; Menasveta, Piamsak

    2010-10-01

    Suppression subtractive hybridization (SSH) libraries between cDNA in stages I (previtellogenic) and III (cortical rod) ovaries of the giant tiger shrimp (Penaeus monodon) were established. In all, 452 ESTs were unidirectionally sequenced. Sequence assembly generated 28 contigs and 201 singletons, 109 of which (48.0%) corresponding to known sequences previously deposited in GenBank. Several reproduction-related transcripts were identified. The full-length cDNA of anaphase promoting complex subunit 11 (PmAPC11; 600 bp with an ORF of 255 bp corresponding to a polypeptide of 84 amino acids) and selenoprotein Mprecursor (PmSePM; 904 bp with an ORF of 396 bp corresponding to a polypeptide of 131 amino acids) were characterized and reported for the first time in penaeid shrimp. Semiquantitative RT-PCR revealed that the expression levels of PmSePM and keratinocyte-associated protein 2 significantly diminished throughout ovarian development, whereas Ser/Thrcheckpoint kinase 1 (Chk1), DNA replication licensing factor mcm2 and egalitarian were down-regulated in mature ovaries of wild P. monodon (p < 0.05). Accordingly, the expression profiles of PmSePM and keratinocyte-associated protein 2 could be used as biomarkers for evaluating the degree of reproductive maturation in domesticated P. monodon.

  16. Isolation and characterization of genes functionally involved in ovarian development of the giant tiger shrimp Penaeus monodon by suppression subtractive hybridization (SSH

    Directory of Open Access Journals (Sweden)

    Rachanimuk Preechaphol

    2010-01-01

    Full Text Available Suppression subtractive hybridization (SSH libraries between cDNA in stages I (previtellogenic and III (cortical rod ovaries of the giant tiger shrimp (Penaeus monodon were established. In all, 452 ESTs were unidirectionally sequenced. Sequence assembly generated 28 contigs and 201 singletons, 109 of which (48.0% corresponding to known sequences previously deposited in GenBank. Several reproduction-related transcripts were identified. The full-length cDNA of anaphase promoting complex subunit 11 (PmAPC11; 600 bp with an ORF of 255 bp corresponding to a polypeptide of 84 amino acids and selenoprotein M precursor (PmSePM; 904 bp with an ORF of 396 bp corresponding to a polypeptide of 131 amino acids were characterized and reported for the first time in penaeid shrimp. Semiquantitative RT-PCR revealed that the expression levels of PmSePM and keratinocyte-associated protein 2 significantly diminished throughout ovarian development, whereas Ser/Thr checkpoint kinase 1 (Chk1, DNA replication licensing factor mcm2 and egalitarian were down-regulated in mature ovaries of wild P. monodon (p < 0.05. Accordingly, the expression profiles of PmSePM and keratinocyte-associated protein 2 could be used as biomarkers for evaluating the degree of reproductive maturation in domesticated P. monodon.

  17. Suppression subtractive hybridization and its application to fish gene cloning%抑制消减杂交(SSH)及其在鱼类基因克隆中的应用

    Institute of Scientific and Technical Information of China (English)

    程起群

    2004-01-01

    There are 10 percent to 15 percent genes expression in certain cells during the life time of fishes like other vertebrates. The genes were different at different development stage, under different physiological conditions, and in different kinds of cells. So comparing the differences of gene expression in different cells can help us understand the genetic nature of phenotypic differences, and understand the basic information of life period, and find the genes in relation to development and diseases, and finally benefit mankind. Several methods were developed to clone differential expression gene in recent years. They are subtractive hybridization (SH), differential display (DD),representional difference analysis (RDA), and so on. These methods all have postive influences on cloning special genes, but they all have some defects, such as higher false-positive, lower replication, lower sensitive and difficulty to manipulate. Suppression subtractive hybridization (SSH) was developed by Diatchenko et al in 1996. SSH was based on suppression PCR and combines normalization and subtraction in a single procedure. It is a more effective and convenient method than all others mentioned above. The principle and the rules of manipulation of SSH in detail was illuminated and the novel genes cloned by SSH was listed. They are immune related genes and reproduction and development related genes. The reproduction and development related genes are as follows: ZP3, Cyclin A2,CBI02, YA2, FSTRAP. The immune related genes are as follows: NKEF(natural killer enhancing factor), CC chemokine, CXCR1, CXCR2, CXCR4, AIF-1(allograft inflammatory factor-1), IL-1β(inteleukin-1), FcεRIγ(γ submit of high affinity Fc receptor for IgE), SSA(serum amyloid A), LECT2 (leucocyte cell-derived hemotaxin 2), GMFβ(glia maturation factorβ), CD45, Lysozyme C, PBEF (Pre-B cell enhancing factor), C-type lectin,PTX(Pentraxin), IL-1RⅡ, IL-8-1ike CXC chemokine, TF(tissue factor), trout chemokine 2, TNF decoy

  18. Social Impact of SSH Research

    DEFF Research Database (Denmark)

    Johansson, Lasse Gøhler; Grønvad, Jonas Følsgaard; Pedersen, David Budtz

    2016-01-01

    of making social impact. However, the social sciences and humanities (SSH) have only played a marginal role in the societal challenges of Horizon2020. According to Science Europe, the pan-European association for research councils and foundations, only 26.7 percent of the topics under the Horizon2020’s...... societal challenges explicitly invite contributions from SSH research. If we look at the humanities in isolation, it is only around 10 percent of the topics. The marginal role of SSH in Horizon2020 is, among other things, the result of an inadequate understanding of the social impact of SSH research...... and of inadequate instruments for measuring the impact of SSH research. In this paper we address the following questions: 1) how can we understand the social impact of SSH research? And 2) how can we meaningfully measure or assess it? These questions are addressed through a survey of the current scientific...

  19. Social Impact of SSH Research

    DEFF Research Database (Denmark)

    Johansson, Lasse Gøhler; Grønvad, Jonas Følsgaard; Pedersen, David Budtz

    2016-01-01

    societal challenges explicitly invite contributions from SSH research. If we look at the humanities in isolation, it is only around 10 percent of the topics. The marginal role of SSH in Horizon2020 is, among other things, the result of an inadequate understanding of the social impact of SSH research...... of making social impact. However, the social sciences and humanities (SSH) have only played a marginal role in the societal challenges of Horizon2020. According to Science Europe, the pan-European association for research councils and foundations, only 26.7 percent of the topics under the Horizon2020’s...... and of inadequate instruments for measuring the impact of SSH research. In this paper we address the following questions: 1) how can we understand the social impact of SSH research? And 2) how can we meaningfully measure or assess it? These questions are addressed through a survey of the current scientific...

  20. Evolutionary conservation and DNA binding properties of the Ssh7 proteins from Sulfolobus shibatae

    Institute of Scientific and Technical Information of China (English)

    CHEN; Xulin(陈绪林); GUO; Rong(郭荣); HUANG; Li(黄力); Ray; Hong

    2002-01-01

    The thermoacidophilic archaeon Sulfolobus shibatae synthesizes a large amount of the 7-ku DNA binding proteins known as Ssh7. Our hybridization experiments showed that two Ssh7-encoding genes existed in the genome of S. Shibatae. These two genes, designated ssh7a and ssh7b, have been cloned, sequenced and expressed in Escherichia coli. The two Ssh7 proteins differ only at three amino acid positions. In addition, the cis-regulatory sequences of the ssh7a and ssh7b genes are highly conserved. These results suggest the presence of a selective pressure to maintain not only the sequence but also the expression of the two genes. We have also found that there are two genes encoding the 7-ku protein in Sulfolobus solfataricus. Based on this and other studies, we suggest that the gene encoding the 7-ku protein underwent duplication before the separation of Sulfolobus species. Binding of native Ssh7 and recombinant (r)Ssh7 to short duplex DNA fragments was analyzed by electrophoretic mobility shift assays. Both native and recombinant forms of the protein behaved in a similar fashion in the assays, suggesting that the interaction of Ssh7 with DNA is not affected either by specific lysine methylation found in the native Ssh7 proteins or by the difference between the two Ssh7 isomers in amino acid sequence. Our data show that Ssh7 binds duplex DNA fragments with a binding size of ~ 6.6 base pairs and an apparent dissociation constant of (0.7-1.0)×10-7 mol/L under the assay conditions employed in the present study. In addition, Ssh7 binds more tightly to negatively supercoiled DNA than to linear or relaxed DNA.

  1. Dicty_cDB: SSH308 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH308 (Link to dictyBase) - - - Contig-U13027-1 SSH308P (Link to Original site) SSH...308F 417 SSH308Z 615 SSH308P 1032 - - Show SSH308 Library SS (Link to library) Clone ID SSH...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-A/SSH308Q.Seq.d/ Representative seq. ID SSH...308P (Link to Original site) Representative DNA sequence >SSH308 (SSH308Q) /CSM/SS/SSH3-A/SSH...sill fllqeidvl*ka*nvlyqksilnilivildlklieklldvysllkqefiihql*sshklh kcitinnnhnnnimh

  2. Dicty_cDB: SSH490 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH490 (Link to dictyBase) - - - Contig-U15458-1 SSH490P (Link to Original site) SSH...490F 364 SSH490Z 515 SSH490P 879 - - Show SSH490 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH4-D/SSH490Q.Seq.d/ Representative seq. ID SSH...490P (Link to Original site) Representative DNA sequence >SSH490 (SSH490Q) /CSM/SS/SSH4-D/SSH4...s l**rysfycsmv*tc*nl*c*s*tt*yfiinw**rssng*yynqsfiktks*stsshl*n i--- ---PSIVNEILKSIVAQFNASQLITQREQVSRLIFKRLVD

  3. Dicty_cDB: SSH379 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH379 (Link to dictyBase) - - - Contig-U15118-1 SSH379P (Link to Original site) SSH...379F 371 SSH379Z 582 SSH379P 953 - - Show SSH379 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-D/SSH379Q.Seq.d/ Representative seq. ID SSH...379P (Link to Original site) Representative DNA sequence >SSH379 (SSH379Q) /CSM/SS/SSH3-D/SSH3...: ti*lcltkrkttylhllkil*svvlpvvsqklllhqlnvlnyyykfnllqlklllinntk vssivllefqknkvsshy

  4. Dicty_cDB: SSH306 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH306 (Link to dictyBase) - - - Contig-U16505-1 SSH306P (Link to Original site) SSH...306F 388 SSH306Z 544 SSH306P 932 - - Show SSH306 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-A/SSH306Q.Seq.d/ Representative seq. ID SSH...306P (Link to Original site) Representative DNA sequence >SSH306 (SSH306Q) /CSM/SS/SSH3-A/SSH3...emcrf**grfgycq*irnpsikstslftkcsirvctfi nygie*kdp--- ---kqslisvsst*gl*tkfgnnvmsshytlh*ilklniw*tlnpskr*emvl*ls

  5. Dicty_cDB: SSH325 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH325 (Link to dictyBase) - - - Contig-U12240-1 SSH325P (Link to Original site) SSH...325F 211 SSH325Z 719 SSH325P 930 - - Show SSH325 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-B/SSH325Q.Seq.d/ Representative seq. ID SSH...325P (Link to Original site) Representative DNA sequence >SSH325 (SSH325Q) /CSM/SS/SSH3-B/SSH3...knfqkqffp*lrixkixxnlikkkkkkxlxvxp*x*f**nkkkkkrkknph*kkth ththhnthtlyiilnlhsshynip

  6. Dicty_cDB: SSH277 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH277 (Link to dictyBase) - - - Contig-U14946-1 SSH277P (Link to Original site) SSH...277F 336 SSH277Z 415 SSH277P 751 - - Show SSH277 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-D/SSH277Q.Seq.d/ Representative seq. ID SSH...277P (Link to Original site) Representative DNA sequence >SSH277 (SSH277Q) /CSM/SS/SSH2-D/SSH2...lmnylrksls ivllvpfhmqa*sxpsflvih*avsklllfkkkkkkxeiyf*iiikwkkkkktfkktlkn pynkkl**lknqkkkkkkkkk Frame C: kkkkyf*kkkifeyfffflssh

  7. Dicty_cDB: SSH109 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH109 (Link to dictyBase) - G02274 DDB0168040 Contig-U05306-1 SSH...109E (Link to Original site) - - - - - - SSH109E 493 Show SSH109 Library SS (Link to library) Clone ID SSH...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH1-A/SSH109Q.Seq.d/ ...Representative seq. ID SSH109E (Link to Original site) Representative DNA sequence >SSH109 (SSH109Q) /CSM/SS/SSH1-A/SSH...lkkviikmiinifffkkkkkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSH109 (SSH

  8. Dicty_cDB: SSH236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH236 (Link to dictyBase) - - - Contig-U12328-1 SSH236F (Link to Original site) SSH...236F 189 - - - - - - Show SSH236 Library SS (Link to library) Clone ID SSH236 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-B/SSH236Q.Seq.d/ Representative seq. ID SSH23...6F (Link to Original site) Representative DNA sequence >SSH236 (SSH236Q) /CSM/SS/SSH2-B/SSH236Q.Seq.d/ CTTTT.../VF/VFI8-C/VFI851Q.Seq.d/ 375 e-103 SSH237 (SSH237Q) /CSM/SS/SSH2-B/SSH237Q.Seq.d/ 375 e-103 SSH236 (SSH236Q) /CSM/SS/SSH2-B/SSH

  9. Dicty_cDB: SSH550 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH550 (Link to dictyBase) - - - Contig-U15330-1 SSH550E (Link... to Original site) - - - - - - SSH550E 258 Show SSH550 Library SS (Link to library) Clone ID SSH550 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-C/SSH550Q.Seq.d/ Representative seq. ID SSH55...0E (Link to Original site) Representative DNA sequence >SSH550 (SSH550Q) /CSM/SS/SSH5-C/SSH550Q.Seq.d/ CGAAT...55Q) /CSM/SS/SSL4-C/SSL455Q.Seq.d/ 456 e-128 SSH550 (SSH550Q) /CSM/SS/SSH5-C/SSH550Q.Seq.d/ 456 e-128 SSH134 (SSH134Q) /CSM/SS/SSH

  10. Dicty_cDB: SSH596 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH596 (Link to dictyBase) - - - Contig-U10001-1 SSH596P (Link to Original site) SSH...596F 354 SSH596Z 451 SSH596P 805 - - Show SSH596 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-D/SSH596Q.Seq.d/ Representative seq. ID SSH...596P (Link to Original site) Representative DNA sequence >SSH596 (SSH596Q) /CSM/SS/SSH5-D/SSH5...re E Sequences producing significant alignments: (bits) Value SSH596 (SSH596Q) /CSM/SS/SSH5-D/SSH

  11. Dicty_cDB: SSH571 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH571 (Link to dictyBase) - - - Contig-U13239-1 SSH571P (Link to Original site) SSH...571F 228 SSH571Z 189 SSH571P 417 - - Show SSH571 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-C/SSH571Q.Seq.d/ Representative seq. ID SSH...571P (Link to Original site) Representative DNA sequence >SSH571 (SSH571Q) /CSM/SS/SSH5-C/SSH5...core E Sequences producing significant alignments: (bits) Value SSH571 (SSH571Q) /CSM/SS/SSH5-C/SSH571Q.Seq.

  12. Dicty_cDB: SSH151 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH151 (Link to dictyBase) - - - Contig-U01152-1 SSH151P (Link to Original site) SSH...151F 286 SSH151Z 654 SSH151P 940 - - Show SSH151 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH1-C/SSH151Q.Seq.d/ Representative seq. ID SSH...151P (Link to Original site) Representative DNA sequence >SSH151 (SSH151Q) /CSM/SS/SSH1-C/SSH1...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSH151 (SSH151Q) /CSM/SS/SSH1-C/SSH

  13. Dicty_cDB: SSH269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH269 (Link to dictyBase) - - - Contig-U01518-1 SSH269P (Link to Original site) SSH...269F 381 SSH269Z 406 SSH269P 787 - - Show SSH269 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-C/SSH269Q.Seq.d/ Representative seq. ID SSH...269P (Link to Original site) Representative DNA sequence >SSH269 (SSH269Q) /CSM/SS/SSH2-C/SSH2...lignments: (bits) Value SSH269 (SSH269Q) /CSM/SS/SSH2-C/SSH269Q.Seq.d/ 1078 0.0 S

  14. Dicty_cDB: SSH644 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH644 (Link to dictyBase) - - - Contig-U15077-1 SSH644P (Link to Original site) SSH...644F 233 SSH644Z 229 SSH644P 462 - - Show SSH644 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-B/SSH644Q.Seq.d/ Representative seq. ID SSH...644P (Link to Original site) Representative DNA sequence >SSH644 (SSH644Q) /CSM/SS/SSH6-B/SSH6...268 7e-71 SSK652 (SSK652Q) /CSM/SS/SSK6-C/SSK652Q.Seq.d/ 268 7e-71 SSH644 (SSH644Q) /CSM/SS/SSH6-B/SSH

  15. Dicty_cDB: SSH168 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH168 (Link to dictyBase) - - - Contig-U15567-1 SSH168P (Link to Original site) SSH...168F 329 SSH168Z 641 SSH168P 970 - - Show SSH168 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH1-C/SSH168Q.Seq.d/ Representative seq. ID SSH...168P (Link to Original site) Representative DNA sequence >SSH168 (SSH168Q) /CSM/SS/SSH1-C/SSH1... producing significant alignments: (bits) Value SSH168 (SSH168Q) /CSM/SS/SSH1-C/SSH

  16. Dicty_cDB: SSH570 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH570 (Link to dictyBase) - - - Contig-U15676-1 SSH570P (Link to Original site) SSH...570F 229 SSH570Z 192 SSH570P 421 - - Show SSH570 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-C/SSH570Q.Seq.d/ Representative seq. ID SSH...570P (Link to Original site) Representative DNA sequence >SSH570 (SSH570Q) /CSM/SS/SSH5-C/SSH5...M-cDNA Score E Sequences producing significant alignments: (bits) Value SSH570 (SSH570Q) /CSM/SS/SSH5-C/SSH5

  17. Dicty_cDB: SSH503 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-A/SSH503Q.Seq.d/ Representative seq. ID SSH50...3F (Link to Original site) Representative DNA sequence >SSH503 (SSH503Q) /CSM/SS/SSH5-A/SSH503Q.Seq.d/ AGAAA

  18. Dicty_cDB: SSH535 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH535 (Link to dictyBase) - - - Contig-U15335-1 SSH535E (Link... to Original site) - - - - - - SSH535E 247 Show SSH535 Library SS (Link to library) Clone ID SSH535 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-B/SSH535Q.Seq.d/ Representative seq. ID SSH53...5E (Link to Original site) Representative DNA sequence >SSH535 (SSH535Q) /CSM/SS/SSH5-B/SSH535Q.Seq.d/ TGGTA... Acid sequence (All Frames) Frame A: w*qmrfgi*ssshnw*rsrfskilr*sip*nlcqdscqr*gsfl

  19. Dicty_cDB: SSH832 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH832 (Link to dictyBase) - G02305 DDB0231538 Contig-U14509-1 SSH...832E (Link to Original site) - - - - - - SSH832E 995 Show SSH832 Library SS (Link to library) Clone ID SSH...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH8-B/SSH832Q.Seq.d/ ...Representative seq. ID SSH832E (Link to Original site) Representative DNA sequence >SSH832 (SSH832Q) /CSM/SS/SSH8-B/SSH...i*iyiykink*ng**cks*rifrcr**kikrw*ll*nvwwwffkirrc sfrlykgskfi*nvkemgssrcsiskssrmlfkgik*t*csiklcfssrll*krkcyrcn hmfessh

  20. Dicty_cDB: SSH711 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH711 (Link to dictyBase) - - - - SSH711Z (Link to Original site) - - SSH...711Z 382 - - - - Show SSH711 Library SS (Link to library) Clone ID SSH711 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH7-A/SSH...711Q.Seq.d/ Representative seq. ID SSH711Z (Link to Original site) R...epresentative DNA sequence >SSH711 (SSH711Q) /CSM/SS/SSH7-A/SSH711Q.Seq.d/ XXXXXXXXXXTCACGTTCAGCTCGTGCCGGTAT

  1. Dicty_cDB: SSH880 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH880 (Link to dictyBase) - G02308 DDB0191109 Contig-U13429-1 SSH...880Z (Link to Original site) - - SSH880Z 601 - - - - Show SSH880 Library SS (Link to library) Clone ID SSH...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH8-D/SSH880Q.Seq.d/ ...Representative seq. ID SSH880Z (Link to Original site) Representative DNA sequence >SSH880 (SSH880Q) /CSM/SS/SSH8-D/SSH...hilf*if*lf*lvvl*qhvvfiy slmvysivlldlylvfiifwlvfvlysskssshkn**iflvfihiglvkvllfl*lvy*s leivdsf*qlvll*lplvlfv*f

  2. Dicty_cDB: SSH508 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH508 (Link to dictyBase) - - - - SSH508E (Link to Original site) - - - - - - SSH...508E 470 Show SSH508 Library SS (Link to library) Clone ID SSH508 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-A/SSH...508Q.Seq.d/ Representative seq. ID SSH508E (Link to Original site) R...epresentative DNA sequence >SSH508 (SSH508Q) /CSM/SS/SSH5-A/SSH508Q.Seq.d/ GTTTTTAAAAAATTTATAAAAATAAAAATTATT

  3. Dicty_cDB: SSH324 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH324 (Link to dictyBase) - - - Contig-U03732-1 SSH324Z (Link... to Original site) - - SSH324Z 644 - - - - Show SSH324 Library SS (Link to library) Clone ID SSH324 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-A/SSH324Q.Seq.d/ Representative seq. ID SSH32...4Z (Link to Original site) Representative DNA sequence >SSH324 (SSH324Q) /CSM/SS/SSH3-A/SSH324Q.Seq.d/ XXXXX...SQMNPMAYPDLQLPPVAE*ik****yntx x**npkkqqntilqpllhkxxkkkkikk*q*kkhqhkrihinvyspsshqq

  4. Dicty_cDB: SSH667 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH667 (Link to dictyBase) - - - Contig-U12865-1 SSH667Z (Link... to Original site) - - SSH667Z 358 - - - - Show SSH667 Library SS (Link to library) Clone ID SSH667 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-C/SSH667Q.Seq.d/ Representative seq. ID SSH66...7Z (Link to Original site) Representative DNA sequence >SSH667 (SSH667Q) /CSM/SS/SSH6-C/SSH667Q.Seq.d/ XXXXX...lkmnplivliqkqklvtklnqrlmplplviphqpllsmfcf*lhlll*lls f Frame C: ---tkfsshqrfkyr*q*

  5. Dicty_cDB: SSH893 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH893 (Link to dictyBase) - - - Contig-U16327-1 SSH893F (Link to Original site) SSH...893F 385 - - - - - - Show SSH893 Library SS (Link to library) Clone ID SSH893 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH8-D/SSH893Q.Seq.d/ Representative seq. ID SSH89...3F (Link to Original site) Representative DNA sequence >SSH893 (SSH893Q) /CSM/SS/SSH8-D/SSH893Q.Seq.d/ AAAAA...SLLTYANAYDYFTTTLANQNPVCASVDVI QNVCTEVCGRFVRYIPDATNTNQFTFAEYTTNQCTVQVTPAVTNTFTCADQTSSHALGSD WSGVCKI--- Transl

  6. Dicty_cDB: SSH429 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH429 (Link to dictyBase) - - - Contig-U14705-1 SSH429Z (Link... to Original site) - - SSH429Z 564 - - - - Show SSH429 Library SS (Link to library) Clone ID SSH429 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH4-B/SSH429Q.Seq.d/ Representative seq. ID SSH42...9Z (Link to Original site) Representative DNA sequence >SSH429 (SSH429Q) /CSM/SS/SSH4-B/SSH429Q.Seq.d/ XXXXX...qlsktmlw*hvlfnftk*pilfn*flwkhkclwsssim*wcslfhs**stfwl w*ifkslqkw*mc*spnl*cwsshvg*trcwyddy*citnylsrshwwiimwle

  7. Dicty_cDB: SSH447 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH447 (Link to dictyBase) - - - Contig-U13429-1 SSH447Z (Link... to Original site) - - SSH447Z 514 - - - - Show SSH447 Library SS (Link to library) Clone ID SSH447 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH4-B/SSH447Q.Seq.d/ Representative seq. ID SSH44...7Z (Link to Original site) Representative DNA sequence >SSH447 (SSH447Q) /CSM/SS/SSH4-B/SSH447Q.Seq.d/ XXXXX...-anqlhilf*if*lf*lvvl*qhvvfiyslmvysivlldlylvfiifwlvfvlyssks sshkn**iflvfihiglvkvllfl*lvy*sleivdsf*qlvll*lplvl

  8. Dicty_cDB: SSH326 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH326 (Link to dictyBase) - - - - SSH326E (Link to Original site) - - - - - - SSH...326E 545 Show SSH326 Library SS (Link to library) Clone ID SSH326 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-B/SSH...326Q.Seq.d/ Representative seq. ID SSH326E (Link to Original site) R...epresentative DNA sequence >SSH326 (SSH326Q) /CSM/SS/SSH3-B/SSH326Q.Seq.d/ AATTCAATTATAAACAACAAATTAAAAACTCAA

  9. Dicty_cDB: SSH791 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH791 (Link to dictyBase) - - - Contig-U03296-1 SSH791E (Link to Original site) SSH...791F 370 SSH791Z 306 SSH791P 676 SSH791E 504 Show SSH791 Library SS (Link to library) Clone ID SSH...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH7-D/SSH791Q.Seq.d/ Representative seq. ID SSH...791E (Link to Original site) Representative DNA sequence >SSH791 (SSH791Q) /CSM/SS/SSH7-D/SSH...lignments: (bits) Value SSL655 (SSL655Q) /CSM/SS/SSL6-C/SSL655Q.Seq.d/ 999 0.0 SSH791 (SSH

  10. Dicty_cDB: SSH770 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH770 (Link to dictyBase) - G21033 DDB0217014 Contig-U09425-1 SSH...770P (Link to Original site) SSH770F 255 SSH770Z 378 SSH770P 633 - - Show SSH770 Library SS (Link to library) Clone ID SSH...ontig-U09425-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH7-C/SSH...770Q.Seq.d/ Representative seq. ID SSH770P (Link to Original site) Representative DNA sequence >SSH770 (SSH770Q) /CSM/SS/SSH...vk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSH770 (SSH770Q) /CSM/SS/SSH7-C/SSH

  11. Dicty_cDB: SSH681 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH681 (Link to dictyBase) - G00800 DDB0189403 Contig-U09422-1 SSH...681P (Link to Original site) SSH681F 304 SSH681Z 355 SSH681P 659 - - Show SSH681 Library SS (Link to library) Clone ID SSH...ontig-U09422-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-D/SSH...681Q.Seq.d/ Representative seq. ID SSH681P (Link to Original site) Representative DNA sequence >SSH681 (SSH681Q) /CSM/SS/SSH...cing significant alignments: (bits) Value SSH681 (SSH681Q) /CSM/SS/SSH6-D/SSH681Q

  12. Dicty_cDB: SSH647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH647 (Link to dictyBase) - G00798 DDB0216578 Contig-U01803-1 SSH...647P (Link to Original site) SSH647F 323 SSH647Z 337 SSH647P 660 - - Show SSH647 Library SS (Link to library) Clone ID SSH...ontig-U01803-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-B/SSH...647Q.Seq.d/ Representative seq. ID SSH647P (Link to Original site) Representative DNA sequence >SSH647 (SSH647Q) /CSM/SS/SSH...cing significant alignments: (bits) Value SSH647 (SSH647Q) /CSM/SS/SSH6-B/SSH647Q

  13. Dicty_cDB: SSH344 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH344 (Link to dictyBase) - G02281 DDB0190364 Contig-U04680-1 SSH...344P (Link to Original site) SSH344F 378 SSH344Z 530 SSH344P 908 - - Show SSH344 Library SS (Link to library) Clone ID SSH...ontig-U04680-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-B/SSH...344Q.Seq.d/ Representative seq. ID SSH344P (Link to Original site) Representative DNA sequence >SSH344 (SSH344Q) /CSM/SS/SSH... significant alignments: (bits) Value SSH344 (SSH344Q) /CSM/SS/SSH3-B/SSH344Q.Seq.d/ 844 0.0 SSL102 (SSL102Q

  14. Dicty_cDB: SSH262 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH262 (Link to dictyBase) - G02279 DDB0232044 Contig-U10243-1 SSH...262P (Link to Original site) SSH262F 411 SSH262Z 346 SSH262P 757 - - Show SSH262 Library SS (Link to library) Clone ID SSH...ontig-U10243-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-C/SSH...262Q.Seq.d/ Representative seq. ID SSH262P (Link to Original site) Representative DNA sequence >SSH262 (SSH262Q) /CSM/SS/SSH...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSH262 (SSH262Q) /CSM/SS/SSH2-C/SSH

  15. Dicty_cDB: SSH842 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH842 (Link to dictyBase) - - - Contig-U16382-1 SSH842E (Link... to Original site) - - - - - - SSH842E 344 Show SSH842 Library SS (Link to library) Clone ID SSH842 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH8-B/SSH842Q.Seq.d/ Representative seq. ID SSH84...2E (Link to Original site) Representative DNA sequence >SSH842 (SSH842Q) /CSM/SS/SSH8-B/SSH842Q.Seq.d/ CACAT...alignments: (bits) Value SSH842 (SSH842Q) /CSM/SS/SSH8-B/SSH842Q.Seq.d/ 541 e-153 VSD831 (VSD831Q) /CSM/VS/V

  16. Dicty_cDB: SSH477 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH477 (Link to dictyBase) - G02285 DDB0167090 Contig-U05359-1 SSH...477F (Link to Original site) SSH477F 280 - - - - - - Show SSH477 Library SS (Link to library) Clone ID SSH...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH4-D/SSH477Q.Seq.d/ ...Representative seq. ID SSH477F (Link to Original site) Representative DNA sequence >SSH477 (SSH477Q) /CSM/SS/SSH4-D/SSH...ficant alignments: (bits) Value SSH477 (SSH477Q) /CSM/SS/SSH4-D/SSH477Q.Seq.d/ 133 2e-30 SSL641 (SSL641Q) /C

  17. Dicty_cDB: SSH783 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH783 (Link to dictyBase) - - - Contig-U16441-1 SSH783Z (Link... to Original site) - - SSH783Z 361 - - - - Show SSH783 Library SS (Link to library) Clone ID SSH783 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH7-D/SSH783Q.Seq.d/ Representative seq. ID SSH78...3Z (Link to Original site) Representative DNA sequence >SSH783 (SSH783Q) /CSM/SS/SSH7-D/SSH783Q.Seq.d/ XXXXX.../CSM/VS/VSA8-A/VSA811Q.Seq.d/ 664 0.0 SSH783 (SSH783Q) /CSM/SS/SSH7-D/SSH783Q.Seq

  18. Dicty_cDB: SSH351 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH351 (Link to dictyBase) - - - Contig-U01797-1 SSH351F (Link to Original site) SSH...351F 189 - - - - - - Show SSH351 Library SS (Link to library) Clone ID SSH351 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-C/SSH351Q.Seq.d/ Representative seq. ID SSH35...1F (Link to Original site) Representative DNA sequence >SSH351 (SSH351Q) /CSM/SS/SSH3-C/SSH351Q.Seq.d/ AAAAA... Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSH580 (SSH580Q) /CSM/SS/SSH5-D/SSH

  19. Dicty_cDB: SSH202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH202 (Link to dictyBase) - G21004 DDB0169430 Contig-U01777-1 SSH...202P (Link to Original site) SSH202F 307 SSH202Z 410 SSH202P 717 - - Show SSH202 Library SS (Link to library) Clone ID SSH...ontig-U01777-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-A/SSH...202Q.Seq.d/ Representative seq. ID SSH202P (Link to Original site) Representative DNA sequence >SSH202 (SSH202Q) /CSM/SS/SSH...kkkkkkkkkkke Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSH202 (SSH202Q) /CSM/SS/SSH

  20. Dicty_cDB: SSH543 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH543 (Link to dictyBase) - - - Contig-U05038-1 SSH543E (Link... to Original site) - - - - - - SSH543E 353 Show SSH543 Library SS (Link to library) Clone ID SSH543 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-B/SSH543Q.Seq.d/ Representative seq. ID SSH54...3E (Link to Original site) Representative DNA sequence >SSH543 (SSH543Q) /CSM/SS/SSH5-B/SSH543Q.Seq.d/ ATTTT...roducing significant alignments: (bits) Value SSH543 (SSH543Q) /CSM/SS/SSH5-B/SSH543Q.Seq.d/ 349 2e-95 SSE66

  1. Dicty_cDB: SSH342 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH342 (Link to dictyBase) - - - Contig-U10784-1 SSH342F (Link to Original site) SSH...342F 339 - - - - - - Show SSH342 Library SS (Link to library) Clone ID SSH342 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-B/SSH342Q.Seq.d/ Representative seq. ID SSH34...2F (Link to Original site) Representative DNA sequence >SSH342 (SSH342Q) /CSM/SS/SSH3-B/SSH342Q.Seq.d/ CAAAA...nificant alignments: (bits) Value SSH342 (SSH342Q) /CSM/SS/SSH3-B/SSH342Q.Seq.d/ 672 0.0 SLE452 (SLE452Q) /C

  2. Dicty_cDB: SSH859 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH859 (Link to dictyBase) - - - Contig-U16289-1 SSH859Z (Link... to Original site) - - SSH859Z 469 - - - - Show SSH859 Library SS (Link to library) Clone ID SSH859 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH8-C/SSH859Q.Seq.d/ Representative seq. ID SSH85...9Z (Link to Original site) Representative DNA sequence >SSH859 (SSH859Q) /CSM/SS/SSH8-C/SSH859Q.Seq.d/ XXXXX...-A/SSI621Q.Seq.d/ 609 e-173 SSI264 (SSI264Q) /CSM/SS/SSI2-C/SSI264Q.Seq.d/ 609 e-173 SSH859 (SSH859Q) /CSM/SS/SSH8-C/SSH

  3. Dicty_cDB: SSH123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH123 (Link to dictyBase) ssh123 G01233 DDB0217220 Contig-U01...Library SS (Link to library) Clone ID SSH123 (Link to dictyBase) Atlas ID ssh123 NBRP ID G01233 dictyBase ID...765-1 | Contig-U16448-1 SSH123P (Link to Original site) SSH123F 377 SSH123Z 186 SSH123P 563 - - Show SSH123 ...tp://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH1-A/SSH123Q.Seq.d/ Representative seq. ID SSH123P (Link to Origin...al site) Representative DNA sequence >SSH123 (SSH123Q) /CSM/SS/SSH1-A/SSH123Q.Seq.d/ TTTTTTTTTTAAAATTTTTCTTT

  4. Dicty_cDB: SSH895 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH895 (Link to dictyBase) - - - Contig-U07719-1 SSH895Z (Link... to Original site) - - SSH895Z 590 - - - - Show SSH895 Library SS (Link to library) Clone ID SSH895 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH8-D/SSH895Q.Seq.d/ Representative seq. ID SSH89...5Z (Link to Original site) Representative DNA sequence >SSH895 (SSH895Q) /CSM/SS/SSH8-D/SSH895Q.Seq.d/ XXXXX...) /CSM/SS/SSI4-C/SSI455Q.Seq.d/ 1059 0.0 SSH895 (SSH895Q) /CSM/SS/SSH8-D/SSH895Q.Seq.d/ 1059 0.0 SSE774 (SSE

  5. Dicty_cDB: SSH279 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH279 (Link to dictyBase) - - - Contig-U10253-1 SSH279E (Link... to Original site) - - - - - - SSH279E 427 Show SSH279 Library SS (Link to library) Clone ID SSH279 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-D/SSH279Q.Seq.d/ Representative seq. ID SSH27...9E (Link to Original site) Representative DNA sequence >SSH279 (SSH279Q) /CSM/SS/SSH2-D/SSH279Q.Seq.d/ CATAA...SS/SSI1-C/SSI155Q.Seq.d/ 349 2e-95 SSH279 (SSH279Q) /CSM/SS/SSH2-D/SSH279Q.Seq.d/ 349 2e-95 own update 2002.

  6. Dicty_cDB: SSH814 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH814 (Link to dictyBase) - - - Contig-U13888-1 SSH814Z (Link... to Original site) - - SSH814Z 529 - - - - Show SSH814 Library SS (Link to library) Clone ID SSH814 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH8-A/SSH814Q.Seq.d/ Representative seq. ID SSH81...4Z (Link to Original site) Representative DNA sequence >SSH814 (SSH814Q) /CSM/SS/SSH8-A/SSH814Q.Seq.d/ XXXXX...M681 (SSM681Q) /CSM/SS/SSM6-D/SSM681Q.Seq.d/ 993 0.0 SSH814 (SSH814Q) /CSM/SS/SSH8-A/SSH814Q.Seq.d/ 993 0.0

  7. Dicty_cDB: SSH196 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH196 (Link to dictyBase) - - - Contig-U03803-1 SSH196Z (Link... to Original site) - - SSH196Z 554 - - - - Show SSH196 Library SS (Link to library) Clone ID SSH196 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH1-D/SSH196Q.Seq.d/ Representative seq. ID SSH19...6Z (Link to Original site) Representative DNA sequence >SSH196 (SSH196Q) /CSM/SS/SSH1-D/SSH196Q.Seq.d/ XXXXX...re E Sequences producing significant alignments: (bits) Value SSH196 (SSH196Q) /CSM/SS/SSH1-D/SSH196Q.Seq.d/

  8. Dicty_cDB: SSH732 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH732 (Link to dictyBase) - - - Contig-U12272-1 SSH732F (Link to Original site) SSH...732F 336 - - - - - - Show SSH732 Library SS (Link to library) Clone ID SSH732 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH7-B/SSH732Q.Seq.d/ Representative seq. ID SSH73...2F (Link to Original site) Representative DNA sequence >SSH732 (SSH732Q) /CSM/SS/SSH7-B/SSH732Q.Seq.d/ AAAAA...t alignments: (bits) Value SSL833 (SSL833Q) /CSM/SS/SSL8-B/SSL833Q.Seq.d/ 402 e-111 SSH732 (SSH732Q) /CSM/SS/SSH7-B/SSH

  9. Dicty_cDB: SSH726 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH726 (Link to dictyBase) - - - Contig-U15185-1 SSH726E (Link to Original site) SSH...726F 290 SSH726Z 187 SSH726P 477 SSH726E 365 Show SSH726 Library SS (Link to library) Clone ID SSH...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH7-B/SSH726Q.Seq.d/ Representative seq. ID SSH...726E (Link to Original site) Representative DNA sequence >SSH726 (SSH726Q) /CSM/SS/SSH7-B/SSH...%: mitochondrial 28.0 %: cytoplasmic 20.0 %: nuclear 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for SSH

  10. Dicty_cDB: SSH403 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH403 (Link to dictyBase) - - - Contig-U04637-1 SSH403Z (Link... to Original site) - - SSH403Z 563 - - - - Show SSH403 Library SS (Link to library) Clone ID SSH403 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH4-A/SSH403Q.Seq.d/ Representative seq. ID SSH40...3Z (Link to Original site) Representative DNA sequence >SSH403 (SSH403Q) /CSM/SS/SSH4-A/SSH403Q.Seq.d/ XXXXX...SSJ8-C/SSJ869Q.Seq.d/ 912 0.0 SSH403 (SSH403Q) /CSM/SS/SSH4-A/SSH403Q.Seq.d/ 912 0.0 SSG441 (SSG441Q) /CSM/S

  11. Dicty_cDB: SSH260 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH260 (Link to dictyBase) - - - Contig-U15823-1 SSH260Z (Link... to Original site) - - SSH260Z 561 - - - - Show SSH260 Library SS (Link to library) Clone ID SSH260 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-C/SSH260Q.Seq.d/ Representative seq. ID SSH26...0Z (Link to Original site) Representative DNA sequence >SSH260 (SSH260Q) /CSM/SS/SSH2-C/SSH260Q.Seq.d/ XXXXX.../VFF3-C/VFF363Q.Seq.d/ 361 8e-99 SSL121 (SSL121Q) /CSM/SS/SSL1-A/SSL121Q.Seq.d/ 361 8e-99 SSH260 (SSH260Q) /CSM/SS/SSH2-C/SSH

  12. Dicty_cDB: SSH128 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH128 (Link to dictyBase) - G21001 DDB0201637 Contig-U04054-1 SSH...128Z (Link to Original site) - - SSH128Z 620 - - - - Show SSH128 Library SS (Link to library) Clone ID SSH...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH1-B/SSH128Q.Seq.d/ ...Representative seq. ID SSH128Z (Link to Original site) Representative DNA sequence >SSH128 (SSH128Q) /CSM/SS/SSH1-B/SSH...ant alignments: (bits) Value SSH128 (SSH128Q) /CSM/SS/SSH1-B/SSH128Q.Seq.d/ 1207 0.0 SLE645 (SLE645Q) /CSM/S

  13. Dicty_cDB: SSH433 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH433 (Link to dictyBase) - - - Contig-U15600-1 SSH433F (Link to Original site) SSH...433F 336 - - - - - - Show SSH433 Library SS (Link to library) Clone ID SSH433 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH4-B/SSH433Q.Seq.d/ Representative seq. ID SSH43...3F (Link to Original site) Representative DNA sequence >SSH433 (SSH433Q) /CSM/SS/SSH4-B/SSH433Q.Seq.d/ AAATT...t alignments: (bits) Value SSH433 (SSH433Q) /CSM/SS/SSH4-B/SSH433Q.Seq.d/ 297 6e-80 SSF237 (SSF237Q) /CSM/SS

  14. Dicty_cDB: SSH518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH518 (Link to dictyBase) - - - Contig-U16252-1 SSH518E (Link... to Original site) - - - - - - SSH518E 456 Show SSH518 Library SS (Link to library) Clone ID SSH518 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-A/SSH518Q.Seq.d/ Representative seq. ID SSH51...8E (Link to Original site) Representative DNA sequence >SSH518 (SSH518Q) /CSM/SS/SSH5-A/SSH518Q.Seq.d/ AAAGA...-B/SSI448Q.Seq.d/ 672 0.0 SSH518 (SSH518Q) /CSM/SS/SSH5-A/SSH518Q.Seq.d/ 672 0.0 SLF154 (SLF154Q) /CSM/SL/SL

  15. Dicty_cDB: SSH619 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH619 (Link to dictyBase) - - - Contig-U04437-1 SSH619Z (Link... to Original site) - - SSH619Z 611 - - - - Show SSH619 Library SS (Link to library) Clone ID SSH619 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-A/SSH619Q.Seq.d/ Representative seq. ID SSH61...9Z (Link to Original site) Representative DNA sequence >SSH619 (SSH619Q) /CSM/SS/SSH6-A/SSH619Q.Seq.d/ XXXXX... Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSH619 (SSH619Q) /CSM/SS/SSH6-A/SSH

  16. Dicty_cDB: SSH436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH436 (Link to dictyBase) - - - Contig-U12201-1 SSH436Z (Link... to Original site) - - SSH436Z 551 - - - - Show SSH436 Library SS (Link to library) Clone ID SSH436 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH4-B/SSH436Q.Seq.d/ Representative seq. ID SSH43...6Z (Link to Original site) Representative DNA sequence >SSH436 (SSH436Q) /CSM/SS/SSH4-B/SSH436Q.Seq.d/ XXXXX...0.0 SSL223 (SSL223Q) /CSM/SS/SSL2-A/SSL223Q.Seq.d/ 694 0.0 SSH436 (SSH436Q) /CSM/SS/SSH4-B/SSH436Q.Seq.d/ 69

  17. Dicty_cDB: SSH176 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH176 (Link to dictyBase) - - - Contig-U09430-1 SSH176E (Link... to Original site) - - - - - - SSH176E 415 Show SSH176 Library SS (Link to library) Clone ID SSH176 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH1-D/SSH176Q.Seq.d/ Representative seq. ID SSH17...6E (Link to Original site) Representative DNA sequence >SSH176 (SSH176Q) /CSM/SS/SSH1-D/SSH176Q.Seq.d/ AAACT...) /CSM/SS/SSI3-C/SSI361Q.Seq.d/ 692 0.0 SSH176 (SSH176Q) /CSM/SS/SSH1-D/SSH176Q.Seq.d/ 692 0.0 SSF336 (SSF33

  18. Dicty_cDB: SSH602 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH602 (Link to dictyBase) - - - Contig-U13413-1 SSH602F (Link to Original site) SSH...602F 311 - - - - - - Show SSH602 Library SS (Link to library) Clone ID SSH602 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-A/SSH602Q.Seq.d/ Representative seq. ID SSH60...2F (Link to Original site) Representative DNA sequence >SSH602 (SSH602Q) /CSM/SS/SSH6-A/SSH602Q.Seq.d/ CTTGT...SI2-C/SSI258Q.Seq.d/ 527 e-149 SSH602 (SSH602Q) /CSM/SS/SSH6-A/SSH602Q.Seq.d/ 527

  19. Dicty_cDB: SSH479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH479 (Link to dictyBase) - - - Contig-U11350-1 SSH479Z (Link... to Original site) - - SSH479Z 544 - - - - Show SSH479 Library SS (Link to library) Clone ID SSH479 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH4-D/SSH479Q.Seq.d/ Representative seq. ID SSH47...9Z (Link to Original site) Representative DNA sequence >SSH479 (SSH479Q) /CSM/SS/SSH4-D/SSH479Q.Seq.d/ XXXXX...g significant alignments: (bits) Value SSH479 (SSH479Q) /CSM/SS/SSH4-D/SSH479Q.Seq.d/ 1078 0.0 SSE215 (SSE21

  20. Dicty_cDB: SSH861 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH861 (Link to dictyBase) - - - Contig-U10970-1 SSH861Z (Link... to Original site) - - SSH861Z 570 - - - - Show SSH861 Library SS (Link to library) Clone ID SSH861 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH8-C/SSH861Q.Seq.d/ Representative seq. ID SSH86...1Z (Link to Original site) Representative DNA sequence >SSH861 (SSH861Q) /CSM/SS/SSH8-C/SSH861Q.Seq.d/ XXXXX.../VFD762Q.Seq.d/ 876 0.0 VFB810 (VFB810Q) /CSM/VF/VFB8-A/VFB810Q.Seq.d/ 876 0.0 SSH861 (SSH861Q) /CSM/SS/SSH8-C/SSH

  1. Dicty_cDB: SSH218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH218 (Link to dictyBase) - G21005 DDB0185803 Contig-U05324-1 SSH...218E (Link to Original site) - - - - - - SSH218E 360 Show SSH218 Library SS (Link to library) Clone ID SSH...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-A/SSH218Q.Seq.d/ ...Representative seq. ID SSH218E (Link to Original site) Representative DNA sequence >SSH218 (SSH218Q) /CSM/SS/SSH2-A/SSH...fvf Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSH218 (SSH218Q) /CSM/SS/SSH2-A/SSH

  2. Dicty_cDB: SSH704 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH704 (Link to dictyBase) ssh704 - - - SSH704P (Link to Original site) SSH704F 228 SSH...704Z 260 SSH704P 488 - - Show SSH704 Library SS (Link to library) Clone ID SSH704 (...Link to dictyBase) Atlas ID ssh704 NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictyc...db.biol.tsukuba.ac.jp/CSM/SS/SSH7-A/SSH704Q.Seq.d/ Representative seq. ID SSH704P... (Link to Original site) Representative DNA sequence >SSH704 (SSH704Q) /CSM/SS/SSH7-A/SSH704Q.Seq.d/ GGTGGTT

  3. Dicty_cDB: SSH153 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH153 (Link to dictyBase) - - - Contig-U16354-1 SSH153E (Link... to Original site) - - - - - - SSH153E 615 Show SSH153 Library SS (Link to library) Clone ID SSH153 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH1-C/SSH153Q.Seq.d/ Representative seq. ID SSH15...3E (Link to Original site) Representative DNA sequence >SSH153 (SSH153Q) /CSM/SS/SSH1-C/SSH153Q.Seq.d/ ATTAA...7-B/SSK729Q.Seq.d/ 1106 0.0 SSH153 (SSH153Q) /CSM/SS/SSH1-C/SSH153Q.Seq.d/ 1106 0

  4. Dicty_cDB: SSH831 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH831 (Link to dictyBase) - G02304 DDB0231410 Contig-U13894-1 SSH...831Z (Link to Original site) - - SSH831Z 574 - - - - Show SSH831 Library SS (Link to library) Clone ID SSH...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH8-B/SSH831Q.Seq.d/ ...Representative seq. ID SSH831Z (Link to Original site) Representative DNA sequence >SSH831 (SSH831Q) /CSM/SS/SSH8-B/SSH...nt alignments: (bits) Value SSH831 (SSH831Q) /CSM/SS/SSH8-B/SSH831Q.Seq.d/ 954 0.0 AFO821 (AFO821Q) /CSM/AF/

  5. Dicty_cDB: SSH618 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH618 (Link to dictyBase) - - - Contig-U15932-1 SSH618Z (Link... to Original site) - - SSH618Z 371 - - - - Show SSH618 Library SS (Link to library) Clone ID SSH618 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-A/SSH618Q.Seq.d/ Representative seq. ID SSH61...8Z (Link to Original site) Representative DNA sequence >SSH618 (SSH618Q) /CSM/SS/SSH6-A/SSH618Q.Seq.d/ XXXXX...CSM/SS/SSK1-A/SSK110Q.Seq.d/ 638 0.0 SSI103 (SSI103Q) /CSM/SS/SSI1-A/SSI103Q.Seq.d/ 638 0.0 SSH618 (SSH618Q) /CSM/SS/SSH6-A/SSH

  6. Dicty_cDB: SSH220 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH220 (Link to dictyBase) - - - Contig-U16394-1 SSH220E (Link... to Original site) - - - - - - SSH220E 277 Show SSH220 Library SS (Link to library) Clone ID SSH220 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-A/SSH220Q.Seq.d/ Representative seq. ID SSH22...0E (Link to Original site) Representative DNA sequence >SSH220 (SSH220Q) /CSM/SS/SSH2-A/SSH220Q.Seq.d/ ATTTA...Sequences producing significant alignments: (bits) Value SSH220 (SSH220Q) /CSM/SS/SSH2-A/SSH

  7. Dicty_cDB: SSH309 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH309 (Link to dictyBase) - - - Contig-U16603-1 SSH309Z (Link... to Original site) - - SSH309Z 633 - - - - Show SSH309 Library SS (Link to library) Clone ID SSH309 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-A/SSH309Q.Seq.d/ Representative seq. ID SSH30...9Z (Link to Original site) Representative DNA sequence >SSH309 (SSH309Q) /CSM/SS/SSH3-A/SSH309Q.Seq.d/ XXXXX.../SS/SSK7-C/SSK766Q.Seq.d/ 1122 0.0 SSH309 (SSH309Q) /CSM/SS/SSH3-A/SSH309Q.Seq.d/

  8. Dicty_cDB: SSH751 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH751 (Link to dictyBase) - - - Contig-U01248-1 SSH751Z (Link... to Original site) - - SSH751Z 323 - - - - Show SSH751 Library SS (Link to library) Clone ID SSH751 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH7-C/SSH751Q.Seq.d/ Representative seq. ID SSH75...1Z (Link to Original site) Representative DNA sequence >SSH751 (SSH751Q) /CSM/SS/SSH7-C/SSH751Q.Seq.d/ XXXXX...188 (SSM188Q) /CSM/SS/SSM1-D/SSM188Q.Seq.d/ 472 e-132 SSH751 (SSH751Q) /CSM/SS/SSH7-C/SSH751Q.Seq.d/ 472 e-1

  9. Efficacy of SSH PCR in isolating differentially expressed genes

    Directory of Open Access Journals (Sweden)

    Cai Li

    2002-05-01

    Full Text Available Abstract Background Suppression Subtractive Hybridization PCR (SSH PCR is a sophisticated cDNA subtraction method to enrich and isolate differentially expressed genes. Despite its popularity, the method has not been thoroughly studied for its practical efficacy and potential limitations. Results To determine the factors that influence the efficacy of SSH PCR, a theoretical model, under the assumption that cDNA hybridization follows the ideal second kinetic order, is proposed. The theoretical model suggests that the critical factor influencing the efficacy of SSH PCR is the concentration ratio (R of a target gene between two cDNA preparations. It preferentially enriches "all or nothing" differentially expressed genes, of which R is infinite, and strongly favors the genes with large R. The theoretical predictions were validated by our experiments. In addition, the experiments revealed some practical limitations that are not obvious from the theoretical model. For effective enrichment of differentially expressed genes, it requires fractional concentration of a target gene to be more than 0.01% and concentration ratio to be more than 5 folds between two cDNA preparations. Conclusion Our research demonstrated theoretical and practical limitations of SSH PCR, which could be useful for its experimental design and interpretation.

  10. Isolation of genes involved in the preventive effect of electroacupuncture at Fenglong acupoint (ST40) on hypercholesterolemia mice by suppression subtractive hybridization (SSH) combined with negative subtraction chain (NSC) technology.

    Science.gov (United States)

    Li, Xingjie; Zhang, Yizheng; Yan, Wenqi; Kang, Jinmei; Kang, Yaoxia; Lie, Min

    2006-01-01

    We have shown that electroacupuncture (EA) at Fenglong acupoint (ST40) has the cholesterol-lowering effect in hypercholesterolemia mice. The present study was designed to study preventive effect of EA at ST40 on hypercholesterolemia. C57BL/6j mice were randomly divided into normal group (NG), hypercholesterolemia group (HG) and EA prevention group (EPG). NG were fed chow, HG a hypercholesterolemic diet (HD), and EPG the same HD and received EA treatment simultaneously. Lipid profile of both the plasma and liver indicated that EA at ST40 had preventive effect on hypercholesterolemia. Compared with corresponding values in the HG mice, the levels of the hepatic total cholesterol and total triglyceride in the EPG mice lowered 45% and 23% respectively, and the levels of plasma total-, LDL-, and HDL-cholesterol in the EPG mice lowered 39%, 37% and 39% respectively. Eleven genes whose expressions were up-regulated in EPG mice compared with HG were isolated using suppression subtractive hybridization (SSH) combined with negative subtraction chain (NSC) technology, and then confirmed by dot-blot assay. Except two genes whose functions were still unknown, the others were mainly involved in cholesterol metabolism, lipid metabolism, glucose metabolism and immune response. The potential molecular mechanism of preventive effect was discussed.

  11. Dicty_cDB: SSH876 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH876 (Link to dictyBase) - - - Contig-U14096-1 SSH876Z (Link... to Original site) - - SSH876Z 603 - - - - Show SSH876 Library SS (Link to library) Clone ID SSH876 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH8-D/SSH876Q.Seq.d/ Representative seq. ID SSH87...6Z (Link to Original site) Representative DNA sequence >SSH876 (SSH876Q) /CSM/SS/SSH8-D/SSH876Q.Seq.d/ XXXXX...1Q.Seq.d/ 658 0.0 SSK159 (SSK159Q) /CSM/SS/SSK1-C/SSK159Q.Seq.d/ 658 0.0 SSH876 (SSH876Q) /CSM/SS/SSH

  12. Dicty_cDB: SSH724 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH724 (Link to dictyBase) - - - Contig-U04708-1 SSH724Z (Link... to Original site) - - SSH724Z 323 - - - - Show SSH724 Library SS (Link to library) Clone ID SSH724 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH7-A/SSH724Q.Seq.d/ Representative seq. ID SSH72...4Z (Link to Original site) Representative DNA sequence >SSH724 (SSH724Q) /CSM/SS/SSH7-A/SSH724Q.Seq.d/ XXXXX...) /CSM/SS/SSK5-C/SSK552Q.Seq.d/ 182 2e-45 SSJ422 (SSJ422Q) /CSM/SS/SSJ4-A/SSJ422Q.Seq.d/ 182 2e-45 SSH724 (SSH724Q) /CSM/SS/SSH

  13. Dicty_cDB: SSH847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH847 (Link to dictyBase) - - - Contig-U01248-1 SSH847E (Link to Original site) SSH...847F 283 SSH847Z 610 SSH847P 893 SSH847E 791 Show SSH847 Library SS (Link to library) Clone ID SSH...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH8-B/SSH847Q.Seq.d/ Representative seq. ID SSH...847E (Link to Original site) Representative DNA sequence >SSH847 (SSH847Q) /CSM/SS/SSH8-B/SSH...ames) Frame A: kkkkklknflkifpkpcrfffhikilflhs*f*syqnikngssss*mlqilqkqtihqi* ilsctrc*nqnfrfrs*esin**ipimcsshl

  14. Dicty_cDB: SSH381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH381 (Link to dictyBase) - - - Contig-U12167-1 SSH381E (Link to Original site) SSH...381F 299 SSH381Z 440 SSH381P 739 SSH381E 693 Show SSH381 Library SS (Link to library) Clone ID SSH...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-D/SSH381Q.Seq.d/ Representative seq. ID SSH...381E (Link to Original site) Representative DNA sequence >SSH381 (SSH381Q) /CSM/SS/SSH3-D/SSH...vttqnvklfstq*thyvqlpgfqnglnkkplisshqt efkyii*iinssinnlfkkkekkknimi*ikkmenfkkikkkkkkkkkkk Homology vs CSM-cDN

  15. Suppression subtractive hybridization (SSH)-based method for estimating Cd-induced differences in gene expression at cultivar level and identification of genes induced by Cd in two water spinach cultivars.

    Science.gov (United States)

    Huang, Baifei; Xin, Junliang; Yang, Zhongyi; Zhou, Yihui; Yuan, Jiangang; Gong, Yulian

    2009-10-14

    The abilities to accumulate cadmium (Cd) are different among cultivars (cv.) in many species. The characteristic of Cd concentration among cultivars is heritable and is probably controlled by genes, but rather limited information about the relevant genes in vegetable crops has been published. In the present study, a suppression subtractive hybridization (SSH) approach was used to identify genes induced by Cd in two water spinach (an important vegetable in southern China) cultivars that differ in Cd accumulation in their edible parts. The two cultivars were cv. Qiangkunqinggu (QK), a low Cd accumulative cultivar and cv. Taiwan 308 (TW), a high Cd accumulative cultivar. In the construction of QK and TW libraries, the plants without Cd treatment were taken as drivers and the plants exposed to 6 mg L(-1) Cd for 24 h as testers. Four hundred clones were sequenced, and 164 nonrepeated sequences (112 from the QK library and 52 from the TW library) were assigned to being functional genes or proteins. A tremendous difference in Cd-induced gene expressions between the two libraries was observed. In the QK library, genes implicated in disease/defense comprised one of the largest sets (20.6%), whereas the proportion was only 8.8% in the TW library. An MT3 gene (Q5), a wound inductive gene (Q22), an antioxidation relevant gene (Q34), a lectin gene (Q45), an f-box family protein gene (Q319), a 20S proteasome subunit gene (T17), a multidrug resistance associated protein gene (T156), and a cationic amino acid transporter gene (T218) were selected to compare semiquantitatively their expression between cv. QK and cv. TW using the RT-PCR method, and obvious differences were detected. The relationships between the identified differences in the expressions of the genes and the Cd accumulation of the two cultivars were discussed, and it was concluded that the SSH approach is useful for finding the difference in expression of Cd-induced gene even at the cultivar level and is applicable

  16. Technique for Measuring Hybrid Electronic Component Reliability

    Energy Technology Data Exchange (ETDEWEB)

    Green, C.C.; Hernandez, C.L.; Hosking, F.M.; Robinson, D.; Rutherford, B.; Uribe, F.

    1999-01-01

    Materials compatibility studies of aged, engineered materials and hardware are critical to understanding and predicting component reliability, particularly for systems with extended stockpile life requirements. Nondestructive testing capabilities for component reliability would significantly enhance lifetime predictions. For example, if the detection of crack propagation through a solder joint can be demonstrated, this technique could be used to develop baseline information to statistically determine solder joint lifelengths. This report will investigate high frequency signal response techniques for nondestructively evaluating the electrical behavior of thick film hybrid transmission lines.

  17. Identification of flowering-related genes between early flowering trifoliate orange mutant and wild-type trifoliate orange (Poncirus trifoliata L. Raf.) by suppression subtraction hybridization (SSH) and macroarray.

    Science.gov (United States)

    Zhang, Jin-Zhi; Li, Zhi-Min; Yao, Jia-Ling; Hu, Chun-Gen

    2009-02-01

    To gain a better understanding of gene expression in early flowering trifoliate orange mutant (precocious trifoliate orange, Poncirus trifoliata L. Raf.), we performed suppression subtractive hybridization, which allowed identification of flowering-related genes in the mutant and the wild type in the juvenile phase. Using macroarray analysis, we identified 125 and 149 non-redundant expressed sequence tags (ESTs) in the forward-subtracted and the reverse-subtracted library. These cDNAs covered a broad repertoire of flowering development related genes, provided helpful information for understanding genetic mechanism underlying the signaling and regulation in transition from the vegetative to reproductive phase. We have investigated the temporal and spatial expression pattern of some SSH-enriched flowering-related genes in the mutant and the wild type. Of these genes, three genes (BARELY ANY MERITED, FLOWERING LOCUS T and TERMINAL FLOWER1) encoding proteins previously reported to be associated with, or involved in, developmental processes in other species were identified and further investigated by in situ hybridization. Specific spatial and/or temporal patterns were detected, and differences were observed between the mutant and the wild type during flower development. Meanwhile, the temporal expression of these genes was further examined by real-time PCR, the results showed that FT and BAM transcripts accumulated to higher levels and TFL1 transcripts accumulated to lower levels in mutant juvenile tissues relative to wild-type juvenile tissues. In the adult stage, FT, BAM and TFL1 expression patterns were closely correlated with flowering development, suggesting that these three genes may play a critical role in the early flowering process of precocious trifoliate orange.

  18. Construction and analysis of SSH cDNA library of human vascular endothelial cells related to gastrocarcinoma

    Institute of Scientific and Technical Information of China (English)

    Yong-Bo Liu; Zhao-Xia Wei; Li Li; Hang-Sheng Li; Hui Chen; Xiao-Wen Li

    2003-01-01

    AIM: To construct subtracted cDNA libraries of human vascular endothelial cells (VECs) related to gastrocarcinoma using suppression substractive hybridization (SSH) and to analyze cDNA libraries of gastrocarcinoma and VECs in Cancer Gene Anatomy Project (CGAP) database.METHODS: Human VECs related to gastric adenocarcinoma and corresponding normal tissue were separated by magnetic beads coupled with antibody CD31 (Dynabeads CD31). A few amount of total RNA were synthesized and amplified by SMARTTM PCR cDNA Synthesis Kit. Then, using SSH and T/A cloning techniques, cDNA fragments of differentially expressed genes in human VECs of gastric adenocarcinoma were inserted into JM109 bacteria. One hundred positive bacteria clones were randomly picked and identified by colony PCR method. To analyze cDNA libraries of gastrocarcinoma and VECs in CGAP database, the tools of Library Finder,cDNA xProfiler, Digital GENE Expression Displayer (DGED),and Digital Differential Display (DDD) were used.RESULTS: Forward and reverse subtraction cDNA libraries of human VECs related to gastrocarcinoma were constructed successfully with SSH and T/A cloning techniques. Analysis of CGAP database indicated that no appropriate library of VECs related to carcinoma was constructed.CONCLUSION: Construction of subtraction cDNA libraries of human VECs related to gastrocarcinoma was successful and necessary, which laid a foundation for screening and cloning new and specific genes of VECs related to gastrocardnoma.

  19. Growth hormone regulation of rat liver gene expression assessed by SSH and microarray.

    Science.gov (United States)

    Gardmo, Cissi; Swerdlow, Harold; Mode, Agneta

    2002-04-25

    The sexually dimorphic secretion of growth hormone (GH) that prevails in the rat leads to a sex-differentiated expression of GH target genes, particularly in the liver. We have used subtractive suppressive hybridization (SSH) to search for new target genes induced by the female-characteristic, near continuous, pattern of GH secretion. Microarrays and dot-blot hybridizations were used in an attempt to confirm differential ratios of expression of obtained SSH clones. Out of 173 unique SSH clones, 41 could be verified as differentially expressed. Among these, we identified 17 known genes not previously recognized as differentially regulated by the sex-specific GH pattern. Additional SSH clones may also represent genes subjected to sex-specific GH regulation since only transcripts abundantly expressed could be verified. Optimized analyses, specific for each gene, are required to fully characterize the degree of differential expression.

  20. Dicty_cDB: SSH606 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH606 (Link to dictyBase) ssh606 - - Contig-U14087-1 SSH606Z ...(Link to Original site) - - SSH606Z 590 - - - - Show SSH606 Library SS (Link to library) Clone ID SSH606 (Li...nk to dictyBase) Atlas ID ssh606 NBRP ID - dictyBase ID - Link to Contig Contig-U14087-1 Original site URL h...ttp://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-A/SSH606Q.Seq.d/ Representative seq. ID SSH...606Z (Link to Original site) Representative DNA sequence >SSH606 (SSH606Q) /CSM/SS/SSH6-A/SSH606Q.Se

  1. Dicty_cDB: SSH359 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH359 (Link to dictyBase) - G21014 DDB0231845 Contig-U12241-1 SSH...359P (Link to Original site) SSH359F 432 SSH359Z 645 SSH359P 1077 - - Show SSH359 Library SS (Link to library) Clone ID SSH...Contig-U12241-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-C/SSH...359Q.Seq.d/ Representative seq. ID SSH359P (Link to Original site) Representative DNA sequence >SSH359 (SSH359Q) /CSM/SS/SSH...3-C/SSH359Q.Seq.d/ ATTCAATAAATAATCATGATATTGAAATTAAAAATCCAGAAAATAATAAAAATTATAATA ATATTAA

  2. Dicty_cDB: SSH823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH823 (Link to dictyBase) ssh823 - - Contig-U04575-1 SSH823F ...(Link to Original site) SSH823F 185 - - - - - - Show SSH823 Library SS (Link to library) Clone ID SSH823 (Li...nk to dictyBase) Atlas ID ssh823 NBRP ID - dictyBase ID - Link to Contig Contig-U04575-1 Original site URL h...ttp://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH8-A/SSH823Q.Seq.d/ Representative seq. ID SSH...823F (Link to Original site) Representative DNA sequence >SSH823 (SSH823Q) /CSM/SS/SSH8-A/SSH823Q.Se

  3. Dicty_cDB: SSH536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH536 (Link to dictyBase) - - - Contig-U01795-1 | Contig-U16069-1 SSH...536P (Link to Original site) SSH536F 335 SSH536Z 129 SSH536P 464 - - Show SSH536 Library SS (Link to library) Clone ID SSH...95-1 | Contig-U16069-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-B/SSH...536Q.Seq.d/ Representative seq. ID SSH536P (Link to Original site) Representative DNA sequence >SSH536 (SSH...536Q) /CSM/SS/SSH5-B/SSH536Q.Seq.d/ ACCAATTCATAACTCTTTACAAAATATTTTTAAAAATGCAAATAGGTCAAATTTAAATAA

  4. Dicty_cDB: SSH288 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH288 (Link to dictyBase) - - - Contig-U13975-1 SSH288Z (Link... to Original site) - - SSH288Z 574 - - - - Show SSH288 Library SS (Link to library) Clone ID SSH288 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-D/SSH288Q.Seq.d/ Representative seq. ID SSH28...8Z (Link to Original site) Representative DNA sequence >SSH288 (SSH288Q) /CSM/SS/SSH2-D/SSH288Q.Seq.d/ XXXXX...0 SSI764 (SSI764Q) /CSM/SS/SSI7-C/SSI764Q.Seq.d/ 767 0.0 SSI633 (SSI633Q) /CSM/SS/SSI6-B/SSI633Q.Seq.d/ 767 0.0 SSH448 (SSH

  5. Dicty_cDB: SSH663 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH663 (Link to dictyBase) - - - Contig-U01805-1 | Contig-U11005-1 SSH...663P (Link to Original site) SSH663F 221 SSH663Z 245 SSH663P 466 - - Show SSH663 Library SS (Link to library) Clone ID SSH...05-1 | Contig-U11005-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-C/SSH...663Q.Seq.d/ Representative seq. ID SSH663P (Link to Original site) Representative DNA sequence >SSH663 (SSH...663Q) /CSM/SS/SSH6-C/SSH663Q.Seq.d/ ACATACTTATATAAAAGTACATATAAGTAAATTTATTATATGTTAAAACATATTATTTAT

  6. Dicty_cDB: SSH475 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH475 (Link to dictyBase) ssh475 - - Contig-U12274-1 SSH475F ...(Link to Original site) SSH475F 187 - - - - - - Show SSH475 Library SS (Link to library) Clone ID SSH475 (Li...nk to dictyBase) Atlas ID ssh475 NBRP ID - dictyBase ID - Link to Contig Contig-U12274-1 Original site URL h...ttp://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH4-D/SSH475Q.Seq.d/ Representative seq. ID SSH...475F (Link to Original site) Representative DNA sequence >SSH475 (SSH475Q) /CSM/SS/SSH4-D/SSH475Q.Se

  7. Dicty_cDB: SSH623 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH623 (Link to dictyBase) - - - Contig-U11902-1 | Contig-U13418-1 SSH...623P (Link to Original site) SSH623F 177 SSH623Z 611 SSH623P 788 - - Show SSH623 Library SS (Link to library) Clone ID SSH...02-1 | Contig-U13418-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-A/SSH...623Q.Seq.d/ Representative seq. ID SSH623P (Link to Original site) Representative DNA sequence >SSH623 (SSH...623Q) /CSM/SS/SSH6-A/SSH623Q.Seq.d/ TAAAAATCAAAAAAATAAAATTTTACCAAATACATTTTCACCAAATCTACAACCTCAACA

  8. Dicty_cDB: SSH630 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH630 (Link to dictyBase) ssh630 G02291 DDB0229933 Contig-U12011-1 SSH...630P (Link to Original site) SSH630F 364 SSH630Z 282 SSH630P 646 - - Show SSH630 Library SS (Link to library) Clone ID SSH...630 (Link to dictyBase) Atlas ID ssh630 NBRP ID G02291 dictyBase ID DDB0229933 Link t...o Contig Contig-U12011-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-B/SSH...630Q.Seq.d/ Representative seq. ID SSH630P (Link to Original site) Representative DNA sequence >SSH630 (SSH

  9. Dicty_cDB: SSH476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH476 (Link to dictyBase) ssh476 G00791 DDB0229928 Contig-U09415-1 SSH...476P (Link to Original site) SSH476F 340 SSH476Z 491 SSH476P 831 - - Show SSH476 Library SS (Link to library) Clone ID SSH...476 (Link to dictyBase) Atlas ID ssh476 NBRP ID G00791 dictyBase ID DDB0229928 Link t...o Contig Contig-U09415-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH4-D/SSH...476Q.Seq.d/ Representative seq. ID SSH476P (Link to Original site) Representative DNA sequence >SSH476 (SSH

  10. Dicty_cDB: SSH286 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH286 (Link to dictyBase) - - - Contig-U12201-1 SSH286Z (Link... to Original site) - - SSH286Z 573 - - - - Show SSH286 Library SS (Link to library) Clone ID SSH286 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-D/SSH286Q.Seq.d/ Representative seq. ID SSH28...6Z (Link to Original site) Representative DNA sequence >SSH286 (SSH286Q) /CSM/SS/SSH2-D/SSH286Q.Seq.d/ XXXXX...M319 (SSM319Q) /CSM/SS/SSM3-A/SSM319Q.Seq.d/ 712 0.0 SSI506 (SSI506Q) /CSM/SS/SSI5-A/SSI506Q.Seq.d/ 712 0.0 SSH286 (SSH

  11. Dicty_cDB: SSH138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH138 (Link to dictyBase) - G00782 DDB0231824 Contig-U01120-1 SSH...138P (Link to Original site) SSH138F 379 SSH138Z 625 SSH138P 1004 - - Show SSH138 Library SS (Link to library) Clone ID SSH...Contig-U01120-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH1-B/SSH...138Q.Seq.d/ Representative seq. ID SSH138P (Link to Original site) Representative DNA sequence >SSH138 (SSH138Q) /CSM/SS/SSH...1-B/SSH138Q.Seq.d/ TTTTTTTTTTCCTCACACAAAAATAAATAAAAAAATAAAAATAAAAATAAATAATTATAA TTGAAGA

  12. Dicty_cDB: SSH370 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH370 (Link to dictyBase) - - - Contig-U16289-1 SSH370F (Link to Original site) SSH...370F 359 - - - - - - Show SSH370 Library SS (Link to library) Clone ID SSH370 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-C/SSH370Q.Seq.d/ Representative seq. ID SSH37...0F (Link to Original site) Representative DNA sequence >SSH370 (SSH370Q) /CSM/SS/SSH3-C/SSH370Q.Seq.d/ AATAA...VS/VSJ2-D/VSJ277Q.Seq.d/ 359 2e-98 SSK265 (SSK265Q) /CSM/SS/SSK2-C/SSK265Q.Seq.d/ 359 2e-98 SSH370 (SSH

  13. Dicty_cDB: SSH463 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH463 (Link to dictyBase) - - - Contig-U13869-1 - (Link to Or...iginal site) - - - - - - SSH463E 454 Show SSH463 Library SS (Link to library) Clone ID SSH463 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSH4-C/SSH463Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSH463 (SSH463Q) /CSM/SS/SSH4-C/SSH463Q.Seq.d/ ATATAATCATAAAATGG...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSH645 (SSH645Q) /CSM/SS/SSH6-B/SSH

  14. Dicty_cDB: SSH589 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH589 (Link to dictyBase) - G21023 DDB0233426 Contig-U13415-1 | Contig-U15575-1 SSH...589P (Link to Original site) SSH589F 380 SSH589Z 453 SSH589P 833 - - Show SSH589 Libra...ry SS (Link to library) Clone ID SSH589 (Link to dictyBase) Atlas ID - NBRP ID G21023 dictyBase ID DDB023342...cdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-D/SSH589Q.Seq.d/ Representative seq. ID SSH589P (Link to Original site) R...epresentative DNA sequence >SSH589 (SSH589Q) /CSM/SS/SSH5-D/SSH589Q.Seq.d/ ATAAAGATTTATCCCCAAATCCAAAAAAAAAAG

  15. Dicty_cDB: SSH604 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH604 (Link to dictyBase) ssh604 - - Contig-U13416-1 | Contig-U16394-1 SSH...nk to library) Clone ID SSH604 (Link to dictyBase) Atlas ID ssh604 NBRP ID - dictyBase ID - Link to Contig C...604P (Link to Original site) SSH604F 347 SSH604Z 268 SSH604P 615 - - Show SSH604 Library SS (Li...ontig-U13416-1 | Contig-U16394-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-A/SSH...604Q.Seq.d/ Representative seq. ID SSH604P (Link to Original site) Representative DNA sequence >SSH604 (SSH

  16. Dicty_cDB: SSH183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH183 (Link to dictyBase) - - - Contig-U15632-1 SSH183E (Link... to Original site) - - - - - - SSH183E 254 Show SSH183 Library SS (Link to library) Clone ID SSH183 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH1-D/SSH183Q.Seq.d/ Representative seq. ID SSH18...3E (Link to Original site) Representative DNA sequence >SSH183 (SSH183Q) /CSM/SS/SSH1-D/SSH183Q.Seq.d/ ATTAA...vfgyqlilhfy*vi**ldplvlis Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSH183 (SSH

  17. Dicty_cDB: SSH416 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH416 (Link to dictyBase) - G23718 DDB0205744 Contig-U00298-1 SSH...416E (Link to Original site) SSH416F 257 SSH416Z 243 SSH416P 500 SSH416E 388 Show SSH416 Library SS (Lin...Contig Contig-U00298-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH4-A/SSH...416Q.Seq.d/ Representative seq. ID SSH416E (Link to Original site) Representative DNA sequence >SSH416 (SSH...416Q) /CSM/SS/SSH4-A/SSH416Q.Seq.d/ GTTGAATCTTTAAATAGATTATATGCTTTGGAATGTTTAGATATTAGTAAGAATAACATT

  18. Dicty_cDB: SSH526 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH526 (Link to dictyBase) - - - Contig-U01794-1 | Contig-U16394-1 SSH...526P (Link to Original site) SSH526F 327 SSH526Z 170 SSH526P 497 - - Show SSH526 Library SS (Link to library) Clone ID SSH...94-1 | Contig-U16394-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-B/SSH...526Q.Seq.d/ Representative seq. ID SSH526P (Link to Original site) Representative DNA sequence >SSH526 (SSH...526Q) /CSM/SS/SSH5-B/SSH526Q.Seq.d/ ATTGAATCCAGCGGTAACAGTTGGTTGTGTTACAACTGGTAGAATGGGAATTCTCAATGG

  19. Dicty_cDB: SSH534 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH534 (Link to dictyBase) - - - Contig-U05020-1 SSH534E (Link... to Original site) - - - - - - SSH534E 365 Show SSH534 Library SS (Link to library) Clone ID SSH534 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-B/SSH534Q.Seq.d/ Representative seq. ID SSH53...4E (Link to Original site) Representative DNA sequence >SSH534 (SSH534Q) /CSM/SS/SSH5-B/SSH534Q.Seq.d/ CTATT...-C/VSI267Q.Seq.d/ 476 e-133 VSG392 (VSG392Q) /CSM/VS/VSG3-D/VSG392Q.Seq.d/ 476 e-133 SSH534 (SSH

  20. Hybrid ultrasound imaging techniques (fusion imaging).

    Science.gov (United States)

    Sandulescu, Daniela Larisa; Dumitrescu, Daniela; Rogoveanu, Ion; Saftoiu, Adrian

    2011-01-07

    Visualization of tumor angiogenesis can facilitate non-invasive evaluation of tumor vascular characteristics to supplement the conventional diagnostic imaging goals of depicting tumor location, size, and morphology. Hybrid imaging techniques combine anatomic [ultrasound, computed tomography (CT), and/or magnetic resonance imaging (MRI)] and molecular (single photon emission CT and positron emission tomography) imaging modalities. One example is real-time virtual sonography, which combines ultrasound (grayscale, colour Doppler, or dynamic contrast harmonic imaging) with contrast-enhanced CT/MRI. The benefits of fusion imaging include an increased diagnostic confidence, direct comparison of the lesions using different imaging modalities, more precise monitoring of interventional procedures, and reduced radiation exposure.

  1. A gene encoding a protein with a proline-rich domain (MtPPRD1), revealed by suppressive subtractive hybridization (SSH), is specifically expressed in the Medicago truncatula embryo axis during germination.

    Science.gov (United States)

    Bouton, Sophie; Viau, Laure; Lelièvre, Eric; Limami, Anis M

    2005-03-01

    A gene MtPPRD1, encoding a protein of 132 amino acids containing a proline-rich domain (PRD), has been revealed by suppressive subtractive hybridization (SSH) with two mRNA populations of embryo axes harvested immediately before and after radicle emergence. Although at the protein level MtPPRD1 showed low homology with plant lipid transfer proteins (LTPs), it did exhibit the eight cysteine residues conserved in all plant LTPs, a characteristic signature that allows the formation of a hydrophobic cavity adapted for loading hydrophobic molecules. Expression studies of MtPPRD1 have been carried out by quantitative real time RT-PCR throughout germination and post-germination processes in control seeds and seeds in which germination was delayed by abscisic acid (ABA) or the glutamine synthetase inhibitor methionine sulphoximine (MSX) treatments. The results showed that MtPPRD1 expression is developmentally regulated, induced in the embryo axis immediately before radicle emergence, reaches its maximum expression and declines during the early post-germination phase. Organ specificity studies showed that, except for a low and probably constitutive expression in roots, MtPPRD1 is specifically expressed in the embryo axis. Based on both experimental and in silico studies several putative roles are proposed for MtPPRD1 in Medicago truncatula, this protein can intervene (i) as an LTP in membrane biogenesis and regulation of the intracellular fatty acid pool by binding and transferring fatty acids and phospholipids between membranes, (ii) in the control of a developmental process specific to late germination and to early phases of post-germination, and (iii) and/or pathogen defence.

  2. Dicty_cDB: SSH126 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH126 (Link to dictyBase) - - - Contig-U10885-1 SSH126Z (Link... to Original site) - - SSH126Z 627 - - - - Show SSH126 Library SS (Link to library) Clone ID SSH126 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH1-B/SSH126Q.Seq.d/ Representative seq. ID SSH12...6Z (Link to Original site) Representative DNA sequence >SSH126 (SSH126Q) /CSM/SS/SSH1-B/SSH126Q.Seq.d/ XXXXX...ifyyql llfslfqlqfyhyffkiiiiiiiirkikkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSH

  3. Dicty_cDB: SSH574 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH574 (Link to dictyBase) - G00795 DDB0191628 Contig-U03732-1 SSH...574P (Link to Original site) SSH574F 319 SSH574Z 351 SSH574P 670 - - Show SSH574 Library SS (Link to library) Clone ID SSH...ontig-U03732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-D/SSH...574Q.Seq.d/ Representative seq. ID SSH574P (Link to Original site) Representative DNA sequence >SSH574 (SSH574Q) /CSM/SS/SSH...fis**se*KNILFIKKKKTHTIY IKNSYKMSKVAALGWGTLVYLGVGLLLAIYPPFVTDKPLGRVCFI--- ---iii*ytriikskkttkyyfttpvt*ttkkkkikk*q*kkhqhkrihinvyspssh

  4. Dicty_cDB: SSH793 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH793 (Link to dictyBase) - - - Contig-U15497-1 SSH793Z (Link... to Original site) - - SSH793Z 375 - - - - Show SSH793 Library SS (Link to library) Clone ID SSH793 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH7-D/SSH793Q.Seq.d/ Representative seq. ID SSH79...3Z (Link to Original site) Representative DNA sequence >SSH793 (SSH793Q) /CSM/SS/SSH7-D/SSH793Q.Seq.d/ XXXXX...al 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for SSH793 is cyt 5' end seq. ID - 5' end seq. - Le

  5. Dicty_cDB: SSH234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH234 (Link to dictyBase) - - - Contig-U16581-1 SSH234E (Link... to Original site) - - - - - - SSH234E 564 Show SSH234 Library SS (Link to library) Clone ID SSH234 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-B/SSH234Q.Seq.d/ Representative seq. ID SSH23...4E (Link to Original site) Representative DNA sequence >SSH234 (SSH234Q) /CSM/SS/SSH2-B/SSH234Q.Seq.d/ CAATT...%: vacuolar 4.0 %: cytoskeletal >> prediction for SSH234 is cyt 5' end seq. ID - 5' end seq. - Length of 5'

  6. Dicty_cDB: SSH461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH461 (Link to dictyBase) - - - Contig-U16709-1 SSH461E (Link... to Original site) - - - - - - SSH461E 509 Show SSH461 Library SS (Link to library) Clone ID SSH461 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH4-C/SSH461Q.Seq.d/ Representative seq. ID SSH46...1E (Link to Original site) Representative DNA sequence >SSH461 (SSH461Q) /CSM/SS/SSH4-C/SSH461Q.Seq.d/ TTTAG...gi 4.0 %: vesicles of secretory system 4.0 %: cytoplasmic >> prediction for SSH46

  7. Dicty_cDB: SSH311 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH311 (Link to dictyBase) - - - Contig-U12223-1 SSH311Z (Link... to Original site) - - SSH311Z 508 - - - - Show SSH311 Library SS (Link to library) Clone ID SSH311 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH3-A/SSH311Q.Seq.d/ Representative seq. ID SSH31...1Z (Link to Original site) Representative DNA sequence >SSH311 (SSH311Q) /CSM/SS/SSH3-A/SSH311Q.Seq.d/ XXXXX.../ 301 6e-81 SSK705 (SSK705Q) /CSM/SS/SSK7-A/SSK705Q.Seq.d/ 301 6e-81 SSI190 (SSI190Q) /CSM/SS/SSI1-D/SSI190Q.Seq.d/ 301 6e-81 SSH

  8. Dicty_cDB: SSH653 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH653 (Link to dictyBase) - - - Contig-U15497-1 SSH653Z (Link... to Original site) - - SSH653Z 342 - - - - Show SSH653 Library SS (Link to library) Clone ID SSH653 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH6-C/SSH653Q.Seq.d/ Representative seq. ID SSH65...3Z (Link to Original site) Representative DNA sequence >SSH653 (SSH653Q) /CSM/SS/SSH6-C/SSH653Q.Seq.d/ XXXXX... 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 20.0 %: cytoskeletal 4.0 %: peroxisomal >> prediction for SSH653 i

  9. SSH reveals a linkage between a senescence-associated protease and Verticillium wilt symptom development in lettuce (Lactuca sativa)

    Science.gov (United States)

    Suppression subtractive hybridization (SSH) was employed to identify lettuce (Lactuca sativa) genes that are differentially expressed in symptomatic leaves infected with Verticillium dahliae. Genes expressed only in symptomatic leaves included those with homology to pathogenesis-related (PR) protei...

  10. Construction and analysis of SSH cDNA library of human vascular endothelial cells related to gastrocarcinoma

    OpenAIRE

    2003-01-01

    AIM: To construct subtracted cDNA libraries of human vascular endothelial cells (VECs) related to gastrocarcinoma using suppression substractive hybridization (SSH) and to analyze cDNA libraries of gastrocarcinoma and VECs in Cancer Gene Anatomy Project (CGAP) database.

  11. SSH Honeypot: Building, Deploying and Analysis

    Directory of Open Access Journals (Sweden)

    Harry Doubleday

    2016-05-01

    Full Text Available This article is set to discuss the various techniques that can be used while developing a honeypot, of any form, while considering the advantages and disadvantages of these very different methods. The foremost aims are to cover the principles of the Secure Shell (SSH, how it can be useful and more importantly, how attackers can gain access to a system by using it. The article involved the development of multiple low interaction honeypots. The low interaction honeypots that have been developed make use of the highly documented libssh and even editing the source code of an already available SSH daemon. Finally the aim is to combine the results with the vastly distributed Kippo honeypot, in order to be able to compare and contrast the results along with usability and necessity of particular features. Providing a clean and simple description for less knowledgeable users to be able to create and deploy a honeypot of production quality, adding security advantages to their network instantaneously.

  12. [Valuation for usefulness of selected chromosomal markers for Bacillus anthracis identification. II. Valuation for markers SSH and rpoB].

    Science.gov (United States)

    Zasada, Aleksandra Anna; Jagielski, Marek

    2006-01-01

    The article presents results of valuation for B. anthracis-specificity and usefulness for its identification obtained for different chromosomal markers. In the second part of the study markers SSH241, SSH196, SSH163, SSH133 as well as a fragment of the house-keeping gene rpoB were analyzed. For the investigation MSSCP and multiplex-PCR assays were used. There were also tested different techniques of electrophoresis. The results gave an information about specificity of tested markers and their usefulness for B. anthracis identification.

  13. Hybrid ultrasound imaging techniques(fusion imaging)

    Institute of Scientific and Technical Information of China (English)

    Daniela Larisa Sandulescu; Daniela Dumitrescu; Ion Rogoveanu; Adrian Saftoiu

    2011-01-01

    Visualization of tumor angiogenesis can facilitate noninvasive evaluation of tumor vascular characteristics to supplement the conventional diagnostic imaging goals of depicting tumor location,size,and morphology.Hybrid imaging techniques combine anatomic [ultrasound,computed tomography(CT),and/or magnetic resonance imaging(MRI)] and molecular(single photon emission CT and positron emission tomography)imaging modalities.One example is real-time virtual sonography,which combines ultrasound(grayscale,colour Doppler,or dynamic contrast harmonic imaging)with contrast-enhanced CT/MRI.The benefits of fusion imaging include an increased diagnostic confidence,direct comparison of the lesions using different imaging modalities,more precise monitoring of interventional procedures,and reduced radiation exposure.

  14. HYBRID INTERNET TRAFFIC CLASSIFICATION TECHNIQUE1

    Institute of Scientific and Technical Information of China (English)

    Li Jun; Zhang Shunyi; Lu Yanqing; Yan Junrong

    2009-01-01

    Accurate and real-time classification of network traffic is significant to network operation and management such as QoS differentiation, traffic shaping and security surveillance. However, with many newly emerged P2P applications using dynamic port numbers, masquerading techniques, and payload encryption to avoid detection, traditional classification approaches turn to be ineffective. In this paper, we present a layered hybrid system to classify current Internet traffic, motivated by variety of network activities and their requirements of traffic classification. The proposed method could achieve fast and accurate traffic classification with low overheads and robustness to accommodate both known and unknown/encrypted applications. Furthermore, it is feasible to be used in the context of real-time traffic classification. Our experimental results show the distinct advantages of the proposed classification system, compared with the one-step Machine Learning (ML) approach.

  15. Dicty_cDB: SSH190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH190 (Link to dictyBase) - - - Contig-U16136-1 SSH190F (Link to Original site) SSH...190F 324 - - - - - - Show SSH190 Library SS (Link to library) Clone ID SSH190 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH1-D/SSH190Q.Seq.d/ Representative seq. ID SSH19...0F (Link to Original site) Representative DNA sequence >SSH190 (SSH190Q) /CSM/SS/SSH1-D/SSH190Q.Seq.d/ AGATA...yis***************iykqntnknikne*ftc*r*frl*ryyg*rvl ng*ye*tw*nfssh*il**f*r*f*r*i*r

  16. Dicty_cDB: SSH552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH552 (Link to dictyBase) - - - Contig-U13930-1 SSH552F (Link to Original site) SSH...552F 298 - - - - - - Show SSH552 Library SS (Link to library) Clone ID SSH552 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH5-C/SSH552Q.Seq.d/ Representative seq. ID SSH55...2F (Link to Original site) Representative DNA sequence >SSH552 (SSH552Q) /CSM/SS/SSH5-C/SSH552Q.Seq.d/ AAACA...mkkltlvlaisskrevlnllmert*pifk--- Frame B: nkykykkkky**in**ifnk*inkin*ndcqsfqinypriihfisqrwfnfslwc*nyfp kc*kr*r*sr*kssh

  17. A New Generic Taxonomy on Hybrid Malware Detection Technique

    CERN Document Server

    Robiah, Y; Zaki, M Mohd; Shahrin, S; Faizal, M A; Marliza, R

    2009-01-01

    Malware is a type of malicious program that replicate from host machine and propagate through network. It has been considered as one type of computer attack and intrusion that can do a variety of malicious activity on a computer. This paper addresses the current trend of malware detection techniques and identifies the significant criteria in each technique to improve malware detection in Intrusion Detection System (IDS). Several existing techniques are analyzing from 48 various researches and the capability criteria of malware detection technique have been reviewed. From the analysis, a new generic taxonomy of malware detection technique have been proposed named Hybrid Malware Detection Technique (Hybrid MDT) which consists of Hybrid Signature and Anomaly detection technique and Hybrid Specification based and Anomaly detection technique to complement the weaknesses of the existing malware detection technique in detecting known and unknown attack as well as reducing false alert before and during the intrusion ...

  18. Wind Speed Forecasting Using Hybrid Wavelet Transform—ARMA Techniques

    Directory of Open Access Journals (Sweden)

    Diksha Kaur

    2015-01-01

    Full Text Available The objective of this paper is to develop a novel wind speed forecasting technique, which produces more accurate prediction. The Wavelet Transform (WT along with the Auto Regressive Moving Average (ARMA is chosen to form a hybrid whose combination is expected to give minimum Mean Absolute Prediction Error (MAPE. A simulation study has been conducted by comparing the forecasting results using the Wavelet-ARMA with the ARMA and Artificial Neural Network (ANN-Ensemble Kalman Filter (EnKF hybrid technique to verify the effectiveness of the proposed hybrid method. Results of the proposed hybrid show significant improvements in the forecasting error.

  19. Ultra Wide Band localization and tracking hybrid technique using VRTs

    Directory of Open Access Journals (Sweden)

    Mohd Shamian Zianal

    2012-12-01

    Full Text Available This research presents hybrid radar tracking technique consisting of Time Of Arrival (TOA and Received Signal Strength (RSS techniques. This hybrid design increases efficiency, accuracy and sensitivity of radar system. The radar used in this research is multistatic radar with one transmitter and three receivers. One common drawback in RSS and TOA techniques is high level synchronization in transmitter and receivers. The hybrid design also suffers from transmitter-receiver synchronization. To overcome TX-RX synchronization problem Virtual Reference Tags (VRTs are used. These tags are virtually mapped over the surveillance area giving radar design different reference points from which it can accurately locate intruder and monitor its movements. Also four cases of different

  20. A Mathematical Model for Suppression Subtractive Hybridization

    OpenAIRE

    2002-01-01

    Suppression subtractive hybridization (SSH) is frequently used to unearth differentially expressed genes on a whole-genome scale. Its versatility is based on combining cDNA library subtraction and normalization, which allows the isolation of sequences of varying degrees of abundance and differential expression. SSH is a complex process with many adjustable parameters that affect the outcome of gene isolation.We present a mathematical model of SSH based on DNA hybridization kinetics for assess...

  1. Genomic comparison of Yersinia pestis and Yersinia pseudotuberculosis by combination of suppression subtractive hybridization and DNA microarray

    DEFF Research Database (Denmark)

    Wang, Xiaoyi; Zhou, Dongsheng; Qin, Long

    2006-01-01

    a combination of suppression subtractive hybridization (SSH) and comparative genomic hybridization with DNAs from a diverse panel of Y. pestis and Y. pseudotuberculosis strains. SSH followed by BLAST analysis revealed 112 SSH fragments specific to strain ATCC29833, compared to the genomic sequence data of Y...

  2. A hybrid localization technique for patient tracking.

    Science.gov (United States)

    Rodionov, Denis; Kolev, George; Bushminkin, Kirill

    2013-01-01

    Nowadays numerous technologies are employed for tracking patients and assets in hospitals or nursing homes. Each of them has advantages and drawbacks. For example, WiFi localization has relatively good accuracy but cannot be used in case of power outage or in the areas with poor WiFi coverage. Magnetometer positioning or cellular network does not have such problems but they are not as accurate as localization with WiFi. This paper describes technique that simultaneously employs different localization technologies for enhancing stability and average accuracy of localization. The proposed algorithm is based on fingerprinting method paired with data fusion and prediction algorithms for estimating the object location. The core idea of the algorithm is technology fusion using error estimation methods. For testing accuracy and performance of the algorithm testing simulation environment has been implemented. Significant accuracy improvement was showed in practical scenarios.

  3. New techniques for emulsion analysis in a hybrid experiment

    Energy Technology Data Exchange (ETDEWEB)

    Kodama, K. (Aichi University of Education, Kariya 448 (Japan)); Ushida, N. (Aichi University of Education, Kariya 448 (Japan)); Mokhtarani, A. (University of California (Davis), Davis, CA 95616 (United States)); Paolone, V.S. (University of California (Davis), Davis, CA 95616 (United States)); Volk, J.T. (University of California (Davis), Davis, CA 95616 (United States)); Wilcox, J.O. (University of California (Davis), Davis, CA 95616 (United States)); Yager, P.M. (University of California (Davis), Davis, CA 95616 (United States)); Edelstein, R.M. (Carnegie-Mellon University, Pittsburgh, PA 15213 (United States)); Freyberger, A.P. (Carnegie-Mellon University, Pittsburgh, PA 15213 (United States)); Gibaut, D.B. (Carnegie-Mellon University, Pittsburgh, PA 15213 (United States)); Lipton, R.J. (Carnegie-Mellon University, Pittsburgh, PA 15213 (United States)); Nichols, W.R. (Carnegie-Mellon University, Pittsburgh, PA 15213 (United States)); Potter, D.M. (Carnegie-Mellon Univers

    1994-08-01

    A new method, called graphic scanning, was developed by the Nagoya University Group for emulsion analysis in a hybrid experiment. This method enhances both speed and reliability of emulsion analysis. Details of the application of this technique to the analysis of Fermilab experiment E653 are described. ((orig.))

  4. A Hybridized Centroid Technique for 3D Molodensky-Badekas ...

    African Journals Online (AJOL)

    Richannan

    two new hybrid centroid techniques known as the harmonic-quadratic mean and arithmetic- ... was subsequently involved in triangulation nets with other trigonometric ..... The functional relation that is used to compute the TLS solution is given by ..... mathematical models is an approximation of reality, hence it is worth noting ...

  5. The SSH + Ext human resources management system%SSH+Ext人力资源管理系统

    Institute of Scientific and Technical Information of China (English)

    只春升

    2013-01-01

    本文在研究当前形势的情况下,提出了一种基于SSH+EXT技术的人力资源管理系统,对系统的需求和总体框架的设计进行了分析,并且描述了基于SSH+EXT技术的人力资源管理系统的设计过程.

  6. SSH adequacy to preimplantation mammalian development: Scarce specific transcripts cloning despite irregular normalisation

    Directory of Open Access Journals (Sweden)

    Renard JP

    2005-11-01

    Full Text Available Abstract Background SSH has emerged as a widely used technology to identify genes that are differentially regulated between two biological situations. Because it includes a normalisation step, it is used for preference to clone low abundance differentially expressed transcripts. It does not require previous sequence knowledge and may start from PCR amplified cDNAs. It is thus particularly well suited to biological situations where specific genes are expressed and tiny amounts of RNA are available. This is the case during early mammalian embryo development. In this field, few differentially expressed genes have been characterized from SSH libraries, but an overall assessment of the quality of SSH libraries is still required. Because we are interested in the more systematic establishment of SSH libraries from early embryos, we have developed a simple and reliable strategy based on reporter transcript follow-up to check SSH library quality and repeatability when starting with small amounts of RNA. Results Four independent subtracted libraries were constructed. They aimed to analyze key events in the preimplantation development of rabbit and bovine embryos. The performance of the SSH procedure was assessed through the large-scale screening of thousands of clones from each library for exogenous reporter transcripts mimicking either tester specific or tester/driver common transcripts. Our results show that abundant transcripts escape normalisation which is only efficient for rare and moderately abundant transcripts. Sequencing 1600 clones from one of the libraries confirmed and extended our results to endogenous transcripts and demonstrated that some very abundant transcripts common to tester and driver escaped subtraction. Nonetheless, the four libraries were greatly enriched in clones encoding for very rare (0.0005% of mRNAs tester-specific transcripts. Conclusion The close agreement between our hybridization and sequencing results shows that the

  7. Bonding techniques for hybrid active pixel sensors (HAPS)

    Science.gov (United States)

    Bigas, M.; Cabruja, E.; Lozano, M.

    2007-05-01

    A hybrid active pixel sensor (HAPS) consists of an array of sensing elements which is connected to an electronic read-out unit. The most used way to connect these two different devices is bump bonding. This interconnection technique is very suitable for these systems because it allows a very fine pitch and a high number of I/Os. However, there are other interconnection techniques available such as direct bonding. This paper, as a continuation of a review [M. Lozano, E. Cabruja, A. Collado, J. Santander, M. Ullan, Nucl. Instr. and Meth. A 473 (1-2) (2001) 95-101] published in 2001, presents an update of the different advanced bonding techniques available for manufacturing a hybrid active pixel detector.

  8. Wind Speed Forecasting Using Hybrid Wavelet Transform—ARMA Techniques

    OpenAIRE

    Diksha Kaur; Tek Tjing Lie; Nirmal K. C. Nair; Brice Vallès

    2015-01-01

    The objective of this paper is to develop a novel wind speed forecasting technique, which produces more accurate prediction. The Wavelet Transform (WT) along with the Auto Regressive Moving Average (ARMA) is chosen to form a hybrid whose combination is expected to give minimum Mean Absolute Prediction Error (MAPE). A simulation study has been conducted by comparing the forecasting results using the Wavelet-ARMA with the ARMA and Artificial Neural Network (ANN)-Ensemble Kalman Filter (EnKF) hy...

  9. Early Oscillation Detection Technique for Hybrid DC/DC Converters

    Science.gov (United States)

    Wang, Bright L.

    2011-01-01

    Oscillation or instability is a situation that must be avoided for reliable hybrid DC/DC converters. A real-time electronics measurement technique was developed to detect catastrophic oscillations at early stages for hybrid DC/DC converters. It is capable of identifying low-level oscillation and determining the degree of the oscillation at a unique frequency for every individual model of the converters without disturbing their normal operations. This technique is specially developed for space-used hybrid DC/DC converters, but it is also suitable for most of commercial and military switching-mode power supplies. This is a weak-electronic-signal detection technique to detect hybrid DC/DC converter oscillation presented as a specific noise signal at power input pins. It is based on principles of feedback control loop oscillation and RF signal modulations, and is realized by using signal power spectral analysis. On the power spectrum, a channel power amplitude at characteristic frequency (CPcf) and a channel power amplitude at switching frequency (CPsw) are chosen as oscillation level indicators. If the converter is stable, the CPcf is a very small pulse and the CPsw is a larger, clear, single pulse. At early stage of oscillation, the CPcf increases to a certain level and the CPsw shows a small pair of sideband pulses around it. If the converter oscillates, the CPcf reaches to a higher level and the CPsw shows more high-level sideband pulses. A comprehensive stability index (CSI) is adopted as a quantitative measure to accurately assign a degree of stability to a specific DC/DC converter. The CSI is a ratio of normal and abnormal power spectral density, and can be calculated using specified and measured CPcf and CPsw data. The novel and unique feature of this technique is the use of power channel amplitudes at characteristic frequency and switching frequency to evaluate stability and identify oscillations at an early stage without interfering with a DC/DC converter s

  10. SNP, ARMS and SSH authentication of medicinal Dendrobium officinale KIMURA et MIGO and application for identification of Fengdou drugs.

    Science.gov (United States)

    Ding, Ge; Zhang, Daizhen; Feng, Zhenyu; Fan, Wenjing; Ding, Xiaoyu; Li, Xuexia

    2008-04-01

    Dried stems of Dendrobium officinale have been used as crude drugs in traditional Chinese medicine (TCM) with good tonic efficacy. Sequences of chloroplast, nuclear and mitochondria genes and the method of genomic DNA (gDNA) suppression subtraction hybridization (SSH) were used to authenticate different populations during the process of good agriculture practice (GAP) and crude drug quality control. Six populations could be authenticated successfully by nine single sucleotide polymorphism (SNP) sites and six pairs of diagnostic primers for amplification refractory mutation system (ARMS) were also designed to identify six populations on the basis of single nucleotide polymorphism (SNPs). The remainder two populations (JSR, GGL) with the same sequences could be authenticated by SSH. One population-specific fragment was obtained by SSH and a pair of specific primers (SSH-JB01, SSH-JB02) on the specific sequence was designed to authenticate GGL population from the other populations tested. As the resultants were population-specific, the botanic origins of fifty "Fengdou" drug samples from markets could be classified. It is evident that the combined methods provide a high throughput and reliable approach for identification of D. officinale plants and "Fengdou" drugs.

  11. “A STUDY ON SECURE SHELL (SSH PROTOCOL”

    Directory of Open Access Journals (Sweden)

    NIDHI KANDHIL

    2011-08-01

    Full Text Available Secure Shell (SSH provides an open protocol for securing network communications that is less complex and expensive than hardware-based VPN solutions. Secure Shell client/server solutions provide command shell, file transfer, and data tunneling services for TCP/IP applications. SSH connections provide highly secure authentication, encryption, and data integrity to combat password theft and other security threats. VanDyke Software® clients and servers are mature native Windows implementations that offer a range of SSH apabilities and are interoperable with SSH software on other platforms.

  12. Resonant frequency calculations using a hybrid perturbation-Galerkin technique

    Science.gov (United States)

    Geer, James F.; Andersen, Carl M.

    1991-01-01

    A two-step hybrid perturbation Galerkin technique is applied to the problem of determining the resonant frequencies of one or several degrees of freedom nonlinear systems involving a parameter. In one step, the Lindstedt-Poincare method is used to determine perturbation solutions which are formally valid about one or more special values of the parameter (e.g., for large or small values of the parameter). In step two, a subset of the perturbation coordinate functions determined in step one is used in Galerkin type approximation. The technique is illustrated for several one degree of freedom systems, including the Duffing and van der Pol oscillators, as well as for the compound pendulum. For all of the examples considered, it is shown that the frequencies obtained by the hybrid technique using only a few terms from the perturbation solutions are significantly more accurate than the perturbation results on which they are based, and they compare very well with frequencies obtained by purely numerical methods.

  13. Hybrid Technique of Lamellar Keratoplasty (DMEK-S

    Directory of Open Access Journals (Sweden)

    Pavel Studeny

    2013-01-01

    Full Text Available Purpose: To evaluate the outcomes of the hybrid technique of posterior lamellar keratoplasty (DMEK-S. Materials and Methods: 71 eyes of 55 patients enrolled in a single-center study underwent posterior lamellar keratoplasty with a hybrid lamella DMEK-S implanted using a solution implantation technique, owing to endothelial dysfunction. The outcome measures studied were visual acuity and endothelial cell density. Results: The rate of endothelial cell loss caused by surgery was 43.8%. During followups, we observed the stabilization of postoperative findings, or at minimum a very low rate of corneal endothelial cell loss. The UCDVA and BCDVA dramatically improved postoperatively. The rebubbling rate in our group of patients was 61.9%. We replaced the lamella due to its failure or malfunction in 17 patients (23.9%. Conclusion: In summary, DMEK-S combines the advantages of DSEK/DSAEK and DMEK. The central zone of bare Descemet’s membrane and endothelium allows for very good visual outcomes, and the peripheral rim allows for better manipulation of the lamella during implantation. It is an effective method of treating the endothelial dysfunction of various etiologies, but the high complication rate needs to be addressed before widespread implementation of the technique in the future.

  14. Combining SSH and cDNA microarrays for rapid identification of differentially expressed genes.

    Science.gov (United States)

    Yang, G P; Ross, D T; Kuang, W W; Brown, P O; Weigel, R J

    1999-03-15

    Comparing patterns of gene expression in cell lines and tissues has important applications in a variety of biological systems. In this study we have examined whether the emerging technology of cDNA microarrays will allow a high throughput analysis of expression of cDNA clones generated by suppression subtractive hybridization (SSH). A set of cDNA clones including 332 SSH inserts amplified by PCR was arrayed using robotic printing. The cDNA arrays were hybridized with fluorescent labeled probes prepared from RNA from ER-positive (MCF7 and T47D) and ER-negative (MDA-MB-231 and HBL-100) breast cancer cell lines. Ten clones were identified that were over-expressed by at least a factor of five in the ER-positive cell lines. Northern blot analysis confirmed over-expression of these 10 cDNAs. Sequence analysis identified four of these clones as cytokeratin 19, GATA-3, CD24 and glutathione-S-transferase mu-3. Of the remaining six cDNA clones, four clones matched EST sequences from two different genes and two clones were novel sequences. Flow cytometry and immunofluorescence confirmed that CD24 protein was over-expressed in the ER-positive cell lines. We conclude that SSH and microarray technology can be successfully applied to identify differentially expressed genes. This approach allowed the identification of differentially expressed genes without the need to obtain previously cloned cDNAs.

  15. Reconstruction of ocean velocities from the synergy between SSH and SST measurements

    Science.gov (United States)

    Isern-Fontanet, Jordi; Turiel, Antonio

    2013-04-01

    Recent advances in our understanding of the dynamics in the upper layers of the ocean have allowed us to develop methodologies to recover high resolution velocities from surface measurements such as Sea Surface Heights (SSH) and Sea Surface Temperatures (SST). These methods are based on the combined use of advanced signal processing techniques, such as wavelet analysis and singularity analysis, with dynamical approaches such as the Surface Quasi-Geostrophic (SQG) equations. Within the SQG framework, SSH and SST are closely related, which can be exploited to develop a synergetic approach that combines existing satellite measurements of these fields that can be used to recover subsurface buoyancy anomaly, surface and subsurface horizontal velocities and vertical velocities in the upper 300-500 m. Sentinel-3 satellite will follow its predecessors, ERS-1/2 and Envisat, and will provide simultaneous measurements of SST (SLSTR instrument) and SSH (SRAL and auxiliary instruments) that can be combined to produce high resolution surface currents. To test the feasibility of this approach for Sentinel-3 satellites we have reconstructed surface currents from AATSR and RA data provided by Envisat and compared results against independent SSH measurements provided Jason-1/2 platforms.

  16. SSH 框架技术分析%Analysis of the SSH Framework Technology

    Institute of Scientific and Technical Information of China (English)

    杜素芳

    2014-01-01

    This paper analyzes the technical advantages of SSH framework and its constituent parts, and thor-oughly introduces the functions of each part.%本文分析了SSH框架技术的优势及各组成部分,并对各部分的功能特点进行了详细阐述。

  17. A hybrid sequential deposition fabrication technique for micro fuel cells

    Science.gov (United States)

    Stanley, Kevin G.; Czyzewska, Eva K.; Vanderhoek, Tom P. K.; Fan, Lilian L. Y.; Abel, Keith A.; Wu, Q. M. Jonathan; Parameswaran, M. Ash

    2005-10-01

    Micro fuel cell systems have elicited significant interest due to their promise for instantly rechargeable, longer duration and portable power. Most micro fuel cell systems are either built as miniaturized plate-and-frame or silicon-based microelectromechanical systems (MEMS). Plate-and-frame systems are difficult to fabricate smaller than 20 cm3. Existing micro fuel cell designs cannot meet the cost, scale and power requirements of some portable power markets. Traditional MEMS scaling advantages do not apply to fuel cells because the minimum area for the fuel cell is fixed by the catalyst area required for a given power output, and minimum volume set by mass transport limitations. We have developed a new hybrid technique that borrows from both micro and macro machining techniques to create fuel cells in the 1-20 cm3 range, suitable for cell phones, PDAs and smaller devices.

  18. An Adaptive Hybrid Multiprocessor technique for bioinformatics sequence alignment

    KAUST Repository

    Bonny, Talal

    2012-07-28

    Sequence alignment algorithms such as the Smith-Waterman algorithm are among the most important applications in the development of bioinformatics. Sequence alignment algorithms must process large amounts of data which may take a long time. Here, we introduce our Adaptive Hybrid Multiprocessor technique to accelerate the implementation of the Smith-Waterman algorithm. Our technique utilizes both the graphics processing unit (GPU) and the central processing unit (CPU). It adapts to the implementation according to the number of CPUs given as input by efficiently distributing the workload between the processing units. Using existing resources (GPU and CPU) in an efficient way is a novel approach. The peak performance achieved for the platforms GPU + CPU, GPU + 2CPUs, and GPU + 3CPUs is 10.4 GCUPS, 13.7 GCUPS, and 18.6 GCUPS, respectively (with the query length of 511 amino acid). © 2010 IEEE.

  19. SSH compromise detection using NetFlow/IPFIX

    NARCIS (Netherlands)

    Hofstede, Rick; Hendriks, Luuk

    2015-01-01

    Dictionary attacks against SSH daemons are a common type of brute-force attack, in which attackers perform authentication attempts on a remote machine. By now, we are used to observing a steady number of SSH dictionary attacks in our networks every day; however, these attacks should not be underesti

  20. SSHCure: SSH Intrusion Detection using NetFlow and IPFIX

    NARCIS (Netherlands)

    Hendriks, Luuk; Hofstede, Rick; Sperotto, Anna; Pras, Aiko

    2014-01-01

    With this poster, we present our SSH Intrusion Detection System named SSHCure: it is the first IDS capable of distinguishing successful attacks from unsuccessful attacks, thus detecting actual compromises. As powerful as SSH is to administrators, as attractive it is to anyone with malicious intents.

  1. Suppression subtractive hybridization.

    Science.gov (United States)

    Ghorbel, Mohamed T; Murphy, David

    2011-01-01

    Comparing two RNA populations that differ from the effects of a single independent variable, such as a drug treatment or a specific genetic defect, can establish differences in the abundance of specific transcripts that vary in a population dependent manner. There are different methods for identifying differentially expressed genes. These methods include microarray, Serial Analysis of Gene Expression (SAGE), and quantitative Reverse-Transcriptase Polymerase Chain Reaction (qRT-PCR). Herein, the protocol describes an easy and cost-effective alternative that does not require prior knowledge of the transcriptomes under examination. It is specifically relevant when low levels of RNA starting material are available. This protocol describes the use of Switching Mechanism At RNA Termini Polymerase Chain Reaction (SMART-PCR) to amplify cDNA from small amounts of RNA. The amplified cDNA populations under comparison are then subjected to Suppression Subtractive Hybridization (SSH-PCR). SSH-PCR is a technique that couples subtractive hybridization with suppression PCR to selectively amplify fragments of differentially expressed genes. The resulting products are cDNA populations enriched for significantly overrepresented transcripts in either of the two input RNAs. These cDNA populations can then be cloned to generate subtracted cDNA library. Microarrays made with clones from the subtracted forward and reverse cDNA libraries are then screened for differentially expressed genes using targets generated from tester and driver total RNAs.

  2. Use of SSH on a compartmented mode workstation

    Energy Technology Data Exchange (ETDEWEB)

    Tolliver, J.S. [Oak Ridge National Lab., TN (United States); Dillow, D. [Lockheed Martin Energy Systems, Oak Ridge, TN (United States)

    1997-08-01

    SSH stands for {open_quotes}Secure Shell.{close_quotes} It is now a user shell like csh or ksh. Instead it is a widely-used means to accomplish secure, encrypted communication among cooperating nodes. It is a secure replacement for the {open_quotes}r-commands{close_quotes}, rlogin, and rcp. SSH is free for noncommercial use and builds and runs on most any Unix platform. A Compartmented Mode Workstation (CMW) is an example of a secure or {open_quotes}trusted{close_quotes} operating system. The use of SSH on a CMW introduces security problems unless the SSH source code is modified to take advantage of the security features of the CMW. This paper describes the port and use of SSH on one particular brand of CMW.

  3. Proposal and Implementation of SSH Client System Using Ajax

    Science.gov (United States)

    Kosuda, Yusuke; Sasaki, Ryoichi

    Technology called Ajax gives web applications the functionality and operability of desktop applications. In this study, we propose and implement a Secure Shell (SSH) client system using Ajax, independent of the OS or Java execution environment. In this system, SSH packets are generated on a web browser by using JavaScript and a web server works as a proxy in communication with an SSH server to realize end-to-end SSH communication. We implemented a prototype program and confirmed by experiment that it runs on several web browsers and mobile phones. This system has enabled secure SSH communication from a PC at an Internet cafe or any mobile phone. By measuring the processing performance, we verified satisfactory performance for emergency use, although the speed was unsatisfactory in some cases with mobile phone. The system proposed in this study will be effective in various fields of E-Business.

  4. Identification of differentially expressed genes in uveal melanoma using suppressive subtractive hybridization

    Science.gov (United States)

    Landreville, Solange; Lupien, Caroline B.; Vigneault, Francois; Gaudreault, Manon; Mathieu, Mélissa; Rousseau, Alain P.; Guérin, Sylvain L.

    2011-01-01

    Purpose Uveal melanoma (UM) is the most common primary cancer of the eye, resulting not only in vision loss, but also in metastatic death. This study attempts to identify changes in the patterns of gene expression that lead to malignant transformation and proliferation of normal uveal melanocytes (UVM) using the Suppressive Subtractive Hybridization (SSH) technique. Methods The SSH technique was used to isolate genes that are differentially expressed in the TP31 cell line derived from a primary UM compared to UVM. The expression level of selected genes was further validated by microarray, semi-quantitative RT–PCR and western blot analyses. Results Analysis of the subtracted libraries revealed that 37 and 36 genes were, respectively, up- and downregulated in TP31 cells compared to UVM. Differential expression of the majority of these genes was confirmed by comparing UM cells with UVM by microarray. The expression pattern of selected genes was analyzed by semi-quantitative RT–PCR and western blot, and was found to be consistent with the SSH findings. Conclusions We demonstrated that the SSH technique is efficient to detect differentially expressed genes in UM. The genes identified in this study represent valuable candidates for further functional analysis in UM and should be informative in studying the biology of this tumor. PMID:21647268

  5. OFF-LINE HANDWRITING RECOGNITION USING VARIOUS HYBRID MODELING TECHNIQUES AND CHARACTER N-GRAMS

    NARCIS (Netherlands)

    Brakensiek, A.; Rottland, J.; Kosmala, A.; Rigoll, G.

    2004-01-01

    In this paper a system for on-line cursive handwriting recognition is described. The system is based on Hidden Markov Models (HMMs) using discrete and hybrid modeling techniques. Here, we focus on two aspects of the recognition system. First, we present different hybrid modeling techniques, whereas

  6. ARC Code TI: Middleware Using Existing SSH Hosts (Mesh)

    Data.gov (United States)

    National Aeronautics and Space Administration — Mesh is a secure, lightweight grid middleware that is based on the addition of a single sign-on capability to the built-in public key authentication mechanism of SSH...

  7. [Study on gene expression of Tamarix under NaHCO3 stress using SSH technology].

    Science.gov (United States)

    Yang, Chuan-Ping; Wang, Yu-Cheng; Liu, Gui-Feng; Jiang, Jing

    2004-09-01

    The gene expression of Tamarix androssowii under NaHCO3 stresses is studied by using SSH technique, in which the cDNA from the materials treated with NaHCO3 solution is as tester and the cDNA from the materials in normal growth is as driver. Total 36 genes related to NaHCO3 stress were obtained through Northern hybridization. Blastx analysis showed that the proteins encoded by these genes were homologous to the following proteins: the antioxidant enzymes catalase and peroxiredoxin; trehalose phosphatase, which was related to trehalose synthesis; a few regulation proteins such as bZIP transcription factor, MADS-box protein, glycine-rich RNA-binding proteins, CCCH-type zinc finger protein and F-box protein etc; early light-induced protein, which could protect and/or repair the photosynthetic apparatus damage induced by stress; cysteine proteinase and vacuolar processing enzyme that can make function in plant cell death, and lipid transfer protein precursor, polyubiquitin, chalcone synthase, NADP-dependent isocitrate dehydrogenase, salt-induced S12 protein, and oxygen-evolving enhancer protein 1 etc. Among 36 genes obtained, the proteins encoded three genes were homologous to 3 putative proteins: HAK2, calcium-binding protein and RNA-binding protein, respectively. In addition, 6 new salt stress response squences were found. The result indicated that the salt-tolerant mechanism of Tamarix androssowii may be a complicated, interactive system involving multiple approaches and multiple genes, but not only a single salt gland-depended approach.

  8. Dicty_cDB: SSH130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH130 (Link to dictyBase) - G21002 DDB0190562 Contig-U05309-1...k to library) Clone ID SSH130 (Link to dictyBase) Atlas ID - NBRP ID G21002 dictyBase ID DDB0190562 Link to ...Contig Contig-U05309-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/S...NYILYPTSPPLLSECF SVSYPPPPFLNCNNNSNNSSPINSPKSFNNNNHSSNNFNITNVNNFYFNNNLNNSGSGST SSGGNSGTPPSPIQIPIICT...KKKKKINKMYQPXINNNYILYPTSPPLLSECF SVSYPPPPFLNCNNNSNNSSPINSPKSFNNNNHSSNNFNITNVNNFYFNNNLNNSGSGST SSGGNSGTPPSPIQIPIICT

  9. Suppression subtractive hybridization: a method for generating differentially regulated or tissue-specific cDNA probes and libraries.

    OpenAIRE

    1996-01-01

    A new and highly effective method, termed suppression subtractive hybridization (SSH), has been developed for the generation of subtracted cDNA libraries. It is based primarily on a recently described technique called suppression PCR and combines normalization and subtraction in a single procedure. The normalization step equalizes the abundance of cDNAs within the target population and the subtraction step excludes the common sequences between the target and driver populations. In a model sys...

  10. Transactivating effect of complete S protein of hepatitis B virus and cloning of genes transactivated by complete S protein using suppression subtractive hybridization technique

    Institute of Scientific and Technical Information of China (English)

    Gui-Qin Bai; Yan Liu; Jun Cheng; Shu-Lin Zhang; Ya-Fei Yue; Yan-Ping Huang; Li-Ying Zhang

    2005-01-01

    AIM: To investigate the transactivating effect of complete S protein of hepatitis B virus (HBV) and to construct a subtractive cDNA library of genes transactivated by complete S protein of HBV by suppression subtractive hybridization (SSH) technique and to clone genes associated with its transactivation activity, and to pave the way for elucidating the pathogenesis of hepatitis B virus infection.METHODS: pcDNA3.1(-)-complete S containing full-length HBV S gene was constructed by insertion of HBV complete S gene into BarmH-I/Kpn I sites. HepG2 cells were cotransfected with pcDNA3.1(-)-complete S and pSV-lacZ.After 48 h, cells were collected and detected for the expression of β-galactosidase (β-gal). Suppression subtractive hybridization and bioinformatics techniques were used.The mRNA of HepG2 cells transfected with pcDNA3.1(-)-complete S and pcDNA3.1(-) empty vector was isolated,and detected for the expression of complete S protein by reverse transcription polymerase chain reaction (RT-PCR)method, and cDNA was synthesized. After digestion with restriction enzyme RcaI, cDNA fragments were obtained.Tester cDNA was then divided into two groups and ligated to the specific adaptors 1 and 2, respectively. After tester cDNA had been hybridized with driver cDNA twice and underwent nested PCR twice, amplified cDNA fragments were subcloned into pGEM-Teasy vectors to set up the subtractive library. Amplification of the library was carried out within E. coli strain DH5α. The cDNA was sequenced and analyzed in GenBank with BLAST search after polymerase chain reaction (PCR) amplification.RESULTS: The complete S mRNA could be detected by RT-PCR in HepG2 cells transfected with the pcDNA3.1(-)-complete S. The activity of β-gal in HepG2 cells transfected with the pcDNA3.1(-)-complete S was 6.9 times higher than that of control plasmid. The subtractive library of genes transactivated by HBV complete S protein was constructed successfully. The amplified library contains 86

  11. Identification of differentially expressed genes in normal mucosa, adenoma and adenocarcinoma of colon by SSH

    Institute of Scientific and Technical Information of China (English)

    Min-Jie Luo; Mao-De Lai

    2001-01-01

    AIM To construct subtracted cDNA libraries and further identify differentially expressed genes that are related to the development of colorectal carcinoma (CRC).``METHODS Suppression subtractive hybridization(SSH)was done on cDNAs of normal mucosa, adenoma and adenocarcinoma tissues from the same patient. Three subtracted cDNA libraries were constructed and then hybridized with forward and backward subtracted probes for differential screening. Positive clones from each subtracted cDNA library were selected for sequencing and BLAST analysis. Finally, virtual Northern Blot confirmed such differential expression.``RESULTS By this way, there were about 3 -4× l02clones identified in each subtracted cDNA library, in which about 85% positive clones were differentially screened. Sequencing and BLAST homology search revealed some clones containing sequences of known gene fragments and several possibly novel genes showing few or no sequence homologies with any known sequences in the database.``CONCLUSION All results confirmed the effectiveness and sensitivity of SSH. The differentially expressed genes during the development of CRC can be used to shed light on the pathogenesis of CRC and be useful genetic markers for early diagnosis and therapy.``

  12. Coupling Turbulence in Hybrid LES-RANS Techniques

    Science.gov (United States)

    Woodruff, Stephen L.

    2011-01-01

    A formulation is proposed for hybrid LES-RANS computations that permits accurate computations during resolution changes, so that resolution may be changed at will in order to employ only as much resolution in each subdomain as is required by the physics. The two components of this formulation, establishing the accuracy of a hybrid model at constant resolutions throughout the RANS-to-LES range and maintaining that accuracy when resolution is varied, are demonstrated for decaying, homogeneous, isotropic turbulence.

  13. Hybrid estimation technique for predicting butene concentration in polyethylene reactor

    Science.gov (United States)

    Mohd Ali, Jarinah; Hussain, M. A.

    2016-03-01

    A component of artificial intelligence (AI), which is fuzzy logic, is combined with the so-called conventional sliding mode observer (SMO) to establish a hybrid type estimator to predict the butene concentration in the polyethylene production reactor. Butene or co-monomer concentration is another significant parameter in the polymerization process since it will affect the molecular weight distribution of the polymer produced. The hybrid estimator offers straightforward formulation of SMO and its combination with the fuzzy logic rules. The error resulted from the SMO estimation will be manipulated using the fuzzy rules to enhance the performance, thus improved on the convergence rate. This hybrid estimation is able to estimate the butene concentration satisfactorily despite the present of noise in the process.

  14. Hybrid computer techniques for solving partial differential equations

    Science.gov (United States)

    Hammond, J. L., Jr.; Odowd, W. M.

    1971-01-01

    Techniques overcome equipment limitations that restrict other computer techniques in solving trivial cases. The use of curve fitting by quadratic interpolation greatly reduces required digital storage space.

  15. A Hybrid Islanding Detection Technique Using Average Rate of Voltage Change and Real Power Shift

    DEFF Research Database (Denmark)

    Mahat, Pukar; Chen, Zhe; Bak-Jensen, Birgitte

    2009-01-01

    technique is proposed to solve this problem. An average rate of voltage change (passive technique) has been used to initiate a real power shift (active technique), which changes the eal power of distributed generation (DG), when the passive technique cannot have a clear discrimination between islanding......The mainly used islanding detection techniques may be classified as active and passive techniques. Passive techniques don't perturb the system but they have larger nondetection znes, whereas active techniques have smaller nondetection zones but they perturb the system. In this paper, a new hybrid...

  16. Direct detection of expanded trinucleotide repeats using DNA hybridization techniques

    Energy Technology Data Exchange (ETDEWEB)

    Petronis, A.; Tatuch, Y.; Kennedy, J.L. [Univ. of Toronto (Canada)] [and others

    1994-09-01

    Recently, unstable trinucleotide repeats have been shown to be the etiologic factor in several neuropsychiatric diseases, and they may play a similar role in other disorders. To our knowledge, a method that detects expanded trinucleotide sequences with the opportunity for direct localization and cloning has not been achieved. We have developed a set of hybridization-based methods for direct detection of unstable DNA expansion. Our analysis of myotonic dystrophy patients that possess different degrees of (CTG){sub n} expansion, versus unaffected controls, has demonstrated the identification of the trinucleotide instability site without any prior information regarding genetic map location. High stringency modified Southern blot hybridization with a PCR-generated trinucleotide repeat probe allowed us to detect the DNA fragment containing the expansion in myotonic dystrophy patients. The same probe was used for fluorescent in situ hybridization and several regions of (CTG){sub n}/(CAG){sub n} repeats in the human genome were detected, including the myotonic dystrophy locus on chromosome 19q. These strategies can be applied to directly clone genes involved in disorders caused by unstable DNA.

  17. Application of asymptotic waveform approximation technique to hybrid FE/BI method for 3D scattering

    Institute of Scientific and Technical Information of China (English)

    PENG Zhen; SHENG XinQing

    2007-01-01

    The asymptotic waveform evaluation (AWE) technique is a rational function approximation method in computational mathematics, which is used in many applications in computational electromagnetics. In this paper, the performance of the AWE technique in conjunction with hybrid finite element/boundary integral (FE/BI) method is firstly investigated. The formulation of the AWE applied in hybrid FE/BI method is given in detail. The characteristic implementation of the application of the AWE to the hybrid FE/BI method is discussed. Numerical results demonstrate that the AWE technique can greatly speed up the hybrid FE/BI method to acquire wide-band and wide-angle backscatter radar-cross-section (RCS) by complex targets.

  18. Resizing Technique-Based Hybrid Genetic Algorithm for Optimal Drift Design of Multistory Steel Frame Buildings

    Directory of Open Access Journals (Sweden)

    Hyo Seon Park

    2014-01-01

    Full Text Available Since genetic algorithm-based optimization methods are computationally expensive for practical use in the field of structural optimization, a resizing technique-based hybrid genetic algorithm for the drift design of multistory steel frame buildings is proposed to increase the convergence speed of genetic algorithms. To reduce the number of structural analyses required for the convergence, a genetic algorithm is combined with a resizing technique that is an efficient optimal technique to control the drift of buildings without the repetitive structural analysis. The resizing technique-based hybrid genetic algorithm proposed in this paper is applied to the minimum weight design of three steel frame buildings. To evaluate the performance of the algorithm, optimum weights, computational times, and generation numbers from the proposed algorithm are compared with those from a genetic algorithm. Based on the comparisons, it is concluded that the hybrid genetic algorithm shows clear improvements in convergence properties.

  19. SSHCure: a flow-based SSH intrusion detection system

    NARCIS (Netherlands)

    Hellemons, Laurens; Hendriks, Luuk; Hofstede, Rick; Sperotto, Anna; Sadre, Ramin; Pras, Aiko

    2012-01-01

    SSH attacks are a main area of concern for network managers, due to the danger associated with a successful compromise. Detecting these attacks, and possibly compromised victims, is therefore a crucial activity. Most existing network intrusion detection systems designed for this purpose rely on the

  20. A Hybrid IMRT/VMAT Technique for the Treatment of Nasopharyngeal Cancer

    Directory of Open Access Journals (Sweden)

    Nan Zhao

    2015-01-01

    Full Text Available Hybrid IMRT/VMAT technique which combined intensity modulated radiotherapy (IMRT and volumetric modulated arc therapy (VMAT was developed for the treatment of nasopharyngeal cancer (NPC. Two-full-arc VMAT (2ARC-VMAT, 9-field IMRT (9F-IMRT, and Hybrid IMRT/VMAT plans for NPC were compared in terms of the dosimetric quality, sparing of organs at risk (OARs, and delivery efficiency. The Hybrid IMRT/VMAT technique can improve the target dose homogeneity and conformity compared with 9F-IMRT and 2ARC-VMAT. It can reduce the dose delivered to the TMJ, mandible, temporal lobe, and unspecified tissue with fewer MUs compared with 9F-IMRT and dose delivered to parotids, brainstem, and spinal cord compared with 2ARC-VMAT technique. The mean delivery time of Hybrid plans was shorter than that of 9F-IMRT plans (408 s versus 812 s; P=0.00 and longer than that of 2ARC-VMAT plans (408 s versus 179 s; P=0.00. Hybrid IMRT/VMAT technique could be a viable radiotherapy technique with better plan quality.

  1. A hybrid IMRT/VMAT technique for the treatment of nasopharyngeal cancer.

    Science.gov (United States)

    Zhao, Nan; Yang, Ruijie; Jiang, Yuliang; Tian, Suqing; Guo, Fuxin; Wang, Junjie

    2015-01-01

    Hybrid IMRT/VMAT technique which combined intensity modulated radiotherapy (IMRT) and volumetric modulated arc therapy (VMAT) was developed for the treatment of nasopharyngeal cancer (NPC). Two-full-arc VMAT (2ARC-VMAT), 9-field IMRT (9F-IMRT), and Hybrid IMRT/VMAT plans for NPC were compared in terms of the dosimetric quality, sparing of organs at risk (OARs), and delivery efficiency. The Hybrid IMRT/VMAT technique can improve the target dose homogeneity and conformity compared with 9F-IMRT and 2ARC-VMAT. It can reduce the dose delivered to the TMJ, mandible, temporal lobe, and unspecified tissue with fewer MUs compared with 9F-IMRT and dose delivered to parotids, brainstem, and spinal cord compared with 2ARC-VMAT technique. The mean delivery time of Hybrid plans was shorter than that of 9F-IMRT plans (408 s versus 812 s; P=0.00) and longer than that of 2ARC-VMAT plans (408 s versus 179 s; P=0.00). Hybrid IMRT/VMAT technique could be a viable radiotherapy technique with better plan quality.

  2. A Hybrid IMRT/VMAT Technique for the Treatment of Nasopharyngeal Cancer

    Science.gov (United States)

    Zhao, Nan; Yang, Ruijie; Jiang, Yuliang; Tian, Suqing; Guo, Fuxin; Wang, Junjie

    2015-01-01

    Hybrid IMRT/VMAT technique which combined intensity modulated radiotherapy (IMRT) and volumetric modulated arc therapy (VMAT) was developed for the treatment of nasopharyngeal cancer (NPC). Two-full-arc VMAT (2ARC-VMAT), 9-field IMRT (9F-IMRT), and Hybrid IMRT/VMAT plans for NPC were compared in terms of the dosimetric quality, sparing of organs at risk (OARs), and delivery efficiency. The Hybrid IMRT/VMAT technique can improve the target dose homogeneity and conformity compared with 9F-IMRT and 2ARC-VMAT. It can reduce the dose delivered to the TMJ, mandible, temporal lobe, and unspecified tissue with fewer MUs compared with 9F-IMRT and dose delivered to parotids, brainstem, and spinal cord compared with 2ARC-VMAT technique. The mean delivery time of Hybrid plans was shorter than that of 9F-IMRT plans (408 s versus 812 s; P = 0.00) and longer than that of 2ARC-VMAT plans (408 s versus 179 s; P = 0.00). Hybrid IMRT/VMAT technique could be a viable radiotherapy technique with better plan quality. PMID:25688371

  3. Test and numerical simulation of a new type of hybrid control technique

    Institute of Scientific and Technical Information of China (English)

    Meng Qingli; Zhang Minzheng; Cheng Dong

    2005-01-01

    In this paper, a new hybrid control technique, based on a combination of base-isolation and semi-active variable stiffness/damping in a superstructure, is presented. To illustrate the efficiency of the proposed control system, model tests on a mini-electromagnetic shaking table and a numerical simulation were performed. The test and numerical calculation results indicate that this new hybrid control mode with additional damping and smaller additional stiffness can achieve a better control efficiency.

  4. Management of internal resorption of central incisor using hybrid technique.

    Science.gov (United States)

    Gayathri, Prabakaran; Pandey, Ramesh Kumar; Jain, Eesha

    2014-01-28

    Internal inflammatory root resorption is characterised by progressive destruction of intraradicular dentin and dentinal tubules along the root canal wall. A number of theories have been proposed as a possible cause for internal resorption. It is usually asymptomatic and detected during routine radiographic investigations. Prompt diagnosis and early management of such defects is essential to maintain the integrity of the tooth. Non-surgical and surgical methods are the two main strategies involved in the management of internal resorption. The non-surgical method is usually preferred, but in cases of extensive resorption with external root perforation, surgical intervention has been advocated. The present case illustrates repair of perforating internal resorption by hybrid method, using mineral trioxide aggregate and gutta-percha, following surgical exposure. After a 10-month follow-up, no clinical and radiographic abnormalities were observed. Additionally, there was also marked reduction in periodontal pocket depth.

  5. Constrained Optimization Based on Hybrid Evolutionary Algorithm and Adaptive Constraint-Handling Technique

    DEFF Research Database (Denmark)

    Wang, Yong; Cai, Zixing; Zhou, Yuren

    2009-01-01

    A novel approach to deal with numerical and engineering constrained optimization problems, which incorporates a hybrid evolutionary algorithm and an adaptive constraint-handling technique, is presented in this paper. The hybrid evolutionary algorithm simultaneously uses simplex crossover and two...... mutation operators to generate the offspring population. Additionally, the adaptive constraint-handling technique consists of three main situations. In detail, at each situation, one constraint-handling mechanism is designed based on current population state. Experiments on 13 benchmark test functions...... and four well-known constrained design problems verify the effectiveness and efficiency of the proposed method. The experimental results show that integrating the hybrid evolutionary algorithm with the adaptive constraint-handling technique is beneficial, and the proposed method achieves competitive...

  6. Large-scale multi-zone optimal power dispatch using hybrid hierarchical evolution technique

    Directory of Open Access Journals (Sweden)

    Manjaree Pandit

    2014-03-01

    Full Text Available A new hybrid technique based on hierarchical evolution is proposed for large, non-convex, multi-zone economic dispatch (MZED problems considering all practical constraints. Evolutionary/swarm intelligence-based optimisation techniques are reported to be effective only for small/medium-sized power systems. The proposed hybrid hierarchical evolution (HHE algorithm is specifically developed for solving large systems. The HHE integrates the exploration and exploitation capabilities of particle swarm optimisation and differential evolution in a novel manner such that the search efficiency is improved substantially. Most hybrid techniques export or exchange features or operations from one algorithm to the other, but in HHE their entire individual features are retained. The effectiveness of the proposed algorithm has been verified on six-test systems having different sizes and complexity levels. Non-convex MZED solution for such large and complex systems has not yet been reported.

  7. Single Molecule Techniques for Advanced in situ Hybridization

    Energy Technology Data Exchange (ETDEWEB)

    Hollars, C W; Stubbs, L; Carlson, K; Lu, X; Wehri, E

    2003-02-03

    One of the most significant achievements of modern science is completion of the human genome sequence, completed in the year 2000. Despite this monumental accomplishment, researchers have only begun to understand the relationships between this three-billion-nucleotide genetic code and the regulation and control of gene and protein expression within each of the millions of different types of highly specialized cells. Several methodologies have been developed for the analysis of gene and protein expression in situ, yet despite these advancements, the pace of such analyses is extremely limited. Because information regarding the precise timing and location of gene expression is a crucial component in the discovery of new pharmacological agents for the treatment of disease, there is an enormous incentive to develop technologies that accelerate the analytical process. Here we report on the use of plasmon resonant particles as advanced probes for in situ hybridization. These probes are used for the detection of low levels of gene-probe response and demonstrate a detection method that enables precise, simultaneous localization within a cell of the points of expression of multiple genes or proteins in a single sample.

  8. A hybrid classifier using the parallelepiped and Bayesian techniques. [for multispectral image data

    Science.gov (United States)

    Addington, J. D.

    1975-01-01

    A versatile classification scheme is developed which uses the best features of the parallelepiped algorithm and the Bayesian maximum likelihood algorithm. The parallelepiped technique has the advantage of being very fast, especially when implemented into a table look-up scheme; its disadvantage is its inability to distinguish and classify spectral signatures which are similar in nature. This disadvantage is eliminated by the Bayesian technique which is capable of distinguishing subtle differences very well. The hybrid algorithm developed reduces computer time by as much as 90%. A two- and n-dimensional description of the hybrid classifier is given.

  9. Brain tumor segmentation based on a hybrid clustering technique

    Directory of Open Access Journals (Sweden)

    Eman Abdel-Maksoud

    2015-03-01

    This paper presents an efficient image segmentation approach using K-means clustering technique integrated with Fuzzy C-means algorithm. It is followed by thresholding and level set segmentation stages to provide an accurate brain tumor detection. The proposed technique can get benefits of the K-means clustering for image segmentation in the aspects of minimal computation time. In addition, it can get advantages of the Fuzzy C-means in the aspects of accuracy. The performance of the proposed image segmentation approach was evaluated by comparing it with some state of the art segmentation algorithms in case of accuracy, processing time, and performance. The accuracy was evaluated by comparing the results with the ground truth of each processed image. The experimental results clarify the effectiveness of our proposed approach to deal with a higher number of segmentation problems via improving the segmentation quality and accuracy in minimal execution time.

  10. Comparison of hybrid volumetric modulated arc therapy (VMAT technique and double arc VMAT technique in the treatment of prostate cancer

    Directory of Open Access Journals (Sweden)

    Amaloo Christopher

    2015-09-01

    Full Text Available Background. Volumetric modulated arc therapy (VMAT has quickly become accepted as standard of care for the treatment of prostate cancer based on studies showing it is able to provide faster delivery with adequate target coverage and reduced monitor units while maintaining organ at risk (OAR sparing. This study aims to demonstrate the potential to increase dose conformality with increased planner control and OAR sparing using a hybrid treatment technique compared to VMAT.

  11. HybridArc: A novel radiation therapy technique combining optimized dynamic arcs and intensity modulation

    Energy Technology Data Exchange (ETDEWEB)

    Robar, James L., E-mail: james.robar@cdha.nshealth.ca [Department of Radiation Oncology, Dalhousie University, Halifax (Canada); Department of Physics and Atmospheric Science, Dalhousie University, Halifax (Canada); Thomas, Christopher [Department of Radiation Oncology, Dalhousie University, Halifax (Canada)

    2012-01-01

    This investigation focuses on possible dosimetric and efficiency advantages of HybridArc-a novel treatment planning approach combining optimized dynamic arcs with intensity-modulated radiation therapy (IMRT) beams. Application of this technique to two disparate sites, complex cranial tumors, and prostate was examined. HybridArc plans were compared with either dynamic conformal arc (DCA) or IMRT plans to determine whether HybridArc offers a synergy through combination of these 2 techniques. Plans were compared with regard to target volume dose conformity, target volume dose homogeneity, sparing of proximal organs at risk, normal tissue sparing, and monitor unit (MU) efficiency. For cranial cases, HybridArc produced significantly improved dose conformity compared with both DCA and IMRT but did not improve sparing of the brainstem or optic chiasm. For prostate cases, conformity was improved compared with DCA but not IMRT. Compared with IMRT, the dose homogeneity in the planning target volume was improved, and the maximum doses received by the bladder and rectum were reduced. Both arc-based techniques distribute peripheral dose over larger volumes of normal tissue compared with IMRT, whereas HybridArc involved slightly greater volumes of normal tissues compared with DCA. Compared with IMRT, cranial cases required 38% more MUs, whereas for prostate cases, MUs were reduced by 7%. For cranial cases, HybridArc improves dose conformity to the target. For prostate cases, dose conformity and homogeneity are improved compared with DCA and IMRT, respectively. Compared with IMRT, whether required MUs increase or decrease with HybridArc was site-dependent.

  12. A Hybrid Neural Network-Genetic Algorithm Technique for Aircraft Engine Performance Diagnostics

    Science.gov (United States)

    Kobayashi, Takahisa; Simon, Donald L.

    2001-01-01

    In this paper, a model-based diagnostic method, which utilizes Neural Networks and Genetic Algorithms, is investigated. Neural networks are applied to estimate the engine internal health, and Genetic Algorithms are applied for sensor bias detection and estimation. This hybrid approach takes advantage of the nonlinear estimation capability provided by neural networks while improving the robustness to measurement uncertainty through the application of Genetic Algorithms. The hybrid diagnostic technique also has the ability to rank multiple potential solutions for a given set of anomalous sensor measurements in order to reduce false alarms and missed detections. The performance of the hybrid diagnostic technique is evaluated through some case studies derived from a turbofan engine simulation. The results show this approach is promising for reliable diagnostics of aircraft engines.

  13. Hybrid inverse lithography techniques for advanced hierarchical memories

    Science.gov (United States)

    Xiao, Guangming; Hooker, Kevin; Irby, Dave; Zhang, Yunqiang; Ward, Brian; Cecil, Tom; Hall, Brett; Lee, Mindy; Kim, Dave; Lucas, Kevin

    2014-03-01

    Traditional segment-based model-based OPC methods have been the mainstream mask layout optimization techniques in volume production for memory and embedded memory devices for many device generations. These techniques have been continually optimized over time to meet the ever increasing difficulties of memory and memory periphery patterning. There are a range of difficult issues for patterning embedded memories successfully. These difficulties include the need for a very high level of symmetry and consistency (both within memory cells themselves and between cells) due to circuit effects such as noise margin requirements in SRAMs. Memory cells and access structures consume a large percentage of area in embedded devices so there is a very high return from shrinking the cell area as much as possible. This aggressive scaling leads to very difficult resolution, 2D CD control and process window requirements. Additionally, the range of interactions between mask synthesis corrections of neighboring areas can extend well beyond the size of the memory cell, making it difficult to fully take advantage of the inherent designed cell hierarchy in mask pattern optimization. This is especially true for non-traditional (i.e., less dependent on geometric rule) OPC/RET methods such as inverse lithography techniques (ILT) which inherently have more model-based decisions in their optimizations. New inverse methods such as model-based SRAF placement and ILT are, however, well known to have considerable benefits in finding flexible mask pattern solutions to improve process window, improve 2D CD control, and improve resolution in ultra-dense memory patterns. They also are known to reduce recipe complexity and provide native MRC compliant mask pattern solutions. Unfortunately, ILT is also known to be several times slower than traditional OPC methods due to the increased computational lithographic optimizations it performs. In this paper, we describe and present results for a methodology to

  14. A Robust Hybrid Video Watermarking Technique using Mosaicing

    Directory of Open Access Journals (Sweden)

    Jeebananda Panda

    2014-10-01

    Full Text Available Video Watermarking is the technique by which some information is inserted in the video which can be extracted later. It provides protection against any kind of illegal manipulation by third party. In this paper , a non -blind watermarking scheme is proposed which is based on the combination of Discrete Wavelet Transform,(DWT, Discrete Cosine Transform (DCT and Singular Value Decomposition (SVD.The watermark is embedded in the mosaic formed from the frames of the video by modifying the DCT coefficients of LL1 (low frequency sub-band obtained by applying 1-level DWT on the mosaic followed by diagonal based modification of singular value matrix which is obtained by SVD decomposition of LL2 (low frequency sub-band obtained by applying 2-level DWT on the modified LL1.The experimental values of PSNR, Correlation Factor show that the above proposed scheme is imperceptible, secure and robust against various types of attacks.

  15. High performance technique for database applicationsusing a hybrid GPU/CPU platform

    KAUST Repository

    Zidan, Mohammed A.

    2012-07-28

    Many database applications, such as sequence comparing, sequence searching, and sequence matching, etc, process large database sequences. we introduce a novel and efficient technique to improve the performance of database applica- tions by using a Hybrid GPU/CPU platform. In particular, our technique solves the problem of the low efficiency result- ing from running short-length sequences in a database on a GPU. To verify our technique, we applied it to the widely used Smith-Waterman algorithm. The experimental results show that our Hybrid GPU/CPU technique improves the average performance by a factor of 2.2, and improves the peak performance by a factor of 2.8 when compared to earlier implementations. Copyright © 2011 by ASME.

  16. Construction of a metastasis-associated gene subtracted cDNA library of human colorectal carcinoma by suppression subtraction hybridization

    Institute of Scientific and Technical Information of China (English)

    Li Liang; Yan-Qing Ding; Xin Li; Guang-Zhi Yang; Jun Xiao; Li-Chun Lu; Jin-Hua Zhang

    2004-01-01

    AIM: To construct a differentially-expressed gene subtracted cDNA library from two colorectal carcinoma (CRC) cell lines with different metastatic phenotypes by suppression subtractive hybridization.METHODS: Two cell lines of human CRC from the same patient were used. SW620 cell line showing highly metastatic potential was regarded as tester in the forward subtractive hybridization, while SW480 cell line with lowly metastatic potential was treated as tester in the reverse hybridization. Suppression subtractive hybridization (SSH)was employed to obtain cDNA fragments of differentially expressed genes for the metastasis of CRC. These fragments were ligated with T vectors, screened through the bluewhite screening system to establish cDNA library.RESULTS: After the blue-white screening, 235 white clones were picked out from the positive-going hybridization and 232 from the reverse. PCR results showed that 200-700 bp inserts were seen in 98% and 91% clones from the forward and reverse hybridizations, respectively.CONCLUSIONS: A subtractive cDNA library of differentially expressed genes specific for metastasis of CRC can be constructed with SSH and T/A cloning techniques.

  17. 多快好省地实施OpenSSH

    Institute of Scientific and Technical Information of China (English)

    赵长林

    2008-01-01

    虽然使用代替口令的公钥认证是增强SSH传输安全性的一个好方法,但传输SSH的统一性密钥却也是一件令人不快的事。而ssh-copy-id这个包括在OpenSSH之内的小程序使得这个过程变得格外简单。

  18. Critical Success Factors (CSFs for achieving sustainable social housing (SSH

    Directory of Open Access Journals (Sweden)

    Akanbi Olusayo Oyebanji

    2017-06-01

    Full Text Available The overarching objective of social housing is to meet housing needs, particularly those of the vulnerable households – low and middle income earners. However, there is evidence to show that social housing is not adequately supported to achieve sustainable goals despite its significance for addressing the housing crisis. The aim of this study is to determine the Critical Success Factors (CSFs for achieving Sustainable Social Housing (SSH from economic, environmental and social perspectives for meeting housing needs. The document content analysis approach involving relevant literature resources was used for generating the success factors (SFs for achieving SSH. Findings from this approach were refined before using them in preparing a questionnaire used to gather data from housing authorities (public and private non-profit social housing organisations in England and they were asked to rank the criticality level of the identified success factors. The data gathered through the relevant documents and respondents were analysed respectively with NVivo and Statistical Package for Social Science (SPSS. Findings revealed some of the CSFs for achieving SSH for meeting housing needs as: adequate funding and provision, affordability, efficient economic planning, appropriate construction technology, environmental protection, use of environmental friendly materials, effective land use planning, appropriate design, security of lives and property, provision of social services and ensuring social cohesion. The paper recommends the use of efficient sustainable development (SD strategies and legal and institutional frameworks for monitoring and evaluating the delivery of SSH. The Government must embark on effective housing programmes for ensuring adequate provision of social housing that is sustainable for meeting housing needs in the short and long-run. There is need for the Government to regularly provide financial supports to social housing providers and users

  19. A Proposed Hybrid Technique for Recognizing Arabic Characters

    Directory of Open Access Journals (Sweden)

    S F Bahgat

    2012-07-01

    Full Text Available Optical character recognition systems improve human-machine interaction and are urgently required for many governmental and commercial departments. A considerable progress in the recognition techniques of Latin and Chinese characters has been achieved. By contrast, Arabic Optical Character Recognition (AOCR is still lagging although the interest and research in this area is becoming more intensive than before. This is because the Arabic is a cursive language, written from right to left, each character has two to four different forms according to its position in the word, and most characters are associated with complementary parts above, below, or inside the character. The process of Arabic character recognition passes through several stages; the most serious and error-prone of which are segmentation, and feature extraction & classification. This research focuses on the feature extraction and classification stage, being as important as the segmentation stage. Features can be classified into two categories; Local features, which are usually geometric, and Global features, which are either topological or statistical. Four approaches related to the statistical category are to be investigated, namely: Moment Invariants, Gray Level Co-occurrence Matrix, Run Length Matrix, and Statistical Properties of Intensity Histogram. The paper aims at fusing the features of these methods to get the most representative feature vector that maximizes the recognition rate.

  20. Locomotion training of legged robots using hybrid machine learning techniques

    Science.gov (United States)

    Simon, William E.; Doerschuk, Peggy I.; Zhang, Wen-Ran; Li, Andrew L.

    1995-01-01

    In this study artificial neural networks and fuzzy logic are used to control the jumping behavior of a three-link uniped robot. The biped locomotion control problem is an increment of the uniped locomotion control. Study of legged locomotion dynamics indicates that a hierarchical controller is required to control the behavior of a legged robot. A structured control strategy is suggested which includes navigator, motion planner, biped coordinator and uniped controllers. A three-link uniped robot simulation is developed to be used as the plant. Neurocontrollers were trained both online and offline. In the case of on-line training, a reinforcement learning technique was used to train the neurocontroller to make the robot jump to a specified height. After several hundred iterations of training, the plant output achieved an accuracy of 7.4%. However, when jump distance and body angular momentum were also included in the control objectives, training time became impractically long. In the case of off-line training, a three-layered backpropagation (BP) network was first used with three inputs, three outputs and 15 to 40 hidden nodes. Pre-generated data were presented to the network with a learning rate as low as 0.003 in order to reach convergence. The low learning rate required for convergence resulted in a very slow training process which took weeks to learn 460 examples. After training, performance of the neurocontroller was rather poor. Consequently, the BP network was replaced by a Cerebeller Model Articulation Controller (CMAC) network. Subsequent experiments described in this document show that the CMAC network is more suitable to the solution of uniped locomotion control problems in terms of both learning efficiency and performance. A new approach is introduced in this report, viz., a self-organizing multiagent cerebeller model for fuzzy-neural control of uniped locomotion is suggested to improve training efficiency. This is currently being evaluated for a possible

  1. GA and PSO culled hybrid technique for economic dispatch problem with prohibited operating zones

    Institute of Scientific and Technical Information of China (English)

    SUDHAKARAN M.; AJAY-D-VIMALRAJ P.; PALANIVELU T.G.

    2007-01-01

    This paper presents an efficient and reliable genetic algorithm (GA) based particle swarm optimization (PSO) technique (hybrid GAPSO) for solving the economic dispatch (ED) problem in power systems. The non-linear characteristics of the generators, such as prohibited operating zones, ramp rate limits and non-smooth cost functions of the practical generator operation are considered. The proposed hybrid algorithm is demonstrated for three different systems and the performance is compared with the GA and PSO in terms of solution quality and computation efficiency. Comparison of results proved that the proposed algorithm can obtain higher quality solutions efficiently in ED problems. A comprehensive software package is developed using MATLAB.

  2. Indirect porcelain veneers in periodontally compromised teeth. The hybrid technique: a case report.

    Science.gov (United States)

    Garcia-Baeza, David; Saavedra, Carlos; Garcia-Adámez, Ramón

    2015-01-01

    The loss of periodontal structure causes an esthetic problem for many patients, especially when the esthetic zone is compromised. Among the various types of solutions is the use of composite resins. While this procedure is not aggressive towards tooth structure, it does require the clinician to have a precise technique, and demands strict longterm maintenance. 1 Another way of treating the compromised teeth is with porcelain veneers. This procedure is especially difficult, however, if carried out on periodontal teeth, as it requires preparation along the roots. 2 The intention of the hybrid technique described in this article is to combine both of these procedures in order to obtain a less aggressive treatment with precise management of the soft tissue and an adequate esthetic outcome. The hybrid technique consists of enlarging the root portion of the teeth with composite resin to obtain a less aggressive tooth preparation, and thereafter placing porcelain veneers.

  3. 3D Printed PEG-Based Hybrid Nanocomposites Obtained by Sol-Gel Technique.

    Science.gov (United States)

    Chiappone, Annalisa; Fantino, Erika; Roppolo, Ignazio; Lorusso, Massimo; Manfredi, Diego; Fino, Paolo; Pirri, Candido Fabrizio; Calignano, Flaviana

    2016-03-02

    In this work, three-dimensional (3D) structured hybrid materials were fabricated combining 3D printing technology with in situ generation of inorganic nanoparticles by sol-gel technique. Those materials, consisting of silica nanodomains covalently interconnected with organic polymers, were 3D printed in complex multilayered architectures, incorporating liquid silica precursors into a photocurable oligomer in the presence of suitable photoinitiators and exposing them to a digital light system. A post sol-gel treatment in acidic vapors allowed the in situ generation of the inorganic phase in a dedicated step. This method allows to build hybrid structures operating with a full liquid formulation without meeting the drawbacks of incorporating inorganic powders into 3D printable formulations. The influence of the generated silica nanoparticle on the printed objects was deeply investigated at macro- and nanoscale; the resulting light hybrid structures show improved mechanical properties and, thus, have a huge potential for applications in a variety of advanced technologies.

  4. Closure technique for the hybrid girder cable stayed bridge of Edong Bridge

    Institute of Scientific and Technical Information of China (English)

    Liu Minghu; Tan Hao; Xu GuoPing; Zhao Canhui

    2012-01-01

    Based on Edong Yangtze River Bridge, which is the second longest hybrid girder cable stayed bridge with 926 m long main span, the influencing factors and crucial techniques of the main span closure method for long span hybrid girder cable stayed bridge are studied. After theoretical analysis, numerical evaluation and practical test, the loading assistant closure method is employed in Edong Yangtze River Bridge. The loading assistant closure method, with better thermal adaptability and less influence on bridge line and the forced status, can meet the requirements of the unstressed state control method. Based on the mentioned advantages, the loading assistant closure method is applicable to long span hybrid girder cable stayed bridges. The conclusion can provide a reference for the further design of the similar brid~es.

  5. A new hybrid jpeg image compression scheme using symbol reduction technique

    CERN Document Server

    Kumar, Bheshaj; Sinha, G R

    2012-01-01

    Lossy JPEG compression is a widely used compression technique. Normally the JPEG standard technique uses three process mapping reduces interpixel redundancy, quantization, which is lossy process and entropy encoding, which is considered lossless process. In this paper, a new technique has been proposed by combining the JPEG algorithm and Symbol Reduction Huffman technique for achieving more compression ratio. The symbols reduction technique reduces the number of symbols by combining together to form a new symbol. As a result of this technique the number of Huffman code to be generated also reduced. It is simple fast and easy to implement. The result shows that the performance of standard JPEG method can be improved by proposed method. This hybrid approach achieves about 20% more compression ratio than the Standard JPEG.

  6. Hybrid single-beam reconstruction technique for slow and fast varying wave fields.

    Science.gov (United States)

    Falaggis, Konstantinos; Kozacki, Tomasz; Kujawinska, Malgorzata

    2015-06-01

    An iterative single-beam wave field reconstruction technique that employs both non-paraxial, wave propagation based and paraxial deterministic phase retrieval techniques is presented. This approach overcomes two major obstacles that exist in the current state of the art techniques: iterative methods do not reconstruct slowly varying wave fields due to slow convergence and stagnation, and deterministic methods have paraxial limits, making the reconstructions of quickly varying object features impossible. In this work, a hybrid approach is reported that uses paraxial wave field corrections within iterative phase retrieval solvers. This technique is suitable for cases ranging from slow to fast varying wave fields, and unlike the currently available methods, can also reconstruct measurement objects with different regions of both slowly and quickly varying object features. It is further shown that this technique gives a higher accuracy than current single-beam phase retrieval techniques, and in comparison to the iterative methods, has a higher convergence speed.

  7. Application of SSH and quantitative real time PCR to construction of gene expression profiles from scallop Chlamys farreri in response to exposure to tetrabromobisphenol A.

    Science.gov (United States)

    Gong, Xiaoli; Pan, Luqing; Miao, Jingjing; Liu, Na

    2012-11-01

    TBBPA-induced genes were identified using suppression subtractive hybridization (SSH) from Chlamys farreri. A total of 203 and 44 clones from SSH forward and reverse library were respectively obtained including cellular process, immune system process, response to stimulus, metabolic process and signaling etc. Differential gene expressions were compared between scallops from control and TBBPA treatment groups (400 μg/L, 15 days) using quantitative real time RT-PCR. For further research, eight significant genes expression from scallops exposed to TBBPA (0; 100; 200; 400 μg/L) sampling at 0, 1, 3, 6 and 15 days, were utilized for Q-RT-PCR. The results revealed that the expression level of most selected cDNAs was dominantly up-regulated or down-regulated in the TBBPA-induced scallops. These findings provide basic genomic information of the bivalve and the selected genes may be the potential molecular biomarkers for TBBPA pollution in aquatic environment.

  8. Sample preparation and in situ hybridization techniques for automated molecular cytogenetic analysis of white blood cells

    Energy Technology Data Exchange (ETDEWEB)

    Rijke, F.M. van de; Vrolijk, H.; Sloos, W. [Leiden Univ. (Netherlands)] [and others

    1996-06-01

    With the advent in situ hybridization techniques for the analysis of chromosome copy number or structure in interphase cells, the diagnostic and prognostic potential of cytogenetics has been augmented considerably. In theory, the strategies for detection of cytogenetically aberrant cells by in situ hybridization are simple and straightforward. In practice, however, they are fallible, because false classification of hybridization spot number or patterns occurs. When a decision has to be made on molecular cytogenetic normalcy or abnormalcy of a cell sample, the problem of false classification becomes particularly prominent if the fraction of aberrant cells is relatively small. In such mosaic situations, often > 200 cells have to be evaluated to reach a statistical sound figure. The manual enumeration of in situ hybridization spots in many cells in many patient samples is tedious. Assistance in the evaluation process by automation of microscope functions and image analysis techniques is, therefore, strongly indicated. Next to research and development of microscope hardware, camera technology, and image analysis, the optimization of the specimen for the (semi)automated microscopic analysis is essential, since factors such as cell density, thickness, and overlap have dramatic influences on the speed and complexity of the analysis process. Here we describe experiments that have led to a protocol for blood cell specimen that results in microscope preparations that are well suited for automated molecular cytogenetic analysis. 13 refs., 4 figs., 1 tab.

  9. Biomechanical comparison of interference screw and cortical button with screw hybrid technique for distal biceps brachii tendon repair.

    Science.gov (United States)

    Arianjam, Afshin; Camisa, William; Leasure, Jeremi M; Montgomery, William H

    2013-11-01

    Various fixation techniques have been described for ruptured distal biceps tendons. The authors hypothesized that no significant differences would be found between the mean failure strength, maximum strength, and stiffness of the interference screw and hybrid technique. Fourteen fresh-frozen human cadaveric elbows were prepared. Specimens were randomized to either interference screw or hybrid cortical button with screw fixation. The tendon was pulled at a rate of 4 mm/s until failure. Failure strength, maximum strength, and stiffness were measured and compared. Failure strength, maximum strength, and stiffness were 294±81.9 N, 294±82.1 N, and 64.4±40.5 N/mm, respectively, for the interference screw technique and 333±129 N, 383±121 N, and 56.2±40.5 N/mm, respectively, for the hybrid technique. No statistically significant difference existed between the screw and hybrid technique in failure strength, maximum strength, or stiffness (P>.05). The interference screws primarily failed by pullout of the screw and tendon, whereas in the hybrid technique, failure occurred with screw pullout followed by tearing of the biceps tendon. The results suggest that this hybrid technique is nearly as strong and stiff as the interference screw alone. Although the hybrid technique facilitates tensioning of the reconstructed tendon, the addition of the cortical button did not significantly improve the failure strength of the interference screw alone. Copyright 2013, SLACK Incorporated.

  10. A DG Implementation of a Novel Hybrid RANS/LES Technique With RANS Reconstruction

    CERN Document Server

    Abbà, Antonella; Nini, Michele; Restelli, Marco

    2014-01-01

    A new hybrid RANS/LES technique, based on the hybrid filter proposed by Germano in 2004, has been studied. The novelty herein introduced is represented by the reconstruction of the Reynolds stress tensor. As a consequence, no explicit RANS model is needed. The RANS and LES terms are merged using a constant blending factor. The model is implemented in a numerical code based on a high order Discontinuous Galerkin (DG) finite element formulation. The test case considered for numerical simulations is the turbulent tur- bulent channel flow at Mach = 0.2. The comparison with available DNS data shows a good agreement and, in general, an improvement with re- spect to pure LES results, confirming that the technique herein proposed represents a promising approach to the numerical simulation of turbulent flows.

  11. SENSE shimming (SSH): A fast approach for determining B(0) field inhomogeneities using sensitivity coding.

    Science.gov (United States)

    Splitthoff, D N; Zaitsev, M

    2009-11-01

    The pursuit of ever higher field strengths and faster data acquisitions has led to the construction of coil arrays with high numbers of elements. With the sensitivity encoding (SENSE) technique, it has been shown that the sensitivity of those elements can be used for spatial image encoding. Here, a proof-of-principle is presented of a method that can be considered an extreme case of the SENSE approach, completely abstaining from using encoding gradients. The resulting sensitivity encoded free-induction decay (FID) data are then not used for imaging, but for determining B(0) field inhomogeneity distribution. The method has therefore been termed "SENSE shimming" (SSH). In phantom experiments the method's ability to detect inhomogeneities of up to the second order is demonstrated.

  12. Detection of chromosome aberrations in interphase nuclei using fluorescence in situ hybridization technique.

    OpenAIRE

    1993-01-01

    We report here several experiences of interphase cytogenetics, using fluorescence in situ hybridization (FISH) technique, for the detection of chromosome aberrations. FISH, using alpha satellite specific probes of 18, X, Y chromosomes, was done in interphase nuclei from peripheral blood of patients with Edwards' syndrome, Klinefelter's syndrome and Turner's syndrome with healthy male and female controls, respectively. The distributions of fluorescent signals in 100 interphase nuclei were well...

  13. [Identification and analysis of differentially expressed genes during wood formation in Chinese fir by SSH].

    Science.gov (United States)

    Wang, Gui-Feng; Gao, Yan; Yang, Li-Wei; Shi, Ji-Sen

    2007-04-01

    Wood is an important raw material for the global industry with rapidly increasing demand. To isolate the differentially expressed genes in xylogenesis of Chinese fir [Cunninghamia lanceolata (Lamb.) Hook], a forward subtractive cDNA library was constructed using suppression subtractive hybridization (SSH) method, which was performed using the cDNA from the mutant Dugansha clone as the tester and the cDNA from the normal Jurong 0 clone as the driver. Six hundred and eighteen clones were obtained. Recombinants were identified using PCR with universal T7 and SP6 primers and using EcoR digestion. To further eliminate false positive, dot hybridization was used with four DIG-labeled probes (FSP, RSP, UTP, and UDP). Real-time PCR was performed to confirm the results. A total of 260 unique ESTs were obtained, 60% of the ESTs exhibiting homologies with proteins of known function fell into 4 major classes: metabolism, cell wall biogenesis and remodeling, signal transduction and stress. The systematic analysis of genes involved in wood formation in Chinese fir provides valuable insights into the molecular mechanisms involved in xylem differentiation, is important resources for forest research directed toward understanding the genetic control of wood formation and future endeavors to modify wood and fiber properties for industrial use.

  14. A low-loss hybrid rectification technique for piezoelectric energy harvesting

    Science.gov (United States)

    Schlichting, A. D.; Fink, E.; Garcia, E.

    2013-09-01

    Embedded systems have decreased in size and increased in capability; however, small-scale energy storage technologies still significantly limit these advances. Energy neutral operation using small-scale energy harvesting technologies would allow for longer device operation times and smaller energy storage masses. Vibration energy harvesting is an attractive method due to the prevalence of energy sources in many environments. Losses in efficiency due to AC-DC rectification and conditioning circuits limit its application. This work presents a low-loss hybrid rectification technique for piezoelectric vibration energy harvesting using magnetically actuated reed switches and a passive semiconductor full-bridge rectifier. This method shows the capability to have higher efficiency levels and the rectification of low-voltage harvesters without the need for active electrical components. A theoretical model shows that the hybrid rectification technique performance is highly dependent on the proximity delay and the hysteresis behavior of the reed switches. Experimental results validate the model and support the hypothesis of increased performance using the hybrid rectification technique.

  15. A Comparison of Redundancy Techniques for Private and Hybrid Cloud Storage

    Directory of Open Access Journals (Sweden)

    E.M. Hernandez-Ramirez

    2012-11-01

    Full Text Available File redundancy techniques have been very useful mechanisms for offering fault tolerance and data availability in anykind of storage. Cloud storage is not the exception. This paper presents an evaluation of classical file redundancytechniques implemented in two cloud-storage deployment models, private and hybrid. A small prototype of a privateand hybrid cloud storage was implemented for this evaluation. The performance impact when file redundancy is onlyapplied in a private cloud versus when redundancy is also distributed in a public cloud (the hybrid model is analyzed.Additional to classical file redundancy techniques, an innovative method was evaluated for file redundancy based onan information dispersal algorithm (IDA. The usage of IDA represents a good option for managing sensitive data inhybrid cloud storage. In this technique, only parts of a file need to be sent to the public cloud, avoiding the completefile to be read from outside of the private zone. In this context, there is a trade-off between performance (forreconstructing the original file, it is first necessary to obtain all of its fragments and the security level that coulddetermine the viability of using IDA.

  16. High capacity fiber optic sensor networks using hybrid multiplexing techniques and their applications

    Science.gov (United States)

    Sun, Qizhen; Li, Xiaolei; Zhang, Manliang; Liu, Qi; Liu, Hai; Liu, Deming

    2013-12-01

    Fiber optic sensor network is the development trend of fiber senor technologies and industries. In this paper, I will discuss recent research progress on high capacity fiber sensor networks with hybrid multiplexing techniques and their applications in the fields of security monitoring, environment monitoring, Smart eHome, etc. Firstly, I will present the architecture of hybrid multiplexing sensor passive optical network (HSPON), and the key technologies for integrated access and intelligent management of massive fiber sensor units. Two typical hybrid WDM/TDM fiber sensor networks for perimeter intrusion monitor and cultural relics security are introduced. Secondly, we propose the concept of "Microstructure-Optical X Domin Refecltor (M-OXDR)" for fiber sensor network expansion. By fabricating smart micro-structures with the ability of multidimensional encoded and low insertion loss along the fiber, the fiber sensor network of simple structure and huge capacity more than one thousand could be achieved. Assisted by the WDM/TDM and WDM/FDM decoding methods respectively, we built the verification systems for long-haul and real-time temperature sensing. Finally, I will show the high capacity and flexible fiber sensor network with IPv6 protocol based hybrid fiber/wireless access. By developing the fiber optic sensor with embedded IPv6 protocol conversion module and IPv6 router, huge amounts of fiber optic sensor nodes can be uniquely addressed. Meanwhile, various sensing information could be integrated and accessed to the Next Generation Internet.

  17. A HYBRID TECHNIQUE FOR FREQUENCY DOMAIN IDENTIFICATION OF SERVO SYSTEM WITH FRICTION FORCE

    Directory of Open Access Journals (Sweden)

    SHAIK.RAFI KIRAN,

    2011-03-01

    Full Text Available The system identification process in servo system with frictional force seems to be a complex task becauseof its non-linear nature. For such non-linear systems, a good choice is system identification in frequencydomain. However, most of the techniques are manual and are inappropriate for determination of systemparameters. This makes system identification ineffective for servo systems with frictional force. Toovercome this issue, a hybrid technique is proposed in this paper. The proposed technique exploits neuralnetwork and genetic algorithm to determine the system parameters of servo systems with friction. In theproposed technique, the target parameters are determined from the transfer function derived for thesystem. Subsequently, the system parameters are identified by a process formed by blending the neuralnetwork and genetic algorithm techniques. Prior to performing the identification procedure, backpropagation training is given to the neural network using a pre-examined dataset. Then with thecombined operation of neural network and genetic algorithm, the system parameters that are closer tothe target parameters for the servo system with frictional force are determined. The technique isimplemented and compared with the existing frequency domain identification technique. From thecomparative results, it is evident that the proposed technique outperforms the existing technique.

  18. Identification of differentially expressed genes in esophageal cancer through SSH in com- bination with high throughput reverse Northern screening

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    To understand the molecular mechanisms of carcinogenesis of esophagus and to isolate genes with different expression levels in esophageal cancer, suppression subtractive hybridization (SSH) was combined with PCR-based cDNA synthesis and reverse Northern on the cancer tissues and matched almost normal mucosa using 5 microgram of total RNA as starting marterial. Eight genes were found expressed differentially in esophageal cancer, in which 5 were known genes and 3 were novel ones; and 6 were down-regulated in cancer tissues, while 2 were up-regulated; 6 were of mid-high abundance and 2 were of low abundance in esophagus. The results revealed that alteration in expression level of multiple genes underlied the initiation and development of esophageal cancer. The differentially expressed genes identified in this study such as liporcotinⅠ, cystatin A, cystatin B, cytokeratin 13 may play roles in dedifferentiation, transformation and malignant proliferation of esophageal cancer. The combination of SSH with PCR-based double- strand cDNA synthesis and high throughput reverse Northern screening is an efficient way to isolate differentially expressed genes from microgram of total RNA.

  19. Recent Developments on Hybrid Time-Frequency Numerical Simulation Techniques for RF and Microwave Applications

    Directory of Open Access Journals (Sweden)

    Jorge F. Oliveira

    2013-01-01

    Full Text Available This paper reviews some of the promising doors that functional analysis techniques have recently opened in the field of electronic circuit simulation. Because of the modulated nature of radio frequency (RF signals, the corresponding electronic circuits seem to operate in a slow time scale for the aperiodic information and another, much faster, time scale for the periodic carrier. This apparent multirate behavior can be appropriately described using partial differential equations (PDEs within a bivariate framework, which can be solved in an efficient way using hybrid time-frequency techniques. With these techniques, the aperiodic information dimension is treated in the discrete time domain, while the periodic carrier dimension is processed in the frequency domain, in which the solution is evaluated within a space of harmonically related sinusoidal functions. The objective of this paper is thus to provide a general overview on the most important hybrid time-frequency techniques, as the ones found in commercial tools or the ones recently published in the literature.

  20. Hybrid machine learning technique for forecasting Dhaka stock market timing decisions.

    Science.gov (United States)

    Banik, Shipra; Khodadad Khan, A F M; Anwer, Mohammad

    2014-01-01

    Forecasting stock market has been a difficult job for applied researchers owing to nature of facts which is very noisy and time varying. However, this hypothesis has been featured by several empirical experiential studies and a number of researchers have efficiently applied machine learning techniques to forecast stock market. This paper studied stock prediction for the use of investors. It is always true that investors typically obtain loss because of uncertain investment purposes and unsighted assets. This paper proposes a rough set model, a neural network model, and a hybrid neural network and rough set model to find optimal buy and sell of a share on Dhaka stock exchange. Investigational findings demonstrate that our proposed hybrid model has higher precision than the single rough set model and the neural network model. We believe this paper findings will help stock investors to decide about optimal buy and/or sell time on Dhaka stock exchange.

  1. Step Response Enhancement of Hybrid Stepper Motors Using Soft Computing Techniques

    Directory of Open Access Journals (Sweden)

    Amged S. El-Wakeel

    2014-05-01

    Full Text Available This paper presents the use of different soft computing techniques for step response enhancement of Hybrid Stepper Motors. The basic differential equations of hybrid stepper motor are used to build up a model using MATLAB software package. The implementation of Fuzzy Logic (FL and Proportional-Integral-Derivative (PID controllers are used to improve the motor performance. The numerical simulations by a PC-based controller show that the PID controller tuned by Genetic Algorithm (GA produces better performance than that tuned by Fuzzy controller. They show that, the Fuzzy PID-like controller produces better performance than the other linear Fuzzy controllers. Finally, the comparison between PID controllers tuned by genetic algorithm and the Fuzzy PID-like controller shows that, the Fuzzy PID-like controller produces better performance.

  2. Hybrid PIV-PTV technique for measuring blood flow in rat mesenteric vessels.

    Science.gov (United States)

    Ha, Hojin; Nam, Kweon-Ho; Lee, Sang Joon

    2012-11-01

    The micro-particle tracking velocimetry (μ-PTV) technique is used to obtain the velocity fields of blood flow in the microvasculature under in vivo conditions because it can provide the blood velocity distribution in microvessels with high spatial resolution. The in vivo μ-PTV technique usually requires a few to tens of seconds to obtain a whole velocity profile across the vessel diameter because of the limited number density of tracer particles under in vivo conditions. Thus, the μ-PTV technique alone is limited in measuring unsteady blood flows that fluctuate irregularly due to the heart beating and muscle movement in surrounding tissues. In this study, a new hybrid PIV-PTV technique was established by combining PTV and particle image velocimetry (PIV) techniques to resolve the drawbacks of the μ-PTV method in measuring blood flow in microvessels under in vivo conditions. Images of red blood cells (RBCs) and fluorescent particles in rat mesenteric vessels were obtained simultaneously. Temporal variations of the centerline blood velocity were monitored using a fast Fourier transform-based cross-correlation PIV method. The fluorescence particle images were analyzed using the μ-PTV technique to extract the spatial distribution of the velocity vectors. Data from the μ-PTV and PIV methods were combined to obtain a better estimate of the velocity profile in actual blood flow. This technique will be useful in investigating hemodynamics in microcirculation by measuring unsteady irregular blood flows more accurately.

  3. A Low Cost Vision Based Hybrid Fiducial Mark Tracking Technique for Mobile Industrial Robots

    Directory of Open Access Journals (Sweden)

    Mohammed Y Aalsalem

    2012-07-01

    Full Text Available The field of robotic vision is developing rapidly. Robots can react intelligently and provide assistance to user activities through sentient computing. Since industrial applications pose complex requirements that cannot be handled by humans, an efficient low cost and robust technique is required for the tracking of mobile industrial robots. The existing sensor based techniques for mobile robot tracking are expensive and complex to deploy, configure and maintain. Also some of them demand dedicated and often expensive hardware. This paper presents a low cost vision based technique called “Hybrid Fiducial Mark Tracking” (HFMT technique for tracking mobile industrial robot. HFMT technique requires off-the-shelf hardware (CCD cameras and printable 2-D circular marks used as fiducials for tracking a mobile industrial robot on a pre-defined path. This proposed technique allows the robot to track on a predefined path by using fiducials for the detection of Right and Left turns on the path and White Strip for tracking the path. The HFMT technique is implemented and tested on an indoor mobile robot at our laboratory. Experimental results from robot navigating in real environments have confirmed that our approach is simple and robust and can be adopted in any hostile industrial environment where humans are unable to work.

  4. Design and Development of Hybrid Multilevel Inverter employing Dual Reference Modulation Technique for Fuel Cell Applications

    Directory of Open Access Journals (Sweden)

    R. Seyezhai

    2011-10-01

    Full Text Available MultiLevel Inverter (MLI has been recognized as an attractive topology for high voltage DC-AC conversion. This paper focuses on a new dual reference modulation technique for a hybrid multilevel inverter employing Silicon carbide (SiC switches for fuel cell applications. The proposed modulation technique employs two reference waveforms and a single inverted sine wave as the carrier waveform. This technique is compared with the conventional dual carrier waveform in terms of output voltage spectral quality and switching losses. An experimental five-level hybrid inverter test rig has been built using SiC switches to implement the proposed algorithm. Gating signals are generated using PIC microcontroller. The performance of the inverter has been analyzed and compared with the result obtained from theory and simulation. Simulation study of Proportional Integral (PI controller for the inverter employing the proposed modulation strategy has been done in MATLAB/SIMULINK. Keywords: Multilevel inverter, SiC , dual reference modulation, switching losses, PI

  5. Hardwood species classification with DWT based hybrid texture feature extraction techniques

    Indian Academy of Sciences (India)

    Arvind R Yadav; R S Anand; M L Dewal; Sangeeta Gupta

    2015-12-01

    In this work, discrete wavelet transform (DWT) based hybrid texture feature extraction techniques have been used to categorize the microscopic images of hardwood species into 75 different classes. Initially, the DWT has been employed to decompose the image up to 7 levels using Daubechies (db3) wavelet as decomposition filter. Further, first-order statistics (FOS) and four variants of local binary pattern (LBP) descriptors are used to acquire distinct features of these images at various levels. The linear support vector machine (SVM), radial basis function (RBF) kernel SVM and random forest classifiers have been employed for classification. The classification accuracy obtained with state-of-the-art and DWT based hybrid texture features using various classifiers are compared. The DWT based FOS-uniform local binary pattern (DWTFOSLBPu2) texture features at the 4th level of image decomposition have produced best classification accuracy of 97.67 ± 0.79% and 98.40 ± 064% for grayscale and RGB images, respectively, using linear SVM classifier. Reduction in feature dataset by minimal redundancy maximal relevance (mRMR) feature selection method is achieved and the best classification accuracy of 99.00 ± 0.79% and 99.20 ± 0.42% have been obtained for DWT based FOS-LBP histogram Fourier features (DWTFOSLBP-HF) technique at the 5th and 6th levels of image decomposition for grayscale and RGB images, respectively, using linear SVM classifier. The DWTFOSLBP-HF features selected with mRMR method has also established superiority amongst the DWT based hybrid texture feature extraction techniques for randomly divided database into different proportions of training and test datasets.

  6. Establishment of a Multi-color Genomic in situ Hybridization Technique to Simultaneously Discriminate the Three Interspecific Hybrid Genomes in Gossypium

    Institute of Scientific and Technical Information of China (English)

    Bing Guan; Kai Wang; Bao-Liang Zhou; Wang-Zhen Guo; Tian-Zhen Zhang

    2008-01-01

    To identify alien chromosomes in recipient progenies and to analyze genome components in polyploidy, a genomic In situ hybridization (GISH) technique that is suitable for cotton was developed using increased stringency conditions. The increased stringency conditions were a combination of the four factors in the following optimized state: 100:1 ratio of blocking DNA to probe, 60% formamide wash solution, 43 =C temperature wash and a 13 min wash. Under these specific conditions using gDNA from Gossypium sturtianurn (C1C1) as a probe, strong hybridization signals were only observed on chromosomes from the C1 genome in somatic cells of the hybrid F1 (G. hirsutum×G. sturtianum) (AtDtC1). Therefore, GISH was able to discriminate parental chromosomes in the hybrid. Further, we developed a multi-color GISH to simultaneously discriminate the three genomes of the above hybrid. The results repeatedly displayed the three genomes, At, Dt, and C1, and each set of chromosomes with a unique color, making them easy to identify. The power of the multi-color GISH was proven by analysis of the hexaploid hybrid F1 (G. hirsutum × G. australe) (AtAtDtDtG2G2). We believe that the powerful multi-color GISH technique could be applied extensively to analyze the genome component in polyploidy and to identify alien chromosomes in the recipient progenies.

  7. Direct detection of expanded trinucleotide repeats using PCR and DNA hybridization techniques

    Energy Technology Data Exchange (ETDEWEB)

    Petronis, A.; Tatuch, Y.; Klempan, T.A.; Kennedy, J.L. [Hospital for Sick Children, Toronto (Canada)] [and others

    1996-02-16

    Recently, unstable trinucleotide repeats have been shown to be the etiologic factor in seven neuropsychiatric diseases, and they may play a similar role in other genetic disorders which exhibit genetic anticipation. We have tested one polymerase chain reaction (PCR)-based and two hybridization-based methods for direct detection of unstable DNA expansion in genomic DNA. This technique employs a single primer (asymmetric) PCR using total genomic DNA as a template to efficiently screen for the presence of large trinucleotide repeat expansions. High-stringency Southern blot hybridization with a PCR-generated trinucleotide repeat probe allowed detection of the DNA fragment containing the expansion. Analysis of myotonic dystrophy patients containing different degrees of (CTG){sub n} expansion demonstrated the identification of the site of trinucleotide instability in some affected individuals without any prior information regarding genetic map location. The same probe was used for fluorescent in situ hybridization and several regions of (CTG){sub n}/(CAG){sub n} repeats in the human genome were detected, including the myotonic dystrophy locus on chromosome 19q. Although limited at present to large trinucleotide repeat expansions, these strategies can be applied to directly clone genes involved in disorders caused by large expansions of unstable DNA. 33 refs., 4 figs.

  8. Biocompatibility improvement of titanium implants by coating with hybrid materials synthesized by sol-gel technique.

    Science.gov (United States)

    Catauro, M; Bollino, F; Papale, F

    2014-12-01

    Organic-inorganic hybrid materials based on zirconia and polyethylene glycol (PEG) have been synthesized via sol-gel method in the present study. Those materials, still in the sol phase, have been used to coat a titanium grade 4 (Ti-4) substrate to improve its biological properties. Dip-coating technique has been used to obtain thin films. PEG, a biocompatible polymer, used as the organic phase, has been incorporated with different percentages in an inorganic zirconium-based matrix. Those hybrids have been characterized by Fourier transform infrared spectroscopy (FTIR) to detect interactions between the two phases. The films have been examined using SEM to detect morphological changes with PEG percentages. The potential applications of the hybrid coatings in biomedical field have been evaluated by bioactivity and cytotoxicity tests. The coated titanium was immersed in simulated body fluid (SBF) for 21 days and the hydroxyapatite deposition on its surface was subsequently evaluated, as that feature can be used as an index of bone-bonding capability. SEM equipped with energy dispersive spectrometer (EDS) was used to examine hydroxyapatite formation. NIH 3T3 mouse embryonic fibroblast cells were seeded on specimens to evaluate cells-materials interactions and cell vitality was inspected using WST-8 Assay.

  9. Production of CaCO3/hyperbranched polyglycidol hybrid films using spray-coating technique.

    Science.gov (United States)

    Malinova, Kalina; Gunesch, Manfred; Montero Pancera, Sabrina; Wengeler, Robert; Rieger, Bernhard; Volkmer, Dirk

    2012-05-15

    Biomineralizing organisms employ macromolecules and cellular processing strategies in order to produce highly complex composite materials such as nacre. Bionic approaches translating this knowledge into viable technical production schemes for a large-scale production of biomimetic hybrid materials have met with limited success so far. Investigations presented here thus focus on the production of CaCO(3)/polymer hybrid coatings that can be applied to huge surface areas via reactive spray-coating. Technical requirements for simplicity and cost efficiency include a straightforward one-pot synthesis of low molecular weight hyperbranched polyglycidols (polyethers of 2,3-epoxy-1-propanol) as a simple mimic of biological macromolecules. Polymers functionalized with phosphate monoester, sulfate or carboxylate groups provide a means of controlling CaCO(3) particle density and morphology in the final coatings. We employ reactive spray-coating techniques to generate CaCO(3)/hybrid coatings among which vaterite composites can be prepared in the presence of sulfate-containing hyperbranched polyglycidol. These coatings show high stability and remained unchanged for periods longer than 9 months. By employing carboxylate-based hyperbranched polyglycidol, it is possible to deposit vaterite-calcite composites, whereas phosphate-ester-based hyperbranched polyglycidol leads to calcite composites. Nanoindentation was used to study mechanical properties, showing that coatings thus obtained are slightly harder than pure calcite. Copyright © 2012 Elsevier Inc. All rights reserved.

  10. Identification of C4 photosynthesis metabolism and regulatory-associated genes in Eleocharis vivipara by SSH.

    Science.gov (United States)

    Chen, Taiyu; Ye, Rongjian; Fan, Xiaolei; Li, Xianghua; Lin, Yongjun

    2011-09-01

    This is the first effort to investigate the candidate genes involved in kranz developmental regulation and C(4) metabolic fluxes in Eleocharis vivipara, which is a leafless freshwater amphibious plant and possesses a distinct culms anatomy structure and photosynthetic pattern in contrasting environments. A terrestrial specific SSH library was constructed to investigate the genes involved in kranz anatomy developmental regulation and C(4) metabolic fluxes. A total of 73 ESTs and 56 unigenes in 384 clones were identified by array hybridization and sequencing. In total, 50 unigenes had homologous genes in the databases of rice and Arabidopsis. The real-time quantitative PCR results showed that most of the genes were accumulated in terrestrial culms and ABA-induced culms. The C(4) marker genes were stably accumulated during the culms development process in terrestrial culms. With respect to C(3) culms, C(4) photosynthesis metabolism consumed much more transporters and translocators related to ion metabolism, organic acids and carbohydrate metabolism, phosphate metabolism, amino acids metabolism, and lipids metabolism. Additionally, ten regulatory genes including five transcription factors, four receptor-like proteins, and one BURP protein were identified. These regulatory genes, which co-accumulated with the culms developmental stages, may play important roles in culms structure developmental regulation, bundle sheath chloroplast maturation, and environmental response. These results shed new light on the C(4) metabolic fluxes, environmental response, and anatomy structure developmental regulation in E. vivipara.

  11. An SSH library responsive to azadirachtin A constructed in Spodoptera litura Fabricius cell lines.

    Science.gov (United States)

    Yan, Chao; Zhang, Zhi-Xiang; Xu, Han-Hong

    2012-05-31

    The present study revealed differentially expressed genes responsive to azadirachtin A (Aza) in Spodoptera litura cell line through suppression subtractive hybridization. In the Aza-responsive SSH library, approximately 270 sequences represent 53 different identified genes encoding proteins with various predicted functions, and the percentages of the gene clusters were 26.09% (genetic information processing), 11.41% (cell growth and death), 7.07% (metabolism), 6.52% (signal transduction/transport) and 2.72% (immunity), respectively. Eleven clones homologous to identified genes were selected to be confirmed through quantitative real time polymerase chain reaction. Among the eleven clones validated, all but one transcript of lipase showed an increase in SL cell line collected from ETA, whereas the transcripts of other genes were lower in the SL cell line collected from ETA compared with that of UETA. These genes were considered to be related to the response of SL cell line to Aza. These will provide a new clue to uncover the molecular mechanisms of Aza acting on SL cell line.

  12. [Bioinformatic analysis of adenoma-normal mucosa SSH library of colon].

    Science.gov (United States)

    Lü, Bing-Jian; Cui, Jing; Xu, Jing; Zhang, Hao; Luo, Min-Jie; Zhu, Yi-Min; Lai, Mao-De

    2006-04-01

    We established a colonic adenoma-normal mucosa suppressive subtraction hybridization (SSH) library in 1999. In this study, we wanted to explore the expression profile of all candidate genes in this library. We developed an EST pipeline which contained two in-house software packages, nucleic acid analytical software and GetUni. The nucleic acid analytical software, an integrator of the universal bioinformatics tools including phred, phd2fasta, cross_match, repeatmasker and blast2.0, can blast sequences of differential clones with the downloaded non-redundant nucleotide (NR) database. GetUni can cluster these NR sequences into Unigene via matching with the downloaded Homo Sapiens UniGene database. Sixty-two candidate genes in A-N library were obtained via the high throughput automatic gene expression bioinformatics pipeline. Gene Ontology online analysis revealed that ribosome genes and immunity-regulating genes were the two most common categories in the KEGG or Biocarta Pathway. We also detected the expression of 2 genes with highest hits, Reg4 and FAM46A, by semi-quantitative RT-PCR. Both genes were up-regulated in 10 or 9 out of 10 adenomas in comparison with the paired normal mucosa, respectively. The candidate genes in A-N library would be of great significance in disclosing the molecular mechanism underlying in colonic adenoma initiation and progression.

  13. Hybrid OPC modeling with SEM contour technique for 10nm node process

    Science.gov (United States)

    Hitomi, Keiichiro; Halle, Scott; Miller, Marshal; Graur, Ioana; Saulnier, Nicole; Dunn, Derren; Okai, Nobuhiro; Hotta, Shoji; Yamaguchi, Atsuko; Komuro, Hitoshi; Ishimoto, Toru; Koshihara, Shunsuke; Hojo, Yutaka

    2014-03-01

    Hybrid OPC modeling is investigated using both CDs from 1D and simple 2D structures and contours extracted from complex 2D structures, which are obtained by a Critical Dimension-Scanning Electron Microscope (CD-SEM). Recent studies have addressed some of key issues needed for the implementation of contour extraction, including an edge detection algorithm consistent with conventional CD measurements, contour averaging and contour alignment. Firstly, pattern contours obtained from CD-SEM images were used to complement traditional site driven CD metrology for the calibration of OPC models for both metal and contact layers of 10 nm-node logic device, developed in Albany Nano-Tech. The accuracy of hybrid OPC model was compared with that of conventional OPC model, which was created with only CD data. Accuracy of the model, defined as total error root-mean-square (RMS), was improved by 23% with the use of hybrid OPC modeling for contact layer and 18% for metal layer, respectively. Pattern specific benefit of hybrid modeling was also examined. Resist shrink correction was applied to contours extracted from CD-SEM images in order to improve accuracy of the contours, and shrink corrected contours were used for OPC modeling. The accuracy of OPC model with shrink correction was compared with that without shrink correction, and total error RMS was decreased by 0.2nm (12%) with shrink correction technique. Variation of model accuracy among 8 modeling runs with different model calibration patterns was reduced by applying shrink correction. The shrink correction of contours can improve accuracy and stability of OPC model.

  14. SU-E-T-16: A Hybrid VMAT/IMRT Technique for the Treatment of Nasopharyngeal Carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, N; Yang, R; Wang, J [Peking University Third Hospital, Beijing, Beijing (China)

    2014-06-01

    Purpose: To investigate a Hybrid VMAT/IMRT technique which combines volumetric modulated arc therapy (VMAT) and intensity modulated radiation therapy (IMRT) for nasopharyngeal carcinoma (NPC). Methods: 2 full arcs VMAT, 9-field IMRT and Hybrid VMAT/IMRT plans were created for 10 patients with NPC. The Hybrid VMAT/IMRT technique consisted of 1 full VMAT arc and 7 IMRT fields. The dose distribution of planning target volume (PTV) and organs at risk (OARs) for Hybrid VMAT/IMRT was compared with IMRT and VMAT. The monitor units (MUs) were also evaluated. Results: The Hybrid VMAT/IMRT technique significantly improved target dose homogeneity compared with IMRT and VMAT for PTV70 and PTV54. For PTV70 and PTV60, the Hybrid VMAT/IMRT technique significantly improved target dose conformity compared with IMRT (0.62 vs 0.47; p<0.05 and 0.64 vs 0.58; p<0.05, respectively) and VMAT (0.62 vs 0.43; p<0.05 and 0.64 vs 0.6; p<0.05, respectively). The near maximum dose (D2%) of temporomandibular joint (TMJ), temporal lobe and mandible for Hybrid plans were 5.5%, 7.9% and 5.2% lower than IMRT plans (p<0.05). The mean dose of TMJ, temporal lobe, mandible and unspecified tissue for Hybrid plans were 12.8%, 11.4%, 4.2% and 4.1% lower than IMRT plans (p<0.05). The mean dose of right parotid, mandible and unspecified tissue for Hybrid plans were 3.3%, 2.4% and 3.1% lower than VMAT plans (p<0.05). The mean MUs needed for IMRT, VMAT and Hybrid plans were 2256, 507 and 1394, respectively. Conclusion: Hybrid VMAT/IMRT technique significantly improved the target dose homogeneity and conformity compared with IMRT and VMAT and reduced the dose of OARs and unspecified tissue compared with IMRT with fewer MUs. Compared with VMAT, Hybrid VMAT/IMRT technique can better protect parotid gland, mandible and unspecified tissue. Ruijie Yang was funded by the grant project: National Natural Science Foundation of China (No. 81071237). Other authors have no competing interest for this work.

  15. Apical transportation of manual NiTi instruments and a hybrid technique in severely curved simulated canals

    OpenAIRE

    Aurenaila Nascimento Gonçalves; Matheus Franco da Frota; Emilio Carlos Sponchiado Júnior; Fredson Marcio Acris de Carvalho; Lucas da Fonseca Roberti Garcia; André Augusto Franco Marques

    2015-01-01

    Aim: To evaluate the apical transportation induced by two instrumentation techniques in severely curved simulated canals. Materials and Methods: Forty simulated canals were divided into two groups (n = 20), according to the following instrumentation techniques: ProTaper Universal Manual System and a hybrid technique. The simulated canals in the ProTaper group were prepared following the technique recommended by the manufacturer: SX files in the cervical third of the root canal and S1, S2,...

  16. Enhancement in Seismic Imaging using Diffraction Studies and Hybrid Traveltime Technique for PSDM

    Science.gov (United States)

    Bashir, Y.; Ghosh, D. P.; Moussavi Alashloo, S. Y.; Sum, C. W.

    2016-07-01

    The accurate migration of seismic data is conditional on the parameters which are nominated. The effective velocity used in residual processing for migration is small compared to the original migration velocity. Considering traveltime computation is a significant part of seismic imaging algorithms. Conventional implementation of Kirchhoff migration is essential for precomputing a traveltime table from the categories involving traditional ray-tracing methods and finite difference eikonal solvers. In this paper, we examine the accuracy using, the eikonal solver and paraxial ray tracing traveltime computation in pre-stack Kirchhoff depth migration. This hybrid traveltime technique can be applied to a variety of problems related to faults, fractures, and complex region. To evaluate the relevance of this identical traveltime technique, we applied on a Marmousi data set.

  17. REVIEW OF HEART DISEASE PREDICTION SYSTEM USING DATA MINING AND HYBRID INTELLIGENT TECHNIQUES

    Directory of Open Access Journals (Sweden)

    R. Chitra

    2013-07-01

    Full Text Available The Healthcare industry generally clinical diagnosis is done mostly by doctor’s expertise and experience. Computer Aided Decision Support System plays a major role in medical field. With the growing research on heart disease predicting system, it has become important to categories the research outcomes and provides readers with an overview of the existing heart disease prediction techniques in each category. Neural Networks are one of many data mining analytical tools that can be utilized to make predictions for medical data. From the study it is observed that Hybrid Intelligent Algorithm improves the accuracy of the heart disease prediction system. The commonly used techniques for Heart Disease Prediction and their complexities are summarized in this paper.

  18. Local tetrahedron modeling of microelectronics using the finite-volume hybrid-grid technique

    Energy Technology Data Exchange (ETDEWEB)

    Riley, D.J.; Turner, C.D.

    1995-12-01

    The finite-volume hybrid-grid (FVHG) technique uses both structured and unstructured grid regions in obtaining a solution to the time-domain Maxwell`s equations. The method is based on explicit time differencing and utilizes rectilinear finite-difference time-domain (FDTD) and nonorthogonal finite-volume time-domain (FVTD). The technique directly couples structured FDTD grids with unstructured FVTD grids without the need for spatial interpolation across grid interfaces. In this paper, the FVHG method is applied to simple planar microelectronic devices. Local tetrahedron grids are used to model portions of the device under study, with the remainder of the problem space being modeled with cubical hexahedral cells. The accuracy of propagating microstrip-guided waves from a low-density hexahedron region through a high-density tetrahedron grid is investigated.

  19. Enhancement of Twins Fetal ECG Signal Extraction Based on Hybrid Blind Extraction Techniques

    Directory of Open Access Journals (Sweden)

    Ahmed Kareem Abdullah

    2017-07-01

    Full Text Available ECG machines are noninvasive system used to measure the heartbeat signal. It’s very important to monitor the fetus ECG signals during pregnancy to check the heat activity and to detect any problem early before born, therefore the monitoring of ECG signals have clinical significance and importance. For multi-fetal pregnancy case the classical filtering algorithms are not sufficient to separate the ECG signals between mother and fetal. In this paper the mixture consists of mixing from three ECG signals, the first signal is the mother ECG (M-ECG signal, second signal the Fetal-1 ECG (F1-ECG, and third signal is the Fetal-2 ECG (F2-ECG, these signals are extracted based on modified blind source extraction (BSE techniques. The proposed work based on hybridization between two BSE techniques to ensure that the extracted signals separated well. The results demonstrate that the proposed work very efficiently to extract the useful ECG signals

  20. Identification of H. Pylori strain specific DNA sequences between two clinical isolates from NUD and gastric ulcer by SSH

    Institute of Scientific and Technical Information of China (English)

    Feng-Chan Han; Min Gong; Han-Chong Ng; Bow Ho

    2003-01-01

    AIM: The genomes of Helicobacter pylori(H. pylori) from different individuals are different. This project was to identify the strain specific DNA sequences between two clinical H. pylori isolates by suppression subtractive hybridization (SSH).METHODS: Two clinical H. pylori isolates, one from gastric ulcer (GU, tester) and the other from non-ulcer dyspepsia (NUD, driver), were cultured and the genomic DNA was prepared and submitted to AluⅠdigestion. Then two different adaptors were ligated respectively to the 5′-end of two aliquots of the tester DNA fragments and SSH was made between the tester and driver DNA. The un-hybridized tester DNA sequences were amplified by two sequential PCR and cloned into pGEM-T-Easy Vector. The tester strain specific inserts were screened and disease related DNA sequences were identified by dot blotting.RESULTS: Among the 240 colonies randomly chosen, 50contained the tester strain specific DNA sequences. Twenty three inserts were sequenced and the sizes ranged from 261 bp to 1 036 bp. Fifteen inserts belonged to the H.pylori plasmid pHPO100 that is about 3.5 kb and codes a replication protein A. Other inserts had patches of homologous to the genes of H. pylori in GenBank. Various patterns of dot blots were given and no GU strain unique DNA sequences were found when 4 inserts were used as probes to screen the genomic DNA from 27 clinical isolates, 8 from GU, 12 from duodenum ulcer (DU), 4 from GU-DU, 2 from NUD and 1from gastric cancer (GC). But a 670 bp DNA fragment (GU198)that was a bit homologous to the 3′-end of the gene of thymidylate kinase was positive in 7 GU strains (7/8), 3 GUDU strains (3/4) and 3 DU strains (3/12). A 384 bp fragment (GU79) of the replication gene A (repA) was positive only in 4 H, pylori isolates, 2 from GU and 2 from GU-DU.CONCLUSION: Differences exist in the genes of different H.pylori isolates. SSH is very effective to screen H. pylori strain specific DNA sequences between two clinical isolates

  1. Estimation of radon concentrations in coal mines using a hybrid technique calibration curve.

    Science.gov (United States)

    Jamil, K; Ali, S

    2001-01-01

    The results of epidemiological studies in various countries show that radon and its progeny cause carcinogenic effects on mine workers. Therefore, it becomes of paramount importance to monitor radon concentrations and consequently determine the radon dose rates in coal mines for the protection of coal miners. A new calibration curve was obtained for radon concentration estimation using hybrid techniques. A calibration curve was generated using 226Ra activity concentration measured by a HPGe detector-based gamma-ray spectrometer versus alpha-track-density rate due to radon and its progeny on CR-39 track detector. Using the slope of the experimentally determined curve in the units of Becqueral per kilogram (Bq kg-1) per unit alpha-track-density per hour (cm-2 h-1), radon concentrations (Bq m-3) were estimated using coal samples from various coal mines in two provinces of Pakistan, Punjab and Balochistan. Consequently, radon dose rates were computed in the simulated environment of the coal mines. Results of these computations may be considered with a caveat that the method developed in this paper provides only a screening method to indicate the radon dose in coal mines. It has been shown that the actual measurements of radon concentrations in the coal mines are in agreement with the estimated radon concentrations using the hybrid-technique calibration curve.

  2. Hybrid Model Testing Technique for Deep-Sea Platforms Based on Equivalent Water Depth Truncation

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    In this paper, an inner turret moored FPSO which works in the water of 320 m depth, is selected to study the so-called "passively-truncated + numerical-simulation" type of hybrid model testing technique while the truncated water depth is 160 m and the model scale λ=80. During the investigation, the optimization design of the equivalent-depth truncated system is performed by using the similarity of the static characteristics between the truncated system and the full depth one as the objective function. According to the truncated system, the corresponding physical test model is made. By adopting the coupling time domain simulation method, the truncated system model test is numerically reconstructed to carefully verify the computer simulation software and to adjust the corresponding hydrodynamic parameters. Based on the above work, the numerical extrapolation to the full depth system is performed by using the verified computer software and the adjusted hydrodynamic parameters. The full depth system model test is then performed in the basin and the results are compared with those from the numerical extrapolation. At last, the implementation procedure and the key technique of the hybrid model testing of the deep-sea platforms are summarized and printed. Through the above investigations, some beneficial conclusions are presented.

  3. Novel Hybrid Scheduling Technique for Sensor Nodes with Mixed Criticality Tasks

    Directory of Open Access Journals (Sweden)

    Mihai-Victor Micea

    2017-06-01

    Full Text Available Sensor networks become increasingly a key technology for complex control applications. Their potential use in safety- and time-critical domains has raised the need for task scheduling mechanisms specially adapted to sensor node specific requirements, often materialized in predictable jitter-less execution of tasks characterized by different criticality levels. This paper offers an efficient scheduling solution, named Hybrid Hard Real-Time Scheduling (H2RTS, which combines a static, clock driven method with a dynamic, event driven scheduling technique, in order to provide high execution predictability, while keeping a high node Central Processing Unit (CPU utilization factor. From the detailed, integrated schedulability analysis of the H2RTS, a set of sufficiency tests are introduced and demonstrated based on the processor demand and linear upper bound metrics. The performance and correct behavior of the proposed hybrid scheduling technique have been extensively evaluated and validated both on a simulator and on a sensor mote equipped with ARM7 microcontroller.

  4. Skill Assessment of An Hybrid Technique To Estimate Quantitative Precipitation Forecast For Galicia (nw Spain)

    Science.gov (United States)

    Lage, A.; Taboada, J. J.

    Precipitation is the most obvious of the weather elements in its effects on normal life. Numerical weather prediction (NWP) is generally used to produce quantitative precip- itation forecast (QPF) beyond the 1-3 h time frame. These models often fail to predict small-scale variations of rain because of spin-up problems and their coarse spatial and temporal resolution (Antolik, 2000). Moreover, there are some uncertainties about the behaviour of the NWP models in extreme situations (de Bruijn and Brandsma, 2000). Hybrid techniques, combining the benefits of NWP and statistical approaches in a flexible way, are very useful to achieve a good QPF. In this work, a new technique of QPF for Galicia (NW of Spain) is presented. This region has a percentage of rainy days per year greater than 50% with quantities that may cause floods, with human and economical damages. The technique is composed of a NWP model (ARPS) and a statistical downscaling process based on an automated classification scheme of at- mospheric circulation patterns for the Iberian Peninsula (J. Ribalaygua and R. Boren, 1995). Results show that QPF for Galicia is improved using this hybrid technique. [1] Antolik, M.S. 2000 "An Overview of the National Weather Service's centralized statistical quantitative precipitation forecasts". Journal of Hydrology, 239, pp:306- 337. [2] de Bruijn, E.I.F and T. Brandsma "Rainfall prediction for a flooding event in Ireland caused by the remnants of Hurricane Charley". Journal of Hydrology, 239, pp:148-161. [3] Ribalaygua, J. and Boren R. "Clasificación de patrones espaciales de precipitación diaria sobre la España Peninsular". Informes N 3 y 4 del Servicio de Análisis e Investigación del Clima. Instituto Nacional de Meteorología. Madrid. 53 pp.

  5. Array-based techniques for fingerprinting medicinal herbs

    Directory of Open Access Journals (Sweden)

    Xue Charlie

    2011-05-01

    Full Text Available Abstract Poor quality control of medicinal herbs has led to instances of toxicity, poisoning and even deaths. The fundamental step in quality control of herbal medicine is accurate identification of herbs. Array-based techniques have recently been adapted to authenticate or identify herbal plants. This article reviews the current array-based techniques, eg oligonucleotides microarrays, gene-based probe microarrays, Suppression Subtractive Hybridization (SSH-based arrays, Diversity Array Technology (DArT and Subtracted Diversity Array (SDA. We further compare these techniques according to important parameters such as markers, polymorphism rates, restriction enzymes and sample type. The applicability of the array-based methods for fingerprinting depends on the availability of genomics and genetics of the species to be fingerprinted. For the species with few genome sequence information but high polymorphism rates, SDA techniques are particularly recommended because they require less labour and lower material cost.

  6. A hybrid MAS/MoM technique for 2D impedance scatterers illuminated by closely positioned sources

    DEFF Research Database (Denmark)

    Larsen, Niels Vesterdal; Breinbjerg, Olav

    2005-01-01

    A hybrid technique for 2D scattering problems with impedance structures and closely positioned illuminating sources is presented. This technique combines the method of auxiliary sources (MAS) with a localized method of moments (MoM) region near the source. Significant improvements over standard MAS...

  7. WRHT: A Hybrid Technique for Detection of Wormhole Attack in Wireless Sensor Networks

    Directory of Open Access Journals (Sweden)

    Rupinder Singh

    2016-01-01

    Full Text Available Wormhole attack is a challenging security threat to wireless sensor networks which results in disrupting most of the routing protocols as this attack can be triggered in different modes. In this paper, WRHT, a wormhole resistant hybrid technique, is proposed, which can detect the presence of wormhole attack in a more optimistic manner than earlier techniques. WRHT is based on the concept of watchdog and Delphi schemes and ensures that the wormhole will not be left untreated in the sensor network. WRHT makes use of the dual wormhole detection mechanism of calculating probability factor time delay probability and packet loss probability of the established path in order to find the value of wormhole presence probability. The nodes in the path are given different ranking and subsequently colors according to their behavior. The most striking feature of WRHT consists of its capacity to defend against almost all categories of wormhole attacks without depending on any required additional hardware such as global positioning system, timing information or synchronized clocks, and traditional cryptographic schemes demanding high computational needs. The experimental results clearly indicate that the proposed technique has significant improvement over the existing wormhole attack detection techniques.

  8. Hybrid Clustering-GWO-NARX neural network technique in predicting stock price

    Science.gov (United States)

    Das, Debashish; Safa Sadiq, Ali; Mirjalili, Seyedali; Noraziah, A.

    2017-09-01

    Prediction of stock price is one of the most challenging tasks due to nonlinear nature of the stock data. Though numerous attempts have been made to predict the stock price by applying various techniques, yet the predicted price is not always accurate and even the error rate is high to some extent. Consequently, this paper endeavours to determine an efficient stock prediction strategy by implementing a combinatorial method of Grey Wolf Optimizer (GWO), Clustering and Non Linear Autoregressive Exogenous (NARX) Technique. The study uses stock data from prominent stock market i.e. New York Stock Exchange (NYSE), NASDAQ and emerging stock market i.e. Malaysian Stock Market (Bursa Malaysia), Dhaka Stock Exchange (DSE). It applies K-means clustering algorithm to determine the most promising cluster, then MGWO is used to determine the classification rate and finally the stock price is predicted by applying NARX neural network algorithm. The prediction performance gained through experimentation is compared and assessed to guide the investors in making investment decision. The result through this technique is indeed promising as it has shown almost precise prediction and improved error rate. We have applied the hybrid Clustering-GWO-NARX neural network technique in predicting stock price. We intend to work with the effect of various factors in stock price movement and selection of parameters. We will further investigate the influence of company news either positive or negative in stock price movement. We would be also interested to predict the Stock indices.

  9. Improved Framework for Breast Cancer Detection using Hybrid Feature Extraction Technique and FFNN

    Directory of Open Access Journals (Sweden)

    Ibrahim Mohamed Jaber Alamin

    2016-10-01

    Full Text Available Breast Cancer early detection using terminologies of image processing is suffered from the less accuracy performance in different automated medical tools. To improve the accuracy, still there are many research studies going on different phases such as segmentation, feature extraction, detection, and classification. The proposed framework is consisting of four main steps such as image preprocessing, image segmentation, feature extraction and finally classification. This paper presenting the hybrid and automated image processing based framework for breast cancer detection. For image preprocessing, both Laplacian and average filtering approach is used for smoothing and noise reduction if any. These operations are performed on 256 x 256 sized gray scale image. Output of preprocessing phase is used at efficient segmentation phase. Algorithm is separately designed for preprocessing step with goal of improving the accuracy. Segmentation method contributed for segmentation is nothing but the improved version of region growing technique. Thus breast image segmentation is done by using proposed modified region growing technique. The modified region growing technique overcoming the limitations of orientation as well as intensity. The next step we proposed is feature extraction, for this framework we have proposed to use combination of different types of features such as texture features, gradient features, 2D-DWT features with higher order statistics (HOS. Such hybrid feature set helps to improve the detection accuracy. For last phase, we proposed to use efficient feed forward neural network (FFNN. The comparative study between existing 2D-DWT feature extraction and proposed HOS-2D-DWT based feature extraction methods is proposed.

  10. Potentials of Optical Damage Assessment Techniques in Automotive Crash-Concepts composed of FRP-Steel Hybrid Material Systems

    Science.gov (United States)

    Dlugosch, M.; Spiegelhalter, B.; Soot, T.; Lukaszewicz, D.; Fritsch, J.; Hiermaier, S.

    2017-05-01

    With car manufacturers simultaneously facing increasing passive safety and efficiency requirements, FRP-metal hybrid material systems are one way to design lightweight and crashworthy vehicle structures. Generic automotive hybrid structural concepts have been tested under crash loading conditions. In order to assess the state of overall damage and structural integrity, and primarily to validate simulation data, several NDT techniques have been assessed regarding their potential to detect common damage mechanisms in such hybrid systems. Significant potentials were found particularly in combining 3D-topography laser scanning and X-Ray imaging results. Ultrasonic testing proved to be limited by the signal coupling quality on damaged or curved surfaces.

  11. 基于SSH+Ajax框架技术的MMS的研究与实现

    Institute of Scientific and Technical Information of China (English)

    张少龙

    2012-01-01

    针对B/S的MMS的建设与应用,提出基于SSH+Ajax技术架构的解决方案并具体实现,结果证明,SSH(Struts、Spring、Hibernate)技术架构能提高系统的可维护性、可扩展性并提高系统开发效率。

  12. Effects of a supersulfated low molecular weight heparin (IK-SSH) on different hemostatic parameters.

    Science.gov (United States)

    Glusa, E; Barthel, W; Schenk, J; Radziwon, P; Butti, A; Markwardt, F; Breddin, K H

    1998-01-01

    In a phase I trial effects of a new supersulfated low molecular weight heparin (IK-SSH) on different hemostatic parameters were investigated in healthy volunteers. Parameters studied were activated partial thromboplastin time (aPTT), thrombin time, Heptest, anti-activated factor II (anti-FIIa) and anti-activated factor X (anti-FXa) activity, platelet adhesion, platelet count, platelet-induced thrombin generation time (PITT), bleeding time, antithrombin III, fibrinogen and several safety parameters. After single intravenous (i.v.) injections of IK-SSH (0.14, 0.33 and 0.66 mg/kg) aPTT, Heptest and PITT were strongly and dose-dependently prolonged. After ascending subcutaneous (s.c.) doses of IK-SSH (0.33, 0.66 and 1 mg/kg) aPTT, Heptest and PITT were prolonged in a dose-dependent manner. Repeat s.c. injections of 1 mg/kg IK-SSH for 5 days markedly prolonged aPTT, Heptest and PITT. No cumulative effects were observed. Anti-FIIa and anti-FXa activity were not or only slightly increased. Bleeding time, thrombin time and platelet adhesion were not significantly changed after i.v. and s.c. injections of IK-SSH. However, tissue factor pathway inhibitor (TFPI) concentration was markedly increased after each injection of IK-SSH and returned to the preinjection value 24 h later. IK-SSH prolongs aPTT, Heptest and PITT in a similar manner as other low molecular weight heparins but without significantly affecting thrombin time, FIIa and FXa activity. The release of TFPI may well be responsible for the prolongation of aPTT, Heptest and PITT. IK-SSH may be further developed as an antithrombotic agent.

  13. Hydrophobicity control by a supercritical drying technique in a sol–gel process with hybrid materials

    Energy Technology Data Exchange (ETDEWEB)

    Ren, Hongbo; Qiao, Zemin; Liu, Xiao; Cui, Xudong, E-mail: xudcui@gmail.com

    2015-10-15

    Highlights: • Sol–gel route is combined with polymerization without using modifier. • Supercritical drying control is the key to obtain super-hydrophobic surfaces. • The whole fabrication is technologically controllable and with low costs. • The production rate is higher than 90%. • The method provides a cost-effective way for industry applications. - Abstract: We successfully synthesized one type of cheap super-hydrophobic hybrid porous materials in a sol–gel process. In this route, hydrophilic polymers and TEOS-base sol are used as precursors, the ultraviolet ray-initiated polymerization and supercritical fluid drying techniques are combined together to fulfill this task. All fabricated samples exhibit lotus-leaf-like surface structures with super-hydrophobicity. The underlying mechanisms are carefully investigated using a field-emission scanning electron microscopy (FESEM) and an X-ray photoelectron spectroscopy (XPS). We found that a well-controlled drying process is crucial to the formation of such super-hydrophobic surfaces. As high as 90% production rate is obtained in our route and thus, it might provide a cost-effective way to produce super-hydrophobic hybrid materials for industry applications.

  14. Adaptation of Hybrid FSO/RF Communication System Using Puncturing Technique

    Directory of Open Access Journals (Sweden)

    M. N. Khan

    2016-12-01

    Full Text Available Spectrum of radio frequency (RF communications is limited and expensive to install new applications. Free space optical (FSO communication is a viable technology which offers enormous bandwidth, license free installation, inexpensive deployment and error prone links. The FSO links degrade significantly due to the varying atmospheric and weather conditions (fog, cloud, snow, haze and combination of these. We propose a hybrid FSO/RF communication system which adapts the varying nature of atmosphere and weather. For the adaption of varying atmosphere and weather scenarios, we develop a novel optimization algorithm. The proposed algorithm is based on the well-known puncturing technique. We provide an extrinsic information transfer (EXIT chart for the binary and quaternary mapping scheme for the proposed communication system. We simulate the proposed algorithm for the hybrid communication system and analyze the system performance. The proposed algorithm is computationally less expensive and provide better performance gains over varying atmosphere and weather conditions. The algorithm is suitable for fast speed applications.

  15. Identifying genes related to choriogenesis in insect panoistic ovaries by Suppression Subtractive Hybridization

    Directory of Open Access Journals (Sweden)

    Bellés Xavier

    2009-04-01

    Full Text Available Abstract Background Insect ovarioles are classified into two categories: panoistic and meroistic, the later having apparently evolved from an ancestral panoistic type. Molecular data on oogenesis is practically restricted to meroistic ovaries. If we aim at studying the evolutionary transition from panoistic to meroistic, data on panoistic ovaries should be gathered. To this end, we planned the construction of a Suppression Subtractive Hybridization (SSH library to identify genes involved in panoistic choriogenesis, using the cockroach Blattella germanica as model. Results We constructed a post-vitellogenic ovary library by SSH to isolate genes involved in choriogenesis in B. germanica. The tester library was prepared with an ovary pool from 6- to 7-day-old females, whereas the driver library was prepared with an ovary pool from 3- to 4-day-old females. From the SSH library, we obtained 258 high quality sequences which clustered into 34 unique sequences grouped in 19 contigs and 15 singlets. The sequences were compared against non-redundant NCBI databases using BLAST. We found that 44% of the unique sequences had homologous sequences in known genes of other organisms, whereas 56% had no significant similarity to any of the databases entries. A Gene Ontology analysis was carried out, classifying the 34 sequences into different functional categories. Seven of these gene sequences, representative of different categories and processes, were chosen to perform expression studies during the first gonadotrophic cycle by real-time PCR. Results showed that they were mainly expressed during post-vitellogenesis, which validates the SSH technique. In two of them corresponding to novel genes, we demonstrated that they are specifically expressed in the cytoplasm of follicular cells in basal oocytes at the time of choriogenesis. Conclusion The SSH approach has proven to be useful in identifying ovarian genes expressed after vitellogenesis in B. germanica. For

  16. Screening of UV-B-induced genes from apple peels by SSH: possible involvement of MdCOP1-mediated signaling cascade genes in anthocyanin accumulation.

    Science.gov (United States)

    Peng, Ting; Saito, Takanori; Honda, Chikako; Ban, Yusuke; Kondo, Satoru; Liu, Ji-Hong; Hatsuyama, Yoshimichi; Moriguchi, Takaya

    2013-07-01

    Suppression subtractive hybridization (SSH) was employed to identify candidate genes involved in red coloration in apple peel with the ultraviolet (UV)-B-treated 'Mutsu'. After reverse Northern blotting verification, nearly 80 clones were successfully sequenced. Large portions of the expressed sequence tags (ESTs) are well characterized anthocyanin biosynthesis-related genes, such as chalcone synthase (11A5), flavonol synthase (12F3), anthocyanidin synthase (11H5) and UDP-glycosyl transferase (14A12) whose presence proved the success of SSH. Eight ESTs were selected for quantitative real-time polymerase chain reaction analysis and their expressions were all elevated in 'Induction', further confirming the reliability of the SSH library. One EST, 11F4 (CONSTITUTIVE PHOTOMORPHOGENIC 1: COP1) with putative function in light signal relay was further analyzed in 'Mutsu' and 'Tsugaru', along with MdHY5 (ELONGATED HYPOCOTYL 5: the downstream target of COP1), MdMYB22 (a possible flavonol-specific activator under the regulation of HY5, belonging to the SG7/PRODUCTION OF FLAVONOL GLYCOSIDES family) and MdMYBA. Results showed that MdCOP1, MdHY5, MdMYB22 and MdMYBA were all UV-B inducible genes and anthocyanin accumulation occurred after their increased expressions. Moreover, their expressions and anthocyanin content were enhanced under UV-B plus 17°C treatment. The presence of G box, a known consensus binding site of HY5, in the MdMYBA promoter region implicated that it could be regulated by MdHY5, which was verified by the result of the yeast one-hybrid analysis. Our data suggested that UV-B irradiation would induce the utmost upstream light signaling factor, MdCOP1, which activates MdHY5 signaling by binding to the promoter regions of MdMYBs, and finally leads to the red coloration of apple peels.

  17. A millisecond micro-RNA separation technique by a hybrid structure of nanopillars and nanoslits.

    Science.gov (United States)

    Wu, Qiong; Kaji, Noritada; Yasui, Takao; Rahong, Sakon; Yanagida, Takeshi; Kanai, Masaki; Nagashima, Kazuki; Tokeshi, Manabu; Kawai, Tomoji; Baba, Yoshinobu

    2017-03-08

    A millisecond micro-RNA separation of a mixture of total RNA and genomic DNA, extracted from cultured HeLa cells, was successfully achieved using a hybrid structure of nanopillars and nanoslits contained inside a microchannel. The nanopillars, 250-nm in diameter and 100-nm in height, were fabricated with a 750-nm space inside the nanoslits, which were 100-nm in height and 25-μm in width; the nanopillars were then applied as a new sieve matrix. This ultra-fast technique for the separation of miRNA can be an effective pretreatment for semiconductor nanopore DNA sequencing, which has an optimum reading speed of 1 base/ms to obtain effective signal-to-noise ratio and discriminate each base by ion or tunneling current during the passage of nucleic acids.

  18. Modified Genetic Algorithm for DNA Sequence Assembly by Shotgun and Hybridization Sequencing Techniques

    Directory of Open Access Journals (Sweden)

    Prof.Narayan Kumar Sahu

    2012-09-01

    Full Text Available Since the advent of rapid DNA sequencing methods in 1976, scientists have had the problem of inferring DNA sequences from sequenced fragments. Shotgun sequencing is a well-established biological and computational method used in practice. Many conventional algorithms for shotgun sequencing are based on the notion of pair wise fragment overlap. While shotgun sequencing infers a DNA sequence given the sequences of overlapping fragments, a recent and complementary method, called sequencing by hybridization (SBH, infers a DNA sequence given the set of oligomers that represents all sub words of some fixed length, k. In this paper, we propose a new computer algorithm for DNA sequence assembly that combines in a novel way the techniques of both shotgun and SBH methods. Based on our preliminary investigations, the algorithm promises- to be very fast and practical for DNA sequence assembly [1].

  19. Dual Fixation of Calcaneal Tuberosity Avulsion with Concomitant Achilles Tendon Rupture: A Novel Hybrid Technique

    Directory of Open Access Journals (Sweden)

    Gautham Prabhakar

    2017-01-01

    Full Text Available Fracture of the calcaneal tuberosity with a concomitant Achilles tendon rupture presents a difficult challenge for the treating surgeon. The ultimate goal of treatment is to restore function of both the gastrocnemius-soleus complex and the Achilles tendon. This particular subset of fractures occurs often in diabetics and elderly patients with osteoporosis making fixation of the displaced fragment rather complex. If the Achilles tendon disruption is only discovered later once the fracture is healed, subsequent management is difficult with surgical treatment being more morbid. While this is a rare injury, the consequences of a missed chronic Achilles tendon disruption are severe with significant dysfunction. It is therefore important to have a high index of suspicion for concomitant injury and to be prepared for dual fixation. We present a novel hybrid surgical fixation technique, which may be used in this instance.

  20. Estimation of radon concentrations in coal mines using a hybrid technique calibration curve

    Energy Technology Data Exchange (ETDEWEB)

    Jamil, K.; Ali, S. [PINSTECH, Islamabad (Pakistan). Radiation Physics Division, Environmental Radiation Group

    2001-07-01

    A calibration curve was generated using Ra-226 activity concentration measured by a HPGe detector-based gamma-ray spectrometer versus alpha-track-density rate due to radon and its progeny on CR-39 track detector. Using the slops of the experimentally determined curve in the units of Becquerel per kilogram (Bq kg{sup -1}) per unit alpha -track-density per hour (cm{sup -2}h{sup -1}), radon concentrations (Bq m{sup -3}) were estimated using coal samples from various coal mines in two provinces of Pakistan, Punjab and Balochistan. Consequently, radon dose rates were computed in the simulated environment of the coal mines. These results provide only a screening method to indicate the radon dose in coal mines, It was shown that the actual measurements of radon concentrations in the coal mines are in agreement with the estimated radon concentrations using the hybrid-technique calibration curve.

  1. A millisecond micro-RNA separation technique by a hybrid structure of nanopillars and nanoslits

    Science.gov (United States)

    Wu, Qiong; Kaji, Noritada; Yasui, Takao; Rahong, Sakon; Yanagida, Takeshi; Kanai, Masaki; Nagashima, Kazuki; Tokeshi, Manabu; Kawai, Tomoji; Baba, Yoshinobu

    2017-01-01

    A millisecond micro-RNA separation of a mixture of total RNA and genomic DNA, extracted from cultured HeLa cells, was successfully achieved using a hybrid structure of nanopillars and nanoslits contained inside a microchannel. The nanopillars, 250-nm in diameter and 100-nm in height, were fabricated with a 750-nm space inside the nanoslits, which were 100-nm in height and 25-μm in width; the nanopillars were then applied as a new sieve matrix. This ultra-fast technique for the separation of miRNA can be an effective pretreatment for semiconductor nanopore DNA sequencing, which has an optimum reading speed of 1 base/ms to obtain effective signal-to-noise ratio and discriminate each base by ion or tunneling current during the passage of nucleic acids. PMID:28272420

  2. Development of a fluorescent in situ hybridization (FISH) technique for visualizing CGMMV in plant tissues.

    Science.gov (United States)

    Shargil, D; Zemach, H; Belausov, E; Lachman, O; Kamenetsky, R; Dombrovsky, A

    2015-10-01

    Cucumber green mottle mosaic virus (CGMMV), which belongs to the genus Tobamovirus, is a major pathogen of cucurbit crops grown indoors and in open fields. Currently, immunology (e.g., ELISA) and molecular amplification techniques (e.g., RT-PCR) are employed extensively for virus detection in plant tissues and commercial seed lots diagnostics. In this study, a fluorescent in situ hybridization (FISH) technique, using oligonucleotides whose 5'-terminals were labeled with red cyanine 3 (Cy3) or green fluorescein isothiocyanate (FITC), was developed for the visualization of the pathogen in situ. This simple and reliable method allows detection and localization of CGMMV in the vegetative and reproductive tissues of cucumber and melon. When this technique was applied in male flowers, anther tissues were found to be infected; whereas the pollen grains were found to be virus-free. These results have meaningful epidemiological implications for the management of CGMMV, particularly with regard to virus transfer via seed and the role of insects as CGMMV vectors.

  3. A hybrid technique for private location-based queries with database protection

    KAUST Repository

    Ghinita, Gabriel

    2009-01-01

    Mobile devices with global positioning capabilities allow users to retrieve points of interest (POI) in their proximity. To protect user privacy, it is important not to disclose exact user coordinates to un-trusted entities that provide location-based services. Currently, there are two main approaches to protect the location privacy of users: (i) hiding locations inside cloaking regions (CRs) and (ii) encrypting location data using private information retrieval (PIR) protocols. Previous work focused on finding good trade-offs between privacy and performance of user protection techniques, but disregarded the important issue of protecting the POI dataset D. For instance, location cloaking requires large-sized CRs, leading to excessive disclosure of POIs (O(|D|) in the worst case). PIR, on the other hand, reduces this bound to , but at the expense of high processing and communication overhead. We propose a hybrid, two-step approach to private location-based queries, which provides protection for both the users and the database. In the first step, user locations are generalized to coarse-grained CRs which provide strong privacy. Next, a PIR protocol is applied with respect to the obtained query CR. To protect excessive disclosure of POI locations, we devise a cryptographic protocol that privately evaluates whether a point is enclosed inside a rectangular region. We also introduce an algorithm to efficiently support PIR on dynamic POI sub-sets. Our method discloses O(1) POI, orders of magnitude fewer than CR- or PIR-based techniques. Experimental results show that the hybrid approach is scalable in practice, and clearly outperforms the pure-PIR approach in terms of computational and communication overhead. © 2009 Springer Berlin Heidelberg.

  4. An Alternate Vista in Rehabilitation of Cranial Defects: Combining Digital and Manual Techniques to Fabricate a Hybrid Cranioplast.

    Science.gov (United States)

    Kaur, Harsimran; Nanda, Aditi; Koli, Dheeraj; Verma, Mahesh; Singh, Hukum; Bishnoi, Ishu; Pathak, Pooja; Gupta, Ankur

    2015-06-01

    The desired features of a cranioplast include providing an acceptable contour, continuity with the remaining skull (marginal adaptation), improvising the aesthetic outcome, providing a strengthened prosthesis to avoid fracture in case of repeat trauma, and protecting the remaining neurological structures. Combining digital and manual techniques to fabricate a hybrid polymethylmethacrylate cranioplast during the rehabilitation of a pediatric patient with cranial defect has been described. Utilization of digital techniques (rapid prototyping to obtain skull analog) and manual (hand) sculpting of the prosthesis strengthened with glass fiber enabled the authors to fabricate a hybrid cranioplast. Satisfactory outcome was achieved.

  5. A novel fluorescent in situ hybridization technique for detection of Rickettsia spp. in archival samples

    DEFF Research Database (Denmark)

    Svendsen, Claus Bo; Boye, Mette; Struve, Carsten

    2009-01-01

    A novel, sensitive and specific method for detecting Rickettsia spp. in archival samples is described. The method involves the use of fluorescently marked oligonucleotide probes for in situ hybridization. Specific hybridization of Ricekttsia was found without problems of cross-reactions with bact......A novel, sensitive and specific method for detecting Rickettsia spp. in archival samples is described. The method involves the use of fluorescently marked oligonucleotide probes for in situ hybridization. Specific hybridization of Ricekttsia was found without problems of cross...

  6. Genetic differences between two Leishmania major-like strains revealed by suppression subtractive hybridization.

    Science.gov (United States)

    Wu, Ângela C A; Freitas, Michelle A R; Silva, Soraia de O; Nogueira, Paula M; Soares, Rodrigo P; Pesquero, João Bosco; Gomes, Maria A; Pesquero, Jorge L; Melo, Maria N

    2015-01-01

    Leishmania major, the causative agent of zoonotic leishmaniasis, is restricted to Old World countries. Molecular and biochemical techniques have been used to identify some L. major-like isolated in South America including Brazil. Here, two L. major-like strains, one virulent (BH49) and one non-virulent (BH121), were subjected to suppression subtractive hybridization (SSH) technique in order to identify differentially expressed genes. SSH technique identified nine cDNA fragments exhibiting high homology to previously sequenced L. major genes. Five cDNAs (four specific for BH49 and one for BH121) were confirmed by RT-PCR. Among those differentially expressed subtracted genes, some were involved in physiological processes including metabolism, translation and destination of proteins, production of energy, virulence factors and unknown functions. Western-blot analysis confirmed a higher expression level of β-1,3-galactosyl residues in L. major-like lipophosphoglycan (LPG). This molecular analysis opens the possibility for identification of potential virulence factors not only in different strains, but also in others species of Leishmania.

  7. Organic Scintillators in Nonproliferation Applications With a Hybridized Double-Pulse Rejection Technique

    Science.gov (United States)

    Bourne, Mark Mitchell

    Alternative detection technologies are crucial to meeting demand for neutron detectors, for the current production of He-3, which has been the classical neutron choice, is insufficient. Organic scintillators are a strong candidate as a He-3 alternative due to their high efficiency, fast timing properties, and capabilities for separately identifying gamma-rays and neutrons through pulse shape discrimination (PSD). However, the use of organic scintillators in environments with numerous gamma rays can be limited because overlapping gamma-ray events can be misclassified as neutron events during PSD. To solve this problem, a new, hybridized double-pulse cleaning technique, consisting of three separate cleaning algorithms, was developed. The technique removes gamma-ray double pulses while preserving as many neutron pulses as possible. This technique was applied to separate experiments of Cf-252 and a gamma-ray source when measuring at a 100-kHz count rate and a field of 1000 incident gamma rays per incident neutron. It was found that stilbene scintillators were capable of intrinsic neutron efficiencies between 15-19% when measuring bare Cf-252 and 13-17% when exposed to the gamma-ray field. Misclassification rates ranged from 10-6-10-5, a factor-of-5 better than both the EJ-309 liquid and BB3-5 plastic. Next, plutonium experiments were performed with stilbene to determine which cleaning algorithm was best for each sample. A clear correlation was found that related the correct method of cleaning to the measured gamma ray-to-neutron ratio. When the measured gamma ray-to-neutron ratio is 10 or below, the template cleaning algorithm is preferred, while the fractional and hybrid cleaning algorithms are preferred when the gamma ray-to-neutron ratio is 100 or greater. Discriminating neutron sources such as Cf-252 or AmLi from SNM samples such as plutonium is a top priority in nonproliferation. We demonstrate that time-correlated experiments, utilizing both PSD-capable plastic

  8. A Discrete Wavelet Based Feature Extraction and Hybrid Classification Technique for Microarray Data Analysis

    Directory of Open Access Journals (Sweden)

    Jaison Bennet

    2014-01-01

    Full Text Available Cancer classification by doctors and radiologists was based on morphological and clinical features and had limited diagnostic ability in olden days. The recent arrival of DNA microarray technology has led to the concurrent monitoring of thousands of gene expressions in a single chip which stimulates the progress in cancer classification. In this paper, we have proposed a hybrid approach for microarray data classification based on nearest neighbor (KNN, naive Bayes, and support vector machine (SVM. Feature selection prior to classification plays a vital role and a feature selection technique which combines discrete wavelet transform (DWT and moving window technique (MWT is used. The performance of the proposed method is compared with the conventional classifiers like support vector machine, nearest neighbor, and naive Bayes. Experiments have been conducted on both real and benchmark datasets and the results indicate that the ensemble approach produces higher classification accuracy than conventional classifiers. This paper serves as an automated system for the classification of cancer and can be applied by doctors in real cases which serve as a boon to the medical community. This work further reduces the misclassification of cancers which is highly not allowed in cancer detection.

  9. A Polar Fuzzy Control Scheme for Hybrid Power System Using Vehicle-To-Grid Technique

    Directory of Open Access Journals (Sweden)

    Mohammed Elsayed Lotfy

    2017-07-01

    Full Text Available A novel polar fuzzy (PF control approach for a hybrid power system is proposed in this research. The proposed control scheme remedies the issues of system frequency and the continuity of demand supply caused by renewable sources’ uncertainties. The hybrid power system consists of a wind turbine generator (WTG, solar photovoltaics (PV, a solar thermal power generator (STPG, a diesel engine generator (DEG, an aqua-electrolyzer (AE, an ultra-capacitor (UC, a fuel-cell (FC, and a flywheel (FW. Furthermore, due to the high cost of the battery energy storage system (BESS, a new idea of vehicle-to-grid (V2G control is applied to use the battery of the electric vehicle (EV as equivalent to large-scale energy storage units instead of small batteries to improve the frequency stability of the system. In addition, EV customers’ convenience is taken into account. A minimal-order observer is used to estimate the supply error. Then, the area control error (ACE signal is calculated in terms of the estimated supply error and the frequency deviation. ACE is considered in the frequency domain. Two PF approaches are utilized in the intended system. The mission of each controller is to mitigate one frequency component of ACE. The responsibility for ACE compensation is shared among all parts of the system according to their speed of response. The performance of the proposed control scheme is compared to the conventional fuzzy logic control (FLC. The effectiveness and robustness of the proposed control technique are verified by numerical simulations under various scenarios.

  10. Analysis of SSH library of rice variety Aganni reveals candidate gall midge resistance genes.

    Science.gov (United States)

    Divya, Dhanasekar; Singh, Y Tunginba; Nair, Suresh; Bentur, J S

    2016-03-01

    The Asian rice gall midge, Orseolia oryzae, is a serious insect pest causing extensive yield loss. Interaction between the gall midge and rice genotypes is known to be on a gene-for-gene basis. Here, we report molecular basis of HR- (hypersensitive reaction-negative) type of resistance in Aganni (an indica rice variety possessing gall midge resistance gene Gm8) through the construction and analysis of a suppressive subtraction hybridization (SSH) cDNA library. In all, 2,800 positive clones were sequenced and analyzed. The high-quality ESTs were assembled into 448 non-redundant gene sequences. Homology search with the NCBI databases, using BlastX and BlastN, revealed that 73% of the clones showed homology to genes with known function and majority of ESTs belonged to the gene ontology category 'biological process'. Validation of 27 putative candidate gall midge resistance genes through real-time PCR, following gall midge infestation, in contrasting parents and their derived pre-NILs (near isogenic lines) revealed induction of specific genes related to defense and metabolism. Interestingly, four genes, belonging to families of leucine-rich repeat (LRR), heat shock protein (HSP), pathogenesis related protein (PR), and NAC domain-containing protein, implicated in conferring HR+ type of resistance, were found to be up-regulated in Aganni. Two of the reactive oxygen intermediates (ROI)-scavenging-enzyme-coding genes Cytosolic Ascorbate Peroxidase1, 2 (OsAPx1 and OsAPx2) were found up-regulated in Aganni in incompatible interaction possibly suppressing HR. We suggest that Aganni has a deviant form of inducible, salicylic acid (SA)-mediated resistance but without HR.

  11. Diagnostic accuracy: theoretical models for preimplantation genetic testing of a single nucleus using the fluorescence in situ hybridization technique

    NARCIS (Netherlands)

    P.N. Scriven; P.M.M. Bossuyt

    2010-01-01

    The aim of this study was to develop and use theoretical models to investigate the accuracy of the fluorescence in situ hybridization (FISH) technique in testing a single nucleus from a preimplantation embryo without the complicating effect of mosaicism. Mathematical models were constructed for thre

  12. Silica/polyacrylonitrile hybrid nanofiber membrane separators via sol-gel and electrospinning techniques for lithium-ion batteries

    Science.gov (United States)

    Yanilmaz, Meltem; Lu, Yao; Zhu, Jiadeng; Zhang, Xiangwu

    2016-05-01

    Silica/polyacrylonitrile (SiO2/PAN) hybrid nanofiber membranes were fabricated by using sol-gel and electrospinning techniques and their electrochemical performance was evaluated for use as separators in lithium-ion batteries. The aim of this study was to design high-performance separator membranes with enhanced electrochemical performance and good thermal stability compared to microporous polyolefin membranes. In this study, SiO2 nanoparticle content up to 27 wt% was achieved in the membranes by using sol-gel technique. It was found that SiO2/PAN hybrid nanofiber membranes had superior electrochemical performance with good thermal stability due to their high SiO2 content and large porosity. Compared with commercial microporous polyolefin membranes, SiO2/PAN hybrid nanofiber membranes had larger liquid electrolyte uptake, higher electrochemical oxidation limit, and lower interfacial resistance with lithium. SiO2/PAN hybrid nanofiber membranes with different SiO2 contents (0, 16, 19 and 27 wt%) were also assembled into lithium/lithium iron phosphate cells, and high cell capacities and good cycling performance were demonstrated at room temperature. In addition, cells using SiO2/PAN hybrid nanofiber membranes with high SiO2 contents showed superior C-rate performance compared to those with low SiO2 contents and commercial microporous polyolefin membrane.

  13. A novel hybrid meta-heuristic technique applied to the well-known benchmark optimization problems

    Science.gov (United States)

    Abtahi, Amir-Reza; Bijari, Afsane

    2016-09-01

    In this paper, a hybrid meta-heuristic algorithm, based on imperialistic competition algorithm (ICA), harmony search (HS), and simulated annealing (SA) is presented. The body of the proposed hybrid algorithm is based on ICA. The proposed hybrid algorithm inherits the advantages of the process of harmony creation in HS algorithm to improve the exploitation phase of the ICA algorithm. In addition, the proposed hybrid algorithm uses SA to make a balance between exploration and exploitation phases. The proposed hybrid algorithm is compared with several meta-heuristic methods, including genetic algorithm (GA), HS, and ICA on several well-known benchmark instances. The comprehensive experiments and statistical analysis on standard benchmark functions certify the superiority of the proposed method over the other algorithms. The efficacy of the proposed hybrid algorithm is promising and can be used in several real-life engineering and management problems.

  14. A novel hybrid meta-heuristic technique applied to the well-known benchmark optimization problems

    Science.gov (United States)

    Abtahi, Amir-Reza; Bijari, Afsane

    2017-09-01

    In this paper, a hybrid meta-heuristic algorithm, based on imperialistic competition algorithm (ICA), harmony search (HS), and simulated annealing (SA) is presented. The body of the proposed hybrid algorithm is based on ICA. The proposed hybrid algorithm inherits the advantages of the process of harmony creation in HS algorithm to improve the exploitation phase of the ICA algorithm. In addition, the proposed hybrid algorithm uses SA to make a balance between exploration and exploitation phases. The proposed hybrid algorithm is compared with several meta-heuristic methods, including genetic algorithm (GA), HS, and ICA on several well-known benchmark instances. The comprehensive experiments and statistical analysis on standard benchmark functions certify the superiority of the proposed method over the other algorithms. The efficacy of the proposed hybrid algorithm is promising and can be used in several real-life engineering and management problems.

  15. A hybrid PSO technique for procuring VAR ancillary service in the deregulated electricity markets

    Energy Technology Data Exchange (ETDEWEB)

    El-Araby, E.E. [Department of Electrical Engineering, Suez Canal University (Egypt); Yorino, Naoto [Department of Artificial Complex Systems Engineering, Hiroshima University (Japan)

    2010-07-15

    This paper develops a new market-based technique for acquiring VAR ancillary service in the electricity market. The main objective of the developed market is to enable transmission operator ''TO'' to procure VAR service in a long term contract from the critical VAR providers that satisfy minimum VAR service payment while maintaining system security. Reactive power control problem for voltage stability is introduced into the VAR market problem in an explicit manner for normal and emergency states. An integration of particle swarm optimization ''PSO'' is presented with successive linear programming ''SLP'' for dealing with the VAR ancillary service problem. The problem is formulated as a large-scale nonlinear constrained optimization problem with a non-differentiable objective function representing VAR payment and operational costs. This type of problem is hard to be treated straightforwardly by the classical optimization methods. Therefore, we propose here a two-layer hybrid PSO/SLP approach, which is suited for carrying out the difficulties associated with non-differentiable and discontinuous objective functions. The proposed method has been examined on the standard IEEE 57 bus-system and compared with GA/SLP method to demonstrate its capability. (author)

  16. Optimization of RF power absorption by optimization techniques using the lower hybrid current drive of FTU

    Energy Technology Data Exchange (ETDEWEB)

    Centioli, C. [Associazione Euratom/ENEA Sulla Fusione, Centro Ricerche Frascati, Via E. Fermi 45, CP 65, 00044 Frascati, Rome (Italy); Iannone, F. [Associazione Euratom/ENEA Sulla Fusione, Centro Ricerche Frascati, Via E. Fermi 45, CP 65, 00044 Frascati, Rome (Italy); Mazza, G. [Associazione Euratom/ENEA Sulla Fusione, Centro Ricerche Frascati, Via E. Fermi 45, CP 65, 00044 Frascati, Rome (Italy); Panella, M. [Associazione Euratom/ENEA Sulla Fusione, Centro Ricerche Frascati, Via E. Fermi 45, CP 65, 00044 Frascati, Rome (Italy); Pangione, L. [Dipartimento di Informatica, Sistemi e Produzione, Universita di Roma, Tor Vergata, Via del Politecnico 1, 00133 Rome (Italy)]. E-mail: pangione@frascati.enea.it; Podda, S. [Associazione Euratom/ENEA Sulla Fusione, Centro Ricerche Frascati, Via E. Fermi 45, CP 65, 00044 Frascati, Rome (Italy); Tuccillo, A. [Associazione Euratom/ENEA Sulla Fusione, Centro Ricerche Frascati, Via E. Fermi 45, CP 65, 00044 Frascati, Rome (Italy); Vitale, V. [Associazione Euratom/ENEA Sulla Fusione, Centro Ricerche Frascati, Via E. Fermi 45, CP 65, 00044 Frascati, Rome (Italy); Zaccarian, L. [Dipartimento di Informatica, Sistemi e Produzione, Universita di Roma, Tor Vergata, Via del Politecnico 1, 00133 Rome (Italy)

    2005-11-15

    In this paper, we will report on the experimental results arising from the implementation of optimization techniques to maximize the RF power coupling versus the plasma conditions in the FTU experimental facility. These experiments are carried out by employing the open-source Linux-RTAI control system currently running on the FTU digital feedback loop. The RF power source under consideration is a lower hybrid system (LH) based on six gyrotrons with a nominal power output capability of 1.1 MW each. The optimization of the coupling level between the plasma and the emitting antenna reduces the reflected power, thus maximizing the heating effects in addition to avoiding danger to the emitter (equivalently, annoying safety shutdowns of the system). To this aim, the plasma displacement is modified by suitably adjusting the reference input to the stabilizing feedback, according to a steepest descent algorithm. It will be shown in the paper how this algorithm achieves a satisfactory level of robustness with respect to measurement errors and well performs both in simulation and in experimental tests, thus leading to an improved effectiveness of the RF heating system.

  17. Hybrid LS-LMMSE Channel Estimation Technique for LTE Downlink Systems

    CERN Document Server

    Khlifi, Abdelhakim; 10.5121/ijngn.2011.3401

    2012-01-01

    In this paper, we propose to improve the performance of the channel estimation for LTE Downlink systems under the effect of the channel length. As LTE Downlink system is a MIMO-OFDMA based system, a cyclic prefix (CP) is inserted at the beginning of each transmitted OFDM symbol in order to mitigate both inter-carrier interference (ICI) and inter-symbol interference (ISI). The inserted CP is usually equal to or longer than the channel length. However, the cyclic prefix can be shorter because of some unforeseen channel behaviour. Previous works have shown that in the case where the cyclic prefix is equal to or longer than the channel length, LMMSE performs better than LSE but at the cost of computational complexity .In the other case, LMMSE performs also better than LS only for low SNR values. However, LS shows better performance for LTE Downlink systems for high SNR values. Therefore, we propose a hybrid LS-LMMSE channel estimation technique robust to the channel length effect. MATLAB Monte-Carlo simulations a...

  18. Power Management Based Current Control Technique for Photovoltaic-Battery Assisted Wind-Hydro Hybrid System

    Science.gov (United States)

    Ram Prabhakar, J.; Ragavan, K.

    2013-07-01

    This article proposes new power management based current control strategy for integrated wind-solar-hydro system equipped with battery storage mechanism. In this control technique, an indirect estimation of load current is done, through energy balance model, DC-link voltage control and droop control. This system features simpler energy management strategy and necessitates few power electronic converters, thereby minimizing the cost of the system. The generation-demand (G-D) management diagram is formulated based on the stochastic weather conditions and demand, which would likely moderate the gap between both. The features of management strategy deploying energy balance model include (1) regulating DC-link voltage within specified tolerances, (2) isolated operation without relying on external electric power transmission network, (3) indirect current control of hydro turbine driven induction generator and (4) seamless transition between grid-connected and off-grid operation modes. Furthermore, structuring of the hybrid system with appropriate selection of control variables enables power sharing among each energy conversion systems and battery storage mechanism. By addressing these intricacies, it is viable to regulate the frequency and voltage of the remote network at load end. The performance of the proposed composite scheme is demonstrated through time-domain simulation in MATLAB/Simulink environment.

  19. Using ssh as portal - The CMS CRAB over glideinWMS experience

    CERN Document Server

    Belforte, Stefano; Letts, James; Fanzago, Federica; Saiz Santos, Maria Dolores; Martin, Terrence

    2013-01-01

    The User Analysis of the CMS experiment is performed in distributed way usingboth Grid and dedicated resources. In order to insulate the users from the details of computing fabric, CMS relies on the CRAB (CMS Remote Analysis Builder) package as an abstraction layer. CMS has recently switched from a client-server version of CRAB to a purely client-based solution, with ssh being used to interface with HTCondor-based glideinWMS batch system. This switch has resulted in significant improvement of user satisfaction, as well as in significant simplification of the CRAB code base and of the operation support. This paper presents the architecture of the ssh-based CRAB package, the rationale behind it, as well as the operational experience running both the client-server and the ssh-based versions in parallel forseveral months.

  20. Performance improvement of hybrid subcarrier multiplexing optical spectrum code division multiplexing system using spectral direct decoding detection technique

    Science.gov (United States)

    Sahbudin, R. K. Z.; Abdullah, M. K.; Mokhtar, M.

    2009-06-01

    This paper proposes a hybrid subcarrier multiplexing/optical spectrum code division multiplexing (SCM/OSCDM) system for the purpose of combining the advantages of both techniques. Optical spectrum code division multiple-access (OSCDMA) is one of the multiplexing techniques that is becoming popular because of the flexibility in the allocation of channels, ability to operate asynchronously, enhanced privacy and increased capacity in bursty nature networks. On the other hand, subcarrier multiplexing (SCM) technique is able to enhance the channel data rate of OSCDMA systems. In this paper, a newly developed detection technique for the OSCDM called spectral direct decoding (SDD) detection technique is compared mathematically with the AND subtraction detection technique. The system utilizes a new unified code construction named KS (Khazani-Syed) code. The results characterizing the bit-error-rate (BER) show that SDD offers a significant improved performance at BER of 10 -9.

  1. Isolation, identification and expression analysis of salt-induced genes in Suaeda maritima, a natural halophyte, using PCR-based suppression subtractive hybridization

    Directory of Open Access Journals (Sweden)

    Sahu Binod B

    2009-06-01

    Full Text Available Abstract Background Despite wealth of information generated on salt tolerance mechanism, its basics still remain elusive. Thus, there is a need of continued effort to understand the salt tolerance mechanism using suitable biotechnological techniques and test plants (species to enable development of salt tolerant cultivars of interest. Therefore, the present study was undertaken to generate information on salt stress responsive genes in a natural halophyte, Suaeda maritima, using PCR-based suppression subtractive hybridization (PCR-SSH technique. Results Forward and reverse SSH cDNA libraries were constructed after exposing the young plants to 425 mM NaCl for 24 h. From the forward SSH cDNA library, 429 high quality ESTs were obtained. BLASTX search and TIGR assembler programme revealed overexpression of 167 unigenes comprising 89 singletons and 78 contigs with ESTs redundancy of 81.8%. Among the unigenes, 32.5% were found to be of special interest, indicating novel function of these genes with regard to salt tolerance. Literature search for the known unigenes revealed that only 17 of them were salt-inducible. A comparative analysis of the existing SSH cDNA libraries for NaCl stress in plants showed that only a few overexpressing unigenes were common in them. Moreover, the present study also showed increased expression of phosphoethanolamine N-methyltransferase gene, indicating the possible accumulation of a much studied osmoticum, glycinebetaine, in halophyte under salt stress. Functional categorization of the proteins as per the Munich database in general revealed that salt tolerance could be largely determined by the proteins involved in transcription, signal transduction, protein activity regulation and cell differentiation and organogenesis. Conclusion The study provided a clear indication of possible vital role of glycinebetaine in the salt tolerance process in S. maritima. However, the salt-induced expression of a large number of genes

  2. Suppression Subtractive Hybridization Versus Next-Generation Sequencing in Plant Genetic Engineering: Challenges and Perspectives.

    Science.gov (United States)

    Sahebi, Mahbod; Hanafi, Mohamed M; Azizi, Parisa; Hakim, Abdul; Ashkani, Sadegh; Abiri, Rambod

    2015-10-01

    Suppression subtractive hybridization (SSH) is an effective method to identify different genes with different expression levels involved in a variety of biological processes. This method has often been used to study molecular mechanisms of plants in complex relationships with different pathogens and a variety of biotic stresses. Compared to other techniques used in gene expression profiling, SSH needs relatively smaller amounts of the initial materials, with lower costs, and fewer false positives present within the results. Extraction of total RNA from plant species rich in phenolic compounds, carbohydrates, and polysaccharides that easily bind to nucleic acids through cellular mechanisms is difficult and needs to be considered. Remarkable advancement has been achieved in the next-generation sequencing (NGS) field. As a result of progress within fields related to molecular chemistry and biology as well as specialized engineering, parallelization in the sequencing reaction has exceptionally enhanced the overall read number of generated sequences per run. Currently available sequencing platforms support an earlier unparalleled view directly into complex mixes associated with RNA in addition to DNA samples. NGS technology has demonstrated the ability to sequence DNA with remarkable swiftness, therefore allowing previously unthinkable scientific accomplishments along with novel biological purposes. However, the massive amounts of data generated by NGS impose a substantial challenge with regard to data safe-keeping and analysis. This review examines some simple but vital points involved in preparing the initial material for SSH and introduces this method as well as its associated applications to detect different novel genes from different plant species. This review evaluates general concepts, basic applications, plus the probable results of NGS technology in genomics, with unique mention of feasible potential tools as well as bioinformatics.

  3. [Construction of SSH library from haemocyte of variously colored abalone challenged with bacteria and differential expression analysis of macrophage expressed protein].

    Science.gov (United States)

    Ren, Hong-Lin; Xu, Dan-Dan; Qiao, Kun; Cai, Ling; Huang, Wei-Bin; Zhang, Nai; Wang, Ke-Jian

    2008-08-01

    Abalones are considered to be the most precious delicacy from the sea, and become very important commercial seafood in aquaculture worldwide. Variously colored abalone (Haliotis diversicolor Reeve, 1846) has been widely cultured on the southeast coast for more than twenty years. However, abalone culture frequently suffers from bacterial infection and mass mortality of reared abalones causes serious economic losses. Unfortunately, knowledge of the defense mechanism in this animal is still lacking. In this study, using suppression subtractive hybridization (SSH) technology, a forward SSH library was constructed from haemocytes of H. diversicolor, with the content of 1.37x10(6) pfu and the recombinant rate of 98.18%. After the recombinant plasmids were sequenced, partial cDNA of macrophage expressed protein (MEP) was recognized based on BLAST searches in NCBI, with the size of 1,551 bp, and continuously encoding 517 amino acids. Semi-quantitative PCR and quantitative real-time PCR results showed that MEP cDNA was distinctly up-regulated in haemocytes of the bacterial-challenged group compared to the unchallenged group. The gene information obtained from this library will provide new insights into the immune mechanism of H. diversicolor and facilitate future study of target genes involved in the response to invading microorganisms.

  4. Differential gene expression profiling in aggressive bladder transitional cell carcinoma compared to the adjacent microscopically normal urothelium by microdissection-SMART cDNA PCR-SSH.

    Science.gov (United States)

    Wang, H T; Ma, F L; Ma, X B; Han, R F; Zhang, Y B; Chang, J W

    2006-01-01

    Identifying novel and known genes that are differentially expressed in aggressive bladder transitional cell carcinoma (BTCC) has important implications in understanding the biology of bladder tumorigenesis and developing new diagnostic and therapeutic agents. In this study we identified the differential gene expression profiles comparing tumor to the adjacent microscopically normal mucosa by manual microdissection on frozen sections. The RNAs extracted from microdissected tissues were amplified by SMART cDNA PCR technology to generate forward subtractive cDNA library by suppressive subtractive hybridization (SSH). We obtained 376 positive clones, one hundred clones of aggressive BTCC subtracted cDNA library were selected at random and inserts were reamplified by PCR. After differential screening by reverse dot blotting, 73 positive clones, that contend inserts putatively upregulated in aggressive BTCC, were further analysed by DNA sequencing, GenBank and EST database searching. Sequencing results showed that 66 clones stand for 23 known genes and 7 clones for three new EST (Genbank number: DN236875, DN236874 and DN236873). In conclusion, microdissection-SMART cDNA PCR-SSH allowed for an efficient way to identify aggressive BTCC-specific differential expressed genes that may potentially be involved in the carcinogenesis and/or progression of aggressive BTCC. These differentially expressed genes may be of potential utility as therapeutic and diagnostic targets for aggressive BTCC.

  5. A hybrid conformal planning technique with solitary dynamic portal for postmastectomy radiotherapy with regional nodes

    Directory of Open Access Journals (Sweden)

    K Mohamathu Rafic

    2017-01-01

    Full Text Available Purpose: This study focuses on incorporation of a solitary dynamic portal (SDP in conformal planning for postmastectomy radiotherapy (PMRT with nodal regions with an intention to overcome the treatment planning limitations imposed by conventional techniques. Materials and Methods: Twenty-four patients who underwent surgical mastectomy followed by PMRT were included in this study. Initially, a treatment plan comprising tangential beams fitted to beam's-eye-view (BEV of chest wall (CW and a direct anterior field fitted to BEV of nodal region, both sharing a single isocenter was generated using Eclipse treatment planning system. Multiple field-in-fields with optimum beam weights (5% per field were added primarily from the medial tangent, fitted to BEV of entire target volume, and finally converted into a dynamic portal. Dosimetric analysis for the treatment plans and fluence verification for the dynamic portals were performed. Results and Discussion: Conformal plans with SDP showed excellent dose coverage (V95%>95%, higher degree of tumor dose conformity (≤1.25 and homogeneity (≤0.12 without compromising the organ at risk sparing for PMRT with nodal region. Treatment plans with SDP considerably reduced the lower isodose spread to the ipsilateral lung, heart, and healthy tissue without affecting the dose homogeneity. Further, gamma evaluation showed more than 96% pixel pass rate for standard 3%/3 mm dose difference and distance-to-agreement criteria. Moreover, this plan offers less probability of “geometrical miss” at the highly irregular CW with regional nodal radiotherapy. Conclusion: Hybrid conformal plans with SDP would facilitate improved dose distribution and reduced uncertainty in delivery and promises to be a suitable treatment option for complex postmastectomy CW with regional nodal irradiation.

  6. Passive hybrid technique for the vibration mitigation of systems of interconnected stays

    Science.gov (United States)

    Caracoglia, Luca; Jones, Nicholas P.

    2007-11-01

    The problem of stay oscillation mitigation in cable-stayed bridges, usually induced by wind or wind and rain, may require the introduction of passive devices, such as dampers on individual stays or the use of transverse restrainers (cross-ties). The damper performance is often affected by the geometrical constraints of the bridge deck that limit the installation of such devices to locations very close to the end of the cable. On the other hand, cross-ties are generally incapable of direct energy dissipation. Therefore, the authors have proposed and analyzed a hybrid passive system in which the advantages of both techniques are applied to the oscillation mitigation of complex interconnected systems with multiple external dampers at the deck level, in correspondence with the cross-tie lines. This paper summarizes the relevant findings of a research program involving the authors' efforts focused on the in-plane free-vibration analysis of stay-cable systems. This research is also based upon some recent results associated with the analytical solution of a taut-cable with two attached viscous dampers. These findings are initially extended to a simplified network with reduced number of connectors and one damper, for which the derivation of analytical solution is still possible. Subsequently, an existing multistay multidamped arrangement on a real bridge is considered, in which a fully numerical approach is required. The modal behavior is compared to the simplified examples, also enabling the interpretation of the results in the context of more general guidelines for potential future application.

  7. Prediction of monthly regional groundwater levels through hybrid soft-computing techniques

    Science.gov (United States)

    Chang, Fi-John; Chang, Li-Chiu; Huang, Chien-Wei; Kao, I.-Feng

    2016-10-01

    Groundwater systems are intrinsically heterogeneous with dynamic temporal-spatial patterns, which cause great difficulty in quantifying their complex processes, while reliable predictions of regional groundwater levels are commonly needed for managing water resources to ensure proper service of water demands within a region. In this study, we proposed a novel and flexible soft-computing technique that could effectively extract the complex high-dimensional input-output patterns of basin-wide groundwater-aquifer systems in an adaptive manner. The soft-computing models combined the Self Organized Map (SOM) and the Nonlinear Autoregressive with Exogenous Inputs (NARX) network for predicting monthly regional groundwater levels based on hydrologic forcing data. The SOM could effectively classify the temporal-spatial patterns of regional groundwater levels, the NARX could accurately predict the mean of regional groundwater levels for adjusting the selected SOM, the Kriging was used to interpolate the predictions of the adjusted SOM into finer grids of locations, and consequently the prediction of a monthly regional groundwater level map could be obtained. The Zhuoshui River basin in Taiwan was the study case, and its monthly data sets collected from 203 groundwater stations, 32 rainfall stations and 6 flow stations during 2000 and 2013 were used for modelling purpose. The results demonstrated that the hybrid SOM-NARX model could reliably and suitably predict monthly basin-wide groundwater levels with high correlations (R2 > 0.9 in both training and testing cases). The proposed methodology presents a milestone in modelling regional environmental issues and offers an insightful and promising way to predict monthly basin-wide groundwater levels, which is beneficial to authorities for sustainable water resources management.

  8. A review of the hybrid techniques for the fabrication of hard magnetic microactuators based on bonded magnetic powders

    Science.gov (United States)

    Pallapa, M.; Yeow, J. T. W.

    2015-02-01

    Polymer composites based on permanent magnetic bonded powders exhibit immense potential for applications in microactuators and sensors with magnetic performances comparable to their fully dense counterparts. While fabrication and integration of magnetic devices based on bonded magnetic powders is challenging via conventional deposition and electrochemical growth techniques, hybrid fabrication offers a promising alternative. This paper presents the evolution of permanent magnetic materials into bonded magnetic powders, the magnetic performance figures of merit of permanent magnetic materials significant for the design and manufacture of polymer based sensors and actuators. A review of the hybrid fabrication techniques such as replica molding, squeegee coating, spin casting etc are reported. Critical factors affecting the fabrication of polymer magnetic composites such as filler particle size and effect of magnetic field during fabrication are discussed. Prior art based on polymer magnetic composites for the fabrication of hard magnetic films and hard magnetic actuators are presented.

  9. Mixed potential integral equation technique for hybrid microstrip-slotline multilayered circuits using a mixed rectangular-triangular mesh

    Science.gov (United States)

    Sercu, Jeannick; Fache, Niels; Libbrecht, Frank; Lagasse, Paul

    1995-05-01

    In this paper, a mixed potential integral equation (MPIE) formulation for hybrid microstrip-slotline multilayered circuits is presented. This integral equation is solved with the method of moments (MoM) in combination with Galerkin's method. The vector-valued rooftop functions defined over a mixed rectangular-triangular mesh are used to model the electric and magnetic currents on the microstrip and slotline structures. An efficient calculation technique for the quadruple interaction integrals between two cells in the system matrix equation is presented. Two examples of hybrid microstrip-slotline circuits are discussed. The first example compares the simulation results for a microstrip-slotline transition with measured data. The second example illustrates the use of the simulation technique in the design process of a broadband slot-coupled microstrip line transition.

  10. A 3D hybrid grid generation technique and a multigrid/parallel algorithm based on anisotropic agglomeration approach

    Institute of Scientific and Technical Information of China (English)

    Zhang Laiping; Zhao Zhong; Chang Xinghua; He Xin

    2013-01-01

    A hybrid grid generation technique and a multigrid/parallel algorithm are presented in this paper for turbulence flow simulations over three-dimensional (3D) complex geometries.The hybrid grid generation technique is based on an agglomeration method of anisotropic tetrahedrons.Firstly,the complex computational domain is covered by pure tetrahedral grids,in which anisotropic tetrahedrons are adopted to discrete the boundary layer and isotropic tetrahedrons in the outer field.Then,the anisotropic tetrahedrons in the boundary layer are agglomerated to generate prismatic grids.The agglomeration method can improve the grid quality in boundary layer and reduce the grid quantity to enhance the numerical accuracy and efficiency.In order to accelerate the convergence history,a multigrid/parallel algorithm is developed also based on anisotropic agglomeration approach.The numerical results demonstrate the excellent accelerating capability of this multigrid method.

  11. Using a dynamical advection to reconstruct a part of the SSH evolution in the context of SWOT, application to the Mediterranean Sea

    Science.gov (United States)

    Rogé, Marine; Morrow, Rosemary; Ubelmann, Clément; Dibarboure, Gérald

    2017-08-01

    The main oceanographic objective of the future SWOT mission is to better characterize the ocean mesoscale and sub-mesoscale circulation, by observing a finer range of ocean topography dynamics down to 20 km wavelength. Despite the very high spatial resolution of the future satellite, it will not capture the time evolution of the shorter mesoscale signals, such as the formation and evolution of small eddies. SWOT will have an exact repeat cycle of 21 days, with near repeats around 5-10 days, depending on the latitude. Here, we investigate a technique to reconstruct the missing 2D SSH signal in the time between two satellite revisits. We use the dynamical interpolation (DI) technique developed by Ubelmann et al. (2015). Based on potential vorticity (hereafter PV) conservation using a one and a half layer quasi-geostrophic model, it features an active advection of the SSH field. This model has been tested in energetic open ocean regions such as the Gulf Stream and the Californian Current, and has given promising results. Here, we test this model in the Western Mediterranean Sea, a lower energy region with complex small scale physics, and compare the SSH reconstruction with the high-resolution Symphonie model. We investigate an extension of the simple dynamical model including a separated mean circulation. We find that the DI gives a 16-18% improvement in the reconstruction of the surface height and eddy kinetic energy fields, compared with a simple linear interpolation, and a 37% improvement in the Northern Current subregion. Reconstruction errors are higher during winter and autumn but statistically, the improvement from the DI is also better for these seasons.

  12. Staging of recurrent and advanced lung cancer with 18F-FDG PET in a coincidence technique (hybrid PET).

    Science.gov (United States)

    Schmid, R A; Hautmann, H; Poellinger, B; Kellner, W; Moisseev, A; Brinkbaeumer, K; Weiss, M; Hahn, K; Dresel, S

    2003-01-01

    The aim of this study was to evaluate [18F]fluorodeoxyglucose ( F-FDG) imaging of recurrent or inoperable lung cancer using a hybrid positron emission tomography (PET) device of the third generation. Examinations were compared with the results of conventional staging. Thirty-six patients suffering from recurrent or primarily inoperable lung cancer (29 men, seven women; age 64.8+/-12.0 years) were examined using hybrid PET (Marconi Axis gamma-PET ) 60 min after injection of 370 MBq F-FDG. The data obtained were reconstructed iteratively. All patients received a computed tomography (CT) scan using either the spiral or multislice technique. All lesions suspicious for primary or recurrent tumour were verified by biopsy; mediastinal lymph nodes were considered as malignant, when positive histology or a small axis diameter of greater than 1 cm measured with CT in addition to progression of clinical course was found. Distant metastases were diagnosed by CT and bone scintigraphy. Using hybrid PET all lesions showed a focally elevated glucose metabolism. Lymph node involvement of the ipsilateral peribronchial and hilar station (N1) was identified in 24/26 cases (92%), in 26/29 cases (90%) of ipsilateral central manifestation (N2) and in 11/13 (85%) cases of central contralateral or supraclavicular lymphatic infestation (N3). Pulmonary spread in hybrid PET was found in 4/8 cases (50%), whereas mainly lung metastases with a diameter of 1.5 cm and smaller were missed. Pleural involvement diagnosed by CT was verified in 4/5 patients. All four patients with bony metastases in conventional staging also presented with positive findings in hybrid PET (8/9 lesions). Concordance with conventional staging was found in 28/36 of patients (78%). In 4/36 patients (11%) unknown sites of tumour were detected leading to therapeutic consequences in three patients after radiological confirmation. Hybrid PET would have led to an understaging in four cases (11%), resulting theoretically in

  13. Ecophysiological Analysis of Microorganisms in Complex Microbial Systems by Combination of Fluorescence In Situ Hybridization with Extracellular Staining Techniques

    Science.gov (United States)

    Nielsen, Jeppe Lund; Kragelund, Caroline; Nielsen, Per Halkjær

    Ecophysiological analysis and functions of single cells in complex microbial systems can be examined by simple combinations of Fluorescence in situ hybridization (FISH) for identification with various staining techniques targeting functional phenotypes. In this chapter, we describe methods and protocols optimized for the study of extracellular enzymes, surface hydrophobicity and specific surface structures. Although primarily applied to the study of microbes in wastewater treatment (activated sludge and biofilms), the methods may also be used with minor modifications in several other ecosystems.

  14. POWER OPTIMIZED DATAPATH UNITS OF HYBRID EMBEDDED CORE ARCHITECTURE USING CLOCK GATING TECHNIQUE

    National Research Council Canada - National Science Library

    T.Subhashini; M.Kamaraju

    2015-01-01

    ...% of the total power dissipation. The main goal of this work is to implement a prototype power optimized datapath unit and ALU of Hybrid Embedded Controller Architecture targeted on to the FPGA chip and analyze the power consumption...

  15. RAPD Technique Used to Determine the Purity of Hybrid Hot Pepper Seeds

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Two hybrid hot pepper varieties Xiangyan 5 and Xiangyan 10, and their parents were analyzed the polymerase chain reaction with MJ /PT 200 Peltrier Themal Cycler and DS 800 White-ultravilot Transilluminator to set up a RAPD system adaptable to the purity determination of the hybrid seeds. Among the 39 random primers, 2 and 4 primers were found to be used effectively in Xiangyan 5 and Xiangyan 10 respectively.

  16. Optimisation Sizing of Hybrid Wind-Diesel Systems using Linear Programming Technique

    OpenAIRE

    Gan, Leong Kit; Shek, Jonathan; Mueller, Markus

    2014-01-01

    Despite the great potential of hybrid wind-diesel system in supplying energy to remote or island communities, sizing the system components have been a challenging problem for many project managers due to the reliance on various factors. This work considers utilising a fixed speed wind turbine (induction generator) in the hybrid system. It requires energy for start-up operation and this work takes into account for sizing the battery storage. In addition, the trade-off between the number of bat...

  17. Ssh4, Rcr2 and Rcr1 affect plasma membrane transporter activity in Saccharomyces cerevisiae.

    Science.gov (United States)

    Kota, Jhansi; Melin-Larsson, Monika; Ljungdahl, Per O; Forsberg, Hanna

    2007-04-01

    Nutrient uptake in the yeast Saccharomyces cerevisiae is a highly regulated process. Cells adjust levels of nutrient transporters within the plasma membrane at multiple stages of the secretory and endosomal pathways. In the absence of the ER-membrane-localized chaperone Shr3, amino acid permeases (AAP) inefficiently fold and are largely retained in the ER. Consequently, shr3 null mutants exhibit greatly reduced rates of amino acid uptake due to lower levels of AAPs in their plasma membranes. To further our understanding of mechanisms affecting AAP localization, we identified SSH4 and RCR2 as high-copy suppressors of shr3 null mutations. The overexpression of SSH4, RCR2, or the RCR2 homolog RCR1 increases steady-state AAP levels, whereas the genetic inactivation of these genes reduces steady-state AAP levels. Additionally, the overexpression of any of these suppressor genes exerts a positive effect on phosphate and uracil uptake systems. Ssh4 and Rcr2 primarily localize to structures associated with the vacuole; however, Rcr2 also localizes to endosome-like vesicles. Our findings are consistent with a model in which Ssh4, Rcr2, and presumably Rcr1, function within the endosome-vacuole trafficking pathway, where they affect events that determine whether plasma membrane proteins are degraded or routed to the plasma membrane.

  18. PET/MRI: a novel hybrid imaging technique. Major clinical indications and preliminary experience in Brazil.

    Science.gov (United States)

    Vitor, Taise; Martins, Karine Minaif; Ionescu, Tudor Mihai; Cunha, Marcelo Livorsi da; Baroni, Ronaldo Hueb; Garcia, Marcio Ricardo Taveira; Wagner, Jairo; Campos, Guilherme de Carvalho; Nogueira, Solange Amorim; Guerra, Elaine Gonçalves; Amaro, Edson

    2017-01-01

    In recent years, medical imaging with hybrid techniques has widely accepted and employed in clinical routine. PET/MRI offers significant advantages, including excellent contrast and resolution and reduced ionizing radiation, as compared to well-established PET/CT. Therefore, PET/MRI is a promising modality for oncologic imaging of some regions, such as brain, head and neck, liver and pelvis. This article set out to analyze clinical conditions that could benefit from PET/MRI imaging based on our caseload. The potential of PET/MRI to become the imaging modality of choice for assessment of neurologic and oncologic conditions associated with soft tissues is highlighted. Clinical aspects of PET/MRI and its application to clinical cases are illustrated with examples extracted from the authors' preliminary experience. RESUMO Nos últimos anos, imagens médicas com tecnologias híbridas tornaram-se amplamente aceitas e utilizadas na prática clínica. O PET/RM possui vantagens importantes, incluindo excelentes contrastes e resolução, e menor radiação ionizante, em comparação ao PET/TC. Por isto, é uma modalidade promissora para exames de imagem de pacientes oncológicos, para avaliar o cérebro, cabeça e pescoço, o fígado e a pelve. O objetivo deste artigo foi analisar as situações clínicas que se beneficiariam de exames de PET/RM a partir de uma casuística. Destacamos o potencial desta técnica se tornar o método de imagem de escolha para doenças neurológicas e oncológicas que envolvam partes moles. Os aspectos clínicos de PET/RM e sua aplicação aos casos clínicos são ilustrados com exemplos da experiência inicial dos autores.

  19. Novel fabrication technique of hybrid structure lens array for 3D images

    Science.gov (United States)

    Lee, Junsik; Kim, Junoh; Kim, Cheoljoong; Shin, Dooseub; Koo, Gyohyun; Won, Yong Hyub

    2016-03-01

    Tunable liquid lens arrays can produce three dimensional images by using electrowetting principle that alters surface tensions by applying voltage. This method has advantages of fast response time and low power consumption. However, it is challenging to fabricate a high fill factor liquid lens array and operate three dimensional images which demand high diopter. This study describes a hybrid structure lens array which has not only a liquid lens array but a solid lens array. A concave-shape lens array is unavoidable when using only the liquid lens array and some voltages are needed to make the lens flat. By placing the solid lens array on the liquid lens array, initial diopter can be positive. To fabricate the hybrid structure lens array, a conventional lithographic process in semiconductor manufacturing is needed. A negative photoresist SU-8 was used as chamber master molds. PDMS and UV adhesive replica molding are done sequentially. Two immiscible liquids, DI water and dodecane, are injected in the fabricated chamber, followed by sealing. The fabricated structure has a 20 by 20 pattern of cylindrical shaped circle array and the aperture size of each lens is 1mm. The thickness of the overall hybrid structure is about 2.8mm. Hybrid structure lens array has many advantages. Solid lens array has almost 100% fill factor and allow high efficiency. Diopter can be increased by more than 200 and negative diopter can be shifted to the positive region. This experiment showed several properties of the hybrid structure and demonstrated its superiority.

  20. SSH gene expression profile of Eisenia andrei exposed in situ to a naturally contaminated soil from an abandoned uranium mine.

    Science.gov (United States)

    Lourenço, Joana; Pereira, Ruth; Gonçalves, Fernando; Mendo, Sónia

    2013-02-01

    The effects of the exposure of earthworms (Eisenia andrei) to contaminated soil from an abandoned uranium mine, were assessed through gene expression profile evaluation by Suppression Subtractive Hybridization (SSH). Organisms were exposed in situ for 56 days, in containers placed both in a contaminated and in a non-contaminated site (reference). Organisms were sampled after 14 and 56 days of exposure. Results showed that the main physiological functions affected by the exposure to metals and radionuclides were: metabolism, oxireductase activity, redox homeostasis and response to chemical stimulus and stress. The relative expression of NADH dehydrogenase subunit 1 and elongation factor 1 alpha was also affected, since the genes encoding these enzymes were significantly up and down-regulated, after 14 and 56 days of exposure, respectively. Also, an EST with homology for SET oncogene was found to be up-regulated. To the best of our knowledge, this is the first time that this gene was identified in earthworms and thus, further studies are required, to clarify its involvement in the toxicity of metals and radionuclides. Considering the results herein presented, gene expression profiling proved to be a very useful tool to detect earthworms underlying responses to metals and radionuclides exposure, pointing out for the detection and development of potential new biomarkers.

  1. Isolation of mycoparasitic-related transcripts by SSH during interaction of the mycoparasite Stachybotrys elegans with its host Rhizoctonia solani.

    Science.gov (United States)

    Morissette, Danielle C; Dauch, Amélie; Beech, Robin; Masson, Luke; Brousseau, Roland; Jabaji-Hare, Suha

    2008-02-01

    Mycoparasitism by antagonistic fungi involves changes in the biochemistry and physiology of both partners. Analysis of genes that are expressed during mycoparasite-host interaction represents a powerful strategy to obtain insight into the molecular events underlying these changes. The aim of this study is to identify genes whose expression is upregulated when the mycoparasite Stachybotrys elegans is in direct confrontation with its host Rhizoctonia solani. Suppression subtractive hybridization (SSH) was used to create a subtracted cDNA library, and differential screening was applied to identify the over-expressed transcripts. We report the analysis of 2,166 clones, among which 47% were upregulated during mycoparasitism. Two hundred and sixty-one clones were sequenced that corresponded to 94 unique genes. Forty-four of these were identified as novel genes, while the remainder showed similarity to a broad diversity of genes with putative functions related to toxin production, pathogenicity, and metabolism. As a result of mycoparasitism, 15 genes belonged to R. solani among which 9 genes were assigned putative functions. Quantitative RT-PCR was used to examine the upregulation of 12 genes during the course of mycoparasitism. Seven genes showed significant upregulation at least at one-time point during interaction of the mycoparasite with its host. This study describes a first step toward knowledge of S. elegans genome. The results present the useful application of EST analysis on S. elegans and provide preliminary indication of gene expression putatively involved in mycoparasitism.

  2. HybridSPE: A novel technique to reduce phospholipid-based matrix effect in LC-ESI-MS Bioanalysis.

    Science.gov (United States)

    Ahmad, Shafeeque; Kalra, Harsh; Gupta, Amit; Raut, Bharat; Hussain, Arshad; Rahman, Md Akhlaquer

    2012-10-01

    When complex biological materials are analyzed without an adequate sample preparation technique, MS signal and response undergo significant alteration and result in poor quantification and assay. This problem generally takes place due to the presence of several endogenous materials component in samples. One of the major causes of ion suppression in bioanalysis is the presence of phospholipids during LC-MS analysis. The phospholipid-based matrix effect was investigated with a commercially available electro spray ionization (ESI) source coupled with a triple quadrupole mass spectrometer. HybridSPE dramatically reduced the levels of residual phospholipids in biological samples, leading to significant reduction in matrix effects. This new procedure that combines the simplicity of precipitation with the selectivity of SPE allows obtaining much cleaner extracts than with conventional procedures. HybridSPE-precipitation procedure provides significant improvement in bioanalysis and a practical and fast way to ensure the avoidance of phospholipids-based matrix effects. The present review outlines the HybridSPE technique to minimize phospholipids-based matrix effects on LC-ESI-MS bioanalysis.

  3. HybridSPE: A novel technique to reduce phospholipid-based matrix effect in LC-ESI-MS Bioanalysis

    Directory of Open Access Journals (Sweden)

    Shafeeque Ahmad

    2012-01-01

    Full Text Available When complex biological materials are analyzed without an adequate sample preparation technique, MS signal and response undergo significant alteration and result in poor quantification and assay. This problem generally takes place due to the presence of several endogenous materials component in samples. One of the major causes of ion suppression in bioanalysis is the presence of phospholipids during LC-MS analysis. The phospholipid-based matrix effect was investigated with a commercially available electro spray ionization (ESI source coupled with a triple quadrupole mass spectrometer. HybridSPE dramatically reduced the levels of residual phospholipids in biological samples, leading to significant reduction in matrix effects. This new procedure that combines the simplicity of precipitation with the selectivity of SPE allows obtaining much cleaner extracts than with conventional procedures. HybridSPE-precipitation procedure provides significant improvement in bioanalysis and a practical and fast way to ensure the avoidance of phospholipids-based matrix effects. The present review outlines the HybridSPE technique to minimize phospholipids-based matrix effects on LC-ESI-MS bioanalysis.

  4. Diversity Suppression-Subtractive Hybridization Array for Profiling Genomic DNA Polymorphisms

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Genomic DNA polymorphisms are very useful for tracing genetic traits and studying biological diversity among species. Here, we present a method we call the "diversity suppression-subtractive hybridization array" for effectively profiling genomic DNA polymorphisms. The method first obtains the subtracted gDNA fragments between any two species by suppression subtraction hybridization (SSH) to establish a subtracted gDNA library,from which diversity SSH arrays are created with the selected subtracted clones. The diversity SSH array hybridizes with the DIG-labeled genomic DNA of the organism to be assayed. Six closely related Dendrobium species were studied as model samples. Four Dendrobium species as testers were used to perform SSH. A total of 617 subtracted positive clones were obtained from four Dendrobium species, and the average ratio of positive clones was 80.3%. We demonstrated that the average percentage of polymorphic fragments of pairwise comparisons of four Dendrobium species was up to 42.4%. A dendrogram of the relatedness of six Dendrobium species was produced according to their polymorphic profiles. The results revealed that the diversity SSH array is a highly effective platform for profiling genomic DNA polymorphisms and dendrograms.

  5. Hybrid approach to AAA: bilateral "banana" technique to preserve hypogastric artery in complex anatomy aorto-biiliac aneurysm.

    Science.gov (United States)

    Mosquera Arochena, N; Molina Herrero, F; Carbalho Fernandez, C; Rodriguez Feijoo, G; Fernandez Lebrato, R; Barrios Castro, A; Garcia Fernandez, I

    2011-01-01

    The surgical approach for hypogastric preservation in aorto-iliac aneurysm (AAA) open repair (OR) has been described and performed with different techniques but all of them represent a higher mortality and potencial complications to the procedure; this is even more critical in bilateral disease. Since the introduction of the first endograft, a continuous development has occurred, such as the stent graft with specific branch designed for preserving antegrade flow in the hypogastric artery. On highly angulated and tortuous iliac anatomies, the use of Sandwich-Graft technique, as described by Armando Lobato, represents a valid alternative to iliac branch. The hybrid approach could be a good treatment option in young patients with AAA affecting hypogastric arteries. We present the technical description and a case report of bilateral "banana" technique perfor- med with flexible covered stent (Viabahn(®) WL Gore) to preserve both hypogastric arteries combined with open repair in a 52 years old patient. Technical report and Results: A bilateral retrograde endograft was implanted from both external ilac arteries to hypo- gastric artery excluding bilateral common iliac aneurysms followed by an open repair to the AAA (aneurismectomy + aorto bifemoral by-pass) with good inmediate and short-midterm follow up (12 months) This hybrid technique could be a good approach to hypogastric preservation in low risk and young patients reducing potencial complications of hypogastric artery oclusion.

  6. N-doped ZnO films grown from hybrid target by the pulsed laser deposition technique

    Science.gov (United States)

    Martín-Tovar, E. A.; Chan y Díaz, E.; Acosta, M.; Castro-Rodríguez, R.; Iribarren, A.

    2016-10-01

    ZnO thin films were grown by the pulsed laser deposition technique on glass substrate using a hybrid target composed of ZnO powder embedded into a poly(ethyl cyanoacrylate) matrix. The resulting thin film presented ZnO wurtzite structure with very low stress and diffractogram very similar to that of the powder pattern. From comparing with ZnO thin films grown from traditional sintered target, it is suggested that the use of this hybrid target with a soft matrix led to ejection of ZnO clusters that conveniently disposed and adhered to substrate and previous deposited layers. Chemical measurements showed the presence of Zn-N bonds, besides Zn-O ones. Optical absorption profile confirmed the presence of low-polymerized zinc oxynitride molecular subunits, besides ZnO.

  7. Dielectric property determination of hybrid Al2O3-filled MWCNT buckypaper by the rectangular cavity perturbation technique

    Science.gov (United States)

    Miao, Hsin-Yuan; Liu, Jih-Hsin; Saravanan, L.; Tsao, Che-Wei; Pan, Jui-Wen

    2015-04-01

    This study investigated the complex dielectric permittivity of freestanding multiwalled carbon nanotube buckypaper (MWCNT-BP) and a synthesized hybrid alumina-filled buckypaper (Al2O3-BP) composite with different alumina loadings (5-30 wt%). The non-destructive microwave transmission technique for complex permittivity determination involving cavity perturbation was employed to characterize a set of Al2O3-BP sheets. This was done by filling a rectangular cavity resonator with a standard dielectric Teflon sample and then performing permittivity measurements for the buckypaper (BP) samples in the X-band frequency range (7-12 GHz). Field-emission scanning electron microscopy (FESEM) was used to analyze the morphology of the MWCNT-BP and the alumina-loaded BP composites. DC electrical resistivity measurements clearly demonstrated conductor-insulator transition. The effect of alumina loadings on the dielectric properties of the synthesized hybrid Al2O3-BP sheet is discussed.

  8. Hybrid models for hydrological forecasting: integration of data-driven and conceptual modelling techniques

    NARCIS (Netherlands)

    Corzo Perez, G.A.

    2009-01-01

    This book presents the investigation of different architectures of integrating hydrological knowledge and models with data-driven models for the purpose of hydrological flow forecasting. The models resulting from such integration are referred to as hybrid models. The book addresses the following top

  9. A hybrid method for flood simulation in small catchments combining hydrodynamic and hydrological techniques

    Science.gov (United States)

    Bellos, Vasilis; Tsakiris, George

    2016-09-01

    The study presents a new hybrid method for the simulation of flood events in small catchments. It combines a physically-based two-dimensional hydrodynamic model and the hydrological unit hydrograph theory. Unit hydrographs are derived using the FLOW-R2D model which is based on the full form of two-dimensional Shallow Water Equations, solved by a modified McCormack numerical scheme. The method is tested at a small catchment in a suburb of Athens-Greece for a storm event which occurred in February 2013. The catchment is divided into three friction zones and unit hydrographs of 15 and 30 min are produced. The infiltration process is simulated by the empirical Kostiakov equation and the Green-Ampt model. The results from the implementation of the proposed hybrid method are compared with recorded data at the hydrometric station at the outlet of the catchment and the results derived from the fully hydrodynamic model FLOW-R2D. It is concluded that for the case studied, the proposed hybrid method produces results close to those of the fully hydrodynamic simulation at substantially shorter computational time. This finding, if further verified in a variety of case studies, can be useful in devising effective hybrid tools for the two-dimensional flood simulations, which are lead to accurate and considerably faster results than those achieved by the fully hydrodynamic simulations.

  10. Hybrid models for hydrological forecasting: Integration of data-driven and conceptual modelling techniques

    NARCIS (Netherlands)

    Corzo Perez, G.A.

    2009-01-01

    This book presents the investigation of different architectures of integrating hydrological knowledge and models with data-driven models for the purpose of hydrological flow forecasting. The models resulting from such integration are referred to as hybrid models. The book addresses the following top

  11. Role of hybrid forecasting techniques for transportation planning of broiler meat under uncertain demand in thailand

    Directory of Open Access Journals (Sweden)

    Thoranin Sujjaviriyasup

    2014-12-01

    Full Text Available One of numerous problems experiencing in supply chain management is the demand. Most demands are appeared in terms of uncertainty. The broiler meat industry is inevitably encountering the same problem. In this research, hybrid forecasting model of ARIMA and Support Vector Machine (SVMs are developed to forecast broiler meat export. In addition, ARIMA, SVMs, and Moving Average (MA are chosen for comparing the forecasting efficiency. All the forecasting models are tested and validated using the data of Brazil’s export, Canada’s export, and Thailand’s export. The hybrid model provides accuracy of the forecasted values that are 98.71%, 97.50%, and 93.01%, respectively. In addition, the hybrid model presents the least error of all MAE, RMSE, and MAPE comparing with other forecasting models. As forecasted data are applied to transportation planning, the mean absolute percentage error (MAPE of optimal value of forecasted value and actual value is 14.53%. The hybrid forecasting model shows an ability to reduce risk of total cost of transportation when broiler meat export is forecasted by using MA(2, MA(3, ARIMA, and SVM are 50.59%, 60.18%, 68.01%, and 46.55%, respectively. The results indicate that the developed forecasting model is recommended to broiler meat industries’ supply chain decision.

  12. Hybrid and Model-Based Iterative Reconstruction Techniques for Pediatric CT

    NARCIS (Netherlands)

    den Harder, Annemarie M.; Willemink, Martin J.; Budde, Ricardo P. J.; Schilham, Arnold M. R.; Leiner, Tim; de Jong, Pim A.

    2015-01-01

    OBJECTIVE. Radiation exposure from CT examinations should be reduced to a minimum in children. Iterative reconstruction (IR) is a method to reduce image noise that can be used to improve CT image quality, thereby allowing radiation dose reduction. This article reviews the use of hybrid and model-bas

  13. Hybrid models for hydrological forecasting: integration of data-driven and conceptual modelling techniques

    NARCIS (Netherlands)

    Corzo Perez, G.A.

    2009-01-01

    This book presents the investigation of different architectures of integrating hydrological knowledge and models with data-driven models for the purpose of hydrological flow forecasting. The models resulting from such integration are referred to as hybrid models. The book addresses the following

  14. Hybrid models for hydrological forecasting: Integration of data-driven and conceptual modelling techniques

    NARCIS (Netherlands)

    Corzo Perez, G.A.

    2009-01-01

    This book presents the investigation of different architectures of integrating hydrological knowledge and models with data-driven models for the purpose of hydrological flow forecasting. The models resulting from such integration are referred to as hybrid models. The book addresses the following

  15. Biological evaluation of zirconia/PEG hybrid materials synthesized via sol-gel technique.

    Science.gov (United States)

    Catauro, M; Papale, F; Bollino, F; Gallicchio, M; Pacifico, S

    2014-07-01

    The objective of the following study has been the synthesis via sol-gel and the characterization of novel organic-inorganic hybrid materials to be used in biomedical field. The prepared materials consist of an inorganic zirconia matrix containing as organic component the polyethylene glycol (PEG), a water-soluble polymer used in medical and pharmaceutical fields. Various hybrids have been synthesized changing the molar ratio between the organic and inorganic parts. Fourier transform spectroscopy suggests that the structure of the interpenetrating network is realized by hydrogen bonds between the Zr-OH group in the sol-gel intermediate species and both the terminal alcoholic group and ethereal oxygen atoms in the repeating units of polymer The amorphous nature of the gels has been ascertained by X-ray diffraction analysis. The morphology observation has been carried out by using the Scanning Electron Microscope and has confirmed that the obtained materials are nanostructurated hybrids. The bioactivity of the synthesized system has been shown by the formation of a hydroxyapatite layer on the surface of samples soaked in a fluid simulating the human blood plasma. The potential biocompatibility of hybrids has been assessed as performing indirect MTT cytotoxicity assay towards 3T3 cell line at 24, 48, and 72 h exposure times. Copyright © 2014. Published by Elsevier B.V.

  16. Rapid high-throughput genotyping of HBV DNA using a modified hybridization-extension technique.

    Science.gov (United States)

    Bao, Han; Zhao, Wenliang; Ruan, Banjun; Wang, Qing; Zhao, Jinrong; Lei, Xiaoying; Wang, Weihua; Liu, Yonglan; Sun, Jianbing; Xiang, An; Guo, Yanhai; Yan, Zhen

    2013-11-07

    China has the highest incidence of hepatitis B virus (HBV) infection worldwide. HBV genotypes have variable impacts on disease pathogenesis and drug tolerance. We have developed a technically simple and accurate method for HBV genotyping that will be applicable to pre-treatment diagnosis and individualized treatment. Multiple sequence alignments of HBV genomes from GenBank were used to design primers and probes for genotyping of HBV A through H. The hybridization was carried out on nitrocellulose (NC) membranes with probes fixed in an array format, which was followed by hybrid amplification by an extension step with DNA polymerase to reinforce the double-stranded DNA hybrids on the NC membrane and subsequent visualization using an avidin-biotin system. Genotyping results were confirmed by DNA sequencing and bioinformatics analysis using the National Center for Biotechnology Information genotyping database, and compared with results from the line probe assay. The data show that multiple sequence alignment defined a 630 bp region in the HBV PreS and S regions that was suitable for genotyping. All genotyping significant single nucleotides in the region were defined. Two-hundred-and-ninety-one HBV-positive serum samples from Northwest Chinese patients were genotyped, and the genotyping rate from the new modified hybridization-extension method was 100% compared with direct sequencing. Compared with line probe assay, the newly developed method is superior, featuring reduced reaction time, lower risk of contamination, and increased accuracy for detecting single nucleotide mutation. In conclusion, a novel hybridization-extension method for HBV genotyping was established, which represents a new tool for accurate and rapid SNP detection that will benefit clinical testing.

  17. Heavy-tailed distribution of the SSH Brute-force attack duration in a multi-user environment

    Science.gov (United States)

    Lee, Jae-Kook; Kim, Sung-Jun; Park, Chan Yeol; Hong, Taeyoung; Chae, Huiseung

    2016-07-01

    Quite a number of cyber-attacks to be place against supercomputers that provide highperformance computing (HPC) services to public researcher. Particularly, although the secure shell protocol (SSH) brute-force attack is one of the traditional attack methods, it is still being used. Because stealth attacks that feign regular access may occur, they are even harder to detect. In this paper, we introduce methods to detect SSH brute-force attacks by analyzing the server's unsuccessful access logs and the firewall's drop events in a multi-user environment. Then, we analyze the durations of the SSH brute-force attacks that are detected by applying these methods. The results of an analysis of about 10 thousands attack source IP addresses show that the behaviors of abnormal users using SSH brute-force attacks are based on human dynamic characteristics of a typical heavy-tailed distribution.

  18. Solving Energy Levels for SSH Hamiltonian Describing Peierls Phase Transition by Virtue of Invariant Eigen-operator Method

    Institute of Scientific and Technical Information of China (English)

    P.S. Vyas; FAN Hong-Yi; P.N. Gajjar; WU Hao; B.Y. Thakore; A.R. Jani

    2008-01-01

    We show that the recently proposed invariant eigen-operator (IEO) method can be successfully applied to solving energy levels for SSH Hamiltonian describing Peierls phase transition. The electronic energy band of compound lattice is also studied by IEO method.

  19. Energy Spectrum of Ultra-High Energy Cosmic Rays Observed with the Telescope Array Using a Hybrid Technique

    CERN Document Server

    Abu-Zayyad, T; Allen, M; Anderson, R; Azuma, R; Barcikowski, E; Belz, J W; Bergman, D R; Blake, S A; Cady, R; Cheon, B G; Chiba, J; Chikawa, M; Cho, E J; Cho, W R; Fujii, H; Fujii, T; Fukuda, T; Fukushima, M; Hanlon, W; Hayashi, K; Hayashi, Y; Hayashida, N; Hibino, K; Hiyama, K; Honda, K; Iguchi, T; Ikeda, D; Ikuta, K; Inoue, N; Ishii, T; Ishimori, R; Ito, H; Ivanov, D; Iwamoto, S; Jui, C C H; Kadota, K; Kakimoto, F; Kalashev, O; Kanbe, T; Kasahara, K; Kawai, H; Kawakami, S; Kawana, S; Kido, E; Kim, H B; Kim, H K; Kim, J H; Kitamoto, K; Kitamura, S; Kitamura, Y; Kobayashi, K; Kobayashi, Y; Kondo, Y; Kuramoto, K; Kuzmin, V; Kwon, Y J; Lan, J; Lim, S I; Lundquist, J P; Machida, S; Martens, K; Matsuda, T; Matsuura, T; Matsuyama, T; Matthews, J N; Minamino, M; Miyata, K; Murano, Y; Myers, I; Nagasawa, K; Nagataki, S; Nakamura, T; Nam, S W; Nonaka, T; Ogio, S; Ohnishi, M; Ohoka, H; Oki, K; Oku, D; Okuda, T; Ono, M; Oshima, A; Ozawa, S; Park, I H; Pshirkov, M S; Rodriguez, D C; Roh, S Y; Rubtsov, G; Ryu, D; Sagawa, H; Sakurai, N; Sampson, A L; Scott, L M; Shah, P D; Shibata, F; Shibata, T; Shimodaira, H; Shin, B K; Shin, J I; Shirahama, T; Smith, J D; Sokolsky, P; Springer, R W; Stokes, B T; Stratton, S R; Stroman, T; Suzuki, S; Takahashi, Y; Takeda, M; Taketa, A; Takita, M; Tameda, Y; Tanaka, H; Tanaka, K; Tanaka, M; Thomas, S B; Thomson, G B; Tinyakov, P; Tkachev, I; Tokuno, H; Tomida, T; Troitsky, S; Tsunesada, Y; Tsutsumi, K; Tsuyuguchi, Y; Uchihori, Y; Udo, S; Ukai, H; Urban, F; Vasiloff, G; Wada, Y; Wong, T; Yamakawa, Y; Yamane, R; Yamaoka, H; Yamazaki, K; Yang, J; Yoneda, Y; Yoshida, S; Yoshii, H; Zhou, X; Zollinger, R; Zundel, Z

    2013-01-01

    We measure the spectrum of cosmic rays with energies greater than $10^{18.2}$ eV with the Fluorescence Detectors (FDs) and the Surface Detectors (SDs) of the Telescope Array Experiment using the data taken in our first 2.3-year observation from May 27 2008 to September 7 2010. A hybrid air shower reconstruction technique is employed to improve accuracies in determination of arrival directions and primary energies of cosmic rays using both FD and SD data. The energy spectrum presented here is in agreement with our previously published spectra and the HiRes results.

  20. ADAPTING HYBRID MACHINE TRANSLATION TECHNIQUES FOR CROSS-LANGUAGE TEXT RETRIEVAL SYSTEM

    Directory of Open Access Journals (Sweden)

    P. ISWARYA

    2017-03-01

    Full Text Available This research work aims in developing Tamil to English Cross - language text retrieval system using hybrid machine translation approach. The hybrid machine translation system is a combination of rule based and statistical based approaches. In an existing word by word translation system there are lot of issues and some of them are ambiguity, Out-of-Vocabulary words, word inflections, and improper sentence structure. To handle these issues, proposed architecture is designed in such a way that, it contains Improved Part-of-Speech tagger, machine learning based morphological analyser, collocation based word sense disambiguation procedure, semantic dictionary, and tense markers with gerund ending rules, and two pass transliteration algorithm. From the experimental results it is clear that the proposed Tamil Query based translation system achieves significantly better translation quality over existing system, and reaches 95.88% of monolingual performance.

  1. Applications of Suppression Subtractive Hybridization (SSH) in Identifying differentially expressed transcripts in Ascochyta rabiei

    Science.gov (United States)

    Introduction – Ascochyta rabiei, casual agents of chickpea ascochyta blight, is divided into two pathotypes based on virulence levels. Genetic mechanisms of this phenotypic differentiation are poorly understood. This research is directed toward understanding molecular differences between the two pa...

  2. Application of hybrid microwave thermal extraction techniques for mulberry root bark

    OpenAIRE

    Wang Cheng-Chi; Yau Her-Terng

    2013-01-01

    The main focus of this paper is the extraction of compounds from the mulberry root bark using a hybrid microwave thermal process. The shearing mechanism and an integrated circulation system, which increases the rate of contact between the solvent and extractive, are studied. The results are analyzed by the Taguchi method and verified by high performance liquid chromatography. Furthermore, the optimal operating parameters of the extraction of mulberry root b...

  3. Development and Application of Nucleic Acid Hybridization Techniques to Arbovirus Surveillance and Diagnosis.

    Science.gov (United States)

    1986-11-04

    The pVV9 and pWV7 probes were more specific for dengue-2 RNA, but-o ::e cross reaction with other dengue serotypes was noted. ,PdUc1biLity Codes S...contained dengue specific inserts that strongly hybridized to dengue-2 RMA and to the RNA of other dengue serotypes to varying degrees (Figure 6). The pVVl

  4. FPGA Techniques Based New Hybrid Modulation Strategies for Voltage Source Inverters

    OpenAIRE

    Sudha, L. U.; J. Baskaran; Elankurisil, S. A.

    2015-01-01

    This paper corroborates three different hybrid modulation strategies suitable for single-phase voltage source inverter. The proposed method is formulated using fundamental switching and carrier based pulse width modulation methods. The main tale of this proposed method is to optimize a specific performance criterion, such as minimization of the total harmonic distortion (THD), lower order harmonics, switching losses, and heat losses. The proposed method is articulated using fundamental switch...

  5. Application of DNA hybridization techniques in the assessment of diarrheal disease among refugess in Thailand. [Shigella; Escherichia coli; Campylobacter; Cryptosporidium

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, D.N.; Echeverria, P.; Pitarangsi, C.; Seriwatana, J.; Sethabutr, O.; Bodhidatta, L.; Brown, C.; Herrmann, J.E.; Blacklow, N.R.

    1988-01-01

    The epidemiology and etiology of acute diarrheal disease were determined in a Hmong refugee camp on the Thai-Laotian border from April 11 to May 14, 1985. DNA hybridization techniques were used to detect Shigella species, enteroinvasive Escherichia coli, and enterotoxigenic E. coli. A monoclonal enzyme-linked immunosorbent assay was used to detect rotavirus, and standard microbiology was used to detect other enteropathogens. The age-specific diarrheal disease rates were 47 episodes per month per 1000 children less than five years old and 113 episodes per month per 1000 children less than one year old. Rotavirus, enterotoxigenic E. coli, Campylobacter, and Cryptosporidium were the predominant pathogens in children less than two years old. The DNA probe hybridized with 94% of 31 specimens identified as enterotoxigenic E. coli by the standard assays and with none of the specimens in which the standard assays were negative. The probe for Shigella and enteroinvasive E. coli hybridized in eight of 10 stools that contained Shigella and four of 314 stools from which Shigella and enteroinvasive E. coli were not isolated. The use of DNA probes allows specimens to be collected in remote areas with a minimum amount of equipment and technical expertise so that they can be easily transported to a central laboratory for further processing.

  6. Screening of FOXP3-interacted proteins by yeast two-hybrid technique

    Institute of Scientific and Technical Information of China (English)

    Zhou Lina; Wu Jun; Luo Gaoxing; He Weifeng; Chen Xiwei; Bo Ganping; Yuan Shunzong; Zhang Xiaorong; Hu Xiaohong

    2008-01-01

    Objective: To screen the proteins interacting with the Treg specification factor forkhead box protein P3 (FOXP3) by yeast two-hybrid system. Methods: Human FOXP3 gene was amplified by nest RT-PCR from peripheral blood mononuclear cells (PBMC) and inserted into plasmid pGBKT7 to construct the bait vector, then the self-activation and toxicity of the bait vector in host yeast strain AH109 were observed. Thereafter, a human liver cDNA library was screened by the bait vector. The positive clones were selected out by nutrient-deficient culture and back-hybridizing. The sequences from the candidate positive clones were blasted and analyzed by bioinformatics methods. Results: The constructed bait vector encoding FOXP3 was found no self-activation and toxicity in yeast AH109. Three proteins which interacted with FOXP3, including tumor protein D52, splicing factor 3b subunit 1 and hypothetical protein, were identified. Conclusion: Three new candidate proteins interacting with FOXP3 are selected out by this yeast two-hybrid system and library, which may facilitate the further study of FOXP3 in Treg.

  7. Investigation of bipolaron formation in the Su-Schrieffer-Heeger (SSH) model and various extensions

    Science.gov (United States)

    Sous, John; Berciu, Mona; Krems, Roman

    We develop a variational scheme for studying the stability of bipolarons in one-dimensional systems. In particular, we consider the SSH, Holstein, and, Breathing-Mode models along with combinations of these couplings and with other extended variations. We derive equations of motions under the variational approximation and solve numerically for the two-particle Green's function. We study the stability of bipolarons under different conditions and for fermonic and bosonic particles.

  8. The design of student achievement management system based on SSH2%基于SSH2学生成绩管理系统的设计

    Institute of Scientific and Technical Information of China (English)

    李留青; 张莹莹

    2013-01-01

    Along with the increase in student Numbers,how can the effective management of student achievement information,establish a set of suitable for the university student achievement management system,is the construction of digital information required to solve important problems in colleges and universities.This paper designs an SSH2 based on student achievement management system,can realize the student achievement of entry,query,modify,add and manage of students,and other functions.%  随着学生数量的增多,如何能有效的管理学生成绩信息,建立一套适合本校学生成绩管理系统,是各高校数字信息建设所必需解决的重要问题。本文设计了基于SSH2学生成绩管理系统,可以实现对学生成绩的录入、查询、修改、学生的添加和管理等功能。

  9. An improved, SSH-based method to automatically identify mesoscale eddies in the ocean

    Institute of Scientific and Technical Information of China (English)

    WANG Xin; DU Yun-yan; ZHOU Cheng-hu; FAN Xing; YI Jia-wei

    2013-01-01

      Mesoscale eddies are an important component of oceanic features. How to automatically identify these mesoscale eddies from available data has become an important research topic. Through careful examination of existing methods, we propose an improved, SSH-based automatic identification method. Using the inclusion relation of enclosed SSH contours, the mesoscale eddy boundary and core(s) can be automatically identified. The time evolution of eddies can be examined by a threshold search algorithm and a tracking algorithm based on similarity. Sea-surface height (SSH) data from Naval Research Laboratory Layered Ocean Model (NLOM) and sea-level anomaly (SLA) data from altimeter are used in the many experiments, in which different automatic identification methods are compared. Our results indicate that the improved method is able to extract the mesoscale eddy boundary more precisely, retaining the multiple-core structure. In combination with the tracking algorithm, this method can capture complete mesoscale eddy processes. It can thus provide reliable information for further study of reconstructing eddy dynamics, merging, splitting, and evolution of a multi-core structure.

  10. Collision avoidance for a mobile robot based on radial basis function hybrid force control technique

    Institute of Scientific and Technical Information of China (English)

    Wen Shu-Huan

    2009-01-01

    Collision avoidance is always difficult in the planning path for a mobile robot. In this paper, the virtual force field between a mobile robot and an obstacle is formed and regulated to maintain a desired distance by hybrid force control algorithm. Since uncertainties from robot dynamics and obstacle degrade the performance of a collision avoidance task, intelligent control is used to compensate for the uncertainties. A radial basis function (RBF) neural network is used to regulate the force field of an accurate distance between a robot and an obstacle in this paper and then simulation studies are conducted to confirm that the proposed algorithm is effective.

  11. GENERAL: Collision avoidance for a mobile robot based on radial basis function hybrid force control technique

    Science.gov (United States)

    Wen, Shu-Huan

    2009-10-01

    Collision avoidance is always difficult in the planning path for a mobile robot. In this paper, the virtual force field between a mobile robot and an obstacle is formed and regulated to maintain a desired distance by hybrid force control algorithm. Since uncertainties from robot dynamics and obstacle degrade the performance of a collision avoidance task, intelligent control is used to compensate for the uncertainties. A radial basis function (RBF) neural network is used to regulate the force field of an accurate distance between a robot and an obstacle in this paper and then simulation studies are conducted to confirm that the proposed algorithm is effective.

  12. An alternative hybrid evolutionary technique focused on allocating machines and sequencing operations

    Directory of Open Access Journals (Sweden)

    Mariano Frutos

    2016-09-01

    Full Text Available We present here a hybrid algorithm for the Flexible Job-Shop Scheduling Problem (FJSSP. This problem involves the optimal use of resources in a flexible production environment in which each operation can be carried out by more than a single machine. Our algorithm allocates, in a first step, the machines to operations and in a second stage it sequences them by integrating a Multi-Objective Evolutionary Algorithm (MOEA and a path-dependent search algorithm (Multi-Objective Simulated Annealing, which is enacted at the genetic phase of the procedure. The joint interaction of those two components yields a very efficient procedure for solving the FJSSP. An important step in the development of the algorithm was the selection of the right MOEA. Candidates were tested on problems of low, medium and high complexity. Further analyses showed the relevance of the search algorithm in the hybrid structure. Finally, comparisons with other algorithms in the literature indicate that the performance of our alternative is good.

  13. STUDY OF MECHANICAL PROPERTIES OF BANANA-COIR HYBRID COMPOSITE USING EXPERIMENTAL AND FEM TECHNIQUES

    Directory of Open Access Journals (Sweden)

    T. Hariprasad

    2013-06-01

    Full Text Available The use of natural fibers as reinforcement in polymers has gained importance in recent years due to their eco-friendly nature. Thus, an investigation has been undertaken on banana-coir, which is a natural fiber abundantly available in India. Natural fibers are not only strong and lightweight, but also relatively very cheap. Composite plates were prepared with resin 392 g, coir 54 g, and banana 69 g. The purpose of this work is to establish the tensile, flexural, and impact properties of banana-coir reinforced composite materials with a thermo set for treated and untreated fibers. The resin used was epoxy (EP306. The tensile and impact tests showed that treated banana-coir epoxy hybrid composites have higher tensile strength and impact strength than untreated composites. However, untreated fiber composites have greater flexural strength than the treated fiber composites. The finite element analysis (FEA software ANSYS has been employed successfully to evaluate the properties. The stresses at the interface of the banana-coir and matrix, induced by the different loading conditions, were applied to predict the tensile, impact, and flexural properties by using the FEA models. The model output was compared with the experimental results and found to be close. This analysis is useful for realizing the advantages of hybrid fiber reinforced composites in structural applications and for identifying where the stresses are critical and damage the interface under varying loading conditions.

  14. Improved performance of hybrid error control techniques for real-time digital communications over noisy channels

    Science.gov (United States)

    Yang, Charlie Qing

    1993-06-01

    Delay-related performance characteristics are investigated for asynchronous time division multiplexing links. Two methods based on an imbedded Markov chain model are developed and applied to the system with a noisy feedback channel yielding analytical expressions for the buffer occupancy and the block delay. A recursive expression for packet loss probability for systems with a finite transmitter buffer is obtained. The concept of delay limited error control coding is introduced for real-time communications. Performance improvement by truncation of a type-2 hybrid automatic repeat-request (ARQ) protocol with one retransmission is examined showing that the truncated protocol has a bounded delay and bounded queue length under typical conditions. The error performance of the truncated protocol is further analyzed for various mobile fading channels. Matched rate hybrid error control coding for both adaptive and non-adaptive cases is also studied. A new adaptive error control protocol using Reed-Solomon codes is proposed using novel feedback transmissions to achieve faster estimation of channel states. Numerical optimization is carried out by introducing overall and modified throughput as efficiency criteria. Based on channel bit error rate measurement, optimum overall throughput is obtained with minimum implementation complexity.

  15. Hybrid technique coil embolisation for intrahepatic arterioportal fistula in a cat: case report

    Directory of Open Access Journals (Sweden)

    Akiko Uemura

    2016-04-01

    Full Text Available Case summary A 13-month-old, female, mixed breed, 4.0 kg cat was referred with a 6 month history of decreased appetite, loss of vigour and intermittent vomiting. Physical examination revealed no cyanosis or wasting, and no audible heart murmur was auscultated. Blood profile revealed mild anaemia and mildly elevated postprandial serum ammonia (109 µg/dl. Abdominal ultrasonography revealed dilation of an intrahepatic portal vein branch and an intrahepatic aneurysm, with splenomegaly and ascites. Hepatic arteriovenous fistula/hepatic artery–portal vein fistula with multiple acquired portosystemic shunts was strongly suspected. Medical control was achieved using antibiotics, liver-protecting agents, a low-protein diet and blood transfusions. However, because medical treatment proved ineffective, coil embolisation was performed on day 11, using a hybrid approach via the mesenteric vein. Subsequent follow-up showed good appetite, with no signs of diarrhoea or ascites. Abdominal ultrasonography revealed that the mosaic pattern around the site of coil placement in the portal vein branch had improved and pulsatility had disappeared. Relevance and novel information Intrahepatic arterioportal fistula involves a circulatory shunt between the hepatic artery and the hepatic or portal vein within the liver, and may be congenital or acquired. Both forms have been reported in humans, but most cases in cats have been congenital. Few reports have described treatment methods or prognosis in cats. We report here that coil embolisation using a hybrid approach is a procedure offering easy, effective treatment by blocking hepatofugal blood flow.

  16. DRYING OF EMPTY FRUIT BUNCHES AS WASTED BIOMASS BY HYBRID SOLAR–THERMAL DRYING TECHNIQUE

    Directory of Open Access Journals (Sweden)

    H. H. Al-Kayiem

    2013-12-01

    Full Text Available Solar drying of EFB is highly feasible and economic, but the solar drying process is interrupted during cloudy or rainy days and also at night. In the present paper, a combined solar, as the main heat input, and biomass burner, as an auxiliary source of thermal energy, has been investigated experimentally to dry EFB. An experimental model consisting of a solar dryer integrated with a thermal backup unit was designed and fabricated. A series of experimental measurements were carried out in four different drying modes, namely, open sun, mixed direct and indirect solar, thermal backup, and hybrid. The results from the four modes used to dry 2.5 kg of EFB were summarized and compared. The results indicated that the solar drying mode required around 52 to 80 hours to dry the EFB, while the open sun drying mode required 100 hours. Usage of the thermal backup as heat source reduced the drying time to 48–56 hours. With the hybrid mode, the drying time was considerably reduced to 24–32 hours. The results demonstrate that the combined solar and thermal backup effectively enhanced the drying performance. The application of a solar dryer with a biomass burner is practical for massive production of solid fuels from EFB.

  17. Active control of broadband sound transmission through an airplane trim panel using hybrid feedforward and feedback techniques

    Science.gov (United States)

    Ho, Yun-Ren

    This thesis presents a method of actively controlling the sound transmission through two designs of aircraft trim panels using a hybrid feedforward and feedback control technique. The active trim panels are designed for a high stiffness to mass ratio to allow only rigid body modal vibration in the frequency range of interest, thus simplifying the control technique, which is developed to minimize the vibration of a panel and therefore minimize the sound transmission. The hybrid controller consists of an adaptive feedforward (filtered-X LMS algorithm) controller in conjunction with a linear quadratic Gaussian (LQG) feedback controller. The LQG feedback controller is designed to alter the dynamics of the estimated plant model of the filtered-x LMS algorithm, improving control performance for both steady state and transient disturbances. Numerical simulations indicate that the hybrid controller is a more effective method of reducing the vibrations of the panels (and therefore the sound transmission) when compared to using only a feedforward or feedback controller. Experiments were carried out by using two trim panel designs, the first exhibiting only an out-of-plane piston mode, and the second exhibiting three rigid body modes and the first bending mode in control frequency range. For the first trim panel, the implementation of the active control experiment showed that a 5 to 20 dB reduction in both the vibration level and sound pressure level could be achieved over 50 to 500 Hz under a plane acoustic wave excitation. For the second trim panel, the hybrid controller achieved a 5 to 20 dB vibration reduction over the 50 to 400 Hz frequency band under structure-borne excitation. For air-borne excitation, the control scheme produced a 5 to 15 dB vibration reduction over the 70 to 400 Hz bandwidth with a reference microphone attached on the center of the fuselage skin and facing the sound source. In the near field (50 cm from the panel), the sound pressure levels measured

  18. Transcriptional profiling of genes involved in embryogenic, non-embryogenic calluses and somatic embryogenesis of Valencia sweet orange by SSH-based microarray.

    Science.gov (United States)

    Ge, Xiao-Xia; Chai, Li-Jun; Liu, Zheng; Wu, Xiao-Meng; Deng, Xiu-Xin; Guo, Wen-Wu

    2012-10-01

    Somatic embryogenesis (SE) is a most promising technology that is used for in vitro germplasm conservation and genetic improvement via biotechnological approaches in citrus. Herein, three suppression subtractive hybridization (SSH) libraries were constructed using calluses of Citrus sinensis cv. 'Valencia' to explore the molecular mechanisms that underlie the SE in citrus. A total of 880 unisequences were identified by microarray screening based on these three SSH libraries. Gene ontology analysis of the differentially expressed genes indicated that nucleolus associated regulation and biogenesis processes, hormone signal transduction, and stress factors might be involved in SE. Transcription factors might also play an important role. LEC1/B3 domain regulatory network genes (LEC1, L1L, FUS3, ABI3, and ABI5) were isolated in citrus SE. Some new transcription factors associated with citrus SE, like a B3 domain containing gene and HB4, were identified. To understand the influence of these isolated genes on SE competence, their expression profiles were compared among callus lines of seven citrus cultivars with different SE competence. The expression dynamics suggested that these genes could be necessary for the SE initiation and might play a role in embryogenic competence maintenance in different cultivars. On the basis of gene expression profiles, an overview of major physiological and biosynthesis processes at different developmental stages during citrus SE is presented. For the first time, these data provide a global resource for transcriptional events important for SE in citrus, and the specific genes offer new information for further investigation on citrus SE maintenance and development.

  19. Hybrid Neural-Network: Genetic Algorithm Technique for Aircraft Engine Performance Diagnostics Developed and Demonstrated

    Science.gov (United States)

    Kobayashi, Takahisa; Simon, Donald L.

    2002-01-01

    As part of the NASA Aviation Safety Program, a unique model-based diagnostics method that employs neural networks and genetic algorithms for aircraft engine performance diagnostics has been developed and demonstrated at the NASA Glenn Research Center against a nonlinear gas turbine engine model. Neural networks are applied to estimate the internal health condition of the engine, and genetic algorithms are used for sensor fault detection, isolation, and quantification. This hybrid architecture combines the excellent nonlinear estimation capabilities of neural networks with the capability to rank the likelihood of various faults given a specific sensor suite signature. The method requires a significantly smaller data training set than a neural network approach alone does, and it performs the combined engine health monitoring objectives of performance diagnostics and sensor fault detection and isolation in the presence of nominal and degraded engine health conditions.

  20. Enhancement of the mechanical properties of an aluminum metal matrix nanocomposite by the hybridization technique

    Directory of Open Access Journals (Sweden)

    Kalidindi Sita Rama Raju

    2016-07-01

    Full Text Available A uniform distribution of nanoparticles in the matrix plays a prominent role in improving the composite strength. In the present investigation, two types of launching vehicles, such as aluminum powder (primary and CNTs (secondary, are considered to uniformly carry and launch ultra-fine nanoparticles (13 nm into molten metal. The use of a secondary launching vehicle is identified to promote strengthening compared to a regular primary vehicle, as indicated by the good distribution observed from electron micrographs. CNTs are responsible for hybridizing the composite and also assist strengthening by anchoring to the matrix through the destroyed outer-walls and their axial orientation with the matrix. These results help us in attaining a strength of 197 MPa and a hardness of 93 BHN, with a minimal loss in ductility for the H-3 sample.

  1. FPGA techniques based new hybrid modulation strategies for voltage source inverters.

    Science.gov (United States)

    Sudha, L U; Baskaran, J; Elankurisil, S A

    2015-01-01

    This paper corroborates three different hybrid modulation strategies suitable for single-phase voltage source inverter. The proposed method is formulated using fundamental switching and carrier based pulse width modulation methods. The main tale of this proposed method is to optimize a specific performance criterion, such as minimization of the total harmonic distortion (THD), lower order harmonics, switching losses, and heat losses. The proposed method is articulated using fundamental switching and carrier based pulse width modulation methods. Thus, the harmonic pollution in the power system will be reduced and the power quality will be augmented with better harmonic profile for a target fundamental output voltage. The proposed modulation strategies are simulated in MATLAB r2010a and implemented in a Xilinx spartan 3E-500 FG 320 FPGA processor. The feasibility of these modulation strategies is authenticated through simulation and experimental results.

  2. Fusion techniques for hybrid ground-penetrating radar: electromagnetic induction landmine detection systems

    Science.gov (United States)

    Laffin, Matt; Mohamed, Magdi A.; Etebari, Ali; Hibbard, Mark

    2010-04-01

    Hybrid ground penetrating radar (GPR) and electromagnetic induction (EMI) sensors have advanced landmine detection far beyond the capabilities of a single sensing modality. Both probability of detection (PD) and false alarm rate (FAR) are impacted by the algorithms utilized by each sensing mode and the manner in which the information is fused. Algorithm development and fusion will be discussed, with an aim at achieving a threshold probability of detection (PD) of 0.98 with a low false alarm rate (FAR) of less than 1 false alarm per 2 square meters. Stochastic evaluation of prescreeners and classifiers is presented with subdivisions determined based on mine type, metal content, and depth. Training and testing of an optimal prescreener on lanes that contain mostly low metal anti-personnel mines is presented. Several fusion operators for pre-screeners and classifiers, including confidence map multiplication, will be investigated and discussed for integration into the algorithm architecture.

  3. Technique of performing construction works by machines with hybrid: manual and remote control

    Directory of Open Access Journals (Sweden)

    Sevryugina Nadezhda

    2017-01-01

    Full Text Available The article discusses issues dealing with efficiency of construction work mechanization. It offers a mathematical model for assessment of mutual influence between the members of the ‘construction site-machine-operator’ system triad, that can give a quantitative assessment of how the efficiency of a technological task varies with more comprehensive use of operational capacities of the machine, while lower effect that limiting parameters of production environment and technical condition of the machine have on the operator. The article contains a constructive remote control solution for upgrade of the base machine. It describes the conditions for using the machines with hybrid: manual and remote control at construction sites. There is also an imitation model of operator’s scanning pattern and data experimental research that prove the efficiency of remotely controlled technological operations. The article proves that lower psychological load on the operator and better comfort contribute to positive economic effect and higher quality of the construction process.

  4. Wind Power Forecasting techniques in complex terrain: ANN vs. ANN-CFD hybrid approach

    Science.gov (United States)

    Castellani, Francesco; Astolfi, Davide; Mana, Matteo; Burlando, Massimiliano; Meißner, Cathérine; Piccioni, Emanuele

    2016-09-01

    Due to technology developments, renewable energies are becoming competitive against fossil sources and the number of wind farms is growing, which have to be integrated into power grids. Therefore, accurate power forecast is needed and often operators are charged with penalties in case of imbalance. Yet, wind is a stochastic and very local phenomenon, and therefore hard to predict. It has a high variability in space and time and wind power forecast is challenging. Statistical methods, as Artificial Neural Networks (ANN), are often employed for power forecasting, but they have some shortcomings: they require data sets over several years and are not able to capture tails of wind power distributions. In this work a pure ANN power forecast is compared against a hybrid method, based on the combination of ANN and a physical method using computational fluid dynamics (CFD). The validation case is a wind farm sited in southern Italy in a very complex terrain, with a wide spread turbine layout.

  5. A hybrid fringe analysis technique for the elimination of random noise in interferometric wrapped phase maps

    Science.gov (United States)

    Bhat, Gopalakrishna K.

    1994-10-01

    A fringe analysis technique, which makes use of the spatial filtering property of the Fourier transform method, for the elimination of random impulsive noise in the wrapped phase maps obtained using the phase stepping technique, is presented. Phase noise is converted into intensity noise by transforming the wrapped phase map into a continuous fringe pattern inside the digital image processor. Fourier transform method is employed to filter out the intensity noise and recover the clean wrapped phase map. Computer generated carrier fringes are used to preserve the sign information. This technique makes the two dimensional phase unwrapping process less involved, because it eliminates the local phase fluctuations, which act as pseudo 2π discontinuities. The technique is applied for the elimination of noise in a phase map obtained using electro-optic holography.

  6. Prediction of daily rainfall by a hybrid wavelet-season-neuro technique

    Science.gov (United States)

    Altunkaynak, Abdusselam; Nigussie, Tewodros Assefa

    2015-10-01

    Accurate daily rainfall prediction is required for accurate streamflow prediction, flooding risk analysis, constructing a reliable flood control and early warning system. However, because of its nonlinearity, prediction of daily rainfall with high accuracy and long prediction lead time is difficult. There are many daily rainfall prediction methods in the literature, but they are known to yield inaccurate predictions with short lead time, require many physical parameters and involve complicated mathematical equations with huge computational burden. Recently, artificial neural network has been used for predicting rainfall with the objective of addressing the above mentioned problems. But still, the accuracy has not been satisfactory and predictions are with short lead time. In this study, two methods called combined season-multilayer perceptron (SAS-MP) and hybrid wavelet-season-multilayer perceptron (W-SAS-MP) were developed to enhance prediction accuracy and extend prediction lead time of daily rainfall up to 5 days by using data from two stations in Turkey. These two models were compared with the stand-alone multilayer perceptron and another most commonly used method called combined wavelet-multilayer perceptron (W-MP). The performances of the models were evaluated by using coefficient of determination, coefficient of efficiency and root mean squared error. The SAS-MP model was found to be better than W-MP in most cases, except lead time day 1, where W-MP performed better. Throughout all the lead times, however, the hybrid W-SAS-MP model performed best with CE values of 0.911 and 0.909, respectively, for prediction lead time of 1 day and 0.588 and 0.570, respectively, for prediction lead time of 5 days at Stations 17836 and 17837, respectively, at the model testing (validation) phase. Therefore, W-SAS-MP can be an appropriate tool for enhancing daily rainfall prediction accuracy and extend prediction lead time.

  7. Distributed-parameter problem solved on a hybrid computer by a modified function storage technique

    DEFF Research Database (Denmark)

    Poulsen, N.J.

    1969-01-01

    Describes a method which is based on a function storage technique improved by a number of modifications; it fulfils the two main demands: the solution is based directly on the physical equations, and is accurate within 1%......Describes a method which is based on a function storage technique improved by a number of modifications; it fulfils the two main demands: the solution is based directly on the physical equations, and is accurate within 1%...

  8. A Low Cost Vision Based Hybrid Fiducial Mark Tracking Technique for Mobile Industrial Robots

    OpenAIRE

    Mohammed Y Aalsalem; Wazir Zada Khan; Quratul Ain Arshad

    2012-01-01

    The field of robotic vision is developing rapidly. Robots can react intelligently and provide assistance to user activities through sentient computing. Since industrial applications pose complex requirements that cannot be handled by humans, an efficient low cost and robust technique is required for the tracking of mobile industrial robots. The existing sensor based techniques for mobile robot tracking are expensive and complex to deploy, configure and maintain. Also some of them demand dedic...

  9. Applying Subtractive Hybridization Technique to Enrich and Amplify Tumor-Specific Transcripts of Esophageal Squamous Cell Carcinoma.

    Science.gov (United States)

    Mahmoudian, Reihaneh Alsadat; Abbaszadegan, Mohammad Reza; Gholamin, Mehran

    2017-04-01

    Subtractive hybridization (SH) as an efficient and powerful approach can be applied to isolate differentially expressed transcripts as well as detect of involved mRNAs in various cellular processes, particularly diseases and malignancies. This procedure leads to the enrichment of specific low copy transcripts of tumor cells. Having developed a new approach for SH to isolate tumor specific transcripts, we facilitated discovery of uniquely expressed genes in esophageal squamous cell carcinoma (ESCC). Total RNA was extracted from the fresh tumoral and their adjacent normal tissues, and purified using the Switch Mechanism At the 5' end of Reverse Transcript (SMART) method. Following cDNA synthesis of normal mRNAs using magnetic beads, it was hybridized with tumor mRNAs. To enhance efficiency of subtraction, hybridization was repeated three rounds. Finally, amplification of subtracted tumor-specific transcripts was carried out using in vitro transcription. The subtracted tumoral mRNAs was analyzed quantitatively using real-time PCR for both tumor-specific and housekeeping genes. The subtracted mRNA was confirmed as tumor-specific mRNA pool using RT-PCR and quantitative real-time PCR assessment. The elevated level of tumor-specific transcripts such as MAGE-A4 and CD44 as well as declined copy number of housekeeping genes such as GAPDH, β actin and β2-microglobulin, were confirmed in subtracted tumoral mRNA. The presence of tumor genes was confirmed after the SH procedure. The designed SH method in combination with SMART technique can isolate and amplify high quality tumor-specific transcripts even from small amount of tumor tissues. Removal of common transcripts from the extracted tumoral mRNAs using SH, leads to the enrichment of tumor-specific transcripts. The isolated transcripts are of interest because of their probable roles in ESCC progression and development. In addition, these tumor-specific mRNAs can be applied for future vaccine cancer studies.

  10. SSH Analysis of Endosperm Transcripts and Characterization of Heat Stress Regulated Expressed Sequence Tags in Bread Wheat.

    Science.gov (United States)

    Goswami, Suneha; Kumar, Ranjeet R; Dubey, Kavita; Singh, Jyoti P; Tiwari, Sachidanand; Kumar, Ashok; Smita, Shuchi; Mishra, Dwijesh C; Kumar, Sanjeev; Grover, Monendra; Padaria, Jasdeep C; Kala, Yugal K; Singh, Gyanendra P; Pathak, Himanshu; Chinnusamy, Viswanathan; Rai, Anil; Praveen, Shelly; Rai, Raj D

    2016-01-01

    Heat stress is one of the major problems in agriculturally important cereal crops, especially wheat. Here, we have constructed a subtracted cDNA library from the endosperm of HS-treated (42°C for 2 h) wheat cv. HD2985 by suppression subtractive hybridization (SSH). We identified ~550 recombinant clones ranging from 200 to 500 bp with an average size of 300 bp. Sanger's sequencing was performed with 205 positive clones to generate the differentially expressed sequence tags (ESTs). Most of the ESTs were observed to be localized on the long arm of chromosome 2A and associated with heat stress tolerance and metabolic pathways. Identified ESTs were BLAST search using Ensemble, TriFLD, and TIGR databases and the predicted CDS were translated and aligned with the protein sequences available in pfam and InterProScan 5 databases to predict the differentially expressed proteins (DEPs). We observed eight different types of post-translational modifications (PTMs) in the DEPs corresponds to the cloned ESTs-147 sites with phosphorylation, 21 sites with sumoylation, 237 with palmitoylation, 96 sites with S-nitrosylation, 3066 calpain cleavage sites, and 103 tyrosine nitration sites, predicted to sense the heat stress and regulate the expression of stress genes. Twelve DEPs were observed to have transmembrane helixes (TMH) in their structure, predicted to play the role of sensors of HS. Quantitative Real-Time PCR of randomly selected ESTs showed very high relative expression of HSP17 under HS; up-regulation was observed more in wheat cv. HD2985 (thermotolerant), as compared to HD2329 (thermosusceptible) during grain-filling. The abundance of transcripts was further validated through northern blot analysis. The ESTs and their corresponding DEPs can be used as molecular marker for screening or targeted precision breeding program. PTMs identified in the DEPs can be used to elucidate the thermotolerance mechanism of wheat-a novel step toward the development of "climate-smart" wheat.

  11. SSH analysis of endosperm transcripts and characterization of heat stress regulated expressed sequence tags in bread wheat

    Directory of Open Access Journals (Sweden)

    Suneha Goswami

    2016-08-01

    Full Text Available Heat stress is one of the major problems in agriculturally important cereal crops, especially wheat. Here, we have constructed a subtracted cDNA library from the endosperm of HS-treated (42°C for 2 h wheat cv. HD2985 by suppression subtractive hybridization (SSH. We identified ~550 recombinant clones ranging from 200 to 500 bp with an average size of 300 bp. Sanger’s sequencing was performed with 205 positive clones to generate the differentially expressed sequence tags (ESTs. Most of the ESTs were observed to be localized on the long arm of chromosome 2A and associated with heat stress tolerance and metabolic pathways. Identified ESTs were BLAST search using Ensemble, TriFLD and TIGR databases and the predicted CDS were translated and aligned with the protein sequences available in pfam and InterProScan 5 databases to predict the differentially expressed proteins (DEPs. We observed eight different types of post-translational modifications (PTMs in the DEPs corresponds to the cloned ESTs—147 sites with phosphorylation, 21 sites with sumoylation, 237 with palmitoylation, 96 sites with S-nitrosylation, 3066 calpain cleavage sites, and 103 tyrosine nitration sites, predicted to sense the heat stress and regulate the expression of stress genes. Twelve DEPs were observed to have transmembrane helixes (TMH in their structure, predicted to play the role of sensors of HS. Quantitative Real-Time PCR of randomly selected ESTs showed very high relative expression of HSP17 under HS; up-regulation was observed more in wheat cv. HD2985 (thermotolerant, as compared to HD2329 (thermosusceptible during grain-filling. The abundance of transcripts was further validated through northern blot analysis. The ESTs and their corresponding DEPs can be used as molecular marker for screening or targeted precision breeding program. PTMs identified in the DEPs can be used to elucidate the thermotolerance mechanism of wheat – a novel step towards the development of

  12. Construction of cDNA subtractive library from pearl oyster ( Pinctada fucata Gould) with red color shell by SSH

    Science.gov (United States)

    Guan, Yunyan; Huang, Liangmin; He, Maoxian

    2011-05-01

    The molecular basis of color polymorphism in the shells of the pearl oyster Pinctada fucata is largely unknown. We developed a red-shelled family line and used suppression subtractive hybridization (SSH) to screen for differentially expressed genes in red- and non-red-shelled pearl oysters. We constructed forward and reverse cDNA subtractive libraries consisting of 2 506 and 797 clones, respectively. Among 343 randomly selected clones in the forward library, 304 sequences were identified in GenBank using BLASTx and BLASTn. Of the 304 sequences, 13 showed no similarity to known sequences and 291 were matched with known genes of the pearl oyster, including shematrin-1, shematrin-2, shematrin-6, shematrin-7, nacrein, nacrein-like protein, aspein for shell matrix protein, glycine-rich protein, mantle gene 5, 28S, EST00031, EST00036, 16S, and COI. In the reverse library, 7 clones were sequenced and analyzed by BLAST. Two sequences shared similarity with EST00036 from the P. fucata subtraction cDNA library, four with the P. fucata mitochondrial gene for 16S rRNA and 1 with P. fucata shematrin-2. We evaluated the expression of 12 genes from the forward library using RT PCR. Two sequences matched with 16S and COI so were considered to be false positives. The remaining 10 sequences were differentially expression in the red-shelled pearl oysters. Our results suggest that differential expression of these genes may be related to color variation in the red-shelled family line of the pearl oyster.

  13. SSH Analysis of Endosperm Transcripts and Characterization of Heat Stress Regulated Expressed Sequence Tags in Bread Wheat

    Science.gov (United States)

    Goswami, Suneha; Kumar, Ranjeet R.; Dubey, Kavita; Singh, Jyoti P.; Tiwari, Sachidanand; Kumar, Ashok; Smita, Shuchi; Mishra, Dwijesh C.; Kumar, Sanjeev; Grover, Monendra; Padaria, Jasdeep C.; Kala, Yugal K.; Singh, Gyanendra P.; Pathak, Himanshu; Chinnusamy, Viswanathan; Rai, Anil; Praveen, Shelly; Rai, Raj D.

    2016-01-01

    Heat stress is one of the major problems in agriculturally important cereal crops, especially wheat. Here, we have constructed a subtracted cDNA library from the endosperm of HS-treated (42°C for 2 h) wheat cv. HD2985 by suppression subtractive hybridization (SSH). We identified ~550 recombinant clones ranging from 200 to 500 bp with an average size of 300 bp. Sanger's sequencing was performed with 205 positive clones to generate the differentially expressed sequence tags (ESTs). Most of the ESTs were observed to be localized on the long arm of chromosome 2A and associated with heat stress tolerance and metabolic pathways. Identified ESTs were BLAST search using Ensemble, TriFLD, and TIGR databases and the predicted CDS were translated and aligned with the protein sequences available in pfam and InterProScan 5 databases to predict the differentially expressed proteins (DEPs). We observed eight different types of post-translational modifications (PTMs) in the DEPs corresponds to the cloned ESTs-147 sites with phosphorylation, 21 sites with sumoylation, 237 with palmitoylation, 96 sites with S-nitrosylation, 3066 calpain cleavage sites, and 103 tyrosine nitration sites, predicted to sense the heat stress and regulate the expression of stress genes. Twelve DEPs were observed to have transmembrane helixes (TMH) in their structure, predicted to play the role of sensors of HS. Quantitative Real-Time PCR of randomly selected ESTs showed very high relative expression of HSP17 under HS; up-regulation was observed more in wheat cv. HD2985 (thermotolerant), as compared to HD2329 (thermosusceptible) during grain-filling. The abundance of transcripts was further validated through northern blot analysis. The ESTs and their corresponding DEPs can be used as molecular marker for screening or targeted precision breeding program. PTMs identified in the DEPs can be used to elucidate the thermotolerance mechanism of wheat—a novel step toward the development of

  14. Construction of cDNA subtractive library from pearl oyster (Pinctada fucata Gould) with red color shell by SSH

    Institute of Scientific and Technical Information of China (English)

    GUAN Yunyan; HUANG Liangmin; HE Maoxian

    2011-01-01

    The molecular basis of color polymorphism in the shells of the pearl oyster Pinctada fucata is largely unknown. We developed a red-shelled family line and used suppression subtractive hybridization (SSH) to screen for differentially expressed genes in red- and non-red-shelled pearl oysters. We constructed forward and reverse cDNA subtractive libraries consisting of 2 506 and 797 clones, respectively.Among 343 randomly selected clones in the forward library, 304 sequences were identified in GenBank using BLASTx and BLASTn. Of the 304 sequences, 13 showed no similarity to known sequences and 291 were matched with known genes of the pearl oyster, including shematrin-1, shematrin-2, shematrin-6,shematrin-7, nacrein, nacrein-like protein, aspein for shell matrix protein, glycine-rich protein, mantle gene 5, 28S, EST00031, EST00036, 16S, and COI. In the reverse library, 7 clones were sequenced and analyzed by BLAST. Two sequences shared similarity with EST00036 from the P. fucata subtraction cDNA library, four with the P. fucata mitochondrial gene for 16S rRNA and 1 with P. fucata shematrin-2. We evaluated the expression of 12 genes from the forward library using RT PCR. Two sequences matched with 16S and COI so were considered to be false positives. The remaining 10 sequences were differentially expression in the red-shelled pearl oysters. Our results suggest that differential expression of these genes may be related to color variation in the red-shelled family line of the pearl oyster.

  15. Electromagnetic self-consistent field initialization and fluid advance techniques for hybrid-kinetic PWFA code Architect

    Science.gov (United States)

    Massimo, F.; Marocchino, A.; Rossi, A. R.

    2016-09-01

    The realization of Plasma Wakefield Acceleration experiments with high quality of the accelerated bunches requires an increasing number of numerical simulations to perform first-order assessments for the experimental design and online-analysis of the experimental results. Particle in Cell codes are the state-of-the-art tools to study the beam-plasma interaction mechanism, but due to their requirements in terms of number of cores and computational time makes them unsuitable for quick parametric scans. Considerable interest has been shown thus in methods which reduce the computational time needed for the simulation of plasma acceleration. Such methods include the use of hybrid kinetic-fluid models, which treat the relativistic bunches as in a PIC code and the background plasma electrons as a fluid. A technique to properly initialize the bunch electromagnetic fields in the time explicit hybrid kinetic-fluid code Architect is presented, as well the implementation of the Flux Corrected Transport scheme for the fluid equations integrated in the code.

  16. Model Predictive Control techniques with application to photovoltaic, DC Microgrid, and a multi-sourced hybrid energy system

    Science.gov (United States)

    Shadmand, Mohammad Bagher

    Renewable energy sources continue to gain popularity. However, two major limitations exist that prevent widespread adoption: availability and variability of the electricity generated and the cost of the equipment. The focus of this dissertation is Model Predictive Control (MPC) for optimal sized photovoltaic (PV), DC Microgrid, and multi-sourced hybrid energy systems. The main considered applications are: maximum power point tracking (MPPT) by MPC, droop predictive control of DC microgrid, MPC of grid-interaction inverter, MPC of a capacitor-less VAR compensator based on matrix converter (MC). This dissertation firstly investigates a multi-objective optimization technique for a hybrid distribution system. The variability of a high-penetration PV scenario is also studied when incorporated into the microgrid concept. Emerging (PV) technologies have enabled the creation of contoured and conformal PV surfaces; the effect of using non-planar PV modules on variability is also analyzed. The proposed predictive control to achieve maximum power point for isolated and grid-tied PV systems speeds up the control loop since it predicts error before the switching signal is applied to the converter. The low conversion efficiency of PV cells means we want to ensure always operating at maximum possible power point to make the system economical. Thus the proposed MPPT technique can capture more energy compared to the conventional MPPT techniques from same amount of installed solar panel. Because of the MPPT requirement, the output voltage of the converter may vary. Therefore a droop control is needed to feed multiple arrays of photovoltaic systems to a DC bus in microgrid community. Development of a droop control technique by means of predictive control is another application of this dissertation. Reactive power, denoted as Volt Ampere Reactive (VAR), has several undesirable consequences on AC power system network such as reduction in power transfer capability and increase in

  17. All-optical delay technique for supporting multiple antennas in a hybrid optical - wireless transmission system

    DEFF Research Database (Denmark)

    Prince, Kamau; Chiuchiarelli, A; Presi, M

    2008-01-01

    We introduce a novel continuously-variable optical delay technique to support beam-forming wireless communications systems using antenna arrays. We demonstrate delay with 64-QAM modulated signals at a rate of 15 Msymbol/sec with 2.5 GHz carrier frequency.......We introduce a novel continuously-variable optical delay technique to support beam-forming wireless communications systems using antenna arrays. We demonstrate delay with 64-QAM modulated signals at a rate of 15 Msymbol/sec with 2.5 GHz carrier frequency....

  18. A Hybrid VLM Preceded SLM Technique Using Clipping and Filtering Method for PAPR Reduction in MIMO-OFDM Systems

    Directory of Open Access Journals (Sweden)

    Meenakshi

    2016-07-01

    Full Text Available MIMO-OFDM is an attractive interface for the next generation WLANs, WMAN, 4G and 5G mobile cellular systems. However the performance of the MIMO-OFDM systems is affected by Peak to Average Power Ratio (PAPR. PAPR is the main disadvantage associated with the MIMO-OFDM systems. So far, many techniques have been proposed to reduce the value of PAPR but high PAPR for MIMO-OFDM systems is still a demanding area and a different issue.In this paper, a hybrid VLM precoded SLM scheme using Clipping & Filtering has been proposed to reduce PAPR in MIMO-OFDM systems. And it has been observed that the proposed scheme has achieved a significant gain in PAPR reduction without increasing the system complexity and affecting the error performance of the system

  19. Therapeutic efficacy of a hybrid mandibular advancement device in the management of obstructive sleep apnea assessed with acoustic reflection technique

    Directory of Open Access Journals (Sweden)

    S S Agarwal

    2015-01-01

    Full Text Available Obstructive sleep apnea (OSA is one of the most common forms of sleep-disordered breathing. Various treatment modalities include behavior modification therapy, nasal continuous positive airway pressure (CPAP, oral appliance therapy, and various surgical modalities. Oral appliances are noninvasive and recommended treatment modality for snoring, mild to moderate OSA cases and severe OSA cases when patient is not compliant to CPAP therapy and unwilling for surgery. Acoustic reflection technique (ART is a relatively new modality for three-dimensional assessment of airway caliber in various clinical situations. The accuracy and reproducibility of acoustic rhinometry and acoustic pharyngometry assessment are comparable to computerized tomography and magnetic resonance imaging. This case report highlights the therapeutic efficacy of an innovative customized acrylic hybrid mandibular advancement device in the management of polysomnography diagnosed OSA cases, and the treatment results were assessed by ART.

  20. Hybrid vapor phase-solution phase growth techniques for improved CZT(S,Se) photovoltaic device performance

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Liang-Yi; Gershon, Talia S.; Haight, Richard A.; Lee, Yun Seog

    2016-12-27

    A hybrid vapor phase-solution phase CZT(S,Se) growth technique is provided. In one aspect, a method of forming a kesterite absorber material on a substrate includes the steps of: depositing a layer of a first kesterite material on the substrate using a vapor phase deposition process, wherein the first kesterite material includes Cu, Zn, Sn, and at least one of S and Se; annealing the first kesterite material to crystallize the first kesterite material; and depositing a layer of a second kesterite material on a side of the first kesterite material opposite the substrate using a solution phase deposition process, wherein the second kesterite material includes Cu, Zn, Sn, and at least one of S and Se, wherein the first kesterite material and the second kesterite material form a multi-layer stack of the absorber material on the substrate. A photovoltaic device and method of formation thereof are also provided.

  1. Hybrid vapor phase-solution phase growth techniques for improved CZT(S,Se) photovoltaic device performance

    Science.gov (United States)

    Chang, Liang-Yi; Gershon, Talia S.; Haight, Richard A.; Lee, Yun Seog

    2016-12-27

    A hybrid vapor phase-solution phase CZT(S,Se) growth technique is provided. In one aspect, a method of forming a kesterite absorber material on a substrate includes the steps of: depositing a layer of a first kesterite material on the substrate using a vapor phase deposition process, wherein the first kesterite material includes Cu, Zn, Sn, and at least one of S and Se; annealing the first kesterite material to crystallize the first kesterite material; and depositing a layer of a second kesterite material on a side of the first kesterite material opposite the substrate using a solution phase deposition process, wherein the second kesterite material includes Cu, Zn, Sn, and at least one of S and Se, wherein the first kesterite material and the second kesterite material form a multi-layer stack of the absorber material on the substrate. A photovoltaic device and method of formation thereof are also provided.

  2. Treatment of breast cancer with simultaneous integrated boost in hybrid plan technique. Influence of flattening filter-free beams

    Energy Technology Data Exchange (ETDEWEB)

    Bahrainy, Marzieh; Kretschmer, Matthias; Joest, Vincent; Kasch, Astrid; Wuerschmidt, Florian; Dahle, Joerg; Lorenzen, Joern [Radiologische Allianz, Hamburg (Germany)

    2016-05-15

    The present study compares in silico treatment plans using hybrid plan technique during hypofractionated radiation of mammary carcinoma with simultaneous integrated boost (SIB). The influence of 6 MV photon radiation in flattening filter free (FFF) mode against the clinical standard flattening filter (FF) mode is to be examined. RT planning took place with FF and FFF radiation plans for 10 left-sided breast cancer patients. Hybrid plans were realised with two tangential IMRT fields and one VMAT field. The dose prescription was in line with the guidelines in the ARO-2010-01 study. The dosimetric verification took place with a manufacturer-independent measurement system. Required dose prescriptions for the planning target volumes (PTV) were achieved for both groups. The average dose values of the ipsi- and contralateral lung and the heart did not differ significantly. The overall average incidental dose to the left anterior descending artery (LAD) of 8.24 ± 3.9 Gy in the FFF group and 9.05 ± 3.7 Gy in the FF group (p < 0.05) were found. The dosimetric verifications corresponded to the clinical requirements. FFF-based RT plans reduced the average treatment time by 17 s/fraction. In comparison to the FF-based hybrid plan technique the FFF mode allows further reduction of the average LAD dose for comparable target volume coverage without adverse low-dose exposure of contralateral structures. The combination of hybrid plan technique and 6 MV photon radiation in the FFF mode is suitable for use with hypofractionated dose schemes. The increased dose rate allows a substantial reduction of treatment time and thus beneficial application of the deep inspiration breath hold technique. (orig.) [German] Vergleich der ''In-silico''-Bestrahlungsplaene der klinisch etablierten Hybridplan-Technik bei hypofraktionierter Bestrahlung des Mammakarzinoms mit simultan integriertem Boost (SIB). Untersucht wird der Einfluss von 6MV-Photonenstrahlung im Flattening

  3. Comparison and performance analysis of closed loop controlled nonlinear system connected PWM inverter based on hybrid technique

    Directory of Open Access Journals (Sweden)

    V.M. Deshmukh

    2015-05-01

    Full Text Available This paper proposed closed loop control of nonlinear system connected inverter based on the optimal neural controller (ONC. The novelty of the proposed method rests on the hybrid technique which is the combined performance of both, particle swarm optimization (PSO technique and Radial basis function neural network (RBFNN. It effectively optimizes the feasible solutions by updating the generations, by taking lesser time with greater reliability. In the proposed method, the PSO generates the dataset according to different loading conditions. The RBFNN is trained by using the target control signals along with the corresponding input load voltage error and change in error. Depending on the load variations, the RBFNN predicts the exact control signals of the inverter during the testing time. Since experimentation and comparison of such inverter models on hardware being relatively expensive, the proposed method is implemented in the MATLAB/Simulink platform and the performance has been validated through the comparison analysis with the conventional techniques. The comparison results have proved the superiority of the proposed method.

  4. 3D printing of high-resolution PLA-based structures by hybrid electrohydrodynamic and fused deposition modeling techniques

    Science.gov (United States)

    Zhang, Bin; Seong, Baekhoon; Nguyen, VuDat; Byun, Doyoung

    2016-02-01

    Recently, the three-dimensional (3D) printing technique has received much attention for shape forming and manufacturing. The fused deposition modeling (FDM) printer is one of the various 3D printers available and has become widely used due to its simplicity, low-cost, and easy operation. However, the FDM technique has a limitation whereby its patterning resolution is too low at around 200 μm. In this paper, we first present a hybrid mechanism of electrohydrodynamic jet printing with the FDM technique, which we name E-FDM. We then develop a novel high-resolution 3D printer based on the E-FDM process. To determine the optimal condition for structuring, we also investigated the effect of several printing parameters, such as temperature, applied voltage, working height, printing speed, flow-rate, and acceleration on the patterning results. This method was capable of fabricating both high resolution 2D and 3D structures with the use of polylactic acid (PLA). PLA has been used to fabricate scaffold structures for tissue engineering, which has different hierarchical structure sizes. The fabrication speed was up to 40 mm/s and the pattern resolution could be improved to 10 μm.

  5. Real-time hybrid simulation technique for performance evaluation of full-scale sloshing dampers in wind turbines

    Science.gov (United States)

    Zhang, Zili; Basu, Biswajit; Nielsen, Saren R. K.

    2016-09-01

    As a variation of the pseudodynamic testing technique, the real-time hybrid simulation (RTHS) technique is executed in real time, thus allowing investigation of structural systems with rate-dependent components. In this paper, the RTHS is employed for performance evaluation of full-scale liquid sloshing dampers in multi-megawatt wind turbines, where the tuned liquid damper (TLD) is manufactured and tested as the physical substructure while the wind turbine is treated as the numerical substructure and modelled in the computer using a 13-degree-of-freedom (13-DOF) aeroelastic model. Wind turbines with 2 MW and 3 MW capacities have been considered under various turbulent wind conditions. Extensive parametric studies have been performed on the TLD, e.g., various tuning ratios by changing the water level, TLD without and with damping screens (various mesh sizes of the screen considered), and TLD with flat and sloped bottoms. The present study provides useful guidelines for employing sloshing dampers in large wind turbines, and indicates huge potentials of applying RTHS technique in the area of wind energy.

  6. Screening for cardiac HERG potassium channel interacting proteins using the yeast two-hybrid technique.

    Science.gov (United States)

    Ma, Qingyan; Yu, Hong; Lin, Jijin; Sun, Yifan; Shen, Xinyuan; Ren, Li

    2014-02-01

    The human ERG protein (HERG or Kv 11.1) encoded by the human ether-a-go-go-related gene (herg) is the pore-forming subunit of the cardiac delayed rectifier potassium current (IKr) responsible for action potential (AP) repolarization. Mutations in HERG lead to long-QT syndrome, a major cause of arrhythmias. Protein-protein interactions are fundamental for ion channel trafficking, membrane localization, and functional modulation. To identify proteins involved in the regulation of the HERG channel, we conducted a yeast two-hybrid screen of a human heart cDNA library using the C-terminus or N-terminus of HERG as bait. Fifteen proteins were identified as HERG amino terminal (HERG-NT)-interacting proteins, including Caveolin-1 (a membrane scaffold protein with multiple interacting partners, including G-proteins, kinases and NOS), the zinc finger protein, FHL2 and PTPN12 (a non-receptor tyrosine phosphatase). Eight HERG carboxylic terminal (HERG-CT)-interacting proteins were also identified, including the NF-κB-interacting protein myotrophin, We have identified multiple potential interacting proteins that may regulate cardiac IKr through cytoskeletal interactions, G-protein modulation, phosphorylation and downstream second messenger and transcription cascades. These findings provide further insight into dynamic modulation of HERG under physiological conditions and arrhythmogenesis.

  7. Speeding-up the hybrid video watermarking techniques in the DWT domain

    Science.gov (United States)

    Chammem, A.; Mitrea, M.; Preteux, F.

    2010-01-01

    The watermarking state of the art exhibits the hybrid methods combining spread spectrum and side information principles. The present study is focussed on speeding up such an algorithm (jointly patented by SFR - Vodafone Group and Institut Telecom). The dead lock on the reference method is first identified: the embedding module accounts for 90% of the whole watermarking chain and that more than 99% of this time is spent on applying an attack procedure (required in order to grant a good robustness to this method). The main issue of the present study is to deploy Monte Carlo generators accurately representing the watermarking attacks. In this respect, two difficulties should be overcome. First, accurate statistical models for the watermarking attacks should be obtained. Secondly, efficient Monte Carlo simulators should be deployed for these models. The last part of the study was devoted to the experimental validations. The mark is inserted in the (9,7) DWT representation of video sequence. Several types of attacks have been considered (linear and non-linear filters, geometrical transformations, ...). The quantitative results proved that the data payload, transparency and robustness properties have been inherited from the reference method. However, the watermarking speed was increased by a factor of 80.

  8. Entrapment of glucoamylase by sol-gel technique in PhTES/TEOS hybrid matrixes

    Directory of Open Access Journals (Sweden)

    B. Vlad-Oros

    2007-12-01

    Full Text Available Mesoporous silica particles were prepared by the sol-gel method from different alkoxysilane precursors and used as a host matrix for encapsulation of glucoamylase, an enzyme widely used in fermentative industry. The aim was to investigate the physico-chemical properties of the different silica powders and their effect on the enzyme kinetics. The encapsulated enzymes followed Michaelis-Menten kinetics. The Michaelis constant (KM and the maximum rate of starch hydrolysis reaction (Vmax were calculated according to the Michaelis-Menten and Lineweaver-Burke plots. The values of the Michaelis constant (KM of the encapsulated enzymes were higher than those of the free enzyme. The temperature and pH infl uence on the activity of free and immobilized glucoamylase were also compared. The results of this study show that the enzymes immobilized in organic/inorganic hybrid silica matrixes (obtained by the sol-gel method, allowing the entrapped glucoamylase to retain its biological activity, are suitable for many different applications, (medicinal, clinical, analytical.

  9. Prediction of peak ground acceleration of Iran's tectonic regions using a hybrid soft computing technique

    Directory of Open Access Journals (Sweden)

    Mostafa Gandomi

    2016-01-01

    Full Text Available A new model is derived to predict the peak ground acceleration (PGA utilizing a hybrid method coupling artificial neural network (ANN and simulated annealing (SA, called SA-ANN. The proposed model relates PGA to earthquake source to site distance, earthquake magnitude, average shear-wave velocity, faulting mechanisms, and focal depth. A database of strong ground-motion recordings of 36 earthquakes, which happened in Iran's tectonic regions, is used to establish the model. For more validity verification, the SA-ANN model is employed to predict the PGA of a part of the database beyond the training data domain. The proposed SA-ANN model is compared with the simple ANN in addition to 10 well-known models proposed in the literature. The proposed model performance is superior to the single ANN and other existing attenuation models. The SA-ANN model is highly correlated to the actual records (R = 0.835 and ρ = 0.0908 and it is subsequently converted into a tractable design equation.

  10. Fast hybrid CPU- and GPU-based CT reconstruction algorithm using air skipping technique.

    Science.gov (United States)

    Lee, Byeonghun; Lee, Ho; Shin, Yeong Gil

    2010-01-01

    This paper presents a fast hybrid CPU- and GPU-based CT reconstruction algorithm to reduce the amount of back-projection operation using air skipping involving polygon clipping. The algorithm easily and rapidly selects air areas that have significantly higher contrast in each projection image by applying K-means clustering method on CPU, and then generates boundary tables for verifying valid region using segmented air areas. Based on these boundary tables of each projection image, clipped polygon that indicates active region when back-projection operation is performed on GPU is determined on each volume slice. This polygon clipping process makes it possible to use smaller number of voxels to be back-projected, which leads to a faster GPU-based reconstruction method. This approach has been applied to a clinical data set and Shepp-Logan phantom data sets having various ratio of air region for quantitative and qualitative comparison and analysis of our and conventional GPU-based reconstruction methods. The algorithm has been proved to reduce computational time to half without losing any diagnostic information, compared to conventional GPU-based approaches.

  11. A novel reconstruction method for giant incisional hernia: Hybrid laparoscopic technique

    Directory of Open Access Journals (Sweden)

    G Ozturk

    2015-01-01

    Full Text Available Background and Objectives: Laparoscopic reconstruction of ventral hernia is a popular technique today. Patients with large defects have various difficulties of laparoscopic approach. In this study, we aimed to present a new reconstruction technique that combines laparoscopic and open approach in giant incisional hernias. Materials and Methods: Between January 2006 and August 2012, 28 patients who were operated consequently for incisional hernia with defect size over 10 cm included in this study and separated into two groups. Group 1 (n = 12 identifies patients operated with standard laparoscopic approach, whereas group 2 (n = 16 labels laparoscopic technique combined with open approach. Patients were evaluated in terms of age, gender, body mass index (BMI, mean operation time, length of hospital stay, surgical site infection (SSI and recurrence rate. Results: There are 12 patients in group 1 and 16 patients in group 2. Mean length of hospital stay and SSI rates are similar in both groups. Postoperative seroma formation was observed in six patients for group 1 and in only 1 patient for group 2. Group 1 had 1 patient who suffered from recurrence where group 2 had no recurrence. Discussion: Laparoscopic technique combined with open approach may safely be used as an alternative method for reconstruction of giant incisional hernias.

  12. Hybrid Decompression and Fixation Technique Versus Plated 3-Vertebra Corpectomy for 4-Segment Cervical Myelopathy: Analysis of 81 Cases With a Minimum 2-Year Follow-Up.

    Science.gov (United States)

    Odate, Seiichi; Shikata, Jitsuhiko; Kimura, Hiroaki; Soeda, Tsunemitsu

    2016-07-01

    A retrospective comparative study. The purpose of this study was to compare the stability and outcomes of a hybrid technique with those of a 3-vertebra corpectomy in the management of 4-segment cervical myelopathy. Patients with primarily ventral disease and loss of cervical lordosis are considered good candidates for anterior surgery. Cervical corpectomy is commonly performed in patients with multilevel cervical myelopathy. Corpectomies including >3 vertebraes entail an extremely high risk of reconstruction failure. To avoid the need to perform a 3-vertebra corpectomy, we use a hybrid decompression and fixation technique. This hybrid technique is a technique to obtain optimum decompression and fixation in patients with multilevel cervical myelopathy. A total of 81 patients with multilevel cervical myelopathy who underwent 4-segment cervical fixation with a minimum 2-year follow-up were included. The hybrid technique involved combining a plated 2-vertebra corpectomy and single-level discectomy with stand-alone cage fixation. This technique was performed in 39 patients, and the plated 3-vertebra corpectomy was performed in 42 patients. Nine patients (21%) who underwent the plated 3-vertebra corpectomy were treated with halo immobilization, but no patient in the hybrid group required this treatment (P=0.002). There were fewer instances of reconstruction failure in the hybrid group than in the 3-vertebra corpectomy group (0% vs. 10%, respectively; P=0.048) and fewer instances of C5 palsy (3% vs. 17%, respectively; P vertebra corpectomy for 4-segment cervical fixation: a shorter graft bone and plate are required; the fixed segment has greater initial stability; postoperative external immobilization is simplified; and the risk of reconstruction failure and postoperative C5 palsy is reduced markedly.

  13. Hybrid microelectronic technology

    Science.gov (United States)

    Moran, P.

    Various areas of hybrid microelectronic technology are discussed. The topics addressed include: basic thick film processing, thick film pastes and substrates, add-on components and attachment methods, thin film processing, and design of thick film hybrid circuits. Also considered are: packaging hybrid circuits, automating the production of hybrid circuits, application of hybrid techniques, customer's view of hybrid technology, and quality control and assurance in hybrid circuit production.

  14. Hybrid dynamic radioactive particle tracking (RPT) calibration technique for multiphase flow systems

    Science.gov (United States)

    Khane, Vaibhav; Al-Dahhan, Muthanna H.

    2017-04-01

    The radioactive particle tracking (RPT) technique has been utilized to measure three-dimensional hydrodynamic parameters for multiphase flow systems. An analytical solution to the inverse problem of the RPT technique, i.e. finding the instantaneous tracer positions based upon instantaneous counts received in the detectors, is not possible. Therefore, a calibration to obtain a counts-distance map is needed. There are major shortcomings in the conventional RPT calibration method due to which it has limited applicability in practical applications. In this work, the design and development of a novel dynamic RPT calibration technique are carried out to overcome the shortcomings of the conventional RPT calibration method. The dynamic RPT calibration technique has been implemented around a test reactor with 1foot in diameter and 1 foot in height using Cobalt-60 as an isotopes tracer particle. Two sets of experiments have been carried out to test the capability of novel dynamic RPT calibration. In the first set of experiments, a manual calibration apparatus has been used to hold a tracer particle at known static locations. In the second set of experiments, the tracer particle was moved vertically downwards along a straight line path in a controlled manner. The obtained reconstruction results about the tracer particle position were compared with the actual known position and the reconstruction errors were estimated. The obtained results revealed that the dynamic RPT calibration technique is capable of identifying tracer particle positions with a reconstruction error between 1 to 5.9 mm for the conditions studied which could be improved depending on various factors outlined here.

  15. Isolation and analysis of differentially expressed genes during asexual sporulation in liquid static culture of Ganoderma lucidum by suppression subtractive hybridization.

    Science.gov (United States)

    Xu, Jun-Wei; Zhao, Wei; Xu, Yi-Ning; Zhong, Jian-Jiang

    2012-04-01

    Ganoderma lucidum differentiates in liquid static culture by forming aerial mycelia and asexual spores, and this differentiation process is accompanied by higher production of anti-tumor compounds ganoderic acids. To gain an insight into the molecular events during asexual sporulation of G. lucidum, comparative transcriptome analysis using suppression subtractive hybridization (SSH) technique was performed to identify preferentially expressed genes in liquid static culture vs. in traditional shaking culture. After macroarray analysis of 1920 cDNAs from SSH library, 147 unigenes which exhibited high expression in static culture were identified. Among these sequences, putative translations of 88 unigenes possessed much similarity to known proteins involved in cell organization, signal transduction, cell metabolism, protein biosynthesis and transcription regulation; 13 had significant similarity to hypothetical proteins; the remaining 46 showed little or no similarity to GenBank sequences. RT-qPCR analysis confirmed increases in transcripts of selected genes under liquid static culture condition. The results of this study present the useful application of EST analysis on G. lucidum and provide preliminary indication of gene expression putatively involved in asexual sporulation process.

  16. SSH-BM-I, a tryptamine derivative, stimulates mineralization in terminal osteoblast differentiation but inhibits osteogenesis of pre-committed progenitor cells.

    Science.gov (United States)

    Mikami, Yoshikazu; Somei, Masanori; Tsuda, Hiromasa

    2011-01-01

    SSH-BM-I was synthesized from tryptamine by using a newly developed synthetic method, and it has structural similarity to bromomelatonin. Recently, it had been reported that SSH-BM-I increases osteoblasts in scales of gold fish. However, the effect of SSH-BM-I on osteoblast differentiation in mammalian cells has not yet been examined. Therefore, this study examined the effect of SSH-BM-I on osteoblast differentiation in mesenchymal progenitor-like cells and mature osteoblast-like cells. SSH-BM-I enhanced terminal osteoblast differentiation, as indicated by mineralization, which was accompanied by upregulation of the osteogenic marker genes bone sialoprotein (BSP) and osteocalcin (OC). However, in mesenchymal progenitor ROB-C26 cultures, no mineralized nodules were observed regardless of SSH-BM-I treatment, although BMP-2 was able to induce nodule formation in these cells. Furthermore, BMP-2-induced nodule formation was suppressed by SSH-BM-I treatment in ROB-C26 cultures. We further investigated the impact of the timing and duration of SSH-BM-I treatment on osteoblast differentiation. The effect of SSH-BM-I treatment on osteoblast differentiation of ROB-C26 in the presence of BMP-2 switches from negative to positive sometime between day 6 and 9, because SSH-BM-I treatment enhanced the formation of mineralized nodules when it was started on day 9, but suppressed nodule formation when it was started at day 6 or earlier. These results suggest that the stimulatory effects of SSH-BM-I on the formation of mineralized nodules depend on the degree of cell differentiation.

  17. Establishment of Relationships between Material Design and Product Design Domains by Hybrid FEM-ANN Technique

    CERN Document Server

    Prakash, K Soorya; Raj, M Joseph Malvin

    2010-01-01

    In this paper, research on AI based modeling technique to optimize development of new alloys with necessitated improvements in properties and chemical mixture over existing alloys as per functional requirements of product is done. The current research work novels AI in lieu of predictions to establish association between material and product customary. Advanced computational simulation techniques like CFD, FEA interrogations are made viable to authenticate product dynamics in context to experimental investigations. Accordingly, the current research is focused towards binding relationships between material design and product design domains. The input to feed forward back propagation prediction network model constitutes of material design features. Parameters relevant to product design strategies are furnished as target outputs. The outcomes of ANN shows good sign of correlation between material and product design domains. The study enriches a new path to illustrate material factors at the time of new product d...

  18. On Potentials and Limitations of a Hybrid WLAN-RFID Indoor Positioning Technique

    Directory of Open Access Journals (Sweden)

    Silverio C. Spinella

    2010-01-01

    Full Text Available This paper addresses the important issue of position estimation in indoor environments. Starting point of the research is positioning techniques that exploit the knowledge of power levels of RF signals from multiple 802.11 WLAN APs (Access Points. In particular, the key idea in this paper is to enhance the performance of a WLAN fingerprinting approach by coupling it to a RFID-based procedure. WLAN and RFID technologies are synergistically used to provide a platform for a more performing positioning process, in which the very strong identification capabilities of the RFID technology allow to increase the accuracy of positioning systems via WLAN fingerprinting. The algorithm performance is assessed through general and repeatable experimental campaigns, during which the main algorithm parameters are dimensioned. The results testify both to the feasibility of the solution and to its higher accuracy (attainable at very reduced costs compared to traditional positioning techniques.

  19. Evaluation and Optimization Study on a Hybrid EOR Technique Named as Chemical-Alternating-Foam Floods

    Directory of Open Access Journals (Sweden)

    Xu Xingguang

    2017-01-01

    Full Text Available This work presents a novel Enhanced Oil Recovery (EOR method called Chemical-Alternating-Foam (CAF floods in order to overcome the drawbacks of the conventional foam flooding such as insufficient amount of in-situ foams, severe foam collapse and surfactant retention. The first part of this research focused on the comparison of conventional foam floods and CAF floods both of which had the same amount of gas and chemicals. It showed that: (1 CAF floods possessed the much greater Residual Resistance Factor (RRF at elevated temperature; (2 the accumulative oil recovery of the CAF floods was 10%-15% higher than that of the conventional foam flooding. After 1.8 Pore Volume (PV injection, the oil recovery reached the plateau for both methods; (3 CAF floods yielded the most amount of incremental oil at the 98% water cut (water content in the effluent, while the continuous foam floods achieved the best performance at 60% water cut. The second part of this work determined the optimal foam quality (gas/liquid ratio or the volume percent gas within foam, chemical/foam slug size ratio, cycle number and injection sequence for the CAF floods. It was found that the CAF was endowed with the peak performance if the foam quality, chemical/foam slug size ratio, cycle number was fixed at 80%, 1:1 and 3 respectively with the chemical slug being introduced ahead of the foam slug. Through systematic and thorough research, the proposed hybrid process has been approved to be a viable and effective method significantly strengthening the conventional foam flooding.

  20. High process yield rates of thermoplastic nanofluidic devices using a hybrid thermal assembly technique.

    Science.gov (United States)

    Uba, Franklin I; Hu, Bo; Weerakoon-Ratnayake, Kumuditha; Oliver-Calixte, Nyote; Soper, Steven A

    2015-02-21

    Over the past decade, thermoplastics have been used as alternative substrates to glass and Si for microfluidic devices because of the diverse and robust fabrication protocols available for thermoplastics that can generate high production rates of the desired structures at low cost and with high replication fidelity, the extensive array of physiochemical properties they possess, and the simple surface activation strategies that can be employed to tune their surface chemistry appropriate for the intended application. While the advantages of polymer microfluidics are currently being realized, the evolution of thermoplastic-based nanofluidic devices is fraught with challenges. One challenge is assembly of the device, which consists of sealing a cover plate to the patterned fluidic substrate. Typically, channel collapse or substrate dissolution occurs during assembly making the device inoperable resulting in low process yield rates. In this work, we report a low temperature hybrid assembly approach for the generation of functional thermoplastic nanofluidic devices with high process yield rates (>90%) and with a short total assembly time (16 min). The approach involves thermally sealing a high T(g) (glass transition temperature) substrate containing the nanofluidic structures to a cover plate possessing a lower T(g). Nanofluidic devices with critical feature sizes ranging between 25-250 nm were fabricated in a thermoplastic substrate (T(g) = 104 °C) and sealed with a cover plate (T(g) = 75 °C) at a temperature significantly below the T(g) of the substrate. Results obtained from sealing tests revealed that the integrity of the nanochannels remained intact after assembly and devices were useful for fluorescence imaging at high signal-to-noise ratios. The functionality of the assembled devices was demonstrated by studying the stretching and translocation dynamics of dsDNA in the enclosed thermoplastic nanofluidic channels.

  1. Development of a wireless bridge monitoring system for condition assessment using hybrid techniques

    Science.gov (United States)

    Whelan, Matthew J.; Fuchs, Michael P.; Gangone, Michael V.; Janoyan, Kerop D.

    2007-04-01

    The introduction and development of wireless sensor network technology has resulted in rapid growth within the field of structural health monitoring (SHM), as the dramatic cable costs associated with instrumentation of large civil structures is potentially alleviated. Traditionally, condition assessment of bridge structures is accomplished through the use of either vibration measurements or strain sensing. One approach is through quantifying dynamic characteristics and mode shapes developed through the use of relatively dense arrays of accelerometers. Another widely utilized method of condition assessment is bridge load rating, which is enabled through the use of strain sensors. The Wireless Sensor Solution (WSS) developed specifically for diagnostic bridge monitoring provides a hybrid system that interfaces with both accelerometers and strain sensors to facilitate vibration-based bridge evaluation as well as load rating and static analysis on a universal platform. This paper presents the development and testing of a wireless bridge monitoring system designed within the Laboratory for Intelligent Infrastructure and Transportation Technologies (LIITT) at Clarkson University. The system interfaces with low-cost MEMS accelerometers using custom signal conditioning for amplification and filtering tailored to the spectrum of typical bridge vibrations, specifically from ambient excitation. Additionally, a signal conditioning and high resolution ADC interface is provided for strain gauge sensors. To permit compensation for the influence of temperature, thermistor-based temperature sensing is also enabled. In addition to the hardware description, this paper presents features of the software applications and host interface developed for flexible, user-friendly in-network control of and acquisition from the sensor nodes. The architecture of the software radio protocol is also discussed along with results of field deployments including relatively large-scale networks and

  2. Hybrid Machine Learning Technique for Forecasting Dhaka Stock Market Timing Decisions

    OpenAIRE

    Shipra Banik; Khodadad Khan, A. F. M.; Mohammad Anwer

    2014-01-01

    Forecasting stock market has been a difficult job for applied researchers owing to nature of facts which is very noisy and time varying. However, this hypothesis has been featured by several empirical experiential studies and a number of researchers have efficiently applied machine learning techniques to forecast stock market. This paper studied stock prediction for the use of investors. It is always true that investors typically obtain loss because of uncertain investment purposes and unsigh...

  3. A HYBRID TECHNIQUE FOR PAPR REDUCTION OF OFDM USING DHT PRECODING WITH PIECEWISE LINEAR COMPANDING

    Directory of Open Access Journals (Sweden)

    Thammana Ajay

    2016-06-01

    Full Text Available Orthogonal Frequency Division Multiplexing (OFDM is a fascinating approach for wireless communication applications which require huge amount of data rates. However, OFDM signal suffers from its large Peak-to-Average Power Ratio (PAPR, which results in significant distortion while passing through a nonlinear device, such as a transmitter high power amplifier (HPA. Due to this high PAPR, the complexity of HPA as well as DAC also increases. For the reduction of PAPR in OFDM many techniques are available. Among them companding is an attractive low complexity technique for the OFDM signal’s PAPR reduction. Recently, a piecewise linear companding technique is recommended aiming at minimizing companding distortion. In this paper, a collective piecewise linear companding approach with Discrete Hartley Transform (DHT method is expected to reduce peak-to-average of OFDM to a great extent. Simulation results shows that this new proposed method obtains significant PAPR reduction while maintaining improved performance in the Bit Error Rate (BER and Power Spectral Density (PSD compared to piecewise linear companding method.

  4. [Differential gene expression in incompatible interaction between Lilium regale Wilson and Fusarium oxysporum f. sp. lilii revealed by combined SSH and microarray analysis].

    Science.gov (United States)

    Rao, J; Liu, D; Zhang, N; He, H; Ge, F; Chen, C

    2014-01-01

    Fusarium wilt, caused by a soilborne pathogen Fusarium oxysporum f. sp. lilii, is the major disease of lily (Lilium L.). In order to isolate the genes differentially expressed in a resistant reaction to F. oxysporum in L. regale Wilson, a cDNA library was constructed with L. regale root during F. oxysporum infection using the suppression subtractive hybridization (SSH), and a total of 585 unique expressed sequence tags (ESTs) were obtained. Furthermore, the gene expression profiles in the incompatible interaction between L. regale and F. oxysporum were revealed by oligonucleotide microarray analysis of 585 unique ESTs comparison to the compatible interaction between a susceptible Lilium Oriental Hybrid 'Siberia' and F. oxysporum. The result of expression profile analysis indicated that the genes encoding pathogenesis-related proteins (PRs), antioxidative stress enzymes, secondary metabolism enzymes, transcription factors, signal transduction proteins as well as a large number of unknown genes were involved in early defense response of L. regale to F. oxysporum infection. Moreover, the following quantitative reverse transcription PCR (QRT-PCR) analysis confirmed reliability of the oligonucleotide microarray data. In the present study, isolation of differentially expressed genes in L. regale during response to F. oxysporum helped to uncover the molecular mechanism associated with the resistance of L. regale against F. oxysporum.

  5. Well-defined functional mesoporous silica/polymer hybrids prepared by an ICAR ATRP technique integrated with bio-inspired polydopamine chemistry for lithium isotope separation.

    Science.gov (United States)

    Liu, Yuekun; Liu, Xuegang; Ye, Gang; Song, Yang; Liu, Fei; Huo, Xiaomei; Chen, Jing

    2017-05-09

    Mesoporous silica/polymer hybrids with well-preserved mesoporosity were prepared by integrating the initiators for continuous activator regeneration (ICAR) atom transfer radical polymerization (ATRP) technique with the bio-inspired polydopamine (PDA) chemistry. By manipulating the auto-oxidative polymerization of dopamine, uniform PDA layers were deposited on the surfaces and pore walls of ordered mesoporous silicas (OMSs), thereby promoting the immobilization of ATRP initiators. Poly(glycidyl methacrylate) (PGMA) brushes were then grown from the OMSs by using the ICAR ATRP technique. The evolution of the mesoporous silica/polymer hybrids during synthesis, in terms of morphology, structure, surface and porous properties, was detailed. And, parameters influencing the controlled growth of polymer chains in the ICAR ATRP system were studied. Taking advantage of the abundant epoxy groups in the PGMA platform, post-functionalization of the mesoporous silica/polymer hybrids by the covalent attachment of macrocyclic ligands for the adsorptive separation of lithium isotopes was realized. Adsorption behavior of the functionalized hybrids toward lithium ions was fully investigated, highlighting the good selectivity, and effects of temperature, solvent and counter ions. The ability for lithium isotope separation was evaluated. A higher separation factor could be obtained in systems with softer counter anions and lower polarity solvents. More importantly, due to the versatility of the ICAR ATRP technique, combined with the non-surface specific PDA chemistry, the methodology established in this work would provide new opportunities for the preparation of advanced organic-inorganic porous hybrids for broadened applications.

  6. SEA SURFACE HEIGHT (SSH) CHANGE AND ITS RELATIONSHIP WITH WIND STRESS IN THE NORTH PACIFIC OCEAN%北太平洋海表面高度(SSH)与风应力变化的关系

    Institute of Scientific and Technical Information of China (English)

    黄琳; 孙佳; 杨逸秋; 袁逸凡

    2013-01-01

    利用1958-2008年的北太平洋海表面高度和风应力资料,并与ENSO和PDO指数进行相关分析.结果发现,风应力及其经向分量主要通过季节振动影响海表面高度(SSH)的年周期变化,纬向风应力主要通过多年振动影响SSH的ENSO和PDO周期.纬向风应力和SSH均以黑潮延伸体主轴为界,两侧呈现出相反的升降趋势,SSH为北降南升,纬向风应力南降北升.风应力和SSH升降趋势相同,均表现为“上升—下降—上升”的变化特征.在地形变化剧烈、等深线南北分布的海区,西风增强会导致SSH升高,且西侧升高较为明显.北风增强将导致北太平洋西岸SSH升高,东岸SSH降低.%Correlation analysis between sea surface height, wind stress and index of ENSO and PDO for the period of 1958-2008 shows in the North Pacific Ocean, wind stress and its meridional component affect the annual cycle of SSH mainly through the seasonal vibration, and the zonal component affect the ENSO and PDO cycles of the SSH through years of vibration. Separated by the Kuroshio extension spindle, the zonal wind stress and SSH show different trends at the same side: SSH decreases at the north while increasing at the south, and the zonal wind stress decreases at the south while increasing at the north. Wind stress and SSH has the same trend: "increase-decrease-increase". The westerly enhanced the SSH rise in sea area where the topography is steep and isobaths distribute along the north-south direction, and the west side increased more significantly. The north wind enhancement led to SSH rise at the west coast of the North Pacific and drop at the east coast.

  7. A sixth order hybrid finite difference scheme based on the minimized dispersion and controllable dissipation technique

    Science.gov (United States)

    Sun, Zhen-sheng; Luo, Lei; Ren, Yu-xin; Zhang, Shi-ying

    2014-08-01

    The dispersion and dissipation properties of a scheme are of great importance for the simulation of flow fields which involve a broad range of length scales. In order to improve the spectral properties of the finite difference scheme, the authors have previously proposed the idea of optimizing the dispersion and dissipation properties separately and a fourth order scheme based on the minimized dispersion and controllable dissipation (MDCD) technique is thus constructed [29]. In the present paper, we further investigate this technique and extend it to a sixth order finite difference scheme to solve the Euler and Navier-Stokes equations. The dispersion properties of the scheme is firstly optimized by minimizing an elaborately designed integrated error function. Then the dispersion-dissipation condition which is newly derived by Hu and Adams [30] is introduced to supply sufficient dissipation to damp the unresolved wavenumbers. Furthermore, the optimized scheme is blended with an optimized Weighted Essentially Non-Oscillation (WENO) scheme to make it possible for the discontinuity-capturing. In this process, the approximation-dispersion-relation (ADR) approach is employed to optimize the spectral properties of the nonlinear scheme to yield the true wave propagation behavior of the finite difference scheme. Several benchmark test problems, which include broadband fluctuations and strong shock waves, are solved to validate the high-resolution, the good discontinuity-capturing capability and the high-efficiency of the proposed scheme.

  8. A Hybrid Approach for Detecting Suspicious Accounts in Money Laundering Using Data Mining Techniques

    Directory of Open Access Journals (Sweden)

    Ch. Suresh

    2016-05-01

    Full Text Available Money laundering is a criminal activity to disguise black money as white money. It is a process by which illegal funds and assets are converted into legitimate funds and assets. Money Laundering occurs in three stages: Placement, Layering, and Integration. It leads to various criminal activities like Political corruption, smuggling, financial frauds, etc. In India there is no successful Anti Money laundering techniques which are available. The Reserve Bank of India (RBI, has issued guidelines to identify the suspicious transactions and send it to Financial Intelligence Unit (FIU. FIU verifies if the transaction is actually suspicious or not. This process is time consuming and not suitable to identify the illegal transactions that occurs in the system. To overcome this problem we propose an efficient Anti Money Laundering technique which can able to identify the traversal path of the Laundered money using Hash based Association approach and successful in identifying agent and integrator in the layering stage of Money Laundering by Graph Theoretic Approach.

  9. Development and validation of a hybrid simulation technique for cone beam CT: application to an oral imaging system

    Science.gov (United States)

    Zhang, G.; Pauwels, R.; Marshall, N.; Shaheen, E.; Nuyts, J.; Jacobs, R.; Bosmans, H.

    2011-09-01

    This paper proposes a hybrid technique to simulate the complete chain of an oral cone beam computed tomography (CBCT) system for the study of both radiation dose and image quality. The model was developed around a 3D Accuitomo 170 unit (J Morita, Japan) with a tube potential range of 60-90 kV. The Monte Carlo technique was adopted to simulate the x-ray generation, filtration and collimation. Exact dimensions of the bow-tie filter were estimated iteratively using experimentally acquired flood images. Non-flat radiation fields for different exposure settings were mediated via 'phase spaces'. Primary projection images were obtained by ray tracing at discrete energies and were fused according to the two-dimensional energy modulation templates derived from the phase space. Coarse Monte Carlo simulations were performed for scatter projections and the resulting noisy images were smoothed by Richardson-Lucy fitting. Resolution and noise characteristics of the flat panel detector were included using the measured modulation transfer function (MTF) and the noise power spectrum (NPS), respectively. The Monte Carlo dose calculation was calibrated in terms of kerma free-in-air about the isocenter, using an ionization chamber, and was subsequently validated by comparison against the measured air kerma in water at various positions of a cylindrical water phantom. The resulting dose discrepancies were found <10% for most cases. Intensity profiles of the experimentally acquired and simulated projection images of the water phantom showed comparable fractional increase over the common area as changing from a small to a large field of view, suggesting that the scatter was accurately accounted. Image validation was conducted using two small phantoms and the built-in quality assurance protocol of the system. The reconstructed simulated images showed high resemblance on contrast resolution, noise appearance and artifact pattern in comparison to experimentally acquired images, with <5

  10. A novel technique to neutralize the Yawing moment due to asymmetric thrust in a hybrid buoyant aircraft

    Science.gov (United States)

    Haque, Anwar U.; Asrar, Waqar; Omar, Ashraf A.; Sulaeman, Erwin; J. S Ali, Mohamed

    2016-03-01

    Dorsal fin is used in swimming animals like shark for the generation of thrust as well as to meet the requirement of the lateral stability. In the case of aircraft, rudders are normally used for the said requirement. In the present work, this nature inspired idea is explored for its application to neutralize the unavoidable asymmetric thrust produced by the twin engines of a hybrid buoyant aircraft. First, the estimation of asymmetric thrust is obtained with the help of analytical techniques for maximum thrust condition at 4 degree angle of attack. The moment generated by it is utilized for the sizing of a dorsal fin which looks similar to a tapered wing and is placed aft of the center of gravity. Wind tunnel testing at subsonic speed is carried out to explore the design features of this rotatable dorsal fin. It is found that a small rotation of 5 degree can generate the required moment. However, such rotation requires a complete pneumatic/electro-mechanical system and an alternative of it is to use a cambered airfoil for the dorsal fin installed at fixed location. Such a flow controlling device can also be used as an antenna mast, which is commonly installed out the fuselage of the aircraft for communication purposes. Moreover, by incorporating this technique, a pilot doesn't have to put an extra effort to make the aircraft stable in the presence of side wind.

  11. Research on Theories and Techniques of Irrigation for Safeguarding Seed Production of Two-Line Hybrid Rice

    Institute of Scientific and Technical Information of China (English)

    ZOU Jiang-shi; L(U) Chuan-gen; YAO Ke-min; HU Ning; XIA Shi-jian

    2006-01-01

    By inducing frequency, intensity and duration of lower temperature in the middle and last ten-day periods in August in the rice-growing areas of southern China, increasing temperature for safe seed production was defined as 2℃. During the sensitive period of fertility, characters of panicle height and canopy structure of TGMS rice, Pei'ai64S, were measured.Results showed that temperature changes caused by irrigation in fields were below 40 cm of rice plant, and heating effect was significant at 20 cm when the temperature was increased by 3.1℃. For the present study, the following irrigation techniques were put forth: the water depth of 15-20 cm, current water used, irrigating after 17:00 and bailing at 10:00 in sunny or cloudy weather, irrigating on whole day, in shady or rainy weather, increasing inflows and outflows in large fields. In the present experiment, pollen fertility and self-fertilized seed setting rate accepted that the techniques were feasible and effective for against lower temperature and safeguarding seed production of two-line hybrid rice.

  12. A novel technique to neutralize the Yawing moment due to asymmetric thrust in a hybrid buoyant aircraft

    Directory of Open Access Journals (Sweden)

    Haque Anwar U

    2016-01-01

    Full Text Available Dorsal fin is used in swimming animals like shark for the generation of thrust as well as to meet the requirement of the lateral stability. In the case of aircraft, rudders are normally used for the said requirement. In the present work, this nature inspired idea is explored for its application to neutralize the unavoidable asymmetric thrust produced by the twin engines of a hybrid buoyant aircraft. First, the estimation of asymmetric thrust is obtained with the help of analytical techniques for maximum thrust condition at 4 degree angle of attack. The moment generated by it is utilized for the sizing of a dorsal fin which looks similar to a tapered wing and is placed aft of the center of gravity. Wind tunnel testing at subsonic speed is carried out to explore the design features of this rotatable dorsal fin. It is found that a small rotation of 5 degree can generate the required moment. However, such rotation requires a complete pneumatic/electro-mechanical system and an alternative of it is to use a cambered airfoil for the dorsal fin installed at fixed location. Such a flow controlling device can also be used as an antenna mast, which is commonly installed out the fuselage of the aircraft for communication purposes. Moreover, by incorporating this technique, a pilot doesn’t have to put an extra effort to make the aircraft stable in the presence of side wind.

  13. Optimizing an Industrial Scale Naphtha Catalytic Reforming Plant Using a Hybrid Artificial Neural Network and Genetic Algorithm Technique

    Directory of Open Access Journals (Sweden)

    Sepehr Sadighi

    2015-07-01

    Full Text Available In this paper, a hybrid model for estimating the activity of a commercial Pt-Re/Al2O3 catalyst in an industrial scale heavy naphtha catalytic-reforming unit (CRU is presented. This model is also capable of predicting research octane number (RON and yield of gasoline. In the proposed model, called DANN, the decay function of heterogeneous catalysts is combined with a recurrent-layer artificial neural network. During a life cycle (919 days, fifty-eight points are selected for building and training the DANN (60%, nineteen data points for testing (20%, and the remained ones for validating steps. Results show that DANN can acceptably estimate the activity of catalyst during its life in consideration of all process variables. Moreover, it is confirmed that the proposed model is capable of predicting RON and yield of gasoline for unseen (validating data with AAD% (average absolute deviation of 0.272% and 0.755%, respectively. After validating the model, the octane barrel level (OCB of the plant is maximized by manipulating the inlet temperature of reactors, and hydrogen to hydrocarbon molar ratio whilst all process limitations are taken into account. During a complete life cycle results show that the decision variables, generated by the optimization program, can increase the RON, process yield and OCB of CRU to about 1.15%, 3.21%, and 4.56%, respectively. © 2015 BCREC UNDIP. All rights reserved.Received: 27th July 2014; Revised: 31st May 2015; Accepted: 31th May 2015 How to Cite: Sadighi, S., Mohaddecy, R.S., Norouzian, A. (2015. Optimizing an Industrial Scale Naphtha Catalytic Reforming Plant Using a Hybrid Artificial Neural Network and Genetic Algorithm Technique. Bulletin of Chemical Reaction Engineering & Catalysis, 10(2: 210-220. (doi:10.9767/bcrec.10.2.7171.210-220 Permalink/DOI: http://dx.doi.org/10.9767/bcrec.10.2.7171.210-220  

  14. Recent advances in knowledge-based paradigms and applications enhanced applications using hybrid artificial intelligence techniques

    CERN Document Server

    Jain, Lakhmi

    2014-01-01

    This book presents carefully selected contributions devoted to the modern perspective of AI research and innovation. This collection covers several areas of applications and motivates new research directions. The theme across all chapters combines several domains of AI research , Computational Intelligence and Machine Intelligence including an introduction to  the recent research and models. Each of the subsequent chapters reveals leading edge research and innovative solution that employ AI techniques with an applied perspective. The problems include classification of spatial images, early smoke detection in outdoor space from video images, emergent segmentation from image analysis, intensity modification in images, multi-agent modeling and analysis of stress. They all are novel pieces of work and demonstrate how AI research contributes to solutions for difficult real world problems that benefit the research community, industry and society.

  15. Rapid full Mueller matrix imaging polarimetry based on the hybrid phase modulation technique

    Science.gov (United States)

    Han, Chien-Yuan; Du, Cheng-You; Jhou, Jhe-Yi

    2017-01-01

    In this work, we present a novel method of Mueller matrix imaging polarimetry, which comprises dual liquid crystal variable retarders at the polarization generation portion and a photoelastic modulator at the polarization analysis portion. The light source can be operated either in the continuous mode, which provides an in-situ calibration process for the liquid crystal variable retarders, or in the pulse mode to deduce the full two-dimensional Mueller matrix with 16 images from the camera. We measured the Mueller matrix images of air as a standard test, as well as a quarter wave plate to determine its azimuthal angle and phase retardation by the polar decomposition technique. Finally, the decomposed Mueller matrix images of a biopolymer specimen with the conformational change produced by heat treatment are presented.

  16. MULTILEVEL APPROACH OF CBIR TECHNIQUES FOR VEGETABLE CLASSIFICATION USING HYBRID IMAGE FEATURES

    Directory of Open Access Journals (Sweden)

    D. Latha

    2016-02-01

    Full Text Available CBIR is a technique to retrieve images semantically relevant to query image from an image database. The challenge in CBIR is to develop a method that should increase the retrieval accuracy and reduce the retrieval time. In order to improve the retrieval accuracy and runtime, a multilevel CBIR approach is proposed in this paper. In the first level, the color attributes like mean and standard deviations are proposed to calculate on HSV color space to retrieve the images with minimum disparity distance from the database. In order to minimize search area, in the second level Local Ternary Pattern is proposed on images which were selected from the first level. Experimental results and comparisons demonstrate the superiority of the proposed approach.

  17. A Hybrid Model for the Mid-Long Term Runoff Forecasting by Evolutionary Computaion Techniques

    Institute of Scientific and Technical Information of China (English)

    Zou Xiu-fen; Kang Li-shan; Cae Hong-qing; Wu Zhi-jian

    2003-01-01

    The mid-long term hydrology forecasting is one of most challenging problems in hydrological studies. This paper proposes an efficient dynamical system prediction model using evolutionary computation techniques. The new model overcomes some disadvantages of conventional hydrology fore casting ones. The observed data is divided into two parts: the slow "smooth and steady" data, and the fast "coarse and fluctuation" data. Under the divide and conquer strategy, the behavior of smooth data is modeled by ordinary differential equations based on evolutionary modeling, and that of the coarse data is modeled using gray correlative forecasting method. Our model is verified on the test data of the mid-long term hydrology forecast in tbe northeast region of China. The experimental results show that the model is superior to gray system prediction model (GSPM).

  18. Integrating Internet Video Conferencing Techniques and Online Delivery Systems with Hybrid Classes to Enhance Student Interaction and Learning in Accelerated Programs

    Science.gov (United States)

    Beckwith, E. George; Cunniff, Daniel T.

    2009-01-01

    Online course enrollment has increased dramatically over the past few years. The authors cite the reasons for this rapid growth and the opportunities open for enhancing teaching/learning techniques such as video conferencing and hybrid class combinations. The authors outlined an example of an accelerated learning, eight-class session course…

  19. Fabrication of 2×2 Thermo-Optic Switches with Organic-Inorganic Hybrid Materials Prepared by Sol-Gel Technique

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    2×2 Mach-Zehnder interferometric thermo-optic switch was fabricated with organic/inorganic hybrid materials by sol-gel technique and direct UV patterning. The switching time of device was measured to be 4.2 ms and switching power 9.3 mW.

  20. Contrast-Enhanced MR Angiography (CEMRA) in Peripheral Arterial Occlusive Disease (PAOD): conventional moving table technique versus hybrid technique; Kontrastverstaerkte MR-Angiographie (CEMRA) bei peripherer AVK (pAVK): konventionelle Tischverschiebetechnik versus Hybrid-Technik

    Energy Technology Data Exchange (ETDEWEB)

    Kalle, T. von; Gerlach, A.; Hatopp, A.; Klinger, S.; Prodehl, P.; Arlat, I.P. [Katharinenhospital, Stuttgart (Germany). Radiologisches Inst.

    2004-01-01

    Patients and Methods: 80 patients (males n = 60, females n = 20, median age = 70 years, diabetics n = 27) with PAOD were examined with a 1,5T system (40 mT/m) using a dedicated phased array peripheral vascular coil. Protocol A consisted of a single injection of Gd-BOPTA with consecutive craniocaudal image acquisition and protocol B of two injections, with the first injection of Gd-BOPTA followed by image acquisition of the popliteocrural and pedal segments and the second injection followed by acquiring the aortoiliac and femoral segments (hybrid technique). The evaluation of the arterial system was directed to the iliac, femoral, popliteocrural and pedal arteries. Results: The visualization of the entire aortopedal vascular system was of diagnostically good or satisfactory quality in 16 of 40 patients using protocol A and in 29 of 40 patients using protocol B (iliac 40 vs. 37, femoral 40 vs. 40, popliteocrural 35 vs. 37, pedal 16 vs. 29); without the pedal station the number increased to 35 of 40 patients for both protocols. The reason of diagnostic limitations was an arteriovenous overlap in 24 of 80 cases, with 19 of 40 cases for protocol A and 5 of 40 for protocol B, located exclusively in the cruropedal region. Conclusion: Moving table hybrid CEMRA is superior to conventional technique in craniocaudal direction by producing less venous overlap of arteries and is especially more suitable for the diagnostic evaluation of the cruropedal region. (orig.) [German] Patienten und Methodik: Untersucht wurden 80 Patienten (maennl. n = 60, weibl. n = 20, mittl. Alter 70 J., Diabetiker n = 27) mit pAVK an einem 1,5-Tesla-Geraet (40 mT/m) mit dedizierter Phased-Array-Oberflaechen-Gefaessspule. Protokoll A beinhaltete eine Kontrastmittel-Injektion (Gd-BOPTA) mit konsekutiver kraniokaudaler Bildakquisition. In Protokoll B erfolgte die Akquisition zunaechst der Unterschenkel- und Fussetage mittels einer ersten, anschliessend der Abdomen-Becken- und Oberschenkeletage mittels

  1. A hybrid stock trading framework integrating technical analysis with machine learning techniques

    Directory of Open Access Journals (Sweden)

    Rajashree Dash

    2016-03-01

    Full Text Available In this paper, a novel decision support system using a computational efficient functional link artificial neural network (CEFLANN and a set of rules is proposed to generate the trading decisions more effectively. Here the problem of stock trading decision prediction is articulated as a classification problem with three class values representing the buy, hold and sell signals. The CEFLANN network used in the decision support system produces a set of continuous trading signals within the range 0–1 by analyzing the nonlinear relationship exists between few popular technical indicators. Further the output trading signals are used to track the trend and to produce the trading decision based on that trend using some trading rules. The novelty of the approach is to engender the profitable stock trading decision points through integration of the learning ability of CEFLANN neural network with the technical analysis rules. For assessing the potential use of the proposed method, the model performance is also compared with some other machine learning techniques such as Support Vector Machine (SVM, Naive Bayesian model, K nearest neighbor model (KNN and Decision Tree (DT model.

  2. A Hybrid Technique for Real Time License Plate Localization with the aid of FFBPNNAPSO

    Directory of Open Access Journals (Sweden)

    Reji PI

    2016-04-01

    Full Text Available Vehicle License Plate Recognition (VLPR is an imperative constituent in Intelligent Transportation Systems (ITS, which encircles three foremost phases essentially License Plate Localization (LPL, Character Segmentation (CS, Character Recognition (CR. In this paper, we have intended to introduce a novel License Plate Localization algorithm subjected to Artificial Neural Networks (ANN. This proposed scheme involves distinct phases of pre-processing, image de-noising and enhancement, feature extraction, Neural Network training and License Plate detection. Followed by the mining of assorted statistical features, geometrical features, edge features and texture features from the vehicular image, they are given as the input to Feed Forward Back Propagation Neural Network (FFBPNN in order to localize the License Plate. During the training process, the parameters of the FFBPNN will be optimized using the eminent Adaptive Particle Swarm Optimization (APSO algorithm in order to improve the Neural Network convergence performance. The License Plate Localization of our proposed technique is analyzed with simple Feed Forward Back propagation Neural Network (FFBPNN in terms of accuracy, sensitivity and specificity. The experimental outcomes demonstrate that the proposed procedure proficiently accomplishes an extremely high localization rate with elevated specificity (91.3%.

  3. Flexible Riser Monitoring Using Hybrid Magnetic/Optical Strain Gage Techniques through RLS Adaptive Filtering

    Directory of Open Access Journals (Sweden)

    Pipa Daniel

    2010-01-01

    Full Text Available Flexible riser is a class of flexible pipes which is used to connect subsea pipelines to floating offshore installations, such as FPSOs (floating production/storage/off-loading unit and SS (semisubmersible platforms, in oil and gas production. Flexible risers are multilayered pipes typically comprising an inner flexible metal carcass surrounded by polymer layers and spiral wound steel ligaments, also referred to as armor wires. Since these armor wires are made of steel, their magnetic properties are sensitive to the stress they are subjected to. By measuring their magnetic properties in a nonintrusive manner, it is possible to compare the stress in the armor wires, thus allowing the identification of damaged ones. However, one encounters several sources of noise when measuring electromagnetic properties contactlessly, such as movement between specimen and probe, and magnetic noise. This paper describes the development of a new technique for automatic monitoring of armor layers of flexible risers. The proposed approach aims to minimize these current uncertainties by combining electromagnetic measurements with optical strain gage data through a recursive least squares (RLSs adaptive filter.

  4. [Construction and analysis of SSH library of Gossypium barbadense upon infection with Verticillium dahliae].

    Science.gov (United States)

    Zhu, Long-Fu; Tu, Li-Li; Zhang, Xian-Long; Nie, Yi-Chun; Guo, Xiao-Ping; Xia, Qi-Zhong

    2005-05-01

    Roots were collected from the seedlings inoculated with pathogen Verticillium dahliae after 2, 4, 8, 12, 24, 48, 72 and 96 hours for total RNA extraction. The cDNAs from the inoculated seedlings were used as the tester and those from the control seedlings as the driver. SSH method was employed to find the differently expressed cDNAs responding to the pathogen. T/A clone library was constructed containing 534 clones. The cDNA inserts were amplified from the bacterial clones directly with M13 primers by PCR. The size of the products ranged 0.2 - 1.2 kb with an average size of 0.5 kb. The SSH products were dotted on nylon filters, and the positive clones were screened by virtual Northern blotting with probes of the two kinds of initiative cDNAs. Totally 78 clones which were up-regulated and putatively involved in the defense response of G. barbadense were identified and sequenced. Sequence similarity searches were performed with the Blastn and Blastx. Most of them showed high or partial homology to genes or ESTs induced by different stresses in Arabidopsis thaliana and other species,such as the pathogenesis-related 10 family of G. hirsumtum and disease resistance-responsive family protein in Arabidopsis thaliana. The results would be helpful to understand the molecular mechanisms of disease response in cotton.

  5. Using SSH Technology to Identify Relevant Genes Resistant to Cucumber Downy Mildew%利用SSH技术鉴定黄瓜抗霜霉病相关基因

    Institute of Scientific and Technical Information of China (English)

    刘大军; 秦智伟; 周秀艳; 辛明; 武涛

    2014-01-01

    Adopting SSH technology,this paper studied on the difference expressive genes of downy mildew resistant cucumber inbred line ‘M801-3-1’ before and after the infection of downy mildew.Disease-resistant cucumber material vaccinated downy mildew and unvaccinated cDNA library was constructed using SSH technology.Forty-eight positive clones were obtained by reverse Northern blot hybridization detection, and 14 UniESTs were obtained including 8 singletons and 6 contigs via molecular biology software.The SSH-EST genes function analysis indicated that oxidative stress resistance and chloroplast reconstruction and protection mechanisms had very important role on disease resistance.At the same time,the paper put forward that Clpb,HSP70,HSP22 and peptidyl-prolyl cis-trans isomerase might be involved in the R gene-mediated defense reaction,and smHSP might be the ‘defending target’ of R protein,responsible for monitoring intracellular exception.This study has provided a key evidence for revealing the relations between active oxygen mechanism and R gene mediate protection mechanism.%采用SSH技术对黄瓜抗霜霉病自交系M801-3-1侵染霜霉病菌前后的差异表达基因进行了研究。利用 SSH 技术构建抗病黄瓜材料接种霜霉病菌和未接种差异表达的差减cDNA文库。经反向Northern blot杂交检测,共得到48个阳性克隆。利用分子生物学软件对测序后的序列进行质量检测和聚类、拼接,共得到14个UniESTs,其中包括8个singletons和6个contigs。通过SSH-EST代表基因功能的分析,说明抗氧化胁迫能力和叶绿体的重建和保护机制对抗病品种抗病有重要作用。同时,提出SSH-EST代表的clpb、HSP70、HSP22和肽脯氨酰顺反异构酶还可能参与了R基因介导的防御反应,smHSP有可能就是R蛋白的“保卫靶”,负责监测细胞内的异常,这一发现为揭示活性氧机制和R基因介导的防卫机制之间的关系提供了关键证据。

  6. Heart dose reduction in breast cancer treatment with simultaneous integrated boost. Comparison of treatment planning and dosimetry for a novel hybrid technique and 3D-CRT

    Energy Technology Data Exchange (ETDEWEB)

    Joest, Vincent; Kretschmer, Matthias; Sabatino, Marcello; Wuerschmidt, Florian; Dahle, Joerg; Lorenzen, Joern [Radiological Alliance, Hamburg (Germany); Ueberle, Friedrich [University of Applied Sciences, Faculty Life Sciences, Hamburg (Germany)

    2015-09-15

    The present study compares in silico treatment plans of clinically established three-dimensional conformal radiotherapy (3D-CRT) with a hybrid technique consisting of intensity-modulated radiotherapy (IMRT) and volumetric modulated arc radiotherapy (VMAT) during normally fractionated radiation of mammary carcinomas with simultaneous integrated boost on the basis of dose-volume histogram (DVH) parameters. Radiation treatment planning was performed with a hybrid and a 3D-CRT treatment plan for 20 patients. Hybrid plans were implemented with two tangential IMRT fields and a VMAT field in the angular range of the tangents. Verification of the plan was performed with a manufacturer-independent measurement system consisting of a detector array and rotation unit. The mean values of the heart dose for the entire patient collective were 3.6 ± 2.5 Gy for 3D-CRT and 2.9 ± 2.1 Gy for the hybrid technique (p < 0.01). For the left side (n = 10), the mean values for the left anterior descending artery were 21.8 ± 7.4 Gy for 3D-CRT and 17.6 ± 7.4 Gy for the hybrid technique (p < 0.01). The mean values of the ipsilateral lung were 11.9 ± 1.6 Gy for 3D-CRT and 10.5 ± 1.3 Gy for the hybrid technique (p < 0.01). Calculated dose distributions in the hybrid arm were in good accordance with measured dose (on average 95.6 ± 0.5 % for γ < 1 and 3 %/3 mm). The difference of the mean treatment time per fraction was 7 s in favor of 3D-CRT. Compared with the established 3D-CRT technique, the hybrid technique allows for a decrease in dose, particularly of the mean heart and lung dose with comparable target volume acquisition and without disadvantageous low-dose load of contralateral structures. Uncomplicated implementation of the hybrid technique was demonstrated in this context. The hybrid technique combines the advantages of tangential IMRT with the superior sparing of organs at risk by VMAT. (orig.) [German] Die vorliegende Studie vergleicht ''in silico

  7. Chitosan-pectin hybrid nanoparticles prepared by coating and blending techniques.

    Science.gov (United States)

    Rampino, A; Borgogna, M; Bellich, B; Blasi, P; Virgilio, F; Cesàro, A

    2016-03-10

    The preparation of chitosan nanoparticles in combination with pectins, as additional mucoadhesive biopolymers, was investigated. Pectins from apple and from citrus fruit were considered; polygalacturonic acid was taken as a reference. Tripolyphosphate was used as an anionic cross-linker. Two different techniques were compared, namely the coating and the blending. Coated nanoparticles (NPs) in the ratio pectin:NPs from 2:1 to 5:1 evidenced that the size of NPs increased as the amount of pectin (both from apple and citrus fruit) was increased. In particular, for NPs coated with pectin from citrus fruit the size ranges from 200 to 260nm; while for NPs coated with pectin from apple the size ranges from 330 to 450nm. A minimum value of Z-potential around -35mV was obtained for the ratio pectin:NPs 4:1, while further addition of pectin did not decrease the Z-potential. Also blended NPs showed a dependence of the size on the ratio of the components: for a given ratio pectin:tripolyphosphate the size increases as the fraction of chitosan increases; for a low ratio chitosan:pectin a high amount of tripolyphosphate was needed to obtain a compact structure. The effect of the additional presence of loaded proteins in chitosan-pectin nanoparticles was also investigated, since proteins contribute to alter the electrostatic interactions among charged species. FT-IR and DSC characterization are presented to confirm the interactions between biopolymers. Finally, the biocompatibility of the used materials was assessed by the chorioallantoic membrane assay, confirming the safety of the materials.

  8. Mobile phone ordering system based on Android and SSH2%基于Android和SSH2的手机订餐系统

    Institute of Scientific and Technical Information of China (English)

    张国平; 黄淼; 褚龙现

    2016-01-01

    For the convenience that the users is not restricted to time and space to get the ordering information, this paper uses the technology based on Android and SSH2, designs and develops a Online ordering system. The system is consists of mobile phone client and server,The mobile client of the system can realize the functions of login for registered users, query for Food infromation,build for order and query for order information. The backstage server can realize the functions of user management, user orders and search , shopping cart view and search,restaurant management, food management restaurant orders and serach. The system can realize the more business opportunities for the restaurant seller, and at the same time to provide more convenience for customers. Experimental results show that the system has the advantages of simple operation, strong portability, fast loading speed and less resource-intensive, and thus reaching the design requirements.%为方便用户不受时间和空间的限制,便能快速订餐,本文采用Android和SSH2技术设计并开发一个网上订餐系统,该系统由手机客户端和后台服务器端两部分组成,手机客户端实现用户的注册登录、菜品信息查询、生成订单和订单信息查询等功能;后台服务器端实现了用户管理,用户订单查看与检索,购物车查看与检索,餐厅管理,菜品管理,餐厅订单查看与检索等功能。开发的系统能给餐厅卖家提供更多商机,同时也给顾客提供更多的便利。实验表明,该系统具有操作简便、扩展性强、加载速度快和占用资源少等优点,达到了设计要求。

  9. Design and Implementation of Paperless Examination System Based on SSH2%基于SSH2的无纸化考试系统的设计与实现

    Institute of Scientific and Technical Information of China (English)

    周晨; 陆正; 高莺; 查艳芳; 程龙

    2013-01-01

    本文针对无纸化考试系统,通过SSH2技术架构,描述了系统用户管理,题库管理,试卷生成和考试与分析系统等功能的实现。应用表明本系统实现了基本功能。同时,由于SSH2的使用,系统易于快速实现,具有良好可扩展性和可维护性。%In light of the paperless examination system which includes system user management, question bank management, test paper auto-generation, test and result analysis management, this paper describes that the realization method based on the technology architecture for SSH2. It is shown by the application that the system supplies the based function. At the same time, because of the application of SSH2 framework,the system is easy to realize, and has a good extendibility and maintainability.

  10. Hybrid approach combining multiple characterization techniques and simulations for microstructural analysis of proton exchange membrane fuel cell electrodes

    Science.gov (United States)

    Cetinbas, Firat C.; Ahluwalia, Rajesh K.; Kariuki, Nancy; De Andrade, Vincent; Fongalland, Dash; Smith, Linda; Sharman, Jonathan; Ferreira, Paulo; Rasouli, Somaye; Myers, Deborah J.

    2017-03-01

    The cost and performance of proton exchange membrane fuel cells strongly depend on the cathode electrode due to usage of expensive platinum (Pt) group metal catalyst and sluggish reaction kinetics. Development of low Pt content high performance cathodes requires comprehensive understanding of the electrode microstructure. In this study, a new approach is presented to characterize the detailed cathode electrode microstructure from nm to μm length scales by combining information from different experimental techniques. In this context, nano-scale X-ray computed tomography (nano-CT) is performed to extract the secondary pore space of the electrode. Transmission electron microscopy (TEM) is employed to determine primary C particle and Pt particle size distributions. X-ray scattering, with its ability to provide size distributions of orders of magnitude more particles than TEM, is used to confirm the TEM-determined size distributions. The number of primary pores that cannot be resolved by nano-CT is approximated using mercury intrusion porosimetry. An algorithm is developed to incorporate all these experimental data in one geometric representation. Upon validation of pore size distribution against gas adsorption and mercury intrusion porosimetry data, reconstructed ionomer size distribution is reported. In addition, transport related characteristics and effective properties are computed by performing simulations on the hybrid microstructure.

  11. Recovery and reuse of hexavalent chromium from aqueous solutions by a hybrid technique of electrodialysis and ion exchange

    Energy Technology Data Exchange (ETDEWEB)

    Gayathri, R. [Sengunthar Engineering College, Tiruchengode (India). Dept. of Civil Engineering], e-mail: gay3civil@gmail.com; Senthil Kumar, P. [SSN College of Engineering, Chennai (India). Dept. of Chemical Engineering], E-mail: senthilkumarp@ssn.edu.in

    2010-01-15

    The chrome plating industry is one of the highly polluting industries whose effluent mainly consists of chromium(VI). This compound is highly toxic to aquatic life and human health. The rinse water constituents reflect the chrome plating bath characteristics; generally dead tank wash water contains about 1% of the plating bath concentration. Other metals and metal compounds usually considered as toxic can be precipitated out by suitably adjusting the pH of the wastewaters. However, Cr(VI) is soluble in almost all pH ranges and therefore an efficient treatment is required for the removal and recovery of chromium, and also for the reuse of wastewaters. The present study aims to recover the chromium by a hybrid technique of electrodialysis and ion exchange for the removal and concentration of chromate ions from the effluent. The different modes of operation like batch recirculation process, batch recirculation process with continuous dipping and continuous process were carried out to remove and recover the chromium from the effluent and the percentage reductions of chromium were found to be 98.69%, 99.18% and 100%, respectively. (author)

  12. A hybrid experimental-numerical technique for determining 3D velocity fields from planar 2D PIV data

    Science.gov (United States)

    Eden, A.; Sigurdson, M.; Mezić, I.; Meinhart, C. D.

    2016-09-01

    Knowledge of 3D, three component velocity fields is central to the understanding and development of effective microfluidic devices for lab-on-chip mixing applications. In this paper we present a hybrid experimental-numerical method for the generation of 3D flow information from 2D particle image velocimetry (PIV) experimental data and finite element simulations of an alternating current electrothermal (ACET) micromixer. A numerical least-squares optimization algorithm is applied to a theory-based 3D multiphysics simulation in conjunction with 2D PIV data to generate an improved estimation of the steady state velocity field. This 3D velocity field can be used to assess mixing phenomena more accurately than would be possible through simulation alone. Our technique can also be used to estimate uncertain quantities in experimental situations by fitting the gathered field data to a simulated physical model. The optimization algorithm reduced the root-mean-squared difference between the experimental and simulated velocity fields in the target region by more than a factor of 4, resulting in an average error less than 12% of the average velocity magnitude.

  13. Degradation of Tectilon Yellow 2G by hybrid technique: combination of sonolysis and biodegradation using mutant Pseudomonas putida.

    Science.gov (United States)

    Srinivasan, Raman; Kathiravan, Mathur Nadarajan; Gopinath, Kannappan Panchamoorthy

    2011-02-01

    Degradation of Tectilon Yellow 2G (TY2G), an azo dye has been studied by hybrid technique involving pretreatment by sonochemical method and further biological treatment by Pseudomonas putida mutant. Pretreatment experiments were carried out by sonolysis of the dye solution at different concentrations (100-1000 mg/L). Wild type Gram-negative P. putida species isolated from the textile effluent contaminated soil, which was found to be effective towards dye degradation, has been acclimatized so as to consume TY2G as the sole source of nutrition. Mutant strain was obtained from the acclimatized species by random mutagenesis using the chemical mutagen ethidium bromide for various time intervals (6-30 min). The optimum mutagenesis exposure time for obtaining the most efficient species for dye degradation was found to be 18 min. An efficient mutant strain P. putida ACT 1 has been isolated and was used for growth experiments. The mutant strain showed a better growth compared to the wild strain. The substrate utilization kinetics has been modeled using Monod and Haldane model equations of which the Haldane model provided a better fit. The enzyme kinetics of the mutant and wild species was obtained using Michaelis-Menten equation. The mutated species showed better enzyme kinetics towards the degradation of TY2G.

  14. Hybrid evolutionary techniques in feed forward neural network with distributed error for classification of handwritten Hindi `SWARS'

    Science.gov (United States)

    Kumar, Somesh; Pratap Singh, Manu; Goel, Rajkumar; Lavania, Rajesh

    2013-12-01

    In this work, the performance of feedforward neural network with a descent gradient of distributed error and the genetic algorithm (GA) is evaluated for the recognition of handwritten 'SWARS' of Hindi curve script. The performance index for the feedforward multilayer neural networks is considered here with distributed instantaneous unknown error i.e. different error for different layers. The objective of the GA is to make the search process more efficient to determine the optimal weight vectors from the population. The GA is applied with the distributed error. The fitness function of the GA is considered as the mean of square distributed error that is different for each layer. Hence the convergence is obtained only when the minimum of different errors is determined. It has been analysed that the proposed method of a descent gradient of distributed error with the GA known as hybrid distributed evolutionary technique for the multilayer feed forward neural performs better in terms of accuracy, epochs and the number of optimal solutions for the given training and test pattern sets of the pattern recognition problem.

  15. Heat Treatment Parameters to Optimize Friction and Wear behavior of Novel Hybrid Aluminium Composites Using Taguchi Technique

    Directory of Open Access Journals (Sweden)

    V.C.Uvaraja

    2014-05-01

    Full Text Available In the present study, an Al 7075 alloy is used as the matrix and varying weight percentage of Silicon Carbide (SiC and constant weight percentage of Boron Carbide (B4C as the reinforcing material. The composite is produced using stir casting technique. The composite thus formed is termed as hybrid composite. The samples are prepared for heat treatment process by subjecting to solutionizing temperature of 530o C for 1 hr followed by quenching in water. Further the specimens are subjected to artificial aging for durations of 4, 6 and 8 hr at a temperature of 175°C. The mechanical and tribological properties of composites before and after heat treatment are examined by Vickers hardness test machine and pin-on-disc test machine respectively. The wear rate and friction co-efficient of heat treatment parameters are evaluated based on Taguchi technique. The analysis is further extended to the optimization of test parameters using Design of Experiment (DoE based on L9 orthogonal array. The developed Analysis of Variance (ANOVA and the regression equations is obtained through MINITAB R16 are used to investigate the influence of parameters like sliding speed, applied load, sliding time, and percentage of reinforcement on the dry sliding wear and friction co-efficient of the composites. The wear surface morphology and wear mechanism of the pins are investigated using Scanning Electron Microscope (SEM and are correlated them with wear test results. Finally, confirmation tests are carried out to verify the experimental results.

  16. The application of fluorescence in situ hybridization (FISH technique for studying the microbial communities in intestinal tissues of white shrimp (Penaeus vannamei

    Directory of Open Access Journals (Sweden)

    Supamattaya, K.

    2005-02-01

    Full Text Available Fluorescence in situ hybridization technique is very useful for the evaluation of microbial communities in various environments. It is possible to apply this technique to study the intestinal microflora in white shrimp (Penaeus vannamei. Different fixatives and storage temperature were tested in this technique. It was found that fixation with 10% buffered formalin for 12 hours and changed to 70% ethanol shown positive results when compared to the fixation with Davidson's fixative or RF fixative. The best signaling was obtainedfrom the samples which were stored in -20ºC. By using the DNA probe targeted to the Eubacteria domain (EUB338 probe, 5′-GCT GCC TCC CGT AGG AGT-3′ labeled with fluorescein as a hybridizing probe, it was found that most intestinal microflora were aggregated with the intestinal contents, or dispersed in the lumen. There was not evidence of the attachment of the microflora with the intestinal epithelium in this study.

  17. Are ‘STEM from Mars and SSH from Venus’?: Challenging disciplinary stereotypes of research’s social value

    NARCIS (Netherlands)

    Olmos-Penuela, Julia; Benneworth, Paul; Castro-Martinez, Elena

    2014-01-01

    There is a reasonably settled consensus within the innovation community that science, technology, engineering and mathematics (STEM) research is more ‘useful’ to societies than other types of research, notably social sciences and humanities (SSH) research. Our paper questions this assumption, and se

  18. Safety surrogate histograms (SSH): A novel real-time safety assessment of dilemma zone related conflicts at signalized intersections.

    Science.gov (United States)

    Ghanipoor Machiani, Sahar; Abbas, Montasir

    2016-11-01

    Drivers' indecisiveness in dilemma zones (DZ) could result in crash-prone situations at signalized intersections. DZ is to the area ahead of an intersection in which drivers encounter a dilemma regarding whether to stop or proceed through the intersection when the signal turns yellow. An improper decision to stop by the leading driver, combined with the following driver deciding to go, can result in a rear-end collision, unless the following driver recognizes a collision is imminent and adjusts his or her behavior at or shortly after the onset of yellow. Considering the significance of DZ-related crashes, a comprehensive safety measure is needed to characterize the level of safety at signalized intersections. In this study, a novel safety surrogate measure was developed utilizing real-time radar field data. This new measure, called safety surrogate histogram (SSH), captures the degree and frequency of DZ-related conflicts at each intersection approach. SSH includes detailed information regarding the possibility of crashes, because it is calculated based on the vehicles conflicts. An example illustrating the application of the new methodology at two study sites in Virginia is presented and discussed, and a comparison is provided between SSH and other DZ-related safety surrogate measures mentioned in the literature. The results of the study reveal the efficacy of the SSH as complementary to existing surrogate measures.

  19. Screening and cloning of differentially expressed genes in placentas from patients of pregnancy-induced hypertension by suppression subtractive hybridization

    Institute of Scientific and Technical Information of China (English)

    尹国武; 姜锋; 李东红; 姚元庆

    2003-01-01

    Suppresssion subtractive hybridization (SSH) was preformed to compare gene expression profiles of PIH patients and normal pregnancy placentas. The subtractive cDNA library of PIH placenta was set up and screedned. Differential cDNAs were cloned, and sequenced by T 7 primer methodology. One hundred and three differential cDNAs were isolated by SSH. Sequencing and BLAST analysis showed 90 inserts shared more than 95% homolog with sequences in the GenBank/EMBL database. We identified 36 putative genes including pregnancy-specific glycoprotein gene (BC005924), serine protease inhibitor gene(BC012868), VEGFR-1 gene(AF063657, etc.

  20. Influence of the polymer amount on bioactivity and biocompatibility of SiO{sub 2}/PEG hybrid materials synthesized by sol–gel technique

    Energy Technology Data Exchange (ETDEWEB)

    Catauro, M., E-mail: michelina.catauro@unina2.it [Department of Industrial and Information Engineering, Second University of Naples, Via Roma 29, 81031 Aversa (Italy); Bollino, F.; Papale, F. [Department of Industrial and Information Engineering, Second University of Naples, Via Roma 29, 81031 Aversa (Italy); Gallicchio, M.; Pacifico, S. [Department of Environmental Biological and Pharmaceutical Sciences and Technologies, Second University of Naples, Via Vivaldi 43, 81100 Caserta (Italy)

    2015-03-01

    SiO{sub 2}/PEG organic–inorganic hybrid materials, which differ in polyethylene glycol (PEG) content, were synthesized by sol–gel technique and the characterization of their structure and biological properties was carried out in order to evaluate the possible use in biomedical field. FT-IR spectroscopy detected that the two components of the hybrids (SiO{sub 2} and PEG) are linked by hydrogen bonds between the Si–OH groups of the inorganic phase and the terminal alcoholic groups and/or the ethereal oxygen atoms in the repeating units of polymer. X-ray diffraction analysis ascertained the amorphous nature of the gels and the observation of their morphology by SEM microscopy confirmed that the interpenetration of the two phases (organic and inorganic) occurs on nanometric scale. The biological characterization was carried out as a function of the polymer amount to study its influence on material behavior. The results showed that the synthesized materials were bioactive and biocompatible. The formation of a hydroxyapatite layer, indeed, was observed on their surface by SEM/EDX analysis after soaking in simulated body fluid. Moreover, the biocompatibility of SiO{sub 2}/PEG hybrids was assessed performing MTT and SRB cytotoxicity tests on fibroblast cell NIH 3T3 after 24 and 48 h of exposure, as well as Trypan Blue dye exclusion test. The response to the presence of the investigated materials was positive. The cell growth and proliferation showed dependence on polymer amount and time of exposure to the material extracts. Therefore, the obtained results are encouraging for the use of the obtained hybrids in dental or orthopedic applications. - Highlights: • SiO{sub 2}/PEG hybrid biomaterials synthesized by sol–gel method at various PEG percentages • Chemical and morphological characterization of hybrid materials • Chemical interactions between inorganic and organic components • Biological characterizations with MTT and SRB cytotoxicity tests

  1. [Construction and analysis of the SSH library with the resistant wheat near-isogenic line and its susceptible parent infected by Puccinia striiformis Westend. f. sp. tritici].

    Science.gov (United States)

    Shu, Wei; Chen, Xiao-Hong; Niu, Yong-Chun

    2011-09-01

    To analyze the differentially expressed genes between resistant and susceptible wheat near-isogenic lines infected by Puccinia striiformis Westend. f. sp. tritici, a subtractive library containing about 1300 clones was constructed using suppression subtractive hybridization (SSH) in which the cDNA from resistant Yr4/6 × Taichung 29 seedlings inoculated with race CY26 was used as the tester, and the corresponding cDNA from susceptible Taichung 29 as the driver. Six hundred clones from the library were analyzed with reverse Northern blot. The positive clones were further tested by Northern blotting analysis. Twelve clones were verified and showed significant difference. By means of sequencing and BlastX analysis, six function-known differentially expressed sequences were detected, and their putative products were leucine-rich repeat protein, catalase, thioredoxin H-type, RNA binding protein, ascorbate peroxidase, and heat shock protein, respectively. Among them, leucine-rich repeat protein belongs to signal transduction protein, and others belong to defense response protein.

  2. Hybrid-SAR Technique: Joint Analysis Using Phase-Based and Amplitude-Based Methods for the Xishancun Giant Landslide Monitoring

    Directory of Open Access Journals (Sweden)

    Tengteng Qu

    2016-10-01

    Full Text Available Early detection and early warning are of great importance in giant landslide monitoring because of the unexpectedness and concealed nature of large-scale landslides. In China, the western mountainous areas are prone to landslides and feature many giant complex landslides, especially following the Wenchuan Earthquake in 2008. This work concentrates on a new technique, known as the “hybrid-SAR technique”, that combines both phase-based and amplitude-based methods to detect and monitor large-scale landslides in Li County, Sichuan Province, southwestern China. This work aims to develop a robust methodological approach to promptly identify diverse landslides with different deformation magnitudes, sliding modes and slope geometries, even when the available satellite data are limited. The phase-based and amplitude-based techniques are used to obtain the landslide displacements from six TerraSAR-X Stripmap descending scenes acquired from November 2014 to March 2015. Furthermore, the application circumstances and influence factors of hybrid-SAR are evaluated according to four aspects: (1 quality of terrain visibility to the radar sensor; (2 landslide deformation magnitude and different sliding mode; (3 impact of dense vegetation cover; and (4 sliding direction sensitivity. The results achieved from hybrid-SAR are consistent with in situ measurements. This new hybrid-SAR technique for complex giant landslide research successfully identified representative movement areas, e.g., an extremely slow earthflow and a creeping region with a displacement rate of 1 cm per month and a typical rotational slide with a displacement rate of 2–3 cm per month downwards and towards the riverbank. Hybrid-SAR allows for a comprehensive and preliminary identification of areas with significant movement and provides reliable data support for the forecasting and monitoring of landslides.

  3. [Development of new SSR markers from EST of SSH cDNA libraries on rose fragrance].

    Science.gov (United States)

    Yan, Hui-Jun; Zhang, Hao; Xie, Ji-Rong; Li, Shu-Fa; Jian, Hong-Ying; Qiu, Xian-Qin; Wang, Qi-Gang; Wang, Ji-Hua; Tang, Kai-Xue

    2009-09-01

    The new SSR markers of rose related fragrance were developed based on the SSH cDNA libraries of rose floral scent mutant. In this study, 10 EST-SSRs (2.6%) from 391 ESTs in the libraries were identified. Six EST-SSRs primers were designed to sequence flanking SSRs. The primer pairs designed were screened on the wild-type Jinyindao, which has flowers full of pleasant scent, and the mutant-type Wangriqinghuai without perceivable floral scent. Five primer pairs were amplified effectively in Jinyindao and Wangriqinghuai, and 3 were polymorphic between Jinyindao and Wangriqinghuai. Eighteen rose cultivars including fragrant roses and nonfragrant roses were identified by the five prime pairs. These results proved that EST-SSR markers are effective markers to identify the polymorphism of the rose.

  4. Using ssh and sshfs to virtualize Grid job submission with RCondor

    Science.gov (United States)

    Sfiligoi, I.; Dost, J. M.

    2014-06-01

    The HTCondor based glideinWMS has become the product of choice for exploiting Grid resources for many communities. Unfortunately, its default operational model expects users to log into a machine running a HTCondor schedd before being able to submit their jobs. Many users would instead prefer to use their local workstation for everything. A product that addresses this problem is RCondor, a module delivered with the HTCondor package. RCondor provides command line tools that simulate the behavior of a local HTCondor installation, while using ssh under the hood to execute commands on the remote node instead. RCondor also interfaces with sshfs, virtualizing access to remote files, thus giving the user the impression of a truly local HTCondor installation. This paper presents a detailed description of RCondor, as well as comparing it to the other methods currently available for accessing remote HTCondor schedds.

  5. Selection of genes associated with variations in the Circle of Willis in gerbils using suppression subtractive hybridization.

    Science.gov (United States)

    Li, Zhenkun; Huo, Xueyun; Zhang, Shuangyue; Lu, Jing; Li, Changlong; Guo, Meng; Fu, Rui; He, Zhengming; Du, Xiaoyan; Chen, Zhenwen

    2015-01-01

    Deformities in the Circle of Willis (CoW) can significantly increase the risk of cerebrovascular disease in humans. However, the molecular mechanisms underlying these deformities have not been understood. Based on our previous studies, variations in the CoW of gerbils are hereditary. A normal CoW is observed in approximately 60% of gerbils, a percentage that also applies to humans. Thus, gerbil is an ideal experimental model for studying variations in the CoW. To study the mechanisms underlying these variations, we selected genes associated with different types of the CoW using suppression subtractive hybridization (SSH). After evaluating the efficiency of SSH using quantitative real-time polymerase chain reaction (qPCR) on subtracted and unsubtracted cDNA and Southern blotting on SSH PCR products, 12 SSH libraries were established. We identified 4 genes (CST3, GNAS, GPx4 and PFN2) associated with variations in the CoW. These genes were identified with qPCR and Western blotting using 70 expressed sequence tags from the SSH libraries. Cloning and sequencing allowed us to demonstrate that the 4 genes were closely related to mouse genes. We may assume that these 4 genes play an important role in the development of variations in the CoW. This study provides a foundation for further research of genes related to development of variations in the CoW and the mechanisms of dysmorphosis of cerebral vessels.

  6. Selection of genes associated with variations in the Circle of Willis in gerbils using suppression subtractive hybridization.

    Directory of Open Access Journals (Sweden)

    Zhenkun Li

    Full Text Available Deformities in the Circle of Willis (CoW can significantly increase the risk of cerebrovascular disease in humans. However, the molecular mechanisms underlying these deformities have not been understood. Based on our previous studies, variations in the CoW of gerbils are hereditary. A normal CoW is observed in approximately 60% of gerbils, a percentage that also applies to humans. Thus, gerbil is an ideal experimental model for studying variations in the CoW. To study the mechanisms underlying these variations, we selected genes associated with different types of the CoW using suppression subtractive hybridization (SSH. After evaluating the efficiency of SSH using quantitative real-time polymerase chain reaction (qPCR on subtracted and unsubtracted cDNA and Southern blotting on SSH PCR products, 12 SSH libraries were established. We identified 4 genes (CST3, GNAS, GPx4 and PFN2 associated with variations in the CoW. These genes were identified with qPCR and Western blotting using 70 expressed sequence tags from the SSH libraries. Cloning and sequencing allowed us to demonstrate that the 4 genes were closely related to mouse genes. We may assume that these 4 genes play an important role in the development of variations in the CoW. This study provides a foundation for further research of genes related to development of variations in the CoW and the mechanisms of dysmorphosis of cerebral vessels.

  7. Assessment of fusion facility dose rate map using mesh adaptivity enhancements of hybrid Monte Carlo/deterministic techniques

    Energy Technology Data Exchange (ETDEWEB)

    Ibrahim, Ahmad M., E-mail: ibrahimam@ornl.gov [Oak Ridge National Laboratory, P.O. Box 2008, Oak Ridge, TN 37831 (United States); Wilson, Paul P. [University of Wisconsin-Madison, 1500 Engineering Dr., Madison, WI 53706 (United States); Sawan, Mohamed E., E-mail: sawan@engr.wisc.edu [University of Wisconsin-Madison, 1500 Engineering Dr., Madison, WI 53706 (United States); Mosher, Scott W.; Peplow, Douglas E.; Grove, Robert E. [Oak Ridge National Laboratory, P.O. Box 2008, Oak Ridge, TN 37831 (United States)

    2014-10-15

    Highlights: •Calculate the prompt dose rate everywhere throughout the entire fusion energy facility. •Utilize FW-CADIS to accurately perform difficult neutronics calculations for fusion energy systems. •Develop three mesh adaptivity algorithms to enhance FW-CADIS efficiency in fusion-neutronics calculations. -- Abstract: Three mesh adaptivity algorithms were developed to facilitate and expedite the use of the CADIS and FW-CADIS hybrid Monte Carlo/deterministic techniques in accurate full-scale neutronics simulations of fusion energy systems with immense sizes and complicated geometries. First, a macromaterial approach enhances the fidelity of the deterministic models without changing the mesh. Second, a deterministic mesh refinement algorithm generates meshes that capture as much geometric detail as possible without exceeding a specified maximum number of mesh elements. Finally, a weight window coarsening algorithm decouples the weight window mesh and energy bins from the mesh and energy group structure of the deterministic calculations in order to remove the memory constraint of the weight window map from the deterministic mesh resolution. The three algorithms were used to enhance an FW-CADIS calculation of the prompt dose rate throughout the ITER experimental facility and resulted in a 23.3% increase in the number of mesh tally elements in which the dose rates were calculated in a 10-day Monte Carlo calculation. Additionally, because of the significant increase in the efficiency of FW-CADIS simulations, the three algorithms enabled this difficult calculation to be accurately solved on a regular computer cluster, eliminating the need for a world-class super computer.

  8. Analysis, control and optimal operations in hybrid power systems advanced techniques and applications for linear and nonlinear systems

    CERN Document Server

    Bizon, Nicu; Mahdavi Tabatabaei, Naser

    2014-01-01

    This book explains and analyzes the dynamic performance of linear and nonlinear systems, particularly for Power Systems including Hybrid Power Sources. Offers a detailed description of system stability using state space energy conservation principle, and more.

  9. TiO{sub 2}/PCL hybrid materials synthesized via sol–gel technique for biomedical applications

    Energy Technology Data Exchange (ETDEWEB)

    Catauro, M., E-mail: michelina.catauro@unina2.it [Department of Industrial and Information Engineering, Second University of Naples, Via Roma 29, 81031 Aversa (Italy); Bollino, F.; Papale, F. [Department of Industrial and Information Engineering, Second University of Naples, Via Roma 29, 81031 Aversa (Italy); Marciano, S.; Pacifico, S. [Department Environmental, Biological and Pharmaceutical Sciences and Technologies, Second University of Naples, Via Vivaldi 43, 81100 Caserta (Italy)

    2015-02-01

    The aim of the present work has been the synthesis of organic/inorganic hybrid materials based on titanium dioxide and poly(ε-caprolactone) (PCL) to be used in the biomedical field. Several materials have been synthesized using sol–gel methods by adding different amounts of polymer to the inorganic sol. The obtained gels have been characterized using Fourier transform infrared (FT-IR) spectroscopy, scanning electron microscopy (SEM) and atomic force microscopy (AFM). The FT-IR data allowed us to hypothesize that the structure formed was that of an interpenetrating network, realized by hydrogen bonds between Ti-OH groups in the sol–gel intermediate species and carbonyl groups in the polymer repeating units. SEM and AFM analyses highlighted that the obtained materials were nanostructurated hybrids. To evaluate the biological properties of the hybrids, their bioactivity and cytotoxicity were investigated as a function of the PCL amount. The bioactivity of the synthesized systems was proven by the formation of a hydroxyapatite layer on the surface of samples soaked in a fluid simulating human blood plasma (SBF). MTT cytotoxicity tests and Trypan Blue dye exclusion tests were carried out exposing NIH-3T3 mouse embryonic fibroblasts for 24 and 48 h to extracts from the investigated hybrid materials. The results showed that all the hybrids had a non-cytotoxic effect on target cells. - Highlights: • TiO{sub 2}/PCL hybrids were obtained by the sol–gel process for biomedical applications. • Synthesized materials were found to be first-class hybrid nanocomposites. • Hybrids appear to be bioactive, a fundamental characteristic for osseointegration. • MTT and Trypan Blue viability test show that the materials are biocompatible. • The organic phase is able to modulate the biocompatibility of the materials.

  10. Investigation of kinetics and thermodynamics of DNA hybridization by means of 2-D fluorescence spectroscopy and soft/hard modeling techniques

    Energy Technology Data Exchange (ETDEWEB)

    Ebrahimi, Sara; Kompany-Zareh, Mohsen, E-mail: kmpz@dr.com

    2016-02-04

    Reversible hybridization reaction plays a key role in fundamental biological processes, in many laboratory techniques, and also in DNA based sensing devices. Comprehensive investigation of this process is, therefore, essential for the development of more sophisticated applications. Kinetics and thermodynamics of the hybridization reaction, as a second order process, are systematically investigated with the aid of the soft and hard chemometric methods. Labeling two complementary 21 mer DNA single strands with FAM and Texas red fluorophores, enabled recording of the florescence excitation−emission matrices during the experiments which led to three-way data sets. The presence of fluorescence resonance energy transfer in excitation and emission modes and the closure in concentration mode, made the three-way data arrays rank deficient. To acquire primary chemical information, restricted Tucker3 as a soft method was employed. Herein a model-based method, hard restricted trilinear decomposition, is introduced for in depth analysis of rank deficient three-way data sets. By employing proposed hard method, the nonlinear model parameters as well as the correct profiles could be estimated. In addition, a simple constraint is presented to extract chemically reasonable output profiles regarding the core elements of restricted Tucker3 model. - Highlights: • Hard restricted trilinear decomposition (HrTD) was introduced for model-based analysis of three-way rank deficient data. • DNA hybridization was investigated by two-dimensional fluorescence spectroscopy and soft/hard multi-way techniques. • Restricted Tucker3 analysis enabled accurate estimation of pure FRET profiles in the hybridized form. • HrTD was successfully employed to estimate kinetic and equilibrium parameters of DNA hybridization system. • The performance of the proposed methods in response to different physical stimuli was successfully evaluated.

  11. Construction of Hypericin Gland-Specific cDNA Library via Suppression Subtractive Hybridization.

    Science.gov (United States)

    Singh, Rupesh Kumar; Hou, Weina; Franklin, Gregory

    2016-01-01

    Hypericin, an important determinant of the pharmacological properties of the genus Hypericum, is considered as a major molecule for drug development. However, biosynthesis and accumulation of hypericin is not well understood. Identification of genes differentially expressed in tissues with and without hypericin accumulation is a useful strategy to elucidate the mechanisms underlying the development of the dark glands and hypericin biosynthesis. Suppression Subtractive Hybridization (SSH) is a unique method for PCR-based amplification of specific cDNA fragments that differ between a control (driver) and experimental (tester) transcriptome. This technique relies on the removal of dsDNA formed by hybridization between a control and test sample, thus eliminating cDNAs of similar abundance, and retaining differentially expressed or variable in sequence cDNAs. In our laboratory we applied this method to identify the genes involved in the development of dark glands and accumulation of hypericin in Hypericum perforatum. Here we describe the complete procedure for the construction of hypericin gland-specific subtracted cDNA library.

  12. Coupling physical chemical techniques with hydrotalcite-like compounds to exploit their structural features and new multifunctional hybrids with luminescent properties.

    Science.gov (United States)

    Costantino, Umberto; Costantino, Ferdinando; Elisei, Fausto; Latterini, Loredana; Nocchetti, Morena

    2013-08-28

    Hydrotalcite-like compounds (HTlc), belonging to the large class of Layered Double Hydroxides (LDH), have excited wide interest owing to the incredible number of their potential and achieved applications in physical, chemical and bio-chemical fields. This perspective review deals with recent advances in the application of physical-chemical techniques for the study of HTlc structure and for the design and synthesis, using intercalation chemistry routes, of new hybrid materials. Firstly, a rapid survey on the most common synthetic strategies for the attainment of HTlc with different crystallinity degree and crystal size and for their modification to obtain hybrids has been made, and the use of coupled techniques (XRPD, luminescence, Solid State MAS NMR and Molecular Dynamics) to gain structural information is reported. Then, the design, synthesis and photophysical characterization of azoic dyes-intercalated and co-intercalated HTlc hybrid materials are described. Hybrids constituted of ZnAl-HTlc, co-intercalated with stearate anions and methyl orange or methyl yellow dyes, have been used as nanofillers of hydrophobic polymers. The polymeric nano-composites obtained have been characterized by means of XRPD patterns, Thermo-Gravimetric Analysis and Confocal Fluorescence Microscopy. This latter technique has been found to be an excellent, complementary and non-invasive tool to probe the dispersion degree of the fluorescent fillers into the polymeric matrices and their stability in the compounding process. Finally, the synthesis and spectroscopic characterization of nanoparticle (NP) decorated HTlc for advanced antimicrobial and photo-catalytic applications are also reported. The review terminates with a concluding short note and future trends.

  13. Cervical anterior hybrid technique with bi-level Bryan artificial disc replacement and adjacent segment fusion for cervical myelopathy over three consecutive segments.

    Science.gov (United States)

    Chen, Jiang; Xu, Lin; Jia, Yu-Song; Sun, Qi; Li, Jin-Yu; Zheng, Chen-Ying; Bai, Chun-Xiao; Yu, Qin-Sheng

    2016-05-01

    This study aimed to assess the preliminary clinical efficacy and feasibility of the hybrid technique for multilevel cervical myelopathy. Considering the many shortcomings of traditional treatment methods for multilevel cervical degenerative myelopathy, hybrid surgery (bi-level Bryan artificial disc [Medtronic Sofamor Danek, Memphis, TN, USA] replacement and anterior cervical discectomy and fusion) should be considered. Between March 2006 and November 2012, 108 patients (68 men and 40 women, average age 45years) underwent hybrid surgery. Based on the Japanese Orthopaedic Association (JOA) score, Neck Disability Index (NDI), and Odom's criteria, the clinical symptoms and neurological function before and after surgery were evaluated. Mean surgery duration was 90minutes, with average blood loss of 30mL. Mean follow-up duration was 36months. At the final follow-up, the mean JOA (± standard deviation) scores were significantly higher compared with preoperative values (15.08±1.47 versus 9.18±1.22; P<0.01); meanwhile, NDI values were markedly decreased (12.32±1.03 versus 42.68±1.83; P<0.01). Using Odom's criteria, the clinical outcomes were rated as excellent (76 patients), good (22 patients), fair (six patients), and poor (four patients). These findings indicate that the hybrid method provides an effective treatment for cervical myelopathy over three consecutive segments, ensuring a good clinical outcome. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. A Novel Hybrid Ultramicrotomy/FIB-SEM Technique: Preparation of Serial Electron-Transparent Thin Sections of a Hayabusa Grain

    Science.gov (United States)

    Berger, Eve L.; Keller, Lindsay P.

    2014-01-01

    The Japanese space agency's (JAXA) Hayabusa mission returned the first particulate samples (typically SEM). Using a diamond trim knife, the epoxy surrounding the grain is removed on 3 sides (to within a few microns of the grain); the depth of material removed extends well below the bottom of the particle. The sample is attached to an SEM pin mount, the epoxy coated with conductive paint, and the entire assembly coated with approx. 40nm of carbon to eliminate sample charging during FIB work. A protective carbon cap is placed according to the plan for the 15 FIB sections. The central 'spine' of the cap runs perpendicular to the front of the sample, and the 'ribs' protruding from either side run parallel. Each rib indicates the location of a planned FIB section, and the spine contains the final two planned sections. We use a cap with a 4 micron-wide spine and 2micron-wide ribs that have ?3.5 micron of space between them (narrower cuts result in too much re-deposition of material inside the trenches). Using a 30kV, 3nA ion-beam we expose the front surface of the grain and commence milling trenches between sections. Rather than using the typical C-cut to prepare the sample for lift-out, an L-cut is used instead, leaving the sample connected by an interior tab. tab. Sections are lifted out, attached to TEM grids and thinned to electron transparency. TEM analyses show that our hybrid technique preserves both interior and edge features, including surface modifications from exposure to the space environment, such as damaged rims that form in response to solar wind implantation effects and adhering grains. In addition, the FIB sections provide larger areas that are free of fractures and chatter effects in comparison to the microtome thin sections, thus enabling more accurate measurements of solar flare particle track densities that are used to determine the surface exposure age of the particles.

  15. [The effect of SSH&H on the lifespan and spontaneous cancer development in transgenic mice with HER-2/neu mutation].

    Science.gov (United States)

    Tyndyk, M L; Popovich, I G; Anikin, I V; Egormin, P A; Iurova, M N; Zabezhinskiĭ, M A; Anisimov, V N

    2012-01-01

    10 months old mice receiving SSH&H with daily food increased the lifespan in comparison to the control group. The maximal lifespan was increased by 1,6 months. For the long-living 10% group the mean lifespan increased by 8,7% compared to the control group (pSSH&H on the neoplastic rate in transgenic mice with HER-2/neu mutation.

  16. Suppression substractive hybridisation (SSH) and real time PCR reveal differential gene expression in the Pacific cupped oyster, Crassostrea gigas, challenged with Ostreid herpesvirus 1

    OpenAIRE

    2011-01-01

    Virus-induced genes were identified using suppression subtractive hybridisation (SSH) from Pacific cupped oyster, Crassostrea gigas, haemocytes challenged by OsHV-1. A total of 304 clones from SSH forward library were sequenced. Among these sequences, some homologues corresponded to (i) immune related genes (macrophage express protein, IK cytokine, interferon-induced protein 44 or multicopper oxidase), (ii) apoptosis related genes (Bcl-2) and (iii) cell signalling and virus receptor genes (gl...

  17. Správa veřejných klíčů SSH v programech FreeIPA a SSSD

    OpenAIRE

    Cholasta, Jan

    2012-01-01

    SSH je jeden z nejpoužívanějších protokolů pro vzdálený přístup v Internetu. SSH je flexibilní a rozšiřitelný protokol, který se skládá ze tří hlavních součástí: SSH transportního protokolu, který obstarává důvěrnost, integritu a autentizaci serveru, SSH autentizačního protokolu, který obstarává autentizaci uživatelů a SSH spojovacího protokolu, který obstarává multiplexování více kanálů různých typů (interaktivní sezení, přesměrování TCP/IP spojení, atd.) do jednoho spojení. OpenSSH je jedna...

  18. SSH & the City. A Network Approach for Tracing the Societal Contribution of the Social Sciences and Humanities for Local Development

    Energy Technology Data Exchange (ETDEWEB)

    Robinson-Garcia, N.; Van Leeuwen, T.; Rafols, I.

    2016-07-01

    Current evaluation frameworks in research policy were designed to address: 1) life and natural sciences, 2) global research communities, and; 3) scientific impact. This is problematic, as they do not adapt well to SSH scholarship, to local interests, or to consider broader societal impacts. This paper discusses three different evaluation frameworks and proposes a methodology to operationalize them and capture societal interactions between social sciences and humanities (SSH) researchers and their local context. To capture such interactions, we propose the use of social media and web-link analysis to identify interactions between academics and local stakeholders. We consider that the power of these tools is not so much on understanding their meaning as ‘acts’ to develop impact or visibility metrics whenever a mention to a research article is made, but as proxies for personal interactions. We offer some examples of the expected social networks we aim at developing for two Spanish cities: Granada and Valencia. (Author)

  19. Characterization of expressed sequence tags obtained by SSH during somatic embryogenesis in Cichorium intybus L

    Directory of Open Access Journals (Sweden)

    Quillet Marie-Christine

    2007-06-01

    Full Text Available Abstract Background Somatic embryogenesis (SE is an asexual propagation pathway requiring a somatic-to-embryonic transition of differentiated somatic cells toward embryogenic cells capable of producing embryos in a process resembling zygotic embryogenesis. In chicory, genetic variability with respect to the formation of somatic embryos was detected between plants from a population of Cichorium intybus L. landrace Koospol. Though all plants from this population were self incompatible, we managed by repeated selfing to obtain a few seeds from one highly embryogenic (E plant, K59. Among the plants grown from these seeds, one plant, C15, was found to be non-embryogenic (NE under our SE-inducing conditions. Being closely related, we decided to exploit the difference in SE capacity between K59 and its descendant C15 to study gene expression during the early stages of SE in chicory. Results Cytological analysis indicated that in K59 leaf explants the first cell divisions leading to SE were observed at day 4 of culture. In contrast, in C15 explants no cell divisions were observed and SE development seemed arrested before cell reactivation. Using mRNAs isolated from leaf explants from both genotypes after 4 days of culture under SE-inducing conditions, an E and a NE cDNA-library were generated by SSH. A total of 3,348 ESTs from both libraries turned out to represent a maximum of 2,077 genes. In silico subtraction analysis sorted only 33 genes as differentially expressed in the E or NE genotype, indicating that SSH had resulted in an effective normalisation. Real-time RT-PCR was used to verify the expression levels of 48 genes represented by ESTs from either library. The results showed preferential expression of genes related to protein synthesis and cell division in the E genotype, and related to defence in the NE genotype. Conclusion In accordance with the cytological observations, mRNA levels in explants from K59 and C15 collected at day 4 of SE

  20. SSH-2 measurements of cirrus at 18-28 micrometers from the King Air during FIRE 2

    Science.gov (United States)

    Griffin, Michael K.

    1993-01-01

    In November of 1991, the First ISCCP (International Satellite Cloud Climatology Project) Regional Experiment (FIRE) Phase II cirrus study took place at Coffeyville, Kansas. The field experiment incorporated instrumentation from surface, aircraft, and satellite to attempt to define the optical, radiative, and microphysical characteristics of these high altitude, predominantly ice clouds. The NCAR King Air research aircraft was outfitted with a variety of radiative and microphysical instrumentation for the FIRE II project. Included for this project was the SSH-2, a 16-channel passive radiometer. The SSH-2 was originally designed as a space-qualified infrared (IR) temperature and water vapor sounder for deployment onboard the Defense Meteorological Satellite Program (DMSP) series of environmental satellites. For this experiment, only those channels associated with the water vapor profiling function have been examined although downwelling radiance measurements were taken at all channels during the project. With supporting information from the aircraft telemetry observations it may be possible to relate these SSH-2 measurements to cloud radiative and microphysical properties. The following sections will describe the spectral characteristics of the instrument, the calibration scheme used to convert the raw measured counts into calibrated radiances, and the case studies that will be covered in this paper. This will be followed by a discussion of the results of this preliminary investigation and a description of future work to be done.

  1. Tailed pooled suppression subtractive hybridization (PSSH) adaptors do not alter efficiency.

    Science.gov (United States)

    Gerrish, Robert S; Gill, Steven R

    2010-11-01

    Suppression Subtractive Hybridization (SSH) and its derivative, Pooled Suppression Subtractive hybridization (PSSH), are powerful tools used to study variances larger than ~100 bp in prokaryotic genome structure. The initial steps involve ligating an oligonucleotide of known sequence (the "adaptor") to a fragmented genome to facilitate amplification, subtraction and downstream sequencing. SSH results in the creation of a library of unique DNA fragments which have been traditionally analyzed via Sanger sequencing. Numerous next generation sequencing technologies have entered the market yet SSH is incompatible with these platforms. This is due to the high level of sequence conservation of the oligonucleotide used for SSH. This rigid adherence is partly because it has yet to be determined if alteration of this oligonucleotide will have a deleterious impact on subtraction efficiency. The subtraction occurs when non-unique fragments are inhibited by a secondary self-pairing structure which requires exact nucleotide sequence. We determine if appending custom sequence to the 5' terminal ends of these oligonucleotides during the nested PCR stages of PSSH will reduce subtraction efficiency. We compare a pool of ten S. aureus clinical isolates with a standard PSSH and custom tailed-PSSH. We detected no statistically significant difference between their subtraction efficiencies. Our observations suggest that the adaptor's terminal ends may be labeled during the nested PCR step. This produces libraries labeled with custom sequence. This does not lead to loss of subtraction efficiency and would be invaluable for groups wishing to combine SSH or PSSH with their own downstream applications, such as a high throughput sequencing platform.

  2. COED Transactions, Vol. IX, No. 3, March 1977. Evaluation of a Complex Variable Using Analog/Hybrid Computation Techniques.

    Science.gov (United States)

    Marcovitz, Alan B., Ed.

    Described is the use of an analog/hybrid computer installation to study those physical phenomena that can be described through the evaluation of an algebraic function of a complex variable. This is an alternative way to study such phenomena on an interactive graphics terminal. The typical problem used, involving complex variables, is that of…

  3. The karyotype of Festucopsis serpentini (Poaceae Triticeae) from Albania studied by banding techniques and in situ hybridization

    DEFF Research Database (Denmark)

    Linde-Laursen, I.; Seberg, O.; Frederiksen, S.;

    1996-01-01

    The karyotypes of two populations of Festucopsis serpentini (2n = 2x = 14) endemic to Albania were investigated in detail by Giemsa C- and N-banding, AgNO3 staining, and in situ hybridization with an rDNA probe. The complements consisted of 14 large chromosomes, 10 metacentric and 4 SAT-chromosom...

  4. Application of optimization technique to noncrystalline x-ray diffraction microscopy: Guided hybrid input-output method

    Science.gov (United States)

    Chen, Chien-Chun; Miao, Jianwei; Wang, C. W.; Lee, T. K.

    2007-08-01

    We have developed an algorithm that combines the concept of optimization with the conventional hybrid input-output (HIO) algorithm for phase retrieval of oversampled diffraction intensities. In particular, the optimization algorithm of guiding searching direction to locate the global minimum has been implemented. Compared with HIO, this guided HIO algorithm retrieves the lost phase information from diffraction intensities with much better accuracy.

  5. 应用抑制性消减杂交技术筛选转化生长因子β1刺激LX02细胞的反式调节基因%Screening and cloning genes transactivated by TGF beta 1 in hepatic stellate cells using suppression subtractive hybridization technique

    Institute of Scientific and Technical Information of China (English)

    肖琳; 张跃新; 张建龙; 李燕; 成军; 郭江; 张黎颖; 洪源; 伦永志; 蓝贤勇; 武会娟; 张丽娟

    2008-01-01

    目的 构建转化生长因子(TGF)β1刺激大鼠肝星状细胞(LX02)反式调节基因的cDNA消减文库,筛选并克隆TGF β1反式调节相关基因,以阐明TGF β1介导肝纤维化的分子生物学机制.方法 以TGF β1刺激LX02细胞,同时以磷酸盐缓冲液刺激的LX02细胞作为对照.提取mRNA并逆转录为cDNA,经Rsa Ⅰ酶切后,将实验组cDNA分成两组,分别与两种不同的接头衔接,再与对照组cDNA进行两次消减杂交及两次抑制性多聚酶链反应.将产物与pGEM-Teasy载体连接,构建cDNA消减文库,并转染大肠杆菌进行文库扩增;随机挑选克隆经PCR扩增后进行测序及同源性分析. 结果成功构建了TGF β1刺激LX02细胞反式调节基因的cDNA消减文库.文库扩增后得到146个200~1000bp插入片段的阳性克隆;随机挑取其中35个克隆进行测序,30个列序成功,并通过生物信息学分析发现有28个与已知基因序列和2个与未知功能基因序列高度同源.结论 应用抑制性消减杂交技术成功构建了TGF β1刺激LX02细胞反式调节基因的cDNA消减文库,筛选到一些与细胞生长调节、蛋白质合成,信号传导、细胞外基质代谢、扰脂质过氧化等密切相关的蛋白质编码基因,为进一步阐明TGF β1介导肝纤维化的分子生物学机制提供了线索.%Objectives To construct a eDNA subtractive library of genes transactivated by TGF beta 1 in LX02 hepatic stellate cells (HSC); to screen and to clone the regulated genes transactivated by TGF beta 1; and to elucidate the molecular biological mechanism of hepatic fibrosis mediated by TGF beta 1. Methods mRNA was isolated from HSC treated with TGF beta 1 or with PBS (as controls). Suppression subtractive hybridization (SSH) technique was employed to analyze the differentially expressed DNA sequence between the two groups. After restriction enzyme Rsa I digestion, small size cDNAs were obtained. Then tester cDNA was divided into two groups and ligated

  6. Event Detection and Visualization of Ocean Eddies based on SSH and Velocity Field

    Science.gov (United States)

    Matsuoka, Daisuke; Araki, Fumiaki; Inoue, Yumi; Sasaki, Hideharu

    2016-04-01

    Numerical studies of ocean eddies have been progressed using high-resolution ocean general circulation models. In order to understand ocean eddies from simulation results with large amount of information volume, it is necessary to visualize not only distribution of eddies of each time step, but also events or phenomena of eddies. However, previous methods cannot precisely detect eddies, especially, during the events such as eddies' amalgamation, bifurcation. In the present study, we propose a new approach of eddy's detection, tracking and event visualization based on sea surface height (SSH) and velocity field. The proposed method detects eddies region as well as streams and currents region, and classifies detected eddies into several types. By tracking the time-varying change of classified eddies, it is possible to detect not only eddies event such as amalgamation and bifurcation but also the interaction between eddy and ocean current. As a result of visualizing detected eddies and events, we succeeded in creating the movie which enables us to intuitively understand the region of interest.

  7. Determination of Mean Dynamic Topography (MDT) to Bridge Geoid and Mean Sea Surface Height (SSH) with a New Elliptic Equation

    Science.gov (United States)

    Chu, P. C.

    2016-12-01

    Mean dynamic topography (MDT, η) bridges the geoid and the mean sea surface (from satellite altimetry) and constrains large scale surface geostrophic circulations. It can be estimated from either satellite or underwater ocean temperature (T) and salinity (S) data. Satellite altimeter measures sea surface height (SSH) with high precision and unique resolution above a reference ellipsoid (not geoid). Two Gravity Recovery and Climate Experiment (GRACE) satellites launched in 2002, provide data to compute the marine geoid [called the GRACE Gravity Model (GGM)] (see website: http://www.csr.utexas.edu/grace/). The MDT is the difference of altimetry-derived mean SSH and the mean marine geoid (using GGM or pre-GRACE gravity model such as EGM96). A major difficulty arises that the spatial variations in mean SSH and marine geoid are approximately two orders of magnitude larger than the spatial variations in η.The second approach (using T, Sdata) is based on geostrophic balance, which is at the minimum energy state in the linear Boussinesq primitive equations with conservation of potential vorticity. In this paper, a new elliptic equation, -[∂x(gh/f2)∂xη+∂y(gh/f2)∂yη]+η = (g/f2)(∂C/∂x-∂B/∂y)is derived to determine MDT with H the water depth, g the gravitational acceleration, and coefficients (B, C) depend on 3D mean temperature (T) and salinity (S) data. Numerical approach transforms the elliptic equation into a set of well-posed linear algebraic equations of η at grid points. The solution for the North Atlantic Ocean (100oW-6oW, 7oN-72oN) on 1oX1ogrids with the coefficients (B, C) calculated from the three-dimensional (T, S) data of the NOAA National Centers for Environmental Information (NCEI) World Ocean Atlas 2013 version 2 (http://www.nodc.noaa.gov/OC5/woa13/woa13data.html) and H from the NOAA ETOPO5 (https://www.ngdc.noaa.gov/mgg/fliers/93mgg01.html), compares well with the difference (also considered as the MDT) between the time-averaged SSH and

  8. Magneto-optical mode conversion in a hybrid glass waveguide made by sol-gel and ion-exchange techniques

    Science.gov (United States)

    Royer, François; Amata, Hadi; Parsy, François; Jamon, Damien; Ghibaudo, Elise; Broquin, Jean-Emmanuel; Neveu, Sophie

    2012-01-01

    The integration of magneto-optical materials with classical technologies being still a difficult problem, this study explores the possibility to realize a mode converter based on a hybrid structure. A composite magneto-optical layer made of a silica/zirconia matrix doped by magnetic nanoparticles is coated on the top face of ion-exchanged glass waveguides. Optical characterizations that have been carried out demonstrated the efficiency of these hybrid structures in terms of lateral confinement. Furthermore, TE to TM mode conversion has been observed when a longitudinal magnetic field is applied to the device. The amount of this conversion is analysed taking into account the magneto-optical confinement and the modal birefringence of the structure.

  9. Recombinant expression of TLR5 proteins by ligand supplementation and a leucine-rich repeat hybrid technique

    OpenAIRE

    Hong, Minsun; Yoon, Sung-il; Wilson, Ian A.

    2012-01-01

    Vertebrate TLR5 directly binds bacterial flagellin proteins and activates innate immune responses against pathogenic flagellated bacteria. Structural and biochemical studies on the TLR5/flagellin interaction have been challenging due to the technical difficulty in obtaining active recombinant proteins of TLR5 ectodomain (TLR5-ECD). We recently succeeded in production of the N-terminal leucine rich repeats (LRRs) of Danio rerio (dr) TLR5-ECD in a hybrid with another LRR protein, hagfish variab...

  10. Hybrid FOSS Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Armstrong researchers are continuing their efforts to further develop FOSS technologies. A hybrid FOSS technique (HyFOSS) employs conventional continuous grating...

  11. A Hybrid Technique Based on Combining Fuzzy K-means Clustering and Region Growing for Improving Gray Matter and White Matter Segmentation

    Directory of Open Access Journals (Sweden)

    Ashraf Afifi

    2012-07-01

    Full Text Available In this paper we present a hybrid approach based on combining fuzzy k-means clustering, seed region growing, and sensitivity and specificity algorithms to measure gray (GM and white matter (WM tissue. The proposed algorithm uses intensity and anatomic information for segmenting of MRIs into different tissue classes, especially GM and WM. It starts by partitioning the image into different clusters using fuzzy k-means clustering. The centers of these clusters are the input to the region growing (SRG method for creating the closed regions. The outputs of SRG technique are fed to sensitivity and specificity algorithm to merge the similar regions in one segment. The proposed algorithm is applied to challenging applications: gray matter/white matter segmentation in magnetic resonance image (MRI datasets. The experimental results show that the proposed technique produces accurate and stable results.

  12. Fiber-wireless integrated mobile backhaul network based on a hybrid millimeter-wave and free-space-optics architecture with an adaptive diversity combining technique.

    Science.gov (United States)

    Zhang, Junwen; Wang, Jing; Xu, Yuming; Xu, Mu; Lu, Feng; Cheng, Lin; Yu, Jianjun; Chang, Gee-Kung

    2016-05-01

    We propose and experimentally demonstrate a novel fiber-wireless integrated mobile backhaul network based on a hybrid millimeter-wave (MMW) and free-space-optics (FSO) architecture using an adaptive combining technique. Both 60 GHz MMW and FSO links are demonstrated and fully integrated with optical fibers in a scalable and cost-effective backhaul system setup. Joint signal processing with an adaptive diversity combining technique (ADCT) is utilized at the receiver side based on a maximum ratio combining algorithm. Mobile backhaul transportation of 4-Gb/s 16 quadrature amplitude modulation frequency-division multiplexing (QAM-OFDM) data is experimentally demonstrated and tested under various weather conditions synthesized in the lab. Performance improvement in terms of reduced error vector magnitude (EVM) and enhanced link reliability are validated under fog, rain, and turbulence conditions.

  13. The Hybrid Programming Technique Of Calling MATLAB Library Functions From Visual C++%Visual C++调用MATLAB函数库的混合编程技术

    Institute of Scientific and Technical Information of China (English)

    徐治

    2015-01-01

    The Visual C++ and MATLAB hybrid programming technique uses VC++ as the powerful software development tool, and directly calls the immense MATLAB algorithm function library while implementing a sophisti-cated algorithm. This approach can achieve the complementation of merits and greatly reduce the coding time of so-phisticated algorithm. This paper introduces the principle of hybrid programming, then details the MATLAB compiler based techniques of coding and project configuration which calls MATLAB function library from VC++.%Visual C++与MATLAB的混合编程技术是以VC++作为强有力的软件开发工具,而在实现复杂算法时则直接调用MATLAB涵盖很广的算法函数库。这种方式可以做到优势互补,大大减少复杂算法的编码时间。本文介绍了混合编程的基本原理,并详细介绍了基于MATLAB编译器的VC++调用MATLAB函数库的代码编写及项目配置等方面的技术。

  14. Hybrid Brain–Computer Interface Techniques for Improved Classification Accuracy and Increased Number of Commands: A Review

    Directory of Open Access Journals (Sweden)

    Keum-Shik Hong

    2017-07-01

    Full Text Available In this article, non-invasive hybrid brain–computer interface (hBCI technologies for improving classification accuracy and increasing the number of commands are reviewed. Hybridization combining more than two modalities is a new trend in brain imaging and prosthesis control. Electroencephalography (EEG, due to its easy use and fast temporal resolution, is most widely utilized in combination with other brain/non-brain signal acquisition modalities, for instance, functional near infrared spectroscopy (fNIRS, electromyography (EMG, electrooculography (EOG, and eye tracker. Three main purposes of hybridization are to increase the number of control commands, improve classification accuracy and reduce the signal detection time. Currently, such combinations of EEG + fNIRS and EEG + EOG are most commonly employed. Four principal components (i.e., hardware, paradigm, classifiers, and features relevant to accuracy improvement are discussed. In the case of brain signals, motor imagination/movement tasks are combined with cognitive tasks to increase active brain–computer interface (BCI accuracy. Active and reactive tasks sometimes are combined: motor imagination with steady-state evoked visual potentials (SSVEP and motor imagination with P300. In the case of reactive tasks, SSVEP is most widely combined with P300 to increase the number of commands. Passive BCIs, however, are rare. After discussing the hardware and strategies involved in the development of hBCI, the second part examines the approaches used to increase the number of control commands and to enhance classification accuracy. The future prospects and the extension of hBCI in real-time applications for daily life scenarios are provided.

  15. Artifact reduction in multichannel pervasive EEG using hybrid WPT-ICA and WPT-EMD signal decomposition techniques

    CERN Document Server

    Bono, Valentina; Das, Saptarshi; Maharatna, Koushik

    2014-01-01

    In order to reduce the muscle artifacts in multi-channel pervasive Electroencephalogram (EEG) signals, we here propose and compare two hybrid algorithms by combining the concept of wavelet packet transform (WPT), empirical mode decomposition (EMD) and Independent Component Analysis (ICA). The signal cleaning performances of WPT-EMD and WPT-ICA algorithms have been compared using a signal-to-noise ratio (SNR)-like criterion for artifacts. The algorithms have been tested on multiple trials of four different artifact cases viz. eye-blinking and muscle artifacts including left and right hand movement and head-shaking.

  16. Isolation of EF1gamma from calli regenerating SSH library in Maize (Zea mays).

    Science.gov (United States)

    Xia, Y L; Ding, J; Zhang, Z M; Rong, T Z; Shi, L Y; Pan, G T

    2007-12-01

    18599Hong, a good Maize (Zea mays) inbred line as well as good transformation acceptor with high regeneration capacity, was used for isolating embryonic callus regeneration genes. Subtractive library was constructed by Suppression subtractive hybridization and screened by Reverse Northern Hybridization. The clones of No. 27 was randomly picked to sequence. NCBI blastx results showed the similarity to elongation factor 1gamma in rice.

  17. Hybrid-Thresholding based Image Super-Resolution Technique by the use of Triplet Half-Band Wavelets

    Science.gov (United States)

    Chopade, Pravin B.; Rahulkar, Amol D.; Patil, Pradeep M.

    2016-12-01

    This paper presents a modified image super-resolution scheme based on the wavelet coefficients hybrid-thresholding by the use of triplet half-band wavelets (THW) derived from the generalized half-band polynomial. At first, discrete wavelet transform (DWT) is obtained from triplet half-band kernels and it applied on the low-resolution image to obtain the high frequency sub-bands. These high frequency sub-bands and the original low-resolution image are interpolated to enhance the resolution. Second, stationary wavelet transform is obtained by using THW, which is employed to minimize the loss due to the use of DWT. In addition, hybrid thresholding scheme on wavelet coefficients scheme is proposed on these estimated high-frequency sub-bands in order to reduce the spatial domain noise. These sub-bands are combined together by inverse discrete wavelet transform obtained from THW to generate a high-resolution image. The proposed approach is validated by comparing the quality metrics with existing filter banks and well-known super-resolution scheme.

  18. An enhanced security solution for electronic medical records based on AES hybrid technique with SOAP/XML and SHA-1.

    Science.gov (United States)

    Kiah, M L Mat; Nabi, Mohamed S; Zaidan, B B; Zaidan, A A

    2013-10-01

    This study aims to provide security solutions for implementing electronic medical records (EMRs). E-Health organizations could utilize the proposed method and implement recommended solutions in medical/health systems. Majority of the required security features of EMRs were noted. The methods used were tested against each of these security features. In implementing the system, the combination that satisfied all of the security features of EMRs was selected. Secure implementation and management of EMRs facilitate the safeguarding of the confidentiality, integrity, and availability of e-health organization systems. Health practitioners, patients, and visitors can use the information system facilities safely and with confidence anytime and anywhere. After critically reviewing security and data transmission methods, a new hybrid method was proposed to be implemented on EMR systems. This method will enhance the robustness, security, and integration of EMR systems. The hybrid of simple object access protocol/extensible markup language (XML) with advanced encryption standard and secure hash algorithm version 1 has achieved the security requirements of an EMR system with the capability of integrating with other systems through the design of XML messages.

  19. Implementing a Novel Hybrid Maximum Power Point Tracking Technique in DSP via Simulink/MATLAB under Partially Shaded Conditions

    Directory of Open Access Journals (Sweden)

    Shahrooz Hajighorbani

    2016-01-01

    Full Text Available This paper presents a hybrid maximum power point tracking (MPPT method to detect the global maximum power point (GMPP under partially shaded conditions (PSCs, which have more complex characteristics with multiple peak power points. The hybrid method can track the GMPP when a partial shadow occurs either before or after acquiring the MPP under uniform conditions. When PS occurs after obtaining the MPP during uniform conditions, the new operating point should be specified by the modified linear function, which reduces the searching zone of the GMPP and has a significant effect on reducing the reaching time of the GMPP. Simultaneously, the possible MPPs are scanned and stored when shifting the operating point to a new reference voltage. Finally, after determining the possible location of the GMPP, the GMPP is obtained using the modified P&O. Conversely, when PS occurs before obtaining the MPP, the referenced MPP should be specified. Thus, after recognizing the possible location of the GMPP, the modified P&O can be used to obtain the GMPP. The simulation and experimental implementations for the proposed algorithm are performed with different scenarios of shadowing under different irradiations, which clearly indicate that the proposed method is robust and has a fast tracking speed. Moreover, this work presents the load sizing method for PSCs to avoid controller failure when detecting the GMPP. Additionally, in this paper, the user-friendly method for programming the digital signal processing (DSP via Simulink/MATLAB is presented in detail.

  20. Tle Triangulation Campaign by Japanese High School Students as a Space Educational Project of the Ssh Consortium Kochi

    Science.gov (United States)

    Yamamoto, Masa-Yuki; Okamoto, Sumito; Miyoshi, Terunori; Takamura, Yuzaburo; Aoshima, Akira; Hinokuchi, Jin

    As one of the space educational projects in Japan, a triangulation observation project of TLE (Transient Luminous Events: sprites, elves, blue-jets, etc.) has been carried out since 2006 in collaboration between 29 Super Science High-schools (SSH) and Kochi University of Technol-ogy (KUT). Following with previous success of sprite observations by "Astro High-school" since 2004, the SSH consortium Kochi was established as a national space educational project sup-ported by Japan Science and Technology Agency (JST). High-sensitivity CCD camera (Watec, Neptune-100) with 6 mm F/1.4 C-mount lens (Fujinon) and motion-detective software (UFO-Capture, SonotaCo) were given to each participating team in order to monitor Northern night sky of Japan with almost full-coverage. During each school year (from April to March in Japan) since 2006, thousands of TLE images were taken by many student teams, with considerably large numbers of successful triangulations, i.e., (School year, Numbers of TLE observations, Numbers of triangulations) are (2006, 43, 3), (2007, 441, 95), (2008, 734, 115), and (2009, 337, 78). Note that, school year in Japan begins on April 1 and ends on March 31. The observation campaign began in December 2006, numbers are as of Feb. 28, 2010. Recently, some high schools started wide field observations using multiple cameras, and others started VLF observations using handmade loop antennae and amplifiers. Infomation exchange among the SSH consortium Kochi is frequently communicated with scientific discussion via KUT's mailing lists. Also, interactions with amateur observers in Japan are made through an internet forum of "SonotaCo Network Japan" (http://sonotaco.jp). Not only as an educational project but also as a scientific one, the project is also in success. In February 2008, simultaneous observations of Elves were obtained, in November 2009 a Giant "Graft-shaped" Sprites driven by Jets was clearly imaged with VLF signals. Most recently, ob-servations of Elves

  1. Thermal conductivity prediction of nanoscale phononic crystal slabs using a hybrid lattice dynamics-continuum mechanics technique

    Directory of Open Access Journals (Sweden)

    Charles M. Reinke

    2011-12-01

    Full Text Available Recent work has demonstrated that nanostructuring of a semiconductor material to form a phononic crystal (PnC can significantly reduce its thermal conductivity. In this paper, we present a classical method that combines atomic-level information with the application of Bloch theory at the continuum level for the prediction of the thermal conductivity of finite-thickness PnCs with unit cells sized in the micron scale. Lattice dynamics calculations are done at the bulk material level, and the plane-wave expansion method is implemented at the macrosale PnC unit cell level. The combination of the lattice dynamics-based and continuum mechanics-based dispersion information is then used in the Callaway-Holland model to calculate the thermal transport properties of the PnC. We demonstrate that this hybrid approach provides both accurate and efficient predictions of the thermal conductivity.

  2. Thermal conductivity prediction of nanoscale phononic crystal slabs using a hybrid lattice dynamics-continuum mechanics technique

    Science.gov (United States)

    Reinke, Charles M.; Su, Mehmet F.; Davis, Bruce L.; Kim, Bongsang; Hussein, Mahmoud I.; Leseman, Zayd C.; Olsson-III, Roy H.; El-Kady, Ihab

    2011-12-01

    Recent work has demonstrated that nanostructuring of a semiconductor material to form a phononic crystal (PnC) can significantly reduce its thermal conductivity. In this paper, we present a classical method that combines atomic-level information with the application of Bloch theory at the continuum level for the prediction of the thermal conductivity of finite-thickness PnCs with unit cells sized in the micron scale. Lattice dynamics calculations are done at the bulk material level, and the plane-wave expansion method is implemented at the macrosale PnC unit cell level. The combination of the lattice dynamics-based and continuum mechanics-based dispersion information is then used in the Callaway-Holland model to calculate the thermal transport properties of the PnC. We demonstrate that this hybrid approach provides both accurate and efficient predictions of the thermal conductivity.

  3. 基于SSH架构的语文教学系统设计%Design of Chinese Teaching System On the basis of SSH Framework

    Institute of Scientific and Technical Information of China (English)

    刘志军

    2012-01-01

    提出基于SSH(Struts+Spring+Hibernate)架构构建语文教学系统,设计了SSH架构Web系统分层设计方案及执行流程.利用MyEclipse平台实现了语文教学平台的软件开发过程,证明了方案的可行性.SSH架构方案具有可扩展性、可维护性和可重用性.%A Chinese teaching system has been proposed based on SSH framework. A hierarchical design and the operating process of Web system of SSH ( Struts + Spring + Hibernate) framework has been designed. The development project of the Chinese teaching system is achieved on the MyEclipse. The SSH framework project is characterized by its feasibility, extensibility, maintainability and reusability.

  4. The characteristics of novel bimodal Ag-TiO2 nanoparticles generated by hybrid laser-ultrasonic technique

    Science.gov (United States)

    Hamad, Abubaker; Li, Lin; Liu, Zhu; Zhong, Xiang Li; Burke, Grace; Wang, Tao

    2016-04-01

    Silver-titania (Ag-TiO2) nanoparticles with smaller Ag nanoparticles attached to larger TiO2 nanoparticles were generated by hybrid ultrasonic vibration and picosecond laser ablation of Ag and Ti bulk targets in deionised water, for the first time. The laser has a wavelength of 1064 nm and a pulse duration of 10 ps. It was observed that without the ultrasonic vibration, Ag and TiO2 nanoparticles did not combine, thus the role of ultrasonic vibration is essential. In addition, colloidal TiO2 and Ag nanoparticles were generated separately for comparison under the same laser beam characteristics and process conditions. The absorption spectra of colloidal Ag-TiO2 cluster nanoparticles were examined by UV-Vis spectroscopy, and size distribution was characterised using transmission electron microscopy. The morphology and composition of Ag-TiO2 nanoparticles were examined using scanning transmission electron microscopy in high-angle annular dark field, and energy-dispersive X-ray spectroscopy. The crystalline structures were investigated by X-ray diffraction. The size of larger TiO2 particles was in the range 30-150 nm, and the smaller-sized Ag nanoparticles attached to the TiO2 was mainly in the range of 10-15 nm. The yield is more than 50 % with the remaining nanoparticles in the form of uncombined Ag and TiO2. The nanoparticles generated had strong antibacterial effects as tested against E. coli. A discussion is given on the role of ultrasonic vibration in the formation of Ag-TiO2 hybrid nanoparticles by picosecond laser ablation.

  5. 基于 SSH 框架的高校学生出勤考核管理系统%Management System of Students Attendance Assessment Based on SSH Framework

    Institute of Scientific and Technical Information of China (English)

    张亚娟; 刘寒冰

    2015-01-01

    现有的学生出勤考核系统由于操作较复杂,响应时间长,并且不能对未出勤现象进行申诉,应用情况并不理想。该文提出基于 SSH 框架设计学生上机考勤系统,让学生通过在线完成实验课的考勤,老师可以集中查看学生的出勤情况,并对未正常出勤的学生进行申诉处理。结果表明,该系统操作简单、签到时间短,极大地减轻了老师的工作量。%The existing student attendance assessment system had many poor characteristics,such as complex operation,long period response,and it can't complain when student can't attend class.Student attendance assessment system based on SSH framework can easily assess students’daily attendance in experiment class and help teachers to check students’attendance and punish students that do not attend class.The results show that it is simple to operate,short to check in time and thus reduces workload of student commis-sioner.

  6. Investigation of kinetics and thermodynamics of DNA hybridization by means of 2-D fluorescence spectroscopy and soft/hard modeling techniques.

    Science.gov (United States)

    Ebrahimi, Sara; Kompany-Zareh, Mohsen

    2016-02-01

    Reversible hybridization reaction plays a key role in fundamental biological processes, in many laboratory techniques, and also in DNA based sensing devices. Comprehensive investigation of this process is, therefore, essential for the development of more sophisticated applications. Kinetics and thermodynamics of the hybridization reaction, as a second order process, are systematically investigated with the aid of the soft and hard chemometric methods. Labeling two complementary 21 mer DNA single strands with FAM and Texas red fluorophores, enabled recording of the florescence excitation-emission matrices during the experiments which led to three-way data sets. The presence of fluorescence resonance energy transfer in excitation and emission modes and the closure in concentration mode, made the three-way data arrays rank deficient. To acquire primary chemical information, restricted Tucker3 as a soft method was employed. Herein a model-based method, hard restricted trilinear decomposition, is introduced for in depth analysis of rank deficient three-way data sets. By employing proposed hard method, the nonlinear model parameters as well as the correct profiles could be estimated. In addition, a simple constraint is presented to extract chemically reasonable output profiles regarding the core elements of restricted Tucker3 model.

  7. Differentially expressed genes of virulent and nonvirulent Entamoeba histolytica strains identified by suppression subtractive hybridization.

    Science.gov (United States)

    Freitas, Michelle A R; Alvarenga, Ângela C; Fernandes, Helen C; Gil, Frederico F; Melo, Maria N; Pesquero, Jorge L; Gomes, Maria A

    2014-01-01

    Entamoeba histolytica is a parasite which presents capacity to degrade tissues and therefore has a pathogenic behavior. As this behavior is not shown by all strains, there have been several studies investigating molecular basis of the cytotoxicity process. Using the suppression subtractive hybridization (SSH) technique, differential gene expressions of two E. histolytica strains, one virulent (EGG) and one nonvirulent (452), have been analyzed with the purpose of isolating genes which may be involved with amoebic virulence. Nine cDNA fragments presenting high homology with E. histolytica previously sequenced genes were subtracted. Of these, four genes were confirmed by RT-PCR. Two coding for hypothetical proteins, one for a cysteine-rich protein, expressed only in the virulent strain, EGG and another one, coding for grainin 2 protein, exclusive from 452 strain. This study provided new insight into the proteins differences in the virulent and nonvirulent E. histolytica strains. We believe that further studies with these proteins may prove association of them with tissue damage, providing new perceptions to improve treatment or diagnosis of the invasive disease.

  8. Differentially Expressed Genes of Virulent and Nonvirulent Entamoeba histolytica Strains Identified by Suppression Subtractive Hybridization

    Directory of Open Access Journals (Sweden)

    Michelle A. R. Freitas

    2014-01-01

    Full Text Available Entamoeba histolytica is a parasite which presents capacity to degrade tissues and therefore has a pathogenic behavior. As this behavior is not shown by all strains, there have been several studies investigating molecular basis of the cytotoxicity process. Using the suppression subtractive hybridization (SSH technique, differential gene expressions of two E. histolytica strains, one virulent (EGG and one nonvirulent (452, have been analyzed with the purpose of isolating genes which may be involved with amoebic virulence. Nine cDNA fragments presenting high homology with E. histolytica previously sequenced genes were subtracted. Of these, four genes were confirmed by RT-PCR. Two coding for hypothetical proteins, one for a cysteine-rich protein, expressed only in the virulent strain, EGG and another one, coding for grainin 2 protein, exclusive from 452 strain. This study provided new insight into the proteins differences in the virulent and nonvirulent E. histolytica strains. We believe that further studies with these proteins may prove association of them with tissue damage, providing new perceptions to improve treatment or diagnosis of the invasive disease.

  9. Photoelastic Stress Analysis by Use of Hybrid Technique and Fringe Phase Shifting Method%利用混合法和相移技术的光弹性应力分析

    Institute of Scientific and Technical Information of China (English)

    白泰铉

    2006-01-01

    Photoelastic fringe patterns for stress analysis are investigated by use of hybrid technique and fringe phase shift method. The first one is a hybrid method which combines the conformal mapping technique and measured data away from the edge of a geometric discontinuity. Photoelastic data are hybridized with complex variable/mapping techniques to calculate photoelastic stress-field around a circular hole or an elliptical hole in plates under uniaxial tensile loading. This method determines full-field stresses in perforated finite tensile plates containing either a circular or an elliptical hole. The second one is a fringe phase shift method to separate isochromatics and isoclinics from photoelastic fringes of a circular disk under diametric compression by use of phase shift method. Digitally determined isochromatics and isoclinics are agreed well with those of manual measurements.

  10. Progress on Application of Yeast Two-hybrid Technique%酵母双杂交技术应用进展

    Institute of Scientific and Technical Information of China (English)

    王婷; 葛怀娜; 郭宏

    2015-01-01

    Yeast two-hybrid system is one of the most powerful and widely used method to detect protein-protein interaction in living cells.Yeast two-hybrid technique is cost-effective, easy to operate, can reach the whole-genome level, and identify the interaction between different varieties.Compared with the traditional detected method, it has obvious advantages and has been applied in more and more fields.In this paper, the yeast two-hybrid technology principle and application were reviewed, including the applications on discovering new protein and proteins’new function, setting up the protein linkage map, studing of human genome DNA library, screening target for drug, and so on.The paper was expected to provide reference for the application of yeast two-hybrid system.%酵母双杂交技术是鉴定蛋白互作最有效和最广泛的分子生物学技术。该技术能直接作用于活细胞,检测细胞内蛋白质互作,具有成本低、易操作、可达到全基因组水平、能进行品种间的互作鉴定等诸多优点。较之传统的检测方法有明显优势,已在越来越多的领域得到应用。对酵母双杂交的技术原理以及应用进行了综述,介绍了该技术在发现新蛋白质、探究蛋白质功能、建立基因组蛋白连锁图、研究人类DNA文库和筛选药物作用位点等方面的重要应用,以期为该技术的广泛应用提供参考。

  11. Realization of MMI Power Splitter by UV-light Imprinting Technique Using Hybrid Sol-Gel SiO2 Materials

    Institute of Scientific and Technical Information of China (English)

    WANG Yue; WU Yuan-Da; LI Jian-Guang; WANG Hong-Jie; HU Xiong-Wei

    2008-01-01

    An efficient fabrication scheme of buried ridge, waveguide devices is demonstrated by UV-light imprinting technique using organic-inorganic hybrid sol-gel Zr-doped SiO2 materials. The refractive indices of a guiding layer and a cladding layer for the buried ridge waveguide structure are 1.537 and 1.492 measured at 1550nm, respectively. The tested results show more circular mode profiles due to existence of the cladding layer. A buried ridge single-mode waveguide operating at 1550nm has a low propagation loss (O.088 dB/cm) and the 1 × 2 MMI power splitter exhibits uniform outputs, with a very low splitting loss of O.029dB at 1549nm.

  12. The rate parameters for coupled vibration-dissociation in a generalized SSH approximation. [Schwarz, Slawsky, and Herzfeld

    Science.gov (United States)

    Sharma, Surendra P.; Huo, Winifred M.; Park, Chul

    1988-01-01

    A theoretical study of vibrational excitations and dissociations of nitrogen undergoing a nonequilibrium relaxation process upon heating and cooling is reported. The rate coefficients for collisional induced vibrational transitions and transitions from a bound vibrational state into a dissociative state have been calculated using an extension of the theory originally proposed by Schwarz (SSH) et al. (1952). High-lying vibrational states and dissociative states were explicitly included but rotational energy transfer was neglected. The transition probabilities calculated from the SSH theory were fed into the master equation, which was integrated numerically to determine the population distribution of the vibrational states as well as bulk thermodynamic properties. The results show that: (1) the transition rates have a minimum near the middle of the bound vibrational levels, causing a bottleneck in the vibrational relaxation and dissociation rates; (2) high vibrational states are always in equilibrium with the dissociative state; (3) for the heating case, only the low vibrational states relax according to the Landau-Teller theory; (4) for the cooling case, vibrational relaxation cannot be described by a rate equation; (5) Park's (1985, 1988) two-temperature model is approximately valid; and (6) the average vibrational energy removed in dissociation is about 30 percent of the dissociation energy.

  13. Identification of sennoside A as a novel inhibitor of the slingshot (SSH) family proteins related to cancer metastasis.

    Science.gov (United States)

    Lee, Seon Young; Kim, Wooil; Lee, Young Geun; Kang, Hyo Jin; Lee, Sang-Hyun; Park, Sun Young; Min, Jeong-Ki; Lee, Sang-Rae; Chung, Sang J

    2017-03-06

    Phospho-cofilin (p-cofilin), which has a phosphate group on Ser-3, is involved in actin polymerization. Its dephosphorylated form promotes filopodia formation and cell migration by enhancing actin depolymerization. Protein phosphatase slingshot homologs (SSHs), known as dual-specificity phosphatases, catalyze hydrolytic removal of the Ser-3 phosphate group from phospho-cofilin. Aberrant SSH activity results in cancer metastasis, implicating SSHs as potential therapeutic targets for cancer metastasis. In this study, we screened 658 natural products purified from traditional oriental medicinal plants to identify three potent SSH inhibitors with submicromolar or single-digit micromolar Ki values: gossypol, hypericin, and sennoside A. The three compounds were purified from cottonseed, Saint John's wort, and rhubarb, respectively. Sennoside A markedly increased cofilin phosphorylation in pancreatic cancer cells, leading to impaired actin dynamics in pancreatic cancer cells with or without EGF stimulation and reduced motility and invasiveness in vitro and in vivo. Collaboratively, these results demonstrate that sennoside A is a novel inhibitor of SSHs and suggest that it may be valuable in the development of pharmaceutical drugs for treating cancer metastasis.

  14. Crude oil price forecasting based on hybridizing wavelet multiple linear regression model, particle swarm optimization techniques, and principal component analysis.

    Science.gov (United States)

    Shabri, Ani; Samsudin, Ruhaidah

    2014-01-01

    Crude oil prices do play significant role in the global economy and are a key input into option pricing formulas, portfolio allocation, and risk measurement. In this paper, a hybrid model integrating wavelet and multiple linear regressions (MLR) is proposed for crude oil price forecasting. In this model, Mallat wavelet transform is first selected to decompose an original time series into several subseries with different scale. Then, the principal component analysis (PCA) is used in processing subseries data in MLR for crude oil price forecasting. The particle swarm optimization (PSO) is used to adopt the optimal parameters of the MLR model. To assess the effectiveness of this model, daily crude oil market, West Texas Intermediate (WTI), has been used as the case study. Time series prediction capability performance of the WMLR model is compared with the MLR, ARIMA, and GARCH models using various statistics measures. The experimental results show that the proposed model outperforms the individual models in forecasting of the crude oil prices series.

  15. Prediction of peak ground acceleration of Iran’s tectonic regions using a hybrid soft computing technique

    Institute of Scientific and Technical Information of China (English)

    Mostafa Gandomi; Mohsen Soltanpour; Mohammad R. Zolfaghari; Amir H. Gandomi

    2016-01-01

    A new model is derived to predict the peak ground acceleration (PGA) utilizing a hybrid method coupling artificial neural network (ANN) and simulated annealing (SA), called SA-ANN. The proposed model re-lates PGA to earthquake source to site distance, earthquake magnitude, average shear-wave velocity, faulting mechanisms, and focal depth. A database of strong ground-motion recordings of 36 earthquakes, which happened in Iran’s tectonic regions, is used to establish the model. For more validity verification, the SA-ANN model is employed to predict the PGA of a part of the database beyond the training data domain. The proposed SA-ANN model is compared with the simple ANN in addition to 10 well-known models proposed in the literature. The proposed model performance is superior to the single ANN and other existing attenuation models. The SA-ANN model is highly correlated to the actual records (R ¼ 0.835 and r ¼ 0.0908) and it is subsequently converted into a tractable design equation.

  16. Crude Oil Price Forecasting Based on Hybridizing Wavelet Multiple Linear Regression Model, Particle Swarm Optimization Techniques, and Principal Component Analysis

    Directory of Open Access Journals (Sweden)

    Ani Shabri

    2014-01-01

    Full Text Available Crude oil prices do play significant role in the global economy and are a key input into option pricing formulas, portfolio allocation, and risk measurement. In this paper, a hybrid model integrating wavelet and multiple linear regressions (MLR is proposed for crude oil price forecasting. In this model, Mallat wavelet transform is first selected to decompose an original time series into several subseries with different scale. Then, the principal component analysis (PCA is used in processing subseries data in MLR for crude oil price forecasting. The particle swarm optimization (PSO is used to adopt the optimal parameters of the MLR model. To assess the effectiveness of this model, daily crude oil market, West Texas Intermediate (WTI, has been used as the case study. Time series prediction capability performance of the WMLR model is compared with the MLR, ARIMA, and GARCH models using various statistics measures. The experimental results show that the proposed model outperforms the individual models in forecasting of the crude oil prices series.

  17. Analysis of High Yield and Efficiency Technique in Hybrid Rice Zhongzheyou No.1%杂交水稻中浙优1号高产高效技术途径分析

    Institute of Scientific and Technical Information of China (English)

    刘伟明

    2009-01-01

    To understand the high yield and efficiency technique in hybrid rice Zhongzheyou No.1, we conducted the correlation analysis, regression analysis and path analysis of hybrid rice Zhongzheyou No.1 based on the data of its ear, grain and weight at different yield levels. From this study, we put forward the high yield and efficiency technique in Zhongzheyou No.1: on the basis of certain effective ear number, filled grains per ear should be mainly targeted with a consideration to 1 000-grain weight.

  18. A hybrid color space for skin detection using genetic algorithm heuristic search and principal component analysis technique.

    Directory of Open Access Journals (Sweden)

    Mahdi Maktabdar Oghaz

    Full Text Available Color is one of the most prominent features of an image and used in many skin and face detection applications. Color space transformation is widely used by researchers to improve face and skin detection performance. Despite the substantial research efforts in this area, choosing a proper color space in terms of skin and face classification performance which can address issues like illumination variations, various camera characteristics and diversity in skin color tones has remained an open issue. This research proposes a new three-dimensional hybrid color space termed SKN by employing the Genetic Algorithm heuristic and Principal Component Analysis to find the optimal representation of human skin color in over seventeen existing color spaces. Genetic Algorithm heuristic is used to find the optimal color component combination setup in terms of skin detection accuracy while the Principal Component Analysis projects the optimal Genetic Algorithm solution to a less complex dimension. Pixel wise skin detection was used to evaluate the performance of the proposed color space. We have employed four classifiers including Random Forest, Naïve Bayes, Support Vector Machine and Multilayer Perceptron in order to generate the human skin color predictive model. The proposed color space was compared to some existing color spaces and shows superior results in terms of pixel-wise skin detection accuracy. Experimental results show that by using Random Forest classifier, the proposed SKN color space obtained an average F-score and True Positive Rate of 0.953 and False Positive Rate of 0.0482 which outperformed the existing color spaces in terms of pixel wise skin detection accuracy. The results also indicate that among the classifiers used in this study, Random Forest is the most suitable classifier for pixel wise skin detection applications.

  19. A hybrid color space for skin detection using genetic algorithm heuristic search and principal component analysis technique.

    Science.gov (United States)

    Maktabdar Oghaz, Mahdi; Maarof, Mohd Aizaini; Zainal, Anazida; Rohani, Mohd Foad; Yaghoubyan, S Hadi

    2015-01-01

    Color is one of the most prominent features of an image and used in many skin and face detection applications. Color space transformation is widely used by researchers to improve face and skin detection performance. Despite the substantial research efforts in this area, choosing a proper color space in terms of skin and face classification performance which can address issues like illumination variations, various camera characteristics and diversity in skin color tones has remained an open issue. This research proposes a new three-dimensional hybrid color space termed SKN by employing the Genetic Algorithm heuristic and Principal Component Analysis to find the optimal representation of human skin color in over seventeen existing color spaces. Genetic Algorithm heuristic is used to find the optimal color component combination setup in terms of skin detection accuracy while the Principal Component Analysis projects the optimal Genetic Algorithm solution to a less complex dimension. Pixel wise skin detection was used to evaluate the performance of the proposed color space. We have employed four classifiers including Random Forest, Naïve Bayes, Support Vector Machine and Multilayer Perceptron in order to generate the human skin color predictive model. The proposed color space was compared to some existing color spaces and shows superior results in terms of pixel-wise skin detection accuracy. Experimental results show that by using Random Forest classifier, the proposed SKN color space obtained an average F-score and True Positive Rate of 0.953 and False Positive Rate of 0.0482 which outperformed the existing color spaces in terms of pixel wise skin detection accuracy. The results also indicate that among the classifiers used in this study, Random Forest is the most suitable classifier for pixel wise skin detection applications.

  20. Variable weight Khazani-Syed code using hybrid fixed-dynamic technique for optical code division multiple access system

    Science.gov (United States)

    Anas, Siti Barirah Ahmad; Seyedzadeh, Saleh; Mokhtar, Makhfudzah; Sahbudin, Ratna Kalos Zakiah

    2016-10-01

    Future Internet consists of a wide spectrum of applications with different bit rates and quality of service (QoS) requirements. Prioritizing the services is essential to ensure that the delivery of information is at its best. Existing technologies have demonstrated how service differentiation techniques can be implemented in optical networks using data link and network layer operations. However, a physical layer approach can further improve system performance at a prescribed received signal quality by applying control at the bit level. This paper proposes a coding algorithm to support optical domain service differentiation using spectral amplitude coding techniques within an optical code division multiple access (OCDMA) scenario. A particular user or service has a varying weight applied to obtain the desired signal quality. The properties of the new code are compared with other OCDMA codes proposed for service differentiation. In addition, a mathematical model is developed for performance evaluation of the proposed code using two different detection techniques, namely direct decoding and complementary subtraction.

  1. A comparative analysis of different hybrid MCDM techniques considering a case of selection of 3D printers

    Directory of Open Access Journals (Sweden)

    Debapriyo Paul

    2015-07-01

    Full Text Available A multitude of techniques fall under the domain of Multi- Criteria Decision Making (MCDM which is used to select the best alternative among the available ones. The objective of this paper is to compare some of these techniques with respect to the problem of selection of 3D printers, which is associated with multiple attributes. The weights of the criteria were determined using analytical network process (ANP. Next, the alternatives were ranked using three different MCDM techniques- 1.TOPSIS which ranks alternatives having the shortest distance to the ideal solution as well as the greatest distance from the negative-ideal solution 2. Deng’s Similarity based Approach where the most preferred alternative should have the highest degree of similarity to the positive ideal solution and the lowest degree of similarity to the negative-ideal solution and 3.PROMETHEE and GAIA. The solutions for each of these three cases were analyzed thoroughly, and reasons for any deviations were discussed.

  2. A hybrid electron and photon IMRT planning technique that lowers normal tissue integral patient dose using standard hardware.

    Science.gov (United States)

    Rosca, Florin

    2012-06-01

    To present a mixed electron and photon IMRT planning technique using electron beams with an energy range of 6-22 MeV and standard hardware that minimizes integral dose to patients for targets as deep as 7.5 cm. Ten brain cases, two lung, a thyroid, an abdominal, and a parotid case were planned using two planning techniques: a photon-only IMRT (IMRT) versus a mixed modality treatment (E+IMRT) that includes an enface electron beam and a photon IMRT portion that ensures a uniform target coverage. The electron beam is delivered using a regular cutout placed in an electron cone. The electron energy was chosen to provide a good trade-off between minimizing integral dose and generating a uniform, deliverable plan. The authors choose electron energies that cover the deepest part of PTV with the 65%-70% isodose line. The normal tissue integral dose, the dose for ring structures around the PTV, and the volumes of the 75%, 50%, and 25% isosurfaces were used to compare the dose distributions generated by the two planning techniques. The normal tissue integral dose was lowered by about 20% by the E+IMRT plans compared to the photon-only IMRT ones for most studied cases. With the exception of lungs, the dose reduction associated to the E+IMRT plans was more pronounced further away from the target. The average dose ratio delivered to the 0-2 cm and the 2-4 cm ring structures for brain patients for the two planning techniques were 89.6% and 70.8%, respectively. The enhanced dose sparing away from the target for the brain patients can also be observed in the ratio of the 75%, 50%, and 25% isodose line volumes for the two techniques, which decreases from 85.5% to 72.6% and further to 65.1%, respectively. For lungs, the lateral electron beams used in the E+IMRT plans were perpendicular to the mostly anterior/posterior photon beams, generating much more conformal plans. The authors proved that even using the existing electron delivery hardware, a mixed electron/photon planning

  3. Isolation and identification of genes expressed differentially in rice inflorescence meristem with suppression subtractive hybridization

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A subtracted cDNA library of rice (Oryza sativa L.) inflorescence meristem (IM) was constructed using the sup-pression subtractive hybridization (SSH) method. The cDNAs of the rice shoot apical meristem (SAM) were used as "driver" and inflorescence meristem (IM) as "tester" in the experiment, respectively. Forty of 250 randomly chosen cDNA clones were identified by differential screening, which were IM-specific or IM-highly expressed. Most of the rice IM cDNAs cloned by SSH appear to represent rare transcripts, 40% of which were derived from truly differentially ex-pressed genes. Of all the forty sequenced cDNA inserts, eleven contain the regions with 60%-90% identity to their homolog in GenBank, eighteen are expected to be new genes, only two correspond to published rice genes.

  4. Modeling the structure and absorption spectra of stilbazolium merocyanine in polar and nonpolar solvents using hybrid QM/MM techniques.

    Science.gov (United States)

    Murugan, N Arul; Kongsted, Jacob; Rinkevicius, Zilvinas; Aidas, Kestutis; Ågren, Hans

    2010-10-28

    We have performed Car-Parrinello mixed quantum mechanics/molecular mechanics (CP-QM/MM) calculations for stilbazolium merocyanine (SM) in polar and nonpolar solvents in order to explore the role of solute molecular geometry, solvation shell structure, and different interaction mechanisms on the absorption spectra and its dependence on solvent polarity. On the basis of the average bond length values and group charge distributions, we find that the SM molecule remains in a neutral quinonoid form in chloroform (a nonpolar solvent) while it transforms to a charge-separated benzenoid form in water (a polar solvent). Based on a quantum mechanical/molecular mechanical response technique, with different MM descriptions for the water environment, absorption spectra were obtained as averages over configurations derived from the CP-QM/MM simulations. We show that for SM in water the solute polarization plays a major role in predictions of the λ(max) and solvatochromic shift and that once this effect is included the contributions from solvent polarization and intermolecular charge transfer become less important. For SM in chloroform and water solvents, we have also performed absorption spectra calculations using a polarizable continuum model in order to address its relative performance compared to the QM/MM response technique. In the case of SM in water, our study supports the notion that, in order to predict accurate absorption spectra and solvatochromic shifts, it is important to use a discrete description of the solvent when it, as in water, is involved in site-specific interaction with the solute molecule. The technique is thus shown to outperform the more conventional polarizable continuum model in predicting the solvatochromic shift.

  5. Coral record of southeast Indian Ocean SST, SSH and salinity and their modulation by ENSO and the Western Pacific temperature gradient

    Science.gov (United States)

    Zinke, Jens; Hoell, Andrew; Lough, Janice M.; Feng, Ming; McCulloch, Malcolm T.

    2016-04-01

    Variability of southeastern Indian Ocean (SEIO) sea surface temperatures (SST), sea surface height (SSH) and salinities off Western Australia is a footprint of interannual and decadal climate variations in the tropical Indo-Pacific. La Niña events often result in a strengthened Leeuwin Current, high coastal sea levels, low salinities and unusually warm SSTs, now termed Ningaloo Niño events. The long-term teleconnections of the southeastern Indian Ocean (SEIO) with ENSO and the West Pacific Warm Pool are poorly understood. Here we demonstrate the role of Indo-Pacific coupling in modulating SST, SSH and salinity in the poorly studied SEIO, through a robust 215 year (1795-2010) geochemical coral proxy sea surface temperature (SST), SSH and salinity record. We show that higher SST and SSH accompanied by lower salinities in the SEIO are linked to the behaviour of ENSO and the Western Pacific Warm Pool on decadal to centennial timescales, and are most pronounced when an anomalously strong zonal SST gradient between the western and central Pacific co-occurs with strong La Niña's. Better understanding of the interplay between the zonal SST gradient in the western Pacific, ENSO phase and intrinsic Indian Ocean variability is expected to improve our ability to better predict unusual marine heat waves, sea level surges and important consequences for marine socio-ecological systems in the Future.

  6. A supersulfated low-molecular-weight heparin (IK-SSH) increases plasma levels of free and total tissue factor pathway inhibitor after intravenous and subcutaneous administration in humans.

    Science.gov (United States)

    Kaiser, B; Glusa, E; Hoppensteadt, D A; Breddin, H K; Amiral, J; Fareed, J

    1998-09-01

    Unfractionated as well as low-molecular-weight heparins (LMWH) are known to cause an increase in blood levels of tissue factor pathway inhibitor (TFPI). To study the effect of a newly developed supersulfated LMWH (IK-SSH, Iketon Farmaceutici) on TFPI concentrations in human plasma, the compound was injected into volunteers at doses of 0.14, 0.33 and 0.66 mg/kg intravenously or 0.33, 0.66 and 1.0 mg/kg subcutaneously. At certain known times blood was drawn and plasma levels of both total and free TFPI were measured using enzyme-linked immunosorbent assay methodology. Baseline plasma concentrations of TFPI were 72.2+/-3.1 ng/ml for total and 10.8+/-0.8 ng/ml for free TFPI. Intravenous or subcutaneous injection of IK-SSH led to a strong and long-lasting rise in TFPI levels which were increased more than 5-fold for total TFPI and more than 30-fold for free TFPI. Maximum TFPI levels were reached 5-10 min after intravenous and 60 min after subcutaneous administration. IK-SSH caused prolongation of ex-vivo clotting times in the APTT and Heptest assay, whereas thrombin time was not affected. Anticoagulant actions of IK-SSH showed a significant correlation to plasma concentrations of TFPI and they are thought to be based at least partially on the release of TFPI from vascular sites.

  7. Validation of a low-dose hybrid RSA and fluoroscopy technique: Determination of accuracy, bias and precision.

    Science.gov (United States)

    Ioppolo, James; Börlin, Niclas; Bragdon, Charles; Li, Mingguo; Price, Roger; Wood, David; Malchau, Henrik; Nivbrant, Bo

    2007-01-01

    Analyzing skeletal kinematics with radiostereometric analysis (RSA) following corrective orthopedic surgery allows the quantitative comparison of different implant designs. The purpose of this study was to validate a technique for dynamically estimating the relative position and orientation of skeletal segments using RSA and single plane X-ray fluoroscopy. Two micrometer-based in vitro phantom models of the skeletal segments in the hip and knee joints were used. The spatial positions of tantalum markers that were implanted into each skeletal segment were reconstructed using RSA. The position and orientation of each segment were determined in fluoroscopy images by minimizing the difference between the markers measured and projected in the image plane. Accuracy was determined in terms of bias and precision by analyzing the deviation between the applied displacement protocol and measured pose estimates. Measured translational accuracy was less than 100 microm parallel to the image plane and less than 700 microm in the direction orthogonal to the image plane. The measured rotational error was less than 1 degrees . Measured translational and rotational bias was not statistically significant at the 95% level of confidence. The technique allows real-time kinematic skeletal measurements to be performed on human subjects implanted with tantalum markers for quantitatively measuring the motion of normal joints and different implant designs.

  8. Empleo de la técnica hibridación in situ fluorescente para visualizar microorganismos Use of fluorescence in situ hybridization technique to visualize microorganisms

    Directory of Open Access Journals (Sweden)

    Raúl Rodríguez Martínez

    2011-12-01

    Full Text Available La hibridación in situ fluorescente (FISH, es una técnica que emplea sondas de oligonucleótidos marcadas con fluorocromos las cuales van dirigidas hacia secuencias específicas del ácido ribonucleico ribosomal (ARNr, lo que permite la identificación rápida y específica de células microbianas ya sea que estén como células individuales o se encuentren agrupadas en su ambiente natural. El conocimiento de la composición y distribución de los microorganismos en los hábitats naturales, proporciona un soporte sólido para comprender la interacción entre las diversas especies que componen el micro hábitat. El objetivo de la revisión es presentar la forma como ha evolucionado la hibridación, el empleo del ARNr como molécula diana, los tipos de marcaje, los marcadores fluorescentes empleados hoy en día, la metodología, así como las mejoras que se le han hecho a la técnica FISH al emplearse en conjunto con otras técnicas en la identificación microbiana. Salud UIS 2011; 43 (3: 307-316Fluorescence in situ hybridization (FISH, is a technique that uses oligonucleotides probes labeled with fluorochromes which are directed to specific sequences of ribosomal ribonucleic acid (rRNA, this allows the rapid and specific identification of microbial cells whether as individual cells or grouped cells in their natural environment. Knowledge of the composition and distribution of microorganisms in natural habitats provides a solid support to understand interaction between different species in the microhabitat. This review shows how hybridization has evolved, the use of rRNA as target molecule, the type of labeling, the labeled uses today in fluorescent and the methodology, as well as the improvements that have been made to the FISH technique when is used in conjunction with other techniques in microbial identification. Salud UIS 2011; 43 (3: 307-316

  9. Hybrid and Etch-Less Electrooptic Waveguide Modulator Based on Photo-Bleaching and Strain Induced Optical Waveguide Technique in Polymer.

    Science.gov (United States)

    Kim, Richard; Kang, Byeong-Mo; Jeong, Woon-Jo; Jung, Yang-June; Park, Hyuk-Reol; Kim, Chang-Dae; So, Soon-Youl; Lee, Jin; Park, Gye-Choon; Park, Yongjun

    2016-02-01

    A hybrid and etchless electrooptic (EO) polymer waveguide modulator based on both a photo-bleaching-induced optical waveguide (PBOW) and a strain-induced optical waveguide (SIOW) is described. The SIOW is defined by a metal strip line stressor deposited on top of the upper cladding that introduces the refractive index change within the core region. The PBOW technique is used to form an optical waveguide which is based on a photo-bleaching process, known as a photo-oxidation that is an irreversible decomposition of EO material, resulting in a permanent decrease in index of refraction. It is shown that this proposed fabrication idea combining two etchless techniques can be applicable to a wide range of polymer photonic integrated circuits. Preliminary results obtained from fabricated devices reveal that their half-wave voltage are ranging from 8 V to 10 V, their extinction ratio exhibits more than 15 dB, and the fiber-to-waveguide-to-lens loss is estimated to be ~9.5 dB for TM polarization at 1.55/m wavelength in the active interaction of ~1.5 cm long.

  10. Identification of cold responsive genes in Pacific white shrimp (Litopenaeus vannamei) by suppression subtractive hybridization.

    Science.gov (United States)

    Peng, Jinxia; Wei, Pinyuan; Chen, Xiuli; Zeng, Digang; Chen, Xiaohan

    2016-01-10

    The Pacific white shrimp (Litopenaeus vannamei) is one of the most widely cultured shrimp species in the world. Despite L. vannamei having tropical origins, it is being reared subtropically, with low temperature stress being one of the most severe threats to its growth, survival and distribution. To unravel the molecular basis of cold tolerance in L. vannamei, the suppression subtractive hybridization (SSH) platform was employed to identify cold responsive genes in the hepatopancreas of L. vannamei. Both forward and reverse cDNA libraries were constructed, followed by dot blot hybridization, cloning, sequence analysis and quantitative real-time PCR. These approaches identified 92 cold induced and 48 cold inhibited ESTs to give a total of 37 cold induced and 17 cold inhibited contigs. Some of the identified genes related to stress response or cell defense, such as tetraspanins (TSPANs), DEAD-box helicase, heat shock proteins (HSPs) and metallothionein (MT), which were more abundant in the forward SSH library than in the reverse SSH library. The most abundant Est was a tetraspanin-8 (TSPAN8) homolog dubbed LvTSPAN8. A multiple sequence alignment and transmembrane domain prediction was also performed for LvTSPAN8. LvTSPAN8 expression was also examined in the gills, muscle, heart and hepatopancreas following cold exposure and showed the highest expression levels in the hepatopancreas. Overall, this study was able to identify several known genes and novel genes via SSH that appear to be associated with cold stress and will help to provide further insights into the molecular mechanisms regulating cold tolerance in L. vannamei.

  11. Improving Semantic Updating Method on 3d City Models Using Hybrid Semantic-Geometric 3d Segmentation Technique

    Science.gov (United States)

    Sharkawi, K.-H.; Abdul-Rahman, A.

    2013-09-01

    to LoD4. The accuracy and structural complexity of the 3D objects increases with the LoD level where LoD0 is the simplest LoD (2.5D; Digital Terrain Model (DTM) + building or roof print) while LoD4 is the most complex LoD (architectural details with interior structures). Semantic information is one of the main components in CityGML and 3D City Models, and provides important information for any analyses. However, more often than not, the semantic information is not available for the 3D city model due to the unstandardized modelling process. One of the examples is where a building is normally generated as one object (without specific feature layers such as Roof, Ground floor, Level 1, Level 2, Block A, Block B, etc). This research attempts to develop a method to improve the semantic data updating process by segmenting the 3D building into simpler parts which will make it easier for the users to select and update the semantic information. The methodology is implemented for 3D buildings in LoD2 where the buildings are generated without architectural details but with distinct roof structures. This paper also introduces hybrid semantic-geometric 3D segmentation method that deals with hierarchical segmentation of a 3D building based on its semantic value and surface characteristics, fitted by one of the predefined primitives. For future work, the segmentation method will be implemented as part of the change detection module that can detect any changes on the 3D buildings, store and retrieve semantic information of the changed structure, automatically updates the 3D models and visualize the results in a userfriendly graphical user interface (GUI).

  12. Ranking factors involved in product design using a hybrid model of Quality Function Deployment, Data Envelopment Analysis and TOPSIS technique

    Directory of Open Access Journals (Sweden)

    Davood Feiz

    2014-08-01

    Full Text Available Quality function deployment (QFD is one such extremely important quality management tool, which is useful in product design and development. Traditionally, QFD rates the design requirements (DRs with respect to customer requirements, and aggregates the rating to get relative importance score of DRs. An increasing number of studies emphasize on the need to incorporate additional factors, such as cost and environmental impact, while calculating the relative importance of DRs. However, there are different methodologies for driving the relative importance of DRs, when several additional factors are considered. TOPSIS (technique for order preferences by similarity to ideal solution is suggested for the purpose of the research. This research proposes new approach of TOPSIS for considering the rating of DRs with respect to CRs, and several additional factors, simultaneously. Proposed method is illustrated using by step-by-step procedure. The proposed methodology was applied for the Sanam Electronic Company in Iran.

  13. Novel preparation of controlled porosity particle/fibre loaded scaffolds using a hybrid micro-fluidic and electrohydrodynamic technique.

    Science.gov (United States)

    Parhizkar, Maryam; Sofokleous, Panagiotis; Stride, Eleanor; Edirisinghe, Mohan

    2014-11-27

    The purpose of this research was to produce multi-dimensional scaffolds containing biocompatible particles and fibres. To achieve this, two techniques were combined and used: T-Junction microfluidics and electrohydrodynamic (EHD) processing. The former was used to form layers of monodispersed bovine serum albumin (BSA) bubbles, which upon drying formed porous scaffolds. By altering the T-Junction processing parameters, bubbles with different diameters were produced and hence the scaffold porosity could be controlled. EHD processing was used to spray or spin poly(lactic-co-glycolic) (PLGA), polymethysilsesquioxane (PMSQ) and collagen particles/fibres onto the scaffolds during their production and after drying. As a result, multifunctional BSA scaffolds with controlled porosity containing PLGA, PMSQ and collagen particles/fibres were obtained. Product morphology was studied by optical and scanning electron microscopy. These products have potential applications in many advanced biomedical, pharmaceutical and cosmetic fields e.g. bone regeneration, drug delivery, cosmetic cream lathers, facial scrubbing creams etc.

  14. A Hybrid Reliable Data Transmission based on Ant-agent Resource Allocation Technique in EEMCC Protocol for MANETS

    Directory of Open Access Journals (Sweden)

    Dr. M. Rajanbabu

    2014-04-01

    Full Text Available Real time multicast applications in mobile adhoc network brings forward added advantages in wireless network. The fragile and mobile environment of adhoc network produces the need of bandwidth allocation for real time applications. Reliability is also an important factor in multicasting in mobile adhoc networks (MANETs, as it confirms eventual delivery of all the data to all the group members, without enforcing any particular delivery order in EEMCCP. In the first phase of this paper, we design an "ant agent-resource allocation‟ technique for reserving bandwidth for real-time multicast applications. In the forward phase, the source sends a forward ant agent which collects the bandwidth information of intermediate nodes and reserves a bandwidth for real-time flow for each multicast receiver. In the backward phase, the backward ant confirms the allocation and feeds the bandwidth information to the source.

  15. 基于SSH+jQuery框架的餐饮Web App的设计与实现%Design and implementation of a catering industry Web App based on SSH and jQuery

    Institute of Scientific and Technical Information of China (English)

    张佳佳; 王杨; 韩力英

    2016-01-01

    针对传统方式开发的餐饮Web App平台难以维护和扩展、用户体验不够好等问题,本文提出一种以Windows为开发环境,Eclipse为开发工具,Oracle为数据库,将SSH和jQuery这两种框架整合应用于系统开发的方案。该方案包括视图层、业务逻辑层和数据持久层,分别由SSH+jQuery框架组合实现相应功能。结果表明,该方案将SSH和jQuery这2个框架整合应用于系统开发中,实现了注册登录、订餐、外卖等主要功能,实现了上述三个层面的完全分离,提高了用户体验度。%For solving the Web App platform difficult to maintain and extend and promoting the user experience, a system developing scheme based on integrating framework SSH and jQuery has been proposed in this paper.This scheme adopts Windows as development environment, Eclipse as development tool and Oracle as the database. It contains view layer, business logic layer and date persistence layer, implemented by the JSP+jQuery framework, Struts+Spring framework, and Hibermate+Spring frameworkseparately. The results shows that this scheme has achieved the main function of registration, ordering, take-out, and has realized the complete separation of theview layer, business logic layer and date persistence layer, which also will improved the user experience.

  16. Hybrid technique for DeBakey type Ⅰ aortic dissection%DeBakeyⅠ型主动脉夹层的杂交手术治疗

    Institute of Scientific and Technical Information of China (English)

    郑先杰; 郭大乔; 张双林; 张庄; 赵爱国; 张国瑜; 张筱扬; 董彦军; 段淑敏; 符伟国

    2010-01-01

    Objective To explore the efficacy,indication and the treatment of complication of concomitant thoracic aortic replacement and endoluminal stent grafting (hybrid technique) for DeBakey type Ⅰ aortic dissection. Methods From September 2005 to June 2009,12 patients with acute DeBakey type Ⅰ aortic dissection were diagnosed by contrast-enhanced CT or MRI scan, and underwent hybrid technique.Computed tomography angiography (CTA) was performed in each patient at 2,6 months after operation to check up the post-operative course,such as ascending aortic and vascular prosthesis of aortic arch and decending aorta. The time of the post-operational follow-up was 6 -36 months. Results All patients successfully recovered from surgery procedure,no serious complication. The time of cardiopulmonary bypass was 196 -298 (264.0 ± 36.6) min,arrest time of ascending aortic was 89 -276 (213.6 ±43.8) min. All patients were discharged from hospital. Contrast-enhanced CT or MRI indicated the vascular prosthesis to been unobstructed,no endo-stent dislocation and no organ ischemia, the false lumen and thrombosis disappeared in 10 patients,but false lumen and leakage happened in 2 patients at 2 months after operation.The false lumen disappeared at 6 months after operation. Conclusions Hybrid technique for DeBakey type Ⅰ aortic dissection is satisfactory in short term effect with less invasiveness and definite safety. However,further studies are needed to evaluate its long-term outcomes.%目的 探讨DeBakey Ⅰ型主动脉夹层行升主动脉并全弓置换加降主动脉支架置入术(即杂交手术)的疗效、适应证的选择和并发症的处理.方法 2005年9月至2009年6月,经CT增强扫描或磁共振确诊DeBakey Ⅰ型主动脉夹层患者12例,均行杂交手术.术后2、6个月复查胸部CT增强扫描,了解升主动脉、主动脉弓人工血管及降主动脉血管内覆膜支架的情况.结果 12例患者全部手术成功,无严

  17. Improving the prediction of going concern of Taiwanese listed companies using a hybrid of LASSO with data mining techniques.

    Science.gov (United States)

    Goo, Yeung-Ja James; Chi, Der-Jang; Shen, Zong-De

    2016-01-01

    The purpose of this study is to establish rigorous and reliable going concern doubt (GCD) prediction models. This study first uses the least absolute shrinkage and selection operator (LASSO) to select variables and then applies data mining techniques to establish prediction models, such as neural network (NN), classification and regression tree (CART), and support vector machine (SVM). The samples of this study include 48 GCD listed companies and 124 NGCD (non-GCD) listed companies from 2002 to 2013 in the TEJ database. We conduct fivefold cross validation in order to identify the prediction accuracy. According to the empirical results, the prediction accuracy of the LASSO-NN model is 88.96 % (Type I error rate is 12.22 %; Type II error rate is 7.50 %), the prediction accuracy of the LASSO-CART model is 88.75 % (Type I error rate is 13.61 %; Type II error rate is 14.17 %), and the prediction accuracy of the LASSO-SVM model is 89.79 % (Type I error rate is 10.00 %; Type II error rate is 15.83 %).

  18. The Application of SSH in Telecommunication Service%SSH协议在电信业务的应用

    Institute of Scientific and Technical Information of China (English)

    李岳梦; 赵绍刚

    2009-01-01

    随着网络的不断发展,网络安全性已成为网络设计的一项重要内容.文章介绍了SSH(Secure Shell)协议体系结构,详细分析了SSH的三层结构和密钥机制,讨论了SSH连接建立过程的各个阶段.在此基础上,重点介绍了SSH协议在电信业务中的应用,包括建立一个SSH安全通道过程和在安全通道内实现数据安全交互的过程.

  19. Visceral hybrid reconstruction of thoracoabdominal aortic aneurysm after open repair of type a aortic dissection by the Bentall procedure with the elephant trunk technique: A case report

    Directory of Open Access Journals (Sweden)

    Marjanović Ivan

    2014-01-01

    Full Text Available Introduction. Reconstruction of chronic type B dissection and thoracoabdominal aortic aneurysm (TAAA remaining after the emergency reconstruction of the ascending thoracic aorta and aortic arch for acute type A dissection represents one of the major surgical challenges. Complications of chronic type B dissection are aneurysmal formation and rupture of an aortic aneurysm with a high mortality rate. We presented a case of visceral hybrid reconstruction of TAAA secondary to chronic dissection type B after the Bentall procedure with the elephant trunk technique due to acute type A aortic dissection in a high-risk patient. Case report. A 62 year-old woman was admitted to our institution for reconstruction of Crawford type I TAAA secondary to chronic dissection. The patient had had an acute type A aortic dissection 3 years before and undergone reconstruction by the Bentall procedure with the elephant trunk technique with valve replacement. On admission the patient had coronary artery disease (myocardial infarction, two times in the past 3 years, congestive heart disease with ejection fraction of 25% and chronic obstructive pulmonary disease. On computed tomography (CT of the aorta TAAA was revealed with a maximum diameter of 93 mm in the descending thoracic aorta secondary to chronic dissection. All the visceral arteries originated from the true lumen with exception of the celiac artery (CA, and the end of chronic dissection was below the origin of the superior mesenteric artery (SMA. The patient was operated on using surgical visceral reconstruction of the SMA, CA and the right renal artery (RRA as the first procedure. Postoperative course was without complications. Endovascular TAAA reconstruction was performed as the second procedure one month later, when the elephant trunk was used as the proximal landing zone for the endograft, and distal landing zone was the level of origin of the RRA. Postoperatively, the patient had no neurological deficit and

  20. A fast and robust new pore-network extraction method based on hybrid median axis and maximal inscribed ball techniques

    Science.gov (United States)

    Timofey, Sizonenko; Karsanina, Marina; Byuk, Irina; Gerke, Kirill

    2016-04-01

    To characterize pore structure relevant to single and multi-phase flow modelling it is of special interest to extract topology of the pore space. This is usually achieved using so-called pore-network models. Such models are useful not only to characterize pore space and pore size distributions, but also provide means to simulate flow and transport with very limited computational resources compared to other pore-scale modelling techniques. The main drawback of the pore-network approach is that they have first to simplify the pore space geometry. This crucial step is both time consuming and prone to numerous errors. Two most popular methods based on median axis or inscribed maximal balls have their own strong sides and disadvantages. To address aforementioned problems related to pore-network extraction here we propose a novel method utilizing the advantages of both popular approaches. Combining two algorithms resulted in much faster and robust extraction methodology. Moreover, we have found that accurate topology representation requires extension of the conventional pore-body and pore-throat classification. We test our new methodology using pore structures with "analytical solutions" such as different sphere packs. In addition, we rigorously compare it against inscribed maximal balls methodology's results using numerous 3D images of sandstone and carbonate rocks, soils and some other porous materials. Another verification includes permeability calculations which are also compared both against lab data and voxel based pore-scale modelling simulations. This work was partially supported by RFBR grant 15-34-20989 (X-ray tomography and image fusion) and RSF grant 14-17-00658 (image segmentation and pore-scale modelling).