Design, Implementation, and Evaluation of a Hybrid DS/FFH Spread-Spectrum Radio Transceiver
Energy Technology Data Exchange (ETDEWEB)
Olama, Mohammed M [ORNL; Killough, Stephen M [ORNL; Kuruganti, Teja [ORNL; Carroll, Thomas E. [Pacific Northwest National Laboratory (PNNL)
2014-01-01
In recent years there has been great interest in using hybrid spread-spectrum (HSS) techniques for commercial applications, particularly in the Smart Grid, in addition to their inherent uses in military communications. This is because HSS can accommodate high data rates with high link integrity, even in the presence of significant multipath effects and interfering signals. A highly useful form of this transmission technique for many types of command, control, and sensing applications is the specific code-related combination of standard direct-sequence modulation with "fast" frequency-hopping, denoted hybrid DS/FFH, wherein multiple frequency hops occur within a single data-bit time. In this paper, we present the efforts carried out at Oak Ridge National Laboratory toward exploring the design, implementation, and evaluation of a hybrid DS/FFH spread-spectrum radio transceiver using a single Field Programmable Gate Array (FPGA). The FPGA allows the various subsystems to quickly communicate with each other and thereby maintain tight synchronization. We also investigate various hopping sequences against robustness to interference and jamming. Experimental results are presented that show the receiver sensitivity, radio data-rate/bit-error evaluations, and jamming and interference rejection capabilities of the implemented hybrid DS/FFH spread-spectrum system under widely varying design parameters.
Hybrid spread spectrum radio system
Smith, Stephen F [London, TN; Dress, William B [Camas, WA
2010-02-09
Systems and methods are described for hybrid spread spectrum radio systems. A method, includes receiving a hybrid spread spectrum signal including: fast frequency hopping demodulating and direct sequence demodulating a direct sequence spread spectrum signal, wherein multiple frequency hops occur within a single data-bit time and each bit is represented by chip transmissions at multiple frequencies.
Spread Spectrum Receiver Electromagnetic Interference (EMI) Test Guide
Wheeler, M. L.
1998-01-01
The objective of this test guide is to document appropriate unit level test methods and techniques for the performance of EMI testing of Direct Sequence (DS) spread spectrum receivers. Consideration of EMI test methods tailored for spread spectrum receivers utilizing frequency spreading, techniques other than direct sequence (such as frequency hopping, frequency chirping, and various hybrid methods) is beyond the scope of this test guide development program and is not addressed as part of this document EMI test requirements for NASA programs are primarily developed based on the requirements contained in MIL-STD-46 1 D (or earlier revisions of MIL-STD-46 1). The corresponding test method guidelines for the MIL-STD-461 D tests are provided in MIL-STD-462D. These test methods are well documented with the exception of the receiver antenna port susceptibility tests (intermodulation, cross modulation, and rejection of undesired signals) which must be tailored to the specific type of receiver that is being tested. Thus, test methods addressed in this guide consist only of antenna port tests designed to evaluate receiver susceptibility characteristics. MIL-STD-462D should be referred for guidance pertaining to test methods for EMI tests other than the antenna port tests. The scope of this test guide includes: (1) a discussion of generic DS receiver performance characteristics; (2) a summary of S-band TDRSS receiver operation; (3) a discussion of DS receiver EMI susceptibility mechanisms and characteristics; (4) a summary of military standard test guidelines; (5) recommended test approach and methods; and (6) general conclusions and recommendations for future studies in the area of spread spectrum receiver testing.
Novel Maximum-based Timing Acquisition for Spread-Spectrum Communications
Energy Technology Data Exchange (ETDEWEB)
Sibbetty, Taylor; Moradiz, Hussein; Farhang-Boroujeny, Behrouz
2016-12-01
This paper proposes and analyzes a new packet detection and timing acquisition method for spread spectrum systems. The proposed method provides an enhancement over the typical thresholding techniques that have been proposed for direct sequence spread spectrum (DS-SS). The effective implementation of thresholding methods typically require accurate knowledge of the received signal-to-noise ratio (SNR), which is particularly difficult to estimate in spread spectrum systems. Instead, we propose a method which utilizes a consistency metric of the location of maximum samples at the output of a filter matched to the spread spectrum waveform to achieve acquisition, and does not require knowledge of the received SNR. Through theoretical study, we show that the proposed method offers a low probability of missed detection over a large range of SNR with a corresponding probability of false alarm far lower than other methods. Computer simulations that corroborate our theoretical results are also presented. Although our work here has been motivated by our previous study of a filter bank multicarrier spread-spectrum (FB-MC-SS) system, the proposed method is applicable to DS-SS systems as well.
Directory of Open Access Journals (Sweden)
Mohandass Sundararajan
2014-07-01
Full Text Available Spread spectrum (SS and multicarrier modulation (MCM techniques are recognized as potential candidates for the design of underlay and interweave cognitive radio (CR systems, respectively. Direct Sequence Code Division Multiple Access (DS-CDMA is a spread spectrum technique generally used in underlay CR systems. Orthogonal Frequency Division Multiplexing (OFDM is the basic MCM technique, primarily used in interweave CR systems. There are other MCM schemes derived from OFDM technique, like Non-Contiguous OFDM, Spread OFDM, and OFDM-OQAM, which are more suitable for CR systems. Multicarrier Spread Spectrum Modulation (MCSSM schemes like MC-CDMA, MC-DS-CDMA and SS-MC-CDMA, combine DS-CDMA and OFDM techniques in order to improve the CR system performance and adaptability. This article gives a detailed survey of the various spread spectrum and multicarrier modulation schemes proposed in the literature. Fast Fourier Transform (FFT plays a vital role in all the multicarrier modulation techniques. The FFT part of the modem can be used for spectrum sensing. The performance of the FFT operator plays a crucial role in the overall performance of the system. Since the cognitive radio is an adaptive system, the FFT operator must also be adaptive for various input/output values, in order to save energy and time taken for execution. This article also includes the various efficient FFT algorithms proposed in the literature, which are suitable for CR systems.
Miyatake, Teruhiko; Chiba, Kazuki; Hamamura, Masanori; Tachikawa, Shin'ichi
We propose a novel asynchronous direct-sequence codedivision multiple access (DS-CDMA) using feedback-controlled spreading sequences (FCSSs) (FCSS/DS-CDMA). At the receiver of FCSS/DS-CDMA, the code-orthogonalizing filter (COF) produces a spreading sequence, and the receiver returns the spreading sequence to the transmitter. Then the transmitter uses the spreading sequence as its updated version. The performance of FCSS/DS-CDMA is evaluated over time-dispersive channels. The results indicate that FCSS/DS-CDMA greatly suppresses both the intersymbol interference (ISI) and multiple access interference (MAI) over time-invariant channels. FCSS/DS-CDMA is applicable to the decentralized multiple access.
Improving performance of DS-CDMA systems using chaotic complex Bernoulli spreading codes
Farzan Sabahi, Mohammad; Dehghanfard, Ali
2014-12-01
The most important goal of spreading spectrum communication system is to protect communication signals against interference and exploitation of information by unintended listeners. In fact, low probability of detection and low probability of intercept are two important parameters to increase the performance of the system. In Direct Sequence Code Division Multiple Access (DS-CDMA) systems, these properties are achieved by multiplying the data information in spreading sequences. Chaotic sequences, with their particular properties, have numerous applications in constructing spreading codes. Using one-dimensional Bernoulli chaotic sequence as spreading code is proposed in literature previously. The main feature of this sequence is its negative auto-correlation at lag of 1, which with proper design, leads to increase in efficiency of the communication system based on these codes. On the other hand, employing the complex chaotic sequences as spreading sequence also has been discussed in several papers. In this paper, use of two-dimensional Bernoulli chaotic sequences is proposed as spreading codes. The performance of a multi-user synchronous and asynchronous DS-CDMA system will be evaluated by applying these sequences under Additive White Gaussian Noise (AWGN) and fading channel. Simulation results indicate improvement of the performance in comparison with conventional spreading codes like Gold codes as well as similar complex chaotic spreading sequences. Similar to one-dimensional Bernoulli chaotic sequences, the proposed sequences also have negative auto-correlation. Besides, construction of complex sequences with lower average cross-correlation is possible with the proposed method.
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFH459 (Link to dictyBase) - - - Contig-U16336-1 SFH459P (Link... to Original site) SFH459F 606 SFH459Z 728 SFH459P 1334 - - Show SFH459 Library SF (Link to library) Clone ID SFH459 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...KTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKT...TVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTH
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFH450 (Link to dictyBase) - - - Contig-U13857-1 SFH450F (Link... to Original site) SFH450F 623 - - - - - - Show SFH450 Library SF (Link to library) Clone ID SFH450 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13857-1 Original site URL http://dict...IMIIFLCLEATFDQPYHSIGGFIIVCSGYQLGQGIAGGAFSGIIPDVVHPSQSGI ASGWLGVGFSLGLLIGTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICT...GTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICTMHEDSND EWSFDGSLPSFFKSLHLPSSIYFNFYWVLITRFFNTLGIYMIFSFLLYFATDIIGQTNLM T
Principles of spread-spectrum communication systems
Torrieri, Don
2015-01-01
This book provides a concise but lucid explanation of the fundamentals of spread-spectrum systems with an emphasis on theoretical principles. The choice of specific topics is tempered by the author’s judgment of their practical significance and interest to both researchers and system designers. The book contains many improved derivations of the classical theory and presents the latest research results that bring the reader to the frontier of the field. This third edition includes new coverage of topics such as CDMA networks, acquisition and synchronization in DS-CDMA cellular networks, hopsets for FH-CDMA ad hoc networks, implications of information theory, the central limit theorem, the power spectral density of FH/CPM complex envelopes, adaptive filters, and adaptive arrays. · Focuses on the fundamentals of spread-spectrum communication systems and provides current examples of their applications · Includes problem sets at the end of each chapter to assist readers in co...
A Chaos-Based Secure Direct-Sequence/Spread-Spectrum Communication System
Directory of Open Access Journals (Sweden)
Nguyen Xuan Quyen
2013-01-01
Full Text Available This paper proposes a chaos-based secure direct-sequence/spread-spectrum (DS/SS communication system which is based on a novel combination of the conventional DS/SS and chaos techniques. In the proposed system, bit duration is varied according to a chaotic behavior but is always equal to a multiple of the fixed chip duration in the communication process. Data bits with variable duration are spectrum-spread by multiplying directly with a pseudonoise (PN sequence and then modulated onto a sinusoidal carrier by means of binary phase-shift keying (BPSK. To recover exactly the data bits, the receiver needs an identical regeneration of not only the PN sequence but also the chaotic behavior, and hence data security is improved significantly. Structure and operation of the proposed system are analyzed in detail. Theoretical evaluation of bit-error rate (BER performance in presence of additive white Gaussian noise (AWGN is provided. Parameter choice for different cases of simulation is also considered. Simulation and theoretical results are shown to verify the reliability and feasibility of the proposed system. Security of the proposed system is also discussed.
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFH236 (Link to dictyBase) - G00315 DDB0191340 Contig-U16349-1...brary) Clone ID SFH236 (Link to dictyBase) Atlas ID - NBRP ID G00315 dictyBase ID DDB0191340 Link to Contig ...Contig-U16349-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFH2-...VDCVTNSSDASCTNFQYPLANITADINNL CGSMPYMPVCTIQQSCNQESSTSGICDPFSILGDSCLHDMPGMSG--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICT...ii yvvaclicqfvpfnnhviknpqqvvfvihsqflvivvfticqa*vv--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTC
Optimizing hybrid spreading in metapopulations.
Zhang, Changwang; Zhou, Shi; Miller, Joel C; Cox, Ingemar J; Chain, Benjamin M
2015-04-29
Epidemic spreading phenomena are ubiquitous in nature and society. Examples include the spreading of diseases, information, and computer viruses. Epidemics can spread by local spreading, where infected nodes can only infect a limited set of direct target nodes and global spreading, where an infected node can infect every other node. In reality, many epidemics spread using a hybrid mixture of both types of spreading. In this study we develop a theoretical framework for studying hybrid epidemics, and examine the optimum balance between spreading mechanisms in terms of achieving the maximum outbreak size. We show the existence of critically hybrid epidemics where neither spreading mechanism alone can cause a noticeable spread but a combination of the two spreading mechanisms would produce an enormous outbreak. Our results provide new strategies for maximising beneficial epidemics and estimating the worst outcome of damaging hybrid epidemics.
Upgrade of hybrid fibre coax networks towards bi-directional access
Khoe, G.D.; Wolters, R.P.C.; Boom, van den H.P.A.; Prati, G.
1997-01-01
In this paper we describe an upgrade scenario for Hybrid Fibre Coax (HFC) CATV Networks towards hi-directional access. The communication system described has been newly designed, and is based on the use of Direct Sequence- Code Division Multiple-Access (DS-CDMA). Due to its spread-spectrum
A STUDY ON DETERMINING THE REFERENCE SPREADING SEQUENCES FOR A DS/CDMACOMMUNICATION SYSTEM
Directory of Open Access Journals (Sweden)
Cebrail ÇİFTLİKLİ
2002-02-01
Full Text Available In a direct sequence/code division multiple access (DS/CDMA system, the role of the spreading sequences (codes is crucial since the multiple access interference (MAI is the main performance limitation. In this study, we propose an accurate criterion which enables the determination of the reference spreading codes which yield lower bit error rates (BER's in a given code set for a DS/CDMA system using despreading sequences weighted by stepping chip waveforms. The numerical results show that the spreading codes determined by the proposed criterion are the most suitable codes for using as references.
Optimizing Hybrid Spreading in Metapopulations.
Zhang, C.; Zhou, S.; Miller, J. C.; Cox, I. J.; Chain, B. M.
2015-01-01
Epidemic spreading phenomena are ubiquitous in nature and society. Examples include the spreading of diseases, information, and computer viruses. Epidemics can spread by local spreading, where infected nodes can only infect a limited set of direct target nodes and global spreading, where an infected node can infect every other node. In reality, many epidemics spread using a hybrid mixture of both types of spreading. In this study we develop a theoretical framework for studying hybrid epidemic...
Optimizing Hybrid Spreading in Metapopulations
Zhang, Changwang; Zhou, Shi; Miller, Joel C.; Cox, Ingemar J.; Chain, Benjamin M.
2014-01-01
Epidemic spreading phenomena are ubiquitous in nature and society. Examples include the spreading of diseases, information, and computer viruses. Epidemics can spread by local spreading, where infected nodes can only infect a limited set of direct target nodes and global spreading, where an infected node can infect every other node. In reality, many epidemics spread using a hybrid mixture of both types of spreading. In this study we develop a theoretical framework for studying hybrid epidemic...
Computationally Efficient Chaotic Spreading Sequence Selection for Asynchronous DS-CDMA
Directory of Open Access Journals (Sweden)
Litviņenko Anna
2017-12-01
Full Text Available The choice of the spreading sequence for asynchronous direct-sequence code-division multiple-access (DS-CDMA systems plays a crucial role for the mitigation of multiple-access interference. Considering the rich dynamics of chaotic sequences, their use for spreading allows overcoming the limitations of the classical spreading sequences. However, to ensure low cross-correlation between the sequences, careful selection must be performed. This paper presents a novel exhaustive search algorithm, which allows finding sets of chaotic spreading sequences of required length with a particularly low mutual cross-correlation. The efficiency of the search is verified by simulations, which show a significant advantage compared to non-selected chaotic sequences. Moreover, the impact of sequence length on the efficiency of the selection is studied.
A performance analysis of DS-CDMA and SCPC VSAT networks
Hayes, David P.; Ha, Tri T.
1990-01-01
Spread-spectrum and single-channel-per-carrier (SCPC) transmission techniques work well in very small aperture terminal (VSAT) networks for multiple-access purposes while allowing the earth station antennas to remain small. Direct-sequence code-division multiple-access (DS-CDMA) is the simplest spread-spectrum technique to use in a VSAT network since a frequency synthesizer is not required for each terminal. An examination is made of the DS-CDMA and SCPC Ku-band VSAT satellite systems for low-density (64-kb/s or less) communications. A method for improving the standardf link analysis of DS-CDMA satellite-switched networks by including certain losses is developed. The performance of 50-channel full mesh and star network architectures is analyzed. The selection of operating conditions producing optimum performance is demonstrated.
Generation and reception of spread-spectrum signals
Moser, R.
1983-05-01
The term 'spread-spectrum' implies a technique whereby digitized information is added to a pseudo-random number sequence and the resultant bit stream changes some parameter of the carrier frequency in discrete increments. The discrete modulation of the carrier frequency is usually realized either as a multiple level phase shift keyed or frequency shift keyed signal. The resultant PSK-modulated frequency spectrum is referred to as direct sequence spread-spectrum, whereas the FSK-modulated carrier frequency is referred to as a frequency hopped spread spectrum. These can be considered the major subsets of the more general term 'spread-spectrum'. In discussing signal reception, it is pointed out that active correlation methods are used for channel synchronization when the psuedo random sequences are long or when the processing gain is large, whereas the passive methods may be used for either short pseudo-random noise generation codes or to assist in attaining initial synchronization in long sequence spread-spectrum systems.
Chen, Shih-Hao; Chow, Chi-Wai
2015-02-01
Visible light communication (VLC) using spread spectrum modulation (SSM) and differential signaling (DS), detected by a mobile-phone camera is proposed and demonstrated for the first time to provide high immunity to background ambient light interference. The SSM signal provides the coding gain while the DS scheme enhances the clock recovery particular under high background ambient light. Experiment results confirm the feasibility of the proposed scheme, showing that the proposed system has 6-dB gain comparing with the traditional on-off keying (OOK) modulation under background ambient light of 3000 lux. The direct incident ambient light to the mobile-phone camera is 520 lux.
Spread spectrum image steganography.
Marvel, L M; Boncelet, C R; Retter, C T
1999-01-01
In this paper, we present a new method of digital steganography, entitled spread spectrum image steganography (SSIS). Steganography, which means "covered writing" in Greek, is the science of communicating in a hidden manner. Following a discussion of steganographic communication theory and review of existing techniques, the new method, SSIS, is introduced. This system hides and recovers a message of substantial length within digital imagery while maintaining the original image size and dynamic range. The hidden message can be recovered using appropriate keys without any knowledge of the original image. Image restoration, error-control coding, and techniques similar to spread spectrum are described, and the performance of the system is illustrated. A message embedded by this method can be in the form of text, imagery, or any other digital signal. Applications for such a data-hiding scheme include in-band captioning, covert communication, image tamperproofing, authentication, embedded control, and revision tracking.
Short range spread-spectrum radiolocation system and method
Smith, Stephen F.
2003-04-29
A short range radiolocation system and associated methods that allow the location of an item, such as equipment, containers, pallets, vehicles, or personnel, within a defined area. A small, battery powered, self-contained tag is provided to an item to be located. The tag includes a spread-spectrum transmitter that transmits a spread-spectrum code and identification information. A plurality of receivers positioned about the area receive signals from a transmitting tag. The position of the tag, and hence the item, is located by triangulation. The system employs three different ranging techniques for providing coarse, intermediate, and fine spatial position resolution. Coarse positioning information is provided by use of direct-sequence code phase transmitted as a spread-spectrum signal. Intermediate positioning information is provided by the use of a difference signal transmitted with the direct-sequence spread-spectrum code. Fine positioning information is provided by use of carrier phase measurements. An algorithm is employed to combine the three data sets to provide accurate location measurements.
Secure DS-CDMA spreading codes using fully digital multidimensional multiscroll chaos
Mansingka, Abhinav S.
2014-06-18
This paper introduces a generalized fully digital hardware implementation of 1-D, 2-D and 3-D multiscroll chaos through sawtooth nonlinearities in a 3rd order ODE with the Euler approximation, wherein low-significance bits pass all NIST SP. 800-22 tests. The low-significance bits show good performance as spreading code for multiple-access DS-CDMA in AWGN and multipath environments, equivalent to Gold codes. This system capitalizes on complex nonlinear dynamics afforded by multiscroll chaos to provide higher security than conventional codes with the same BER performance demonstrated experimentally on a Xilinx Virtex 4 FPGA with logic utilization less than 1.25% and throughput up to 10.92 Gbits/s.
Interference management using direct sequence spread spectrum ...
African Journals Online (AJOL)
Interference management using direct sequence spread spectrum (DSSS) technique ... Journal of Fundamental and Applied Sciences ... Keywords: DSSS, LTE network; Wi-Fi network; SINR; interference management and interference power.
Spatial sorting promotes the spread of maladaptive hybridization
Lowe, Winsor H.; Muhlfeld, Clint C.; Allendorf, Fred W.
2015-01-01
Invasive hybridization is causing loss of biodiversity worldwide. The spread of such introgression can occur even when hybrids have reduced Darwinian fitness, which decreases the frequency of hybrids due to low survival or reproduction through time. This paradox can be partially explained by spatial sorting, where genotypes associated with dispersal increase in frequency at the edge of expansion, fueling further expansion and allowing invasive hybrids to increase in frequency through space rather than time. Furthermore, because all progeny of a hybrid will be hybrids (i.e., will possess genes from both parental taxa), nonnative admixture in invaded populations can increase even when most hybrid progeny do not survive. Broader understanding of spatial sorting is needed to protect native biodiversity.
Hybrid epidemic spreading - from Internet worms to HIV infection
Zhang, C.
2015-01-01
Epidemic phenomena are ubiquitous, ranging from infectious diseases, computer viruses, to information dissemination. Epidemics have traditionally been studied as a single spreading process, either in a fully mixed population or on a network. Many epidemics, however, are hybrid, employing more than one spreading mechanism. For example, the Internet worm Conficker spreads locally targeting neighbouring computers in local networks as well as globally by randomly probing any computer on the Inter...
Spread spectrum mobile communication experiment using ETS-V satellite
Ikegami, Tetsushi; Suzuki, Ryutaro; Kadowaki, Naoto; Taira, Shinichi; Sato, Nobuyasu
1990-01-01
The spread spectrum technique is attractive for application to mobile satellite communications, because of its random access capability, immunity to inter-system interference, and robustness to overloading. A novel direct sequence spread spectrum communication equipment is developed for land mobile satellite applications. The equipment is developed based on a matched filter technique to improve the initial acquisition performance. The data rate is 2.4 kilobits per sec. and the PN clock rate is 2.4552 mega-Hz. This equipment also has a function of measuring the multipath delay profile of land mobile satellite channel, making use of a correlation property of a PN code. This paper gives an outline of the equipment and the field test results with ETS-V satellite.
Directory of Open Access Journals (Sweden)
Cotae Paul
2004-01-01
Full Text Available An algorithm for designing spreading sequences for an overloaded multicellular synchronous DS-CDMA system on uplink is introduced. The criterion used to measure the optimality of the design is the total weighted square correlation (TWSC assuming the channel state information known perfectly at both transmitter and receiver. By using this algorithm it is possible to obtain orthogonal generalized WBE sequences sets for any processing gain. The bandwidth of initial generalized WBE signals of each cell is preserved in the extended signal space associated to multicellular system. Mathematical formalism is illustrated by selected numerical examples.
Existing PON Infrastructure Supported Hybrid Fiber-Wireless Sensor Networks
DEFF Research Database (Denmark)
Yu, Xianbin; Zhao, Ying; Deng, Lei
2012-01-01
We propose a hybrid fiber wireless sensor network based on the existing PON infrastructure. The feasibility of remote sensing and PON convergence is experimentally proven by transmitting direct-sequence spread-spectrum wireless sensing and 2.5Gbps GPON signals.......We propose a hybrid fiber wireless sensor network based on the existing PON infrastructure. The feasibility of remote sensing and PON convergence is experimentally proven by transmitting direct-sequence spread-spectrum wireless sensing and 2.5Gbps GPON signals....
Spread Spectrum Techniques and their Applications to Wireless Communications
DEFF Research Database (Denmark)
Prasad, Ramjee; Cianca, E.
2005-01-01
Spread Spectrum (SS) radio communications is on the verge of potentially explosive commercial development An SS-based multiple access, such as CDMA, has been chosen for 3G wireless communications. Other current applications of SS techniues are in Wireless LANs and Satellite Navigation Systems...
Astro-WISE for KiDS survey production and quality control
Kleijn, G.V.; de Jong, Jelte; Valentijn, E.; Kuijken, K.; Consortiums, KiDS; Consortium, Astro-WISE; Ballester, P.; Egret, D.; Lorente, N.P.F.
The Kilo Degree Survey (KiDS) is a 1500 square degree optical imaging survey with the recently commissioned OmegaCAM wide-field imager on the VLT Survey Telescope (VST). A suite of data products will be delivered to ESO and the community by the KiDS survey team. Spread over Europe, the KiDS team
Steganography on multiple MP3 files using spread spectrum and Shamir's secret sharing
Yoeseph, N. M.; Purnomo, F. A.; Riasti, B. K.; Safiie, M. A.; Hidayat, T. N.
2016-11-01
The purpose of steganography is how to hide data into another media. In order to increase security of data, steganography technique is often combined with cryptography. The weakness of this combination technique is the data was centralized. Therefore, a steganography technique is develop by using combination of spread spectrum and secret sharing technique. In steganography with secret sharing, shares of data is created and hidden in several medium. Medium used to concealed shares were MP3 files. Hiding technique used was Spread Spectrum. Secret sharing scheme used was Shamir's Secret Sharing. The result showed that steganography with spread spectrum combined with Shamir's Secret Share using MP3 files as medium produce a technique that could hid data into several cover. To extract and reconstruct the data hidden in stego object, it is needed the amount of stego object which more or equal to its threshold. Furthermore, stego objects were imperceptible and robust.
A Synchronisation Method For Informed Spread-Spectrum Audiowatermarking
Pierre-Yves Fulchiron; Barry O'Donovan; Guenole Silvestre; Neil Hurley
2003-01-01
Under perfect synchronisation conditions, watermarking schemes employing asymmetric spread-spectrum techniques are suitable for copy-protection of audio signals. This paper proposes to combine the use of a robust psychoacoustic projection for the extraction of a watermark feature vector along with non-linear detection functions optimised with side-information. The new proposed scheme benefits from an increased level of security through the use of asymmetric detectors. We apply this scheme to ...
Baudais, Jean-Yves; Crussière, Matthieu
2007-12-01
Bit-loading techniques based on orthogonal frequency division mutiplexing (OFDM) are frequently used over wireline channels. In the power line context, channel state information can reasonably be obtained at both transmitter and receiver sides, and adaptive loading can advantageously be carried out. In this paper, we propose to apply loading principles to an spread spectrum OFDM (SS-OFDM) waveform which is a multicarrier system using 2D spreading in the time and frequency domains. The presented algorithm handles the subcarriers, spreading codes, bits and energies assignment in order to maximize the data rate and the range of the communication system. The optimization is realized at a target symbol error rate and under spectral mask constraint as usually imposed. The analytical study shows that the merging principle realized by the spreading code improves the rate and the range of the discrete multitone (DMT) system in single and multiuser contexts. Simulations have been run over measured power line communication (PLC) channel responses and highlight that the proposed system is all the more interesting than the received signal-to-noise ratio (SNR) is low.
Orthogonal Multi-Carrier DS-CDMA with Frequency-Domain Equalization
Tanaka, Ken; Tomeba, Hiromichi; Adachi, Fumiyuki
Orthogonal multi-carrier direct sequence code division multiple access (orthogonal MC DS-CDMA) is a combination of orthogonal frequency division multiplexing (OFDM) and time-domain spreading, while multi-carrier code division multiple access (MC-CDMA) is a combination of OFDM and frequency-domain spreading. In MC-CDMA, a good bit error rate (BER) performance can be achieved by using frequency-domain equalization (FDE), since the frequency diversity gain is obtained. On the other hand, the conventional orthogonal MC DS-CDMA fails to achieve any frequency diversity gain. In this paper, we propose a new orthogonal MC DS-CDMA that can obtain the frequency diversity gain by applying FDE. The conditional BER analysis is presented. The theoretical average BER performance in a frequency-selective Rayleigh fading channel is evaluated by the Monte-Carlo numerical computation method using the derived conditional BER and is confirmed by computer simulation of the orthogonal MC DS-CDMA signal transmission.
HF band filter bank multi-carrier spread spectrum
Energy Technology Data Exchange (ETDEWEB)
Laraway, Stephen Andrew; Moradi, Hussein; Farhang-Boroujeny, Behrouz
2015-10-01
Abstract—This paper describes modifications to the filter bank multicarrier spread spectrum (FB-MC-SS) system, that was presented in [1] and [2], to enable transmission of this waveform in the HF skywave channel. FB-MC-SS is well suited for the HF channel because it performs well in channels with frequency selective fading and interference. This paper describes new algorithms for packet detection, timing recovery and equalization that are suitable for the HF channel. Also, an algorithm for optimizing the peak to average power ratio (PAPR) of the FBMC- SS waveform is presented. Application of this algorithm results in a waveform with low PAPR. Simulation results using a wide band HF channel model demonstrate the robustness of this system over a wide range of delay and Doppler spreads.
A Charrelation Matrix-Based Blind Adaptive Detector for DS-CDMA Systems
Directory of Open Access Journals (Sweden)
Zhongqiang Luo
2015-08-01
Full Text Available In this paper, a blind adaptive detector is proposed for blind separation of user signals and blind estimation of spreading sequences in DS-CDMA systems. The blind separation scheme exploits a charrelation matrix for simple computation and effective extraction of information from observation signal samples. The system model of DS-CDMA signals is modeled as a blind separation framework. The unknown user information and spreading sequence of DS-CDMA systems can be estimated only from the sampled observation signals. Theoretical analysis and simulation results show that the improved performance of the proposed algorithm in comparison with the existing conventional algorithms used in DS-CDMA systems. Especially, the proposed scheme is suitable for when the number of observation samples is less and the signal to noise ratio (SNR is low.
A Charrelation Matrix-Based Blind Adaptive Detector for DS-CDMA Systems.
Luo, Zhongqiang; Zhu, Lidong
2015-08-14
In this paper, a blind adaptive detector is proposed for blind separation of user signals and blind estimation of spreading sequences in DS-CDMA systems. The blind separation scheme exploits a charrelation matrix for simple computation and effective extraction of information from observation signal samples. The system model of DS-CDMA signals is modeled as a blind separation framework. The unknown user information and spreading sequence of DS-CDMA systems can be estimated only from the sampled observation signals. Theoretical analysis and simulation results show that the improved performance of the proposed algorithm in comparison with the existing conventional algorithms used in DS-CDMA systems. Especially, the proposed scheme is suitable for when the number of observation samples is less and the signal to noise ratio (SNR) is low.
Quadriphase DS-CDMA wireless communication systems employing the generalized detector
Tuzlukov, Vyacheslav
2012-05-01
Probability of bit-error Per performance of asynchronous direct-sequence code-division multiple-access (DS-CDMA) wireless communication systems employing the generalized detector (GD) constructed based on the generalized approach to signal processing in noise is analyzed. The effects of pulse shaping, quadriphase or direct sequence quadriphase shift keying (DS-QPSK) spreading, aperiodic spreading sequences are considered in DS-CDMA based on GD and compared with the coherent Neyman-Pearson receiver. An exact Per expression and several approximations: one using the characterristic function method, a simplified expression for the improved Gaussian approximation (IGA) and the simplified improved Gaussian approximation are derived. Under conditions typically satisfied in practice and even with a small number of interferers, the standard Gaussian approximation (SGA) for the multiple-access interference component of the GD statistic and Per performance is shown to be accurate. Moreover, the IGA is shown to reduce to the SGA for pulses with zero excess bandwidth. Second, the GD Per performance of quadriphase DS-CDMA is shown to be superior to that of bi-phase DS-CDMA. Numerical examples by Monte Carlo simulation are presented to illustrate the GD Per performance for square-root raised-cosine pulses and spreading factors of moderate to large values. Also, a superiority of GD employment in CDMA systems over the Neyman-Pearson receiver is demonstrated
Directory of Open Access Journals (Sweden)
Baudais Jean-Yves
2007-01-01
Full Text Available Bit-loading techniques based on orthogonal frequency division mutiplexing (OFDM are frequently used over wireline channels. In the power line context, channel state information can reasonably be obtained at both transmitter and receiver sides, and adaptive loading can advantageously be carried out. In this paper, we propose to apply loading principles to an spread spectrum OFDM (SS-OFDM waveform which is a multicarrier system using 2D spreading in the time and frequency domains. The presented algorithm handles the subcarriers, spreading codes, bits and energies assignment in order to maximize the data rate and the range of the communication system. The optimization is realized at a target symbol error rate and under spectral mask constraint as usually imposed. The analytical study shows that the merging principle realized by the spreading code improves the rate and the range of the discrete multitone (DMT system in single and multiuser contexts. Simulations have been run over measured power line communication (PLC channel responses and highlight that the proposed system is all the more interesting than the received signal-to-noise ratio (SNR is low.
New PN Even Balanced Sequences for Spread-Spectrum Systems
Directory of Open Access Journals (Sweden)
Inácio JAL
2005-01-01
Full Text Available A new class of pseudonoise even balanced (PN-EB binary spreading sequences is derived from existing classical odd-length families of maximum-length sequences, such as those proposed by Gold, by appending or inserting one extra-zero element (chip to the original sequences. The incentive to generate large families of PN-EB spreading sequences is motivated by analyzing the spreading effect of these sequences from a natural sampling point of view. From this analysis a new definition for PG is established, from which it becomes clear that very high processing gains (PGs can be achieved in band-limited direct-sequence spread-spectrum (DSSS applications by using spreading sequences with zero mean, given that certain conditions regarding spectral aliasing are met. To obtain large families of even balanced (i.e., equal number of ones and zeros sequences, two design criteria are proposed, namely the ranging criterion (RC and the generating ranging criterion (GRC. PN-EB sequences in the polynomial range are derived using these criteria, and it is shown that they exhibit secondary autocorrelation and cross-correlation peaks comparable to the sequences they are derived from. The methods proposed not only facilitate the generation of large numbers of new PN-EB spreading sequences required for CDMA applications, but simultaneously offer high processing gains and good despreading characteristics in multiuser SS scenarios with band-limited noise and interference spectra. Simulation results are presented to confirm the respective claims made.
Heavy quarkonium hybrids: Spectrum, decay, and mixing
Oncala, Ruben; Soto, Joan
2017-07-01
We present a largely model-independent analysis of the lighter heavy quarkonium hybrids based on the strong coupling regime of potential nonrelativistic QCD. We calculate the spectrum at leading order, including the mixing of static hybrid states. We use potentials that fulfill the required short and long distance theoretical constraints and fit well the available lattice data. We argue that the decay width to the lower lying heavy quarkonia can be reliably estimated in some cases and provide results for a selected set of decays. We also consider the mixing with heavy quarkonium states. We establish the form of the mixing potential at O (1 /mQ) , mQ being the mass of the heavy quarks, and work out its short and long distance constraints. The weak coupling regime of potential nonrelativistic QCD and the effective string theory of QCD are used for that goal. We show that the mixing effects may indeed be important and produce large spin symmetry violations. Most of the isospin zero XYZ states fit well in our spectrum, either as a hybrid or standard quarkonium candidate.
A hybrid 3D LIDAR imager based on pixel-by-pixel scanning and DS-OCDMA
Kim, Gunzung; Eom, Jeongsook; Park, Yongwan
2016-03-01
We propose a new hybrid 3D light detection and ranging (LIDAR) system, which measures a scene with 1280 x 600 pixels at a refresh rate of 60fps. The emitted pulses of each pixel are modulated by direct sequence optical code division multiple access (DS-OCDMA) techniques. The modulated pulses include a unique device identification number, the pixel position in the line, and a checksum. The LIDAR emits the modulated pulses periodically without waiting to receive returning light at the detector. When all the pixels are completely through the process, the travel time, amplitude, width, and speed are used by the pixel-by-pixel scanning LIDAR imager to generate point cloud data as the measured results. We programmed the entire hybrid 3D LIDAR operation in a simulator to observe the functionality accomplished by our proposed model.
Coding-Spreading Tradeoff in CDMA Systems
National Research Council Canada - National Science Library
Bolas, Eduardo
2002-01-01
.... Comparing different combinations of coding and spreading with a traditional DS-CDMA, as defined in the IS-95 standard, allows the criteria to be defined for the best coding-spreading tradeoff in CDMA systems...
A Synchronisation Method For Informed Spread-Spectrum Audiowatermarking
Directory of Open Access Journals (Sweden)
Pierre-Yves Fulchiron
2003-12-01
Full Text Available Under perfect synchronisation conditions, watermarking schemes employing asymmetric spread-spectrum techniques are suitable for copy-protection of audio signals. This paper proposes to combine the use of a robust psychoacoustic projection for the extraction of a watermark feature vector along with non-linear detection functions optimised with side-information. The new proposed scheme benefits from an increased level of security through the use of asymmetric detectors. We apply this scheme to real audio signals and experimental results show an increased robustness to desynchronisation attacks such as random cropping.
Statistical inconsistencies in the KiDS-450 data set
Efstathiou, George; Lemos, Pablo
2018-05-01
The Kilo-Degree Survey (KiDS) has been used in several recent papers to infer constraints on the amplitude of the matter power spectrum and matter density at low redshift. Some of these analyses have claimed tension with the Planck Λ cold dark matter cosmology at the ˜2σ-3σ level, perhaps indicative of new physics. However, Planck is consistent with other low-redshift probes of the matter power spectrum such as redshift-space distortions and the combined galaxy-mass and galaxy-galaxy power spectra. Here, we perform consistency tests of the KiDS data, finding internal tensions for various cuts of the data at ˜2.2σ-3.5σ significance. Until these internal tensions are understood, we argue that it is premature to claim evidence for new physics from KiDS. We review the consistency between KiDS and other weak lensing measurements of S8, highlighting the importance of intrinsic alignments for precision cosmology.
International Nuclear Information System (INIS)
Schaaf, Gabriel; Betts, Laurie; Garrett, Teresa A.; Raetz, Christian R. H.; Bankaitis, Vytas A.
2006-01-01
Yeast Sfh1p, a close homolog of the Sec14p phosphatidylinositol transfer protein, was crystallized in the absence of detergent. X-ray data have been collected to 2.5 Å. Sec14p is the major phosphatidylinositol (PtdIns)/phosphatidylcholine (PtdCho) transfer protein in the budding yeast Saccharomyces cerevisiae and is the founding member of a large eukaryotic protein superfamily. This protein catalyzes the exchange of either PtdIns or PtdCho between membrane bilayers in vitro and this exchange reaction requires no external input of energy or of other protein cofactors. Despite the previous elucidation of the crystal structure of a detergent-bound form of Sec14p, the conformational changes that accompany the phospholipid-exchange reaction remain undefined. Moreover, a structural appreciation of how Sec14p or its homologs bind their various phospholipid substrates remains elusive. Here, the purification and crystallization of yeast Sfh1p, the protein most closely related to Sec14p, are reported. A combination of electrospray ionization mass-spectrometry and collision-induced decomposition mass-spectrometry methods indicate that recombinant Sfh1p loads predominantly with phosphatidylethanolamine. Unlike phospholipid-bound forms of Sec14p, this form of Sfh1p crystallizes readily in the absence of detergent. Sfh1p crystals diffract to 2.5 Å and belong to the orthorhombic primitive space group P2 1 2 1 2 1 , with unit-cell parameters a = 49.40, b = 71.55, c = 98.21 Å, α = β = γ = 90°. One Sfh1p molecule is present in the asymmetric unit (V M = 2.5 Å 3 Da −1 ; V s = 50%). Crystallization of a phospholipid-bound Sec14p-like protein is a critical first step in obtaining the first high-resolution picture of how proteins of the Sec14p superfamily bind their phospholipid ligands. This information will significantly extend our current understanding of how Sec14p-like proteins catalyze phospholipid exchange
Peng, Miao; Chen, Ming; Zhou, Hui; Wan, Qiuzhen; Jiang, LeYong; Yang, Lin; Zheng, Zhiwei; Chen, Lin
2018-01-01
High peak-to-average power ratio (PAPR) of the transmit signal is a major drawback in optical orthogonal frequency division multiplexing (OOFDM) system. In this paper, we propose and experimentally demonstrate a novel hybrid scheme, combined the Huffman coding and Discrete Fourier Transmission-Spread (DFT-spread), in order to reduce high PAPR in a 16-QAM short-reach intensity-modulated and direct-detection OOFDM (IMDD-OOFDM) system. The experimental results demonstrated that the hybrid scheme can reduce the PAPR by about 1.5, 2, 3 and 6 dB, and achieve 1.5, 1, 2.5 and 3 dB receiver sensitivity improvement compared to clipping, DFT-spread and Huffman coding and original OFDM signals, respectively, at an error vector magnitude (EVM) of -10 dB after transmission over 20 km standard single-mode fiber (SSMF). Furthermore, the throughput gain can be of the order of 30% by using the hybrid scheme compared with the cases of without applying the Huffman coding.
Analytical energy spectrum for hybrid mechanical systems
International Nuclear Information System (INIS)
Zhong, Honghua; Xie, Qiongtao; Lee, Chaohong; Guan, Xiwen; Gao, Kelin; Batchelor, Murray T
2014-01-01
We investigate the energy spectrum for hybrid mechanical systems described by non-parity-symmetric quantum Rabi models. A set of analytical solutions in terms of the confluent Heun functions and their analytical energy spectrum is obtained. The analytical energy spectrum includes regular and exceptional parts, which are both confirmed by direct numerical simulation. The regular part is determined by the zeros of the Wronskian for a pair of analytical solutions. The exceptional part is relevant to the isolated exact solutions and its energy eigenvalues are obtained by analyzing the truncation conditions for the confluent Heun functions. By analyzing the energy eigenvalues for exceptional points, we obtain the analytical conditions for the energy-level crossings, which correspond to two-fold energy degeneracy. (paper)
Angkustsiri, Kathleen; Goodlin-Jones, Beth; Deprey, Lesley; Brahmbhatt, Khyati; Harris, Susan; Simon, Tony J.
2014-01-01
High prevalence of autism spectrum disorders (ASD) has been reported in 22q11.2DS, although this has been based solely on parent report measures. This study describes the presence of ASD using a procedure more similar to that used in clinical practice by incorporating history (Social Communication Questionnaire) AND a standardized observation…
Hettiarachchi, Ranga; Yokoyama, Mitsuo; Uehara, Hideyuki
This paper presents a novel interference cancellation (IC) scheme for both synchronous and asynchronous direct-sequence code-division multiple-access (DS-CDMA) wireless channels. In the DS-CDMA system, the multiple access interference (MAI) and the near-far problem (NFP) are the two factors which reduce the capacity of the system. In this paper, we propose a new algorithm that is able to detect all interference signals as an individual MAI signal by maximum correlation detection. It is based on the discovery of all the unknowing spreading codes of the interference signals. Then, all possible MAI patterns so called replicas are generated as a summation of interference signals. And the true MAI pattern is found by taking correlation between the received signal and the replicas. Moreover, the receiver executes MAI cancellation in a successive manner, removing all interference signals by single-stage. Numerical results will show that the proposed IC strategy, which alleviates the detrimental effect of the MAI and the near-far problem, can significantly improve the system performance. Especially, we can obtain almost the same receiving characteristics as in the absense of interference for asynchrnous system when received powers are equal. Also, the same performances can be seen under any received power state for synchronous system.
Distributed Control for Autonomous Operation of a Three-Port AC/DC/DS Hybrid Microgrid
DEFF Research Database (Denmark)
Wang, Peng; Jin, Chi; Zhu, Dexuan
2015-01-01
This paper presents a distributed control scheme for reliable autonomous operation of a hybrid three-port ac/dc/distributed storage (ds) microgrid by means of power sharing in individual network, power exchange between ac and dc networks, and power management among three networks. The proposed...... distributed control scheme includes: 1) a fully decentralized control, which is achieved by local power sharing (LPS) in individual ac or dc network, global power sharing (GPS) throughout ac/dc networks, and storage power sharing (SPS) among distributed storages. Upon fully decentralized control, each power...... module can operate independently without communication links. This would benefit for riding through communication malfunction in multilayer supervision control system; 2) a multilevel power exchange control for scheduling LPS, GPS, and SPS has been developed to reduce unnecessary power exchange between...
Simulation and Comparison Between Slow and Fast FH/BPSK Spread Spectrum Using Matlab
Directory of Open Access Journals (Sweden)
Sanaa Said Kadhim
2018-02-01
Full Text Available This paper investigates the properties and applications of Frequency Hopping Spread Spectrum (FHSS. FHSS is radio communication technique by which the sender of information sends the data on a radio channel, which changes the frequency of transmission based on a predetermined sequence of code. The FHSS has many advantages over traditional modulation methods, it can overcome fading, multipath channels and interferences. Hence the interception becomes difficult. This security feature makes FHSS more preferable for military applications. At the receiver side, the signal is demodulated by the same carrier signal for which frequency changes by the same code sequences used by the sender. This paper presents two types of FHSS, slow and fast. The simulation procedures of both types were implemented and applied on Frequency Hopping /Binary Phase Shift Keying (FH/BPSK spread spectrum system using MATLAB. The simulation sequences for fast and slow frequency hopping is the same in number and frequencies of spreading carriers and both used BPSK traditional modulation type. The comparison results based on their power spectral density show that the fast frequency hopping is more resistive to noise the slow one.
Spread-spectrum communication using binary spatiotemporal chaotic codes
International Nuclear Information System (INIS)
Wang Xingang; Zhan Meng; Gong Xiaofeng; Lai, C.H.; Lai, Y.-C.
2005-01-01
We propose a scheme to generate binary code for baseband spread-spectrum communication by using a chain of coupled chaotic maps. We compare the performances of this type of spatiotemporal chaotic code with those of a conventional code used frequently in digital communication, the Gold code, and demonstrate that our code is comparable or even superior to the Gold code in several key aspects: security, bit error rate, code generation speed, and the number of possible code sequences. As the field of communicating with chaos faces doubts in terms of performance comparison with conventional digital communication schemes, our work gives a clear message that communicating with chaos can be advantageous and it deserves further attention from the nonlinear science community
Lau, Su-Ee; Schwarzacher, Trude; Othman, Rofina Yasmin; Harikrishna, Jennifer Ann
2015-08-11
The R2R3-MYB genes regulate pigmentation and morphogenesis of flowers, including flower and cell shape, and therefore have importance in the development of new varieties of orchids. However, new variety development is limited by the long breeding time required in orchids. In this study, we identified a cDNA, DhMYB1, that is expressed during flower development in a hybrid orchid, Dendrobium hybrida (Dendrobium bobby messina X Dendrobium chao phraya) then used the direct application of dsRNA to observe the effect of gene silencing on flower phenotype and floral epidermal cell shape. Flower bud development in the Dendrobium hybrid was characterised into seven stages and the time of meiosis was determined as between stages 3 to 5 when the bud is approximately half of the mature size. Scanning electron microscopy characterisation of adaxial epidermal cells of the flower perianth, showed that the petals and sepals each are divided into two distinct domains based on cell shape and size, while the labellum comprises seven domains. Thirty-two partial cDNA fragments representing R2R3-MYB gene sequences were isolated from D. hybrida. Phylogenetic analysis revealed that nine of the translated sequences were clustered with MYB sequences that are known to be involved in cell shape development and from these, DhMYB1 was selected for full length cDNA cloning and functional study. Direct application of a 430 bp dsRNA from the 3' region of DhMYB1 to emerging orchid flower buds reduced expression of DhMYB1 RNA compared with untreated control. Scanning electron microscopy of adaxial epidermal cells within domain one of the labellum of flowers treated with DhMYB1 dsRNA showed flattened epidermal cells whilst those of control flowers were conical. DhMYB1 is expressed throughout flower bud development and is involved in the development of the conical cell shape of the epidermal cells of the Dendrobium hybrida flower labellum. The direct application of dsRNA changed the phenotype of
Iterative Overlap FDE for Multicode DS-CDMA
Takeda, Kazuaki; Tomeba, Hiromichi; Adachi, Fumiyuki
Recently, a new frequency-domain equalization (FDE) technique, called overlap FDE, that requires no GI insertion was proposed. However, the residual inter/intra-block interference (IBI) cannot completely be removed. In addition to this, for multicode direct sequence code division multiple access (DS-CDMA), the presence of residual interchip interference (ICI) after FDE distorts orthogonality among the spreading codes. In this paper, we propose an iterative overlap FDE for multicode DS-CDMA to suppress both the residual IBI and the residual ICI. In the iterative overlap FDE, joint minimum mean square error (MMSE)-FDE and ICI cancellation is repeated a sufficient number of times. The bit error rate (BER) performance with the iterative overlap FDE is evaluated by computer simulation.
Data Analysis Details (DS): SE51_DS01 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available SE51_DS01 ReSpect The literature used for the MS/MS data we...re obtained from PubMed and Google Scholar, and the MS/MS data were manually digitalized. All literature use...the heights of the MS peaks in the figures were manually measured and calculated. For literature data that h...se contains 163 selected literature reports (3341 records corresponding to 2741 metabolites), Q-TOF/MS data ... data type selection (ignores all single fragments and one major fragment spectrum) and data set selection (literature, Q-TOF/MS and QqQ/MS). ...
Jamming protection of spread spectrum RFID system
Mazurek, Gustaw
2006-10-01
This paper presents a new transform-domain processing algorithm for rejection of narrowband interferences in RFID/DS-CDMA systems. The performance of the proposed algorithm has been verified via computer simulations. Implementation issues have been discussed. The algorithm can be implemented in the FPGA or DSP technology.
An adaptive digital suppression filter for direct-sequence spread-spectrum communications
Saulnier, G. J.; Das, P. K.; Milstein, L. B.
1985-09-01
This paper describes the structure of a digital implementation of the Widrow-Hoff LMS algorithm which uses a burst processing technique to obtain some hardware simplification. This adaptive system is used to suppress narrow-band interference in a direct-sequence spread-spectrum communication system. Several different narrow-band interferers are considered, and probability of error results are presented for all cases. While, in general, the results show significant improvement in performance when the LMS algorithm is used, certain disadvantages are also present and are discussed in this paper.
Development of Elite BPH-Resistant Wide-Spectrum Restorer Lines for Three and Two Line Hybrid Rice.
Fan, Fengfeng; Li, Nengwu; Chen, Yunping; Liu, Xingdan; Sun, Heng; Wang, Jie; He, Guangcun; Zhu, Yingguo; Li, Shaoqing
2017-01-01
Hybrid rice has contributed significantly to the world food security. Breeding of elite high-yield, strong-resistant broad-spectrum restorer line is an important strategy for hybrid rice in commercial breeding programs. Here, we developed three elite brown planthopper (BPH)-resistant wide-spectrum restorer lines by pyramiding big-panicle gene Gn8.1 , BPH-resistant genes Bph6 and Bph9 , fertility restorer genes Rf3, Rf4, Rf5 , and Rf6 through molecular marker assisted selection. Resistance analysis revealed that the newly developed restorer lines showed stronger BPH-resistance than any of the single-gene donor parent Luoyang-6 and Luoyang-9. Moreover, the three new restorer lines had broad spectrum recovery capabilities for Honglian CMS, Wild abortive CMS and two-line GMS sterile lines, and higher grain yields than that of the recurrent parent 9,311 under nature field conditions. Importantly, the hybrid crosses also showed good performance for grain yield and BPH-resistance. Thus, the development of elite BPH-resistant wide-spectrum restorer lines has a promising future for breeding of broad spectrum BPH-resistant high-yield varieties.
Mills, Michael S.
1993-12-01
Analytical results have shown that adaptive filtering can be a powerful tool for the rejection of narrowband interference in a direct sequence spread spectrum receiver. However, the complexity of adaptive filtering hardware has hindered the experimental validation of these results. This thesis describes a unique adaptive filter architecture for implementing the Widrow-Hoff least mean square (LMS) algorithm using two state of the art acoustic charge transport (ACT) programmable transversal filters (PTF's). Signal to noise ratio improvement measurements demonstrate the effectiveness of the adaptive filter for suppressing single- and dual-tone jammers at jammer to signal ratios (JSR's) of up to 30 dB. It is shown that the ACT adaptive interference rejection system can consistently produce 55 dB notch depths with 3-dB bandwidths as low as 300 kHz with minimal degradation to the spread spectrum signal. It is also shown that the adaptive system can eliminate single tone jammers at any frequency within the spread spectrum bandwidth at any of 10, 20, or 30 dB JSRs within 10 to 15 iterations of the adaptive algorithm. The only drawback with the adaptive system as tested is the amount of time taken to perform an iteration because of the requirement to update the PTF tap weights sequentially. Suggestions are given as to how this particular parameter of the adaptive interference system could be optimized.
Default Spread dan Term Spread sebagai Variabel Proxy Siklus Bisnis pada Model Fama-French
Directory of Open Access Journals (Sweden)
Edwin Hendra
2015-08-01
Full Text Available This research aims to apply the Fama-French models and test the effect of alternative variable of bond yield spread, default spread (RBBB – RAAA and RAAA – RF, and the term spread (RSUN10-RSUN1, as proxy variables of the business cycle, in IDX stock data during 2005-2010. Four types of asset pricing models tested are Sharpe-Lintner CAPM, Fama-French models, Hwang et al.model, and hybrid model. The results showed that the size effect and value effect has an impact on excess stock returns. Slopes of market beta, SMB, and HML are more sensitive to stock big size and high B / M. Default spreads and term spreads in Hwang et al. model can explain the value effect, and weakly explain the size effect, meanwhile the power of explanation disappeared on Hybrid models. Based on the assessment adjusted R2 and the frequency of rejection of non-zero alpha, is found that the hybrid model is the most suitable model.
Hybrid Model of Inhomogeneous Solar Wind Plasma Heating by Alfven Wave Spectrum: Parametric Studies
Ofman, L.
2010-01-01
Observations of the solar wind plasma at 0.3 AU and beyond show that a turbulent spectrum of magnetic fluctuations is present. Remote sensing observations of the corona indicate that heavy ions are hotter than protons and their temperature is anisotropic (T(sub perpindicular / T(sub parallel) >> 1). We study the heating and the acceleration of multi-ion plasma in the solar wind by a turbulent spectrum of Alfvenic fluctuations using a 2-D hybrid numerical model. In the hybrid model the protons and heavy ions are treated kinetically as particles, while the electrons are included as neutralizing background fluid. This is the first two-dimensional hybrid parametric study of the solar wind plasma that includes an input turbulent wave spectrum guided by observation with inhomogeneous background density. We also investigate the effects of He++ ion beams in the inhomogeneous background plasma density on the heating of the solar wind plasma. The 2-D hybrid model treats parallel and oblique waves, together with cross-field inhomogeneity, self-consistently. We investigate the parametric dependence of the perpendicular heating, and the temperature anisotropy in the H+-He++ solar wind plasma. It was found that the scaling of the magnetic fluctuations power spectrum steepens in the higher-density regions, and the heating is channeled to these regions from the surrounding lower-density plasma due to wave refraction. The model parameters are applicable to the expected solar wind conditions at about 10 solar radii.
Study of the Decay Bs0→Ds(*)Ds(*)
Abazov, V. M.; Abbott, B.; Abolins, M.; Acharya, B. S.; Adams, M.; Adams, T.; Aguilo, E.; Ahn, S. H.; Ahsan, M.; Alexeev, G. D.; Alkhazov, G.; Alton, A.; Alverson, G.; Alves, G. A.; Anastasoaie, M.; Ancu, L. S.; Andeen, T.; Anderson, S.; Andrieu, B.; Anzelc, M. S.; Arnoud, Y.; Arov, M.; Askew, A.; Åsman, B.; Assis Jesus, A. C. S.; Atramentov, O.; Autermann, C.; Avila, C.; Ay, C.; Badaud, F.; Baden, A.; Bagby, L.; Baldin, B.; Bandurin, D. V.; Banerjee, P.; Banerjee, S.; Barberis, E.; Barfuss, A.-F.; Bargassa, P.; Baringer, P.; Barreto, J.; Bartlett, J. F.; Bassler, U.; Bauer, D.; Beale, S.; Bean, A.; Begalli, M.; Begel, M.; Belanger-Champagne, C.; Bellantoni, L.; Bellavance, A.; Benitez, J. A.; Beri, S. B.; Bernardi, G.; Bernhard, R.; Berntzon, L.; Bertram, I.; Besançon, M.; Beuselinck, R.; Bezzubov, V. A.; Bhat, P. C.; Bhatnagar, V.; Binder, M.; Biscarat, C.; Blazey, G.; Blekman, F.; Blessing, S.; Bloch, D.; Bloom, K.; Boehnlein, A.; Boline, D.; Bolton, T. A.; Borissov, G.; Bos, K.; Bose, T.; Brandt, A.; Brock, R.; Brooijmans, G.; Bross, A.; Brown, D.; Buchanan, N. J.; Buchholz, D.; Buehler, M.; Buescher, V.; Burdin, S.; Burke, S.; Burnett, T. H.; Busato, E.; Buszello, C. P.; Butler, J. M.; Calfayan, P.; Calvet, S.; Cammin, J.; Caron, S.; Carvalho, W.; Casey, B. C. K.; Cason, N. M.; Castilla-Valdez, H.; Chakrabarti, S.; Chakraborty, D.; Chan, K.; Chan, K. M.; Chandra, A.; Charles, F.; Cheu, E.; Chevallier, F.; Cho, D. K.; Choi, S.; Choudhary, B.; Christofek, L.; Christoudias, T.; Cihangir, S.; Claes, D.; Clément, B.; Clément, C.; Coadou, Y.; Cooke, M.; Cooper, W. E.; Corcoran, M.; Couderc, F.; Cousinou, M.-C.; Crépé-Renaudin, S.; Cutts, D.; Ćwiok, M.; da Motta, H.; Das, A.; Davies, G.; de, K.; de Jong, P.; de Jong, S. J.; de La Cruz-Burelo, E.; de Oliveira Martins, C.; Degenhardt, J. D.; Déliot, F.; Demarteau, M.; Demina, R.; Denisov, D.; Denisov, S. P.; Desai, S.; Diehl, H. T.; Diesburg, M.; Dominguez, A.; Dong, H.; Dudko, L. V.; Duflot, L.; Dugad, S. R.; Duggan, D.; Duperrin, A.; Dyer, J.; Dyshkant, A.; Eads, M.; Edmunds, D.; Ellison, J.; Elvira, V. D.; Enari, Y.; Eno, S.; Ermolov, P.; Evans, H.; Evdokimov, A.; Evdokimov, V. N.; Ferapontov, A. V.; Ferbel, T.; Fiedler, F.; Filthaut, F.; Fisher, W.; Fisk, H. E.; Ford, M.; Fortner, M.; Fox, H.; Fu, S.; Fuess, S.; Gadfort, T.; Galea, C. F.; Gallas, E.; Galyaev, E.; Garcia, C.; Garcia-Bellido, A.; Gavrilov, V.; Gay, P.; Geist, W.; Gelé, D.; Gerber, C. E.; Gershtein, Y.; Gillberg, D.; Ginther, G.; Gollub, N.; Gómez, B.; Goussiou, A.; Grannis, P. D.; Greenlee, H.; Greenwood, Z. D.; Gregores, E. M.; Grenier, G.; Gris, Ph.; Grivaz, J.-F.; Grohsjean, A.; Grünendahl, S.; Grünewald, M. W.; Guo, F.; Guo, J.; Gutierrez, G.; Gutierrez, P.; Haas, A.; Hadley, N. J.; Haefner, P.; Hagopian, S.; Haley, J.; Hall, I.; Hall, R. E.; Han, L.; Hanagaki, K.; Hansson, P.; Harder, K.; Harel, A.; Harrington, R.; Hauptman, J. M.; Hauser, R.; Hays, J.; Hebbeker, T.; Hedin, D.; Hegeman, J. G.; Heinmiller, J. M.; Heinson, A. P.; Heintz, U.; Hensel, C.; Herner, K.; Hesketh, G.; Hildreth, M. D.; Hirosky, R.; Hobbs, J. D.; Hoeneisen, B.; Hoeth, H.; Hohlfeld, M.; Hong, S. J.; Hooper, R.; Houben, P.; Hu, Y.; Hubacek, Z.; Hynek, V.; Iashvili, I.; Illingworth, R.; Ito, A. S.; Jabeen, S.; Jaffré, M.; Jain, S.; Jakobs, K.; Jarvis, C.; Jesik, R.; Johns, K.; Johnson, C.; Johnson, M.; Jonckheere, A.; Jonsson, P.; Juste, A.; Käfer, D.; Kahn, S.; Kajfasz, E.; Kalinin, A. M.; Kalk, J. M.; Kalk, J. R.; Kappler, S.; Karmanov, D.; Kasper, J.; Kasper, P.; Katsanos, I.; Kau, D.; Kaur, R.; Kaushik, V.; Kehoe, R.; Kermiche, S.; Khalatyan, N.; Khanov, A.; Kharchilava, A.; Kharzheev, Y. M.; Khatidze, D.; Kim, H.; Kim, T. J.; Kirby, M. H.; Klima, B.; Kohli, J. M.; Konrath, J.-P.; Kopal, M.; Korablev, V. M.; Kotcher, J.; Kothari, B.; Koubarovsky, A.; Kozelov, A. V.; Krop, D.; Kryemadhi, A.; Kuhl, T.; Kumar, A.; Kunori, S.; Kupco, A.; Kurča, T.; Kvita, J.; Lam, D.; Lammers, S.; Landsberg, G.; Lazoflores, J.; Lebrun, P.; Lee, W. M.; Leflat, A.; Lehner, F.; Lesne, V.; Leveque, J.; Lewis, P.; Li, J.; Li, L.; Li, Q. Z.; Lietti, S. M.; Lima, J. G. R.; Lincoln, D.; Linnemann, J.; Lipaev, V. V.; Lipton, R.; Liu, Z.; Lobo, L.; Lobodenko, A.; Lokajicek, M.; Lounis, A.; Love, P.; Lubatti, H. J.; Lynker, M.; Lyon, A. L.; Maciel, A. K. A.; Madaras, R. J.; Mättig, P.; Magass, C.; Magerkurth, A.; Makovec, N.; Mal, P. K.; Malbouisson, H. B.; Malik, S.; Malyshev, V. L.; Mao, H. S.; Maravin, Y.; Martin, B.; McCarthy, R.; Melnitchouk, A.; Mendes, A.; Mendoza, L.; Mercadante, P. G.; Merkin, M.; Merritt, K. W.; Meyer, A.; Meyer, J.; Michaut, M.; Miettinen, H.; Millet, T.; Mitrevski, J.; Molina, J.; Mommsen, R. K.; Mondal, N. K.; Monk, J.; Moore, R. W.; Moulik, T.; Muanza, G. S.; Mulders, M.; Mulhearn, M.; Mundal, O.; Mundim, L.; Nagy, E.; Naimuddin, M.; Narain, M.; Naumann, N. A.; Neal, H. A.; Negret, J. P.; Neustroev, P.; Nilsen, H.; Noeding, C.; Nomerotski, A.; Novaes, S. F.; Nunnemann, T.; O'Dell, V.; O'Neil, D. C.; Obrant, G.; Ochando, C.; Oguri, V.; Oliveira, N.; Onoprienko, D.; Oshima, N.; Osta, J.; Otec, R.; Otero Y Garzón, G. J.; Owen, M.; Padley, P.; Pangilinan, M.; Parashar, N.; Park, S.-J.; Park, S. K.; Parsons, J.; Partridge, R.; Parua, N.; Patwa, A.; Pawloski, G.; Perea, P. M.; Peters, K.; Peters, Y.; Pétroff, P.; Petteni, M.; Piegaia, R.; Piper, J.; Pleier, M.-A.; Podesta-Lerma, P. L. M.; Podstavkov, V. M.; Pogorelov, Y.; Pol, M.-E.; Pompoš, A.; Pope, B. G.; Popov, A. V.; Potter, C.; Prado da Silva, W. L.; Prosper, H. B.; Protopopescu, S.; Qian, J.; Quadt, A.; Quinn, B.; Rangel, M. S.; Rani, K. J.; Ranjan, K.; Ratoff, P. N.; Renkel, P.; Reucroft, S.; Rijssenbeek, M.; Ripp-Baudot, I.; Rizatdinova, F.; Robinson, S.; Rodrigues, R. F.; Royon, C.; Rubinov, P.; Ruchti, R.; Sajot, G.; Sánchez-Hernández, A.; Sanders, M. P.; Santoro, A.; Savage, G.; Sawyer, L.; Scanlon, T.; Schaile, D.; Schamberger, R. D.; Scheglov, Y.; Schellman, H.; Schieferdecker, P.; Schmitt, C.; Schwanenberger, C.; Schwartzman, A.; Schwienhorst, R.; Sekaric, J.; Sengupta, S.; Severini, H.; Shabalina, E.; Shamim, M.; Shary, V.; Shchukin, A. A.; Shivpuri, R. K.; Shpakov, D.; Siccardi, V.; Sidwell, R. A.; Simak, V.; Sirotenko, V.; Skubic, P.; Slattery, P.; Smirnov, D.; Smith, R. P.; Snow, G. R.; Snow, J.; Snyder, S.; Söldner-Rembold, S.; Sonnenschein, L.; Sopczak, A.; Sosebee, M.; Soustruznik, K.; Souza, M.; Spurlock, B.; Stark, J.; Steele, J.; Stolin, V.; Stoyanova, D. A.; Strandberg, J.; Strandberg, S.; Strang, M. A.; Strauss, M.; Ströhmer, R.; Strom, D.; Strovink, M.; Stutte, L.; Sumowidagdo, S.; Svoisky, P.; Sznajder, A.; Talby, M.; Tamburello, P.; Tanasijczuk, A.; Taylor, W.; Telford, P.; Temple, J.; Tiller, B.; Tissandier, F.; Titov, M.; Tokmenin, V. V.; Tomoto, M.; Toole, T.; Torchiani, I.; Trefzger, T.; Trincaz-Duvoid, S.; Tsybychev, D.; Tuchming, B.; Tully, C.; Tuts, P. M.; Unalan, R.; Uvarov, L.; Uvarov, S.; Uzunyan, S.; Vachon, B.; van den Berg, P. J.; van Eijk, B.; van Kooten, R.; van Leeuwen, W. M.; Varelas, N.; Varnes, E. W.; Vartapetian, A.; Vasilyev, I. A.; Vaupel, M.; Verdier, P.; Vertogradov, L. S.; Verzocchi, M.; Villeneuve-Seguier, F.; Vint, P.; Vlimant, J.-R.; von Toerne, E.; Voutilainen, M.; Vreeswijk, M.; Wahl, H. D.; Walder, J.; Wang, L.; Wang, M. H. L. S.; Warchol, J.; Watts, G.; Wayne, M.; Weber, G.; Weber, M.; Weerts, H.; Wenger, A.; Wermes, N.; Wetstein, M.; White, A.; Wicke, D.; Wilson, G. W.; Wimpenny, S. J.; Wobisch, M.; Wood, D. R.; Wyatt, T. R.; Xie, Y.; Yacoob, S.; Yamada, R.; Yan, M.; Yasuda, T.; Yatsunenko, Y. A.; Yip, K.; Yoo, H. D.; Youn, S. W.; Yu, C.; Yu, J.; Yurkewicz, A.; Zatserklyaniy, A.; Zeitnitz, C.; Zhang, D.; Zhao, T.; Zhou, B.; Zhu, J.; Zielinski, M.; Zieminska, D.; Zieminski, A.; Zutshi, V.; Zverev, E. G.
2007-12-01
We report a study of the decay Bs0→Ds(*)Ds(*) using a data sample corresponding to 1.3fb-1 of integrated luminosity collected by the D0 experiment in 2002 2006 during run II of the Fermilab Tevatron collider. One Ds(*) meson was partially reconstructed in the decay Ds→ϕμν, and the other Ds(*) meson was identified using the decay Ds→ϕπ where no attempt was made to distinguish Ds and Ds* states. For the branching fraction Br(Bs0→Ds(*)Ds(*)) we obtain a 90% C.L. range [0.002,0.080] and central value 0.039-0.017+0.019(stat)-0.015+0.016(syst). This was subsequently used to make the most precise estimate of the width difference ΔΓsCP in the Bs0-B¯s0 system: ΔΓsCP/Γs=0.079-0.035+0.038(stat)-0.030+0.031(syst).
Efficiently Synchronized Spread-Spectrum Audio Watermarking with Improved Psychoacoustic Model
Directory of Open Access Journals (Sweden)
Xing He
2008-01-01
Full Text Available This paper presents an audio watermarking scheme which is based on an efficiently synchronized spread-spectrum technique and a new psychoacoustic model computed using the discrete wavelet packet transform. The psychoacoustic model takes advantage of the multiresolution analysis of a wavelet transform, which closely approximates the standard critical band partition. The goal of this model is to include an accurate time-frequency analysis and to calculate both the frequency and temporal masking thresholds directly in the wavelet domain. Experimental results show that this watermarking scheme can successfully embed watermarks into digital audio without introducing audible distortion. Several common watermark attacks were applied and the results indicate that the method is very robust to those attacks.
Genetic relatedness of orbiviruses by RNA-RNA blot hybridization
International Nuclear Information System (INIS)
Bodkin, D.K.
1985-01-01
RNA-RNA blot hybridization was developed in order to identify type-specific genes among double-stranded (ds) RNA viruses, to assess the genetic relatedness of dsRNA viruses and to classify new strains. Viral dsRNA segments were electrophoresed through 10% polyacrylamide gels, transferred to membranes, and hybridized to [5' 32 P]-pCp labeled genomic RNA from a related strain. Hybridization was performed at 52 0 C, 50% formamide, 5X SSC. Under these conditions heterologous RNA species must share ≥ 74% sequence homology in order to form stable dsRNA hybrids. Cognate genes of nine members of the Palyam serogroup of orbiviruses were identified and their sequence relatedness to the prototype. Palyam virus, was determined. Reciprocal blot hybridizations were performed using radiolabeled genomic RNA of all members of the Palyam serogroup. Unique and variant genes were identified by lack of cross-homology or by weak homology between segments. Since genes 2 and 6 exhibited the highest degree of sequence variability, response to the vertebrate immune system may be a major cause of sequence divergence among members of a single serogroup. Changuinola serogroup isolates were compared by dot-blot hybridization, while Colorado tick fever (CTF) serogroup isolates were compared by the RNA-RNA blot hybridization procedure described for reovirus and Palyam serogroup isolates. Preliminary blot hybridization data were also obtained on the relatedness of members of different Orbivirus serogroups
Al-Chokhachy, Robert K.; Muhlfeld, Clint C.; Boyer, Matthew; Jones, Leslie A.; Steed, Amber; Kershner, Jeffrey L.
2014-01-01
Quantifying the effectiveness of management actions to mitigate the effects of changing climatic conditions (i.e., climate adaptation) can be difficult, yet critical for conservation. We used population genetic data from 1984 to 2011 to assess the degree to which ambient climatic conditions and targeted suppression of sources of nonnative Rainbow Trout Oncorhynchus mykiss have influenced the spread of introgressive hybridization in native populations of Westslope Cutthroat Trout O. clarkii lewisi. We found rapid expansion in the spatial distribution and proportion of nonnative genetic admixture in hybridized populations from 1984 to 2004, but minimal change since 2004. The spread of hybridization was negatively correlated with the number of streamflow events in May that exceeded the 75th percentile of historic flows (r = −0.98) and positively correlated with August stream temperatures (r = 0.89). Concomitantly, suppression data showed a 60% decline in catch per unit effort for fish with a high proportion of Rainbow Trout admixture, rendering some uncertainty as to the relative strength of factors controlling the spread of hybridization. Our results illustrate the importance of initiating management actions to mitigate the potential effects of climate change, even where data describing the effectiveness of such actions are initially limited but the risks are severe.
Walker, Ernest; Chen, Xinjia; Cooper, Reginald L.
2010-04-01
An arbitrarily accurate approach is used to determine the bit-error rate (BER) performance for generalized asynchronous DS-CDMA systems, in Gaussian noise with Raleigh fading. In this paper, and the sequel, new theoretical work has been contributed which substantially enhances existing performance analysis formulations. Major contributions include: substantial computational complexity reduction, including a priori BER accuracy bounding; an analytical approach that facilitates performance evaluation for systems with arbitrary spectral spreading distributions, with non-uniform transmission delay distributions. Using prior results, augmented by these enhancements, a generalized DS-CDMA system model is constructed and used to evaluated the BER performance, in a variety of scenarios. In this paper, the generalized system modeling was used to evaluate the performance of both Walsh- Hadamard (WH) and Walsh-Hadamard-seeded zero-correlation-zone (WH-ZCZ) coding. The selection of these codes was informed by the observation that WH codes contain N spectral spreading values (0 to N - 1), one for each code sequence; while WH-ZCZ codes contain only two spectral spreading values (N/2 - 1,N/2); where N is the sequence length in chips. Since these codes span the spectral spreading range for DS-CDMA coding, by invoking an induction argument, the generalization of the system model is sufficiently supported. The results in this paper, and the sequel, support the claim that an arbitrary accurate performance analysis for DS-CDMA systems can be evaluated over the full range of binary coding, with minimal computational complexity.
Directory of Open Access Journals (Sweden)
Krishnan Sridhar
2007-01-01
Full Text Available This paper introduces a novel algorithm to excise single and multicomponent chirp-like interferences in direct sequence spread spectrum (DSSS communications. The excision algorithm consists of two stages: adaptive signal decomposition stage and directional element detection stage based on the Hough-Radon transform (HRT. Initially, the received spread spectrum signal is decomposed into its time-frequency (TF functions using an adaptive signal decomposition algorithm, and the resulting TF functions are mapped onto the TF plane. We then use a line detection algorithm based on the HRT that operates on the image of the TF plane and detects energy varying directional elements that satisfy a parametric constraint. Interference is modeled by reconstructing the corresponding TF functions detected by the HRT, and subtracted from the received signal. The proposed technique has two main advantages: (i it localizes the interferences on the TF plane with no cross-terms, thus facilitating simple filtering techniques based on thresholding of the TF functions, and is an efficient way to excise the interference; (ii it can be used for the detection of any directional interferences that can be parameterized. Simulation results with synthetic models have shown successful performance with linear and quadratic chirp interferences for single and multicomponent interference cases. The proposed method excises the interference even under very low SNR conditions of dB, and the technique could be easily extended to any interferences that could be represented by a parametric equation in the TF plane.
Ódor, G; Odor, Geza; Menyhard, Nora
1998-01-01
The damage spreading (DS) transitions of two one-dimensional stochastic cellular automata suggested by Grassberger (A and B) and the kinetic Ising model of Menyhárd (NEKIM) have been investigated on the level of kinks and spins. On the level of spins the parity conservation is not satisfied and therefore studying these models provides a convenient tool to understand the dependence of DS properties on symmetries. For the model B the critical point and the DS transition point is well separated and directed percolation damage spreading transition universality was found for spin damage as well as for kink damage in spite of the conservation of damage variables modulo 2 in the latter case. For the A stochastic cellular automaton, and the NEKIM model the two transition points coincide with drastic effects on the damage of spin and kink variables showing different time dependent behaviours. While the kink DS transition is continuous and shows regular PC class universality, the spin damage exhibits a discontinuous p...
Saulnier, G. J.; Das, P.; Milstein, L. B.
1984-11-01
Analytical results have shown that adaptive filtering can be a powerful tool for the rejection of narrow-band interference in a spread-spectrum receiver. However, the complexity of adaptive filtering hardware has hindered the experimental verification of these results. This paper describes a new adaptive filter architecture for implementing the Widrow-Hoff LMS algorithm while using only two multipliers regardless of filter order. This hardware simplification is achieved through the use of a burst processing technique. A 16-tap version of this adaptive filter constructed using charge-transfer devices (CTD's) is used to suppress a single tone jammer in a direct sequence spread-spectrum receiver. Probability of error measurements demonstrating the effectiveness of the adaptive filter for suppressing the single tone jammer along with simulation results for the optimal Weiner-Hopf filter are presented and discussed.
Ivanova, N I; Peksheva, O Iu
2009-03-01
A possibility of simultaneously detecting specific antibodies to HIV-1 and HIV-2 by enzyme immunoassay (EIA) at lower concentrations than those by immunoblotting (IB), and well as an additional possibility of earlier diagnosis of HIV infection, by identifying the HIV-1 antigen p24 lay the foundation of the "DS-EIA-HIV-AB-AG-SPECTRUM" test system made by OOO "Research-and-Production Association "Diagnosticheskiye Sistemy" (Diagnostic Systems). These peculiarities were compared with those of IB at a number of laboratories of AIDS prevention and control centers in the Volga Federal District, by using native serum/plasma samples and a specially designed control panel. The analysis of the conducted studies to identify HIV-1 and HIV-2 antibodies and HIV-1 antigen p24 in 65 plasma/serum samples in the "DS-EIA-HIV-AB-AG-SPECTRUM" and "LIA-HIV-1/2" (OOO "Niarmedik plus") test systems while confirming the positive result indicated agreement in 57 (87.7%) cases. The diagnostic possibilities of the "DS-EIA-HIV-AB-AG-SPECTRUM" test system versus the "New Lav-Blot I" one to make a laboratory diagnosis of HIV infection were studied. Irrefragable answers as to the availability of HIV-1 markers in the study serum samples on the enciphered panel were provided by IB in 73.3% of cases and EIA in 92%.
Differential Space-Time Block Code Modulation for DS-CDMA Systems
Directory of Open Access Journals (Sweden)
Liu Jianhua
2002-01-01
Full Text Available A differential space-time block code (DSTBC modulation scheme is used to improve the performance of DS-CDMA systems in fast time-dispersive fading channels. The resulting scheme is referred to as the differential space-time block code modulation for DS-CDMA (DSTBC-CDMA systems. The new modulation and demodulation schemes are especially studied for the down-link transmission of DS-CDMA systems. We present three demodulation schemes, referred to as the differential space-time block code Rake (D-Rake receiver, differential space-time block code deterministic (D-Det receiver, and differential space-time block code deterministic de-prefix (D-Det-DP receiver, respectively. The D-Det receiver exploits the known information of the spreading sequences and their delayed paths deterministically besides the Rake type combination; consequently, it can outperform the D-Rake receiver, which employs the Rake type combination only. The D-Det-DP receiver avoids the effect of intersymbol interference and hence can offer better performance than the D-Det receiver.
Directory of Open Access Journals (Sweden)
Sridhar Krishnan
2007-07-01
Full Text Available This paper introduces a novel algorithm to excise single and multicomponent chirp-like interferences in direct sequence spread spectrum (DSSS communications. The excision algorithm consists of two stages: adaptive signal decomposition stage and directional element detection stage based on the Hough-Radon transform (HRT. Initially, the received spread spectrum signal is decomposed into its time-frequency (TF functions using an adaptive signal decomposition algorithm, and the resulting TF functions are mapped onto the TF plane. We then use a line detection algorithm based on the HRT that operates on the image of the TF plane and detects energy varying directional elements that satisfy a parametric constraint. Interference is modeled by reconstructing the corresponding TF functions detected by the HRT, and subtracted from the received signal. The proposed technique has two main advantages: (i it localizes the interferences on the TF plane with no cross-terms, thus facilitating simple filtering techniques based on thresholding of the TF functions, and is an efficient way to excise the interference; (ii it can be used for the detection of any directional interferences that can be parameterized. Simulation results with synthetic models have shown successful performance with linear and quadratic chirp interferences for single and multicomponent interference cases. The proposed method excises the interference even under very low SNR conditions of −10 dB, and the technique could be easily extended to any interferences that could be represented by a parametric equation in the TF plane.
BER Performance Simulation of Generalized MC DS-CDMA System with Time-Limited Blackman Chip Waveform
Directory of Open Access Journals (Sweden)
I. Develi
2010-09-01
Full Text Available Multiple access interference encountered in multicarrier direct sequence-code division multiple access (MC DS-CDMA is the most important difficulty that depends mainly on the correlation properties of the spreading sequences as well as the shape of the chip waveforms employed. In this paper, bit error rate (BER performance of the generalized MC DS-CDMA system that employs time-limited Blackman chip waveform is presented for Nakagami-m fading channels. Simulation results show that the use of Blackman chip waveform can improve the BER performance of the generalized MC DS-CDMA system, as compared to the performances achieved by using timelimited chip waveforms in the literature.
Blind information-theoretic multiuser detection algorithms for DS-CDMA and WCDMA downlink systems.
Waheed, Khuram; Salem, Fathi M
2005-07-01
Code division multiple access (CDMA) is based on the spread-spectrum technology and is a dominant air interface for 2.5G, 3G, and future wireless networks. For the CDMA downlink, the transmitted CDMA signals from the base station (BS) propagate through a noisy multipath fading communication channel before arriving at the receiver of the user equipment/mobile station (UE/MS). Classical CDMA single-user detection (SUD) algorithms implemented in the UE/MS receiver do not provide the required performance for modern high data-rate applications. In contrast, multi-user detection (MUD) approaches require a lot of a priori information not available to the UE/MS. In this paper, three promising adaptive Riemannian contra-variant (or natural) gradient based user detection approaches, capable of handling the highly dynamic wireless environments, are proposed. The first approach, blind multiuser detection (BMUD), is the process of simultaneously estimating multiple symbol sequences associated with all the users in the downlink of a CDMA communication system using only the received wireless data and without any knowledge of the user spreading codes. This approach is applicable to CDMA systems with relatively short spreading codes but becomes impractical for systems using long spreading codes. We also propose two other adaptive approaches, namely, RAKE -blind source recovery (RAKE-BSR) and RAKE-principal component analysis (RAKE-PCA) that fuse an adaptive stage into a standard RAKE receiver. This adaptation results in robust user detection algorithms with performance exceeding the linear minimum mean squared error (LMMSE) detectors for both Direct Sequence CDMA (DS-CDMA) and wide-band CDMA (WCDMA) systems under conditions of congestion, imprecise channel estimation and unmodeled multiple access interference (MAI).
Directory of Open Access Journals (Sweden)
Святослав Аркадійович МУРАВЕЦЬКИЙ
2016-02-01
Full Text Available There have been discussed key points of operational activates in a large scale geographically spread software development projects. A look taken at required QA processes structure in such project. There have been given up to date methods of integration quality assurance processes into software development processes. There have been reviewed existing groups of software development methodologies. Such as sequential, agile and based on RPINCE2. There have been given a condensed overview of quality assurance processes in each group. There have been given a review of common challenges that sequential and agile models are having in case of large geographically spread hybrid software development project. Recommendations were given in order to tackle those challenges. The conclusions about the best methodology choice and appliance to the particular project have been made.
First observation of $\\overline{B}^{0}_{s} \\to D^{*+}_{s2}X\\mu^{-}\\overline{\
Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Agari, M; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Amoraal, J; Anderson, J; Antunes Nobrega, R; Appleby, R B; Aquines Gutierrez, O; Arefyev, A; Arrabito, L; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Basiladze, S; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belous, K; Belyaev, I; Benayoun, M; Bencivenni, G; Bernet, R; Bettler, M-O; van Beuzekom, M; Bifani, S; Bizzeti, A; Björnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bochin, B; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bos, E; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brisbane, S; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Bursche, A; Buytaert, J; Cadeddu, S; Caicedo Carvajal, J M; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Cameron, W; Camilleri, L; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Charles, M; Charpentier, Ph; Cheng, J; Chiapolini, N; Chlopik, A; Christiansen, J; Ciambrone, P; Cid Vidal, X; Clark, P J; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Constantin, F; Conti, G; Contu, A; Coombes, M; Corti, G; Cowan, G A; Currie, R; D'Almagne, B; D'Ambrosio, C; D'Antone, I; Da Silva, W; Dané, E; David, P; De Bonis, I; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Degaudenzi, H; Deissenroth, M; Del Buono, L; Deplano, C; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Dima, M; Donleavy, S; Dornan, P; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Eames, C; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Eklund, L; d'Enterria, D G; Esperante Pereira, D; Estève, L; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Flegel, W; Fontanelli, F; Forty, R; Frank, M; Frei, C; Frosini, M; Fungueirino Pazos, J L; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garrido, L; Gaspar, C; Gassner, J; Gauvin, N; Gavillet, P; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gong, G; Gong, H; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Guzik, Z; Gys, T; Haefeli, G; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, P F; He, J; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hilke, H J; Hofmann, W; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Iakovenko, V; Iglesias Escudero, C; Ilgner, C; Ilten, P; Imong, J; Jacobsson, R; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kapusta, F; Karbach, T M; Kashchuk, A; Keaveney, J; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koblitz, S; Konoplyannikov, A; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kukulak, S; Kumar, R; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, R W; Lanfranchi, G; Langenbruch, C; Latham, T; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Lehner, F; Leroy, O; Lesiak, T; Li, L; Li, Y Y; Li Gioi, L; Libby, J; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Löchner, S; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Luisier, J; M'charek, B; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Maier, A; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martin Sanchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Matveev, V; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Mclean, C; Meissner, M; Merk, M; Merkel, J; Merkin, M; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M-N; Monteil, S; Moran, D; Morawski, P; Morris, J V; Moscicki, J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Murtas, F; Muryn, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nardulli, J; Nawrot, A; Nedos, M; Needham, M; Neufeld, N; Neustroev, P; Nicol, M; Nies, S; Niess, V; Nikitin, N; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Ostankov, A; Pal, B; Palacios, J; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pauna, E; Pauna, C; Pavel, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Pessina, G; Petrella, A; Petrolini, A; Pie Valls, B; Pietrzyk, B; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Pozzi, S; du Pree, T; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Raniuk, I; Raven, G; Redford, S; Reece, W; dos Reis, A C; Ricciardi, S; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Cobo, C; Rodriguez Perez, P; Rogers, G J; Romanovsky, V; Rouvinet, J; Ruf, T; Ruiz, H; Rusinov, V; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sambade Varela, A; Sannino, M; Santacesaria, R; Santinelli, R; Santovetti, E; Sapunov, M; Saputi, A; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schmelling, M; Schmidt, B; Schneider, O; Schneider, T; Schopper, A; Schune, M -H; Schwemmer, R; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Serra, N; Serrano, J; Shao, B; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Simioni, E; Skottowe, H P; Skwarnicki, T; Smale, N; Smith, A; Smith, A C; Sobczak, K; Soler, F J P; Solomin, A; Somogy, P; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spiridenkov, E; Spradlin, P; Srednicki, A; Stagni, F; Steiner, S; Steinkamp, O; Stenyakin, O; Stoica, S; Stone, S; Storaci, B; Straumann, U; Styles, N; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Talanov, V; Tarkovskiy, E; Teodorescu, E; Terrier, H; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Topp-Joergensen, S; Tran, M T; Traynor, S; Trunk, U; Tsaregorodtsev, A; Tuning, N; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Vervink, K; Viaud, B; Videau, I; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Voong, D; Vorobyev, A; Vorobyev, An; Voss, H; Wacker, K; Wandernoth, S; Wang, J; Ward, D R; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Yang, Z; Ybeles Smit, G; Young, R; Yushchenko, O; Zavertyaev, M; Zeng, M; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zverev, E
2011-01-01
Using data collected with the LHCb detector in proton-proton collisions at a centre-of-mass energy of 7 TeV, the semileptonic decays Bs -> Ds+ X mu nu and Bs -> D0 K+ X mu nu are detected. Two structures are observed in the D0 K+ mass spectrum at masses consistent with the known D^+_{s1}(2536) and $D^{*+}_{s2}(2573) mesons. The measured branching fractions relative to the total Bs semileptonic rate are B(Bs -> D_{s2}^{*+} X mu nu)/B(Bs -> X mu nu)= (3.3\\pm 1.0\\pm 0.4)%, and B(Bs -> D_{s1}^+ X munu)/B(Bs -> X mu nu)= (5.4\\pm 1.2\\pm 0.5)%, where the first uncertainty is statistical and the second is systematic. This is the first observation of the D_{s2}^{*+} state in Bs decays; we also measure its mass and width.
FIR Filter of DS-CDMA UWB Modem Transmitter
Kang, Kyu-Min; Cho, Sang-In; Won, Hui-Chul; Choi, Sang-Sung
This letter presents low-complexity digital pulse shaping filter structures of a direct sequence code division multiple access (DS-CDMA) ultra wide-band (UWB) modem transmitter with a ternary spreading code. The proposed finite impulse response (FIR) filter structures using a look-up table (LUT) have the effect of saving the amount of memory by about 50% to 80% in comparison to the conventional FIR filter structures, and consequently are suitable for a high-speed parallel data process.
Electromagnetic effects on the self-modulation of nonlinear lower hybrid waves
International Nuclear Information System (INIS)
Hsu, P.; Kuehl, H.H.
1983-01-01
Electromagnetic effects on the self-modulation of nonlinear lower hybrid waves in an inhomogeneous plasma are studied for both broad and narrow spectrum excitations. For broad spectrum excitation, the complex modified Korteweg--de Vries equation is modified by two additional terms due to the electromagnetic correction and inhomogeneity. Numerical solutions of this equation for typical tokamak parameters show that these terms suppress soliton formation. For narrow spectrum excitation, the electromagnetic correction produces an additional dispersive term in the differential equation governing the wave envelope. This term opposes thermal dispersion, resulting in significant self-modulation. Numerical solutions show constriction and splitting of the envelope as well as spreading of the Fourier spectrum
Measurement of the Bs(0) → Ds-Ds+ and Bs(0) → D-Ds+ effective lifetimes.
Aaij, R; Adeva, B; Adinolfi, M; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andreotti, M; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Badalov, A; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Batozskaya, V; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Borsato, M; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Calabrese, R; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Cheung, S-F; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Dalseno, J; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Donleavy, S; Dordei, F; Dorosz, P; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fiorini, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianelle, A; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grillo, L; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Hafkenscheid, T W; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Khanji, B; Klaver, S; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Liles, M; Lindner, R; Linn, C; Lionetto, F; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lowdon, P; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Luppi, E; Lupton, O; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Mazurov, A; McCann, M; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morandin, M; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Onderwater, G; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Pappalardo, L; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Pessina, G; Petridis, K; Petrolini, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rachwal, B; Rademacker, J H; Rakotomiaramanana, B; Rama, M; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reichert, S; Reid, M M; Dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, A B; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rotondo, M; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Simi, G; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, E; Smith, J; Smith, M; Snoek, H; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Straticiuc, M; Straumann, U; Stroili, R; Subbiah, V K; Sun, L; Sutcliffe, W; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szilard, D; Szumlak, T; T'jampens, S; Teklishyn, M; Tellarini, G; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; de Vries, J A; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Warrington, N; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A
2014-03-21
The first measurement of the effective lifetime of the B(s)(0) meson in the decay B(s)(0) → Ds-Ds+ is reported using a proton-proton collision data set, corresponding to an integrated luminosity of 3 fb(-1), collected by the LHCb experiment. The measured value of the B(s)(0) → Ds-Ds+ effective lifetime is 1.379 ± 0.026 ± 0.017 ps, where the uncertainties are statistical and systematic, respectively. This lifetime translates into a measurement of the decay width of the light B(s)(0) mass eigenstate of ΓL = 0.725 ± 0.014 ± 0.009 ps(-1). The B(s)(0) lifetime is also measured using the flavor-specific B(s)(0)→ D-Ds+ decay to be 1.52 ± 0.15 ± 0.01 ps.
Chen, Yujing; Wang, Hai-Shui; Morisawa, Yusuke; Ozaki, Yukihiro
2014-02-01
For infrared (IR) spectral measurements, if a quality single-beam background spectrum with desired intensity could be obtained, the contributions from solvent and other background components could be completely suppressed and their bands would not appear in a final transmittance/absorbance spectrum. In order to achieve this ideal but difficult goal, the concept of hybrid single-beam spectrum is introduced in this paper. The hybrid single-beam spectrum (φ h) is defined as a mixture of two single-beam spectra (φ b1 and φ b2) of the same sample but with different pathlengths (b1 and b2), namely, φ h = αφ b1+(1-α)φ b2, where α (0 ≤ α ≤ 1) is the component factor. The properties of the hybrid spectrum have been investigated. Under conditions of b2 > b1 ≥ 0.7 b2 and A max ≤ 0.60 (Amax is the maximum absorbance of b2 sample in the spectral range of interest), all the synthesized hybrid spectra are free from significant distortion regardless of the component factor. Therefore, the hybrid single-beam spectrum with desired intensity can be easily obtained simply by choosing an appropriate component factor. The proposed methodology has been demonstrated experimentally by the complete removal of the interference from the atmospheric water vapor and solvent. © 2013 Elsevier B.V. All rights reserved.
Shima, Tomoyuki; Tomeba, Hiromichi; Adachi, Fumiyuki
Orthogonal multi-carrier direct sequence code division multiple access (orthogonal MC DS-CDMA) is a combination of time-domain spreading and orthogonal frequency division multiplexing (OFDM). In orthogonal MC DS-CDMA, the frequency diversity gain can be obtained by applying frequency-domain equalization (FDE) based on minimum mean square error (MMSE) criterion to a block of OFDM symbols and can improve the bit error rate (BER) performance in a severe frequency-selective fading channel. FDE requires an accurate estimate of the channel gain. The channel gain can be estimated by removing the pilot modulation in the frequency domain. In this paper, we propose a pilot-assisted channel estimation suitable for orthogonal MC DS-CDMA with FDE and evaluate, by computer simulation, the BER performance in a frequency-selective Rayleigh fading channel.
Avoiding the blue spectrum and the fine-tuning of initial conditions in hybrid inflation
International Nuclear Information System (INIS)
Clesse, Sebastien; Rocher, Jonathan
2009-01-01
Hybrid inflation faces two well-known problems: the blue spectrum of the nonsupersymmetric version of the model and the fine-tuning of the initial conditions of the fields leading to sufficient inflation to account for the standard cosmological problems. They are investigated by studying the exact two-fields dynamics instead of assuming slow-roll. When the field values are restricted to be less than the reduced Planck mass, a non-negligible part of the initial condition space (around 15% depending on potential parameters) leads to successful inflation. Most of it is located outside the usual inflationary valley and organized in continuous patterns instead of being isolated as previously found. Their existence is explained and their properties are studied. This shows that no excessive fine-tuning is required for successful hybrid inflation. Moreover, by extending the initial condition space to Planckian-like or super-Planckian values, inflation becomes generically sufficiently long and can produce a red-tilted scalar power spectrum due to slow-roll violations. The robustness of these properties is confirmed by conducting our analysis on three other models of hybrid-type inflation in various framework: 'smooth' and 'shifted' inflation in SUSY and SUGRA, and 'radion assisted' gauge inflation. A high percentage of successful inflation for smooth hybrid inflation (up to 80%) is observed.
Dearden, Rachel
2012-01-01
Infiltration SuDS are sustainable drainage systems (SuDS) that allow surface water to infiltrate to the ground. Examples include soakaways, infiltration basins, infiltration trenches and permeable pavements. Before planning to install Infiltration SuDS, the suitability of the ground should be assessed. The British Geological Survey has developed a bespoke Infiltration SuDS Map that enables a preliminary assessment of the suitability of the ground for infiltration SuDS. Th...
First observation of the decay Bs0-->Ds-Ds+ and measurement of its branching ratio.
Aaltonen, T; Adelman, J; Akimoto, T; Albrow, M G; Alvarez González, B; Amerio, S; Amidei, D; Anastassov, A; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Apresyan, A; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Aurisano, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Beauchemin, P-H; Bedeschi, F; Bednar, P; Behari, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Bizjak, I; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Bridgeman, A; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Buzatu, A; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carlsmith, D; Carosi, R; Carrillo, S; Carron, S; Casal, B; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Dagenhart, D; Datta, M; Davies, T; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; De Lorenzo, G; Dell'Orso, M; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; D'Onofrio, M; Donati, S; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Ferrazza, C; Field, R; Flanagan, G; Forrest, R; Forrester, S; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garberson, F; Garcia, J E; Garfinkel, A F; Gerberich, H; Gerdes, D; Giagu, S; Giakoumopolou, V; Giannetti, P; Gibson, K; Gimmell, J L; Ginsburg, C M; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Grinstein, S; Grosso-Pilcher, C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, D; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Hays, C; Heck, M; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hewamanage, S; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ivanov, A; Iyutin, B; James, E; Jayatilaka, B; Jeans, D; Jeon, E J; Jindariani, S; Johnson, W; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Kar, D; Karchin, P E; Kato, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Koay, S A; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kraus, J; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kulkarni, N P; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Lecompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Linacre, J; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Lovas, L; Lu, R-S; Lucchesi, D; Lueck, J; Luci, C; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; Macqueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Malik, S; Manca, G; Manousakis, A; Margaroli, F; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Martínez-Ballarín, R; Maruyama, T; Mastrandrea, P; Masubuchi, T; Mattson, M E; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyake, H; Moed, S; Moggi, N; Moon, C S; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Mussini, M; Nachtman, J; Nagai, Y; Nagano, A; Naganoma, J; Nakamura, K; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nodulman, L; Norman, M; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagan Griso, S; Pagliarone, C; Palencia, E; Papadimitriou, V; Papaikonomou, A; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ramakrishnan, V; Ranjan, N; Redondo, I; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Roy, P; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M A; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyria, A; Shalhout, S Z; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suslov, I; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thompson, G A; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tu, Y; Turini, N; Ukegawa, F; Uozumi, S; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Vellidis, C; Veszpremi, V; Vidal, M; Vidal, R; Vila, I; Vilar, R; Vine, T; Vogel, M; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner-Kuhr, J; Wagner, W; Wakisaka, T; Wallny, R; Wang, S M; Warburton, A; Waters, D; Weinberger, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zheng, Y; Zucchelli, S
2008-01-18
We report the observation of the exclusive decay Bs0-->Ds-Ds+ at the 7.5 standard deviation level using 355 pb(-1) of data collected by the CDF II detector in pp collisions at sqrt[s]=1.96 TeV at the Fermilab Tevatron. We measure the relative branching ratio B(Bs0-->Ds-Ds+)/B(B0-->D-Ds+)=1.44(-0.44)(+0.48). Using the world average value for B(B0-->D-Ds+), we find B(Bs0-->Ds-Ds+)=(9.4(-4.2)(+4.4))x10(-3). This provides a lower bound DeltaGammasCP/Gammas>or=2B(Bs0-->Ds-Ds+)>1.2x10(-2) at 95% C.L.
PN Sequence Preestimator Scheme for DS-SS Signal Acquisition Using Block Sequence Estimation
Directory of Open Access Journals (Sweden)
Sang Kyu Park
2005-03-01
Full Text Available An m-sequence (PN sequence preestimator scheme for direct-sequence spread spectrum (DS-SS signal acquisition by using block sequence estimation (BSE is proposed and analyzed. The proposed scheme consists of an estimator and a verifier which work according to the PN sequence chip clock, and provides not only the enhanced chip estimates with a threshold decision logic and one-chip error correction among the first m received chips, but also the reliability check of the estimates with additional decision logic. The probabilities of the estimator and verifier operations are calculated. With these results, the detection, the false alarm, and the missing probabilities of the proposed scheme are derived. In addition, using a signal flow graph, the average acquisition time is calculated. The proposed scheme can be used as a preestimator and easily implemented by changing the internal signal path of a generally used digital matched filter (DMF correlator or any other correlator that has a lot of sampling data memories for sampled PN sequence. The numerical results show rapid acquisition performance in a relatively good CNR.
Spreading Sequences Generated Using Asymmetrical Integer-Number Maps
Directory of Open Access Journals (Sweden)
V. Sebesta
2007-09-01
Full Text Available Chaotic sequences produced by piecewise linear maps can be transformed to binary sequences. The binary sequences are optimal for the asynchronous DS/CDMA systems in case of certain shapes of the maps. This paper is devoted to the one-to-one integer-number maps derived from the suitable asymmetrical piecewise linear maps. Such maps give periodic integer-number sequences, which can be transformed to the binary sequences. The binary sequences produced via proposed modified integer-number maps are perfectly balanced and embody good autocorrelation and crosscorrelation properties. The number of different binary sequences is sizable. The sequences are suitable as spreading sequences in DS/CDMA systems.
Measurement of the Bs0 → Ds (∗)+ Ds (∗)- branching fractions
Aaij, R.; Abellán Beteta, C.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; Everse, LA; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J.E.; Appleby, R. B.; Aquines Gutierrez, O.; Archilli, F.; d'Argent, P.; Artamonov, A.; Artuso, M.; Aslanides, E.; Carvalho Akiba, K.; Coco, V.; David, P. N.Y.; De Bruyn, K.; Ferro-Luzzi, M.; Heijne, V.; Ketel, T.; Koopman, R. F.; Van Leerdam, J.; Merk, M.; Onderwater, C. J.G.; Raven, G.; Schiller, M.; Serra, N.; Snoek, H.; Storaci, B.; Syropoulos, V.; Van Tilburg, J.; Tolk, S.; Tsopelas, P.; Tuning, N.
2016-01-01
The branching fraction of the decay Bs0→Ds(∗)+Ds(∗)- is measured using pp collision data corresponding to an integrated luminosity of 1.0 fb-1, collected using the LHCb detector at a center-of-mass energy of 7 TeV. It is found to be B(Bs0→Ds(∗)+Ds(∗)-)=(3.05±0.10±0.20±0.34)%, where the uncertainties
Eriksson, Anders
2014-03-13
Distinguishing between hybridization and population structure in the ancestral species is a key challenge in our understanding of how permeable species boundaries are to gene flow. The doubly conditioned frequency spectrum (dcfs) has been argued to be a powerful metric to discriminate between these two explanations, and it was used to argue for hybridization between Neandertal and anatomically modern humans. The shape of the observed dcfs for these two species cannot be reproduced by a model that represents ancient population structure in Africa with two populations, while adding hybridization produces realistic shapes. In this letter, we show that this result is a consequence of the spatial coarseness of the demographic model and that a spatially structured stepping stone model can generate realistic dcfs without hybridization. This result highlights how inferences on hybridization between recently diverged species can be strongly affected by the choice of how population structure is represented in the underlying demographic model. We also conclude that the dcfs has limited power in distinguishing between the signals left by hybridization and ancient structure. 2014 The Author.
Eriksson, Anders; Manica, Andrea
2014-01-01
Distinguishing between hybridization and population structure in the ancestral species is a key challenge in our understanding of how permeable species boundaries are to gene flow. The doubly conditioned frequency spectrum (dcfs) has been argued to be a powerful metric to discriminate between these two explanations, and it was used to argue for hybridization between Neandertal and anatomically modern humans. The shape of the observed dcfs for these two species cannot be reproduced by a model that represents ancient population structure in Africa with two populations, while adding hybridization produces realistic shapes. In this letter, we show that this result is a consequence of the spatial coarseness of the demographic model and that a spatially structured stepping stone model can generate realistic dcfs without hybridization. This result highlights how inferences on hybridization between recently diverged species can be strongly affected by the choice of how population structure is represented in the underlying demographic model. We also conclude that the dcfs has limited power in distinguishing between the signals left by hybridization and ancient structure. 2014 The Author.
Wavelet versus DCT-based spread spectrum watermarking of image databases
Mitrea, Mihai P.; Zaharia, Titus B.; Preteux, Francoise J.; Vlad, Adriana
2004-05-01
This paper addresses the issue of oblivious robust watermarking, within the framework of colour still image database protection. We present an original method which complies with all the requirements nowadays imposed to watermarking applications: robustness (e.g. low-pass filtering, print & scan, StirMark), transparency (both quality and fidelity), low probability of false alarm, obliviousness and multiple bit recovering. The mark is generated from a 64 bit message (be it a logo, a serial number, etc.) by means of a Spread Spectrum technique and is embedded into DWT (Discrete Wavelet Transform) domain, into certain low frequency coefficients, selected according to the hierarchy of their absolute values. The best results were provided by the (9,7) bi-orthogonal transform. The experiments were carried out on 1200 image sequences, each of them of 32 images. Note that these sequences represented several types of images: natural, synthetic, medical, etc. and each time we obtained the same good results. These results are compared with those we already obtained for the DCT domain, the differences being pointed out and discussed.
Wavelet based mobile video watermarking: spread spectrum vs. informed embedding
Mitrea, M.; Prêteux, F.; Duţă, S.; Petrescu, M.
2005-11-01
The cell phone expansion provides an additional direction for digital video content distribution: music clips, news, sport events are more and more transmitted toward mobile users. Consequently, from the watermarking point of view, a new challenge should be taken: very low bitrate contents (e.g. as low as 64 kbit/s) are now to be protected. Within this framework, the paper approaches for the first time the mathematical models for two random processes, namely the original video to be protected and a very harmful attack any watermarking method should face the StirMark attack. By applying an advanced statistical investigation (combining the Chi square, Ro, Fisher and Student tests) in the discrete wavelet domain, it is established that the popular Gaussian assumption can be very restrictively used when describing the former process and has nothing to do with the latter. As these results can a priori determine the performances of several watermarking methods, both of spread spectrum and informed embedding types, they should be considered in the design stage.
Takeda, Naoko; Horai, Sawako; Tamura, Jun-ichi
2016-04-07
The chondroitin sulfate (CS)/dermatan sulfate (DS) hybrid chain was extracted from specific tissues of several kinds of sharks and rays. The contents and sulfation patterns of the CS/DS hybrid chain were precisely analyzed by digestion with chondroitinases ABC and AC. All samples predominantly contained the A- and C-units. Furthermore, all samples characteristically contained the D-unit. Species-specific differences were observed in the contents of the CS/DS hybrid chain, which were the highest in Mako and Blue sharks and Sharpspine skates, but were lower in Hammerhead sharks. Marked differences were observed in the ratio of the C-unit/A-unit between sharks and rays. The contents of the CS/DS hybrid chain and the ratio of the C-unit/A-unit may be related to an oxidative stress-decreasing ability. Copyright © 2016 Elsevier Ltd. All rights reserved.
Computer code MLCOSP for multiple-correlation and spectrum analysis with a hybrid computer
International Nuclear Information System (INIS)
Oguma, Ritsuo; Fujii, Yoshio; Usui, Hozumi; Watanabe, Koichi
1975-10-01
Usage of the computer code MLCOSP(Multiple Correlation and Spectrum) developed is described for a hybrid computer installed in JAERI Functions of the hybrid computer and its terminal devices are utilized ingeniously in the code to reduce complexity of the data handling which occurrs in analysis of the multivariable experimental data and to perform the analysis in perspective. Features of the code are as follows; Experimental data can be fed to the digital computer through the analog part of the hybrid computer by connecting with a data recorder. The computed results are displayed in figures, and hardcopies are taken when necessary. Series-messages to the code are shown on the terminal, so man-machine communication is possible. And further the data can be put in through a keyboard, so case study according to the results of analysis is possible. (auth.)
User's manual for CBS3DS, version 1.0
Reddy, C. J.; Deshpande, M. D.
1995-10-01
CBS3DS is a computer code written in FORTRAN 77 to compute the backscattering radar cross section of cavity backed apertures in infinite ground plane and slots in thick infinite ground plane. CBS3DS implements the hybrid Finite Element Method (FEM) and Method of Moments (MoM) techniques. This code uses the tetrahedral elements, with vector edge basis functions for FEM in the volume of the cavity/slot and the triangular elements with the basis functions for MoM at the apertures. By virtue of FEM, this code can handle any arbitrarily shaped three-dimensional cavities filled with inhomogeneous lossy materials; due to MoM, the apertures can be of any arbitrary shape. The User's Manual is written to make the user acquainted with the operation of the code. The user is assumed to be familiar with the FORTRAN 77 language and the operating environment of the computer the code is intended to run.
Fault Detection of Aircraft Cable via Spread Spectrum Time Domain Reflectometry
Directory of Open Access Journals (Sweden)
Xudong SHI
2014-03-01
Full Text Available As the airplane cable fault detection based on TDR (time domain reflectometry is affected easily by various noise signals, which makes the reflected signal attenuate and distort heavily, failing to locate the fault. In order to solve these problems, a method of spread spectrum time domain reflectometry (SSTDR is introduced in this paper, taking the advantage of the sharp peak of correlation function. The test signal is generated from ML sequence (MLS modulated by sine wave in the same frequency. Theoretically, the test signal has the very high immunity of noise, which can be applied with excellent precision to fault location on the aircraft cable. In this paper, the method of SSTDR was normally simulated in MATLAB. Then, an experimental setup, based on LabVIEW, was organized to detect and locate the fault on the aircraft cable. It has been demonstrated that SSTDR has the high immunity of noise, reducing some detection errors effectively.
Digital Watermarks Using Discrete Wavelet Transformation and Spectrum Spreading
Directory of Open Access Journals (Sweden)
Ryousuke Takai
2003-12-01
Full Text Available In recent tears, digital media makes rapid progress through the development of digital technology. Digital media normally assures fairly high quality, nevertheless can be easily reproduced in a perfect form. This perfect reproducibility takes and advantage from a certain point of view, while it produces an essential disadvantage, since digital media is frequently copied illegally. Thus the problem of the copyright protection becomes a very important issue. A solution of this problem is to embed digital watermarks that is not perceived clearly by usual people, but represents the proper right of original product. In our method, the images data in the frequency domain are transformed by the Discrete Wavelet Transform and analyzed by the multi resolution approximation, [1]. Further, the spectrum spreading is executed by using PN-sequences. Choi and Aizawa [7] embed watermarks by using block correlation of DCT coefficients. Thus, we apply Discrete Cosine Transformation, abbreviated to DCT, instead of the Fourier transformation in order to embed watermarks.If the value of this variance is high then we decide that the block has bigger magnitude for visual fluctuations. Henceforth, we may embed stronger watermarks, which gives resistance for images processing, such as attacks and/or compressions.
Directory of Open Access Journals (Sweden)
S. Yrjölä
2016-09-01
Full Text Available This paper explores and presents scenarios and business models for mobile network operators (MNOs in the novel hybrid use spectrum sharing concept of the Ultra High Frequency broadcasting spectrum (470-790 MHz used for Digital Terrestrial TV (DTT and Mobile Broadband (MBB. More flexible use of the band could lead to higher efficiency in delivering fast growing and converging MBB, media and TV content to meet changing consumer needs. On one hand, this could be beneficial for broadcasters (BC, e.g., by preserving the spectrum, by providing additional revenues, or by lowering cost of the spectrum and, on the other hand, for MNOs to gain faster access to new potentially lower cost, licensed, below 1GHz spectrum to cope with booming data traffic. As a collaborative benefit, the concept opens up new business opportunities for delivering TV and media content using MBB network with means to introduce this flexibly. This paper highlights the importance of developing sound business models for the new spectrum use concept, as they need to provide clear benefits to the key stakeholders to be adopted in real life. The paper applies a future and action oriented approach to the MBB using the concept to derive scenarios and business models for MNOs for accessing hybrid UHF bands. In order to address the convergence and transformation coming with the concept, business models are first developed for the current situation with separate exclusive spectrum bands. Novel business scenarios are then developed for the introduction of the new flexible hybrid UHF spectrum concept. The created business model indicates that the MNOs could benefit significantly from the new UHF bands, which would enable them to cope with increasing data traffic asymmetry, and to offer differentiation through personalized broadcasting and new media services. Moreover, it could significantly re-shape the business ecosystem around both the broadcasting and the mobile broadband by introducing
On the dynamics of the power spectrum during lower hybrid current drive in Tokamaks
International Nuclear Information System (INIS)
Bizarro, J.P.
1993-01-01
An investigation is provided on the propagation and absorption of the power spectrum during lower hybrid current drive in Tokamaks. A combined ray tracing and Fokker-Planck code is utilized and stochastic effects induced by toroidicity are correctly taken into account by using a large number of rays. It is shown that when strong wave damping prevails the absorbed spectrum is very similar in shape to the launched one, although some broadening and shifting in parallel wave index generally occur, and power deposition is localized. If the wave damping is weak and stochastic effects are important, rays end up sweeping the entire plasma cross-section, power deposition turns out to be extended, and the absorbed spectrum is much broader than the launched one
DEFF Research Database (Denmark)
Demenikov, Mads
2011-01-01
to optimization results based on full-reference image measures of restored images. In comparison with full-reference measures, the kurtosis measure is fast to compute and requires no images, noise distributions, or alignment of restored images, but only the signal-to-noise-ratio. © 2011 Optical Society of America.......I propose a novel, but yet simple, no-reference, objective image quality measure based on the kurtosis of the restored point spread function. Using this measure, I optimize several phase masks for extended-depth-of-field in hybrid imaging systems and obtain results that are identical...
Institute of Scientific and Technical Information of China (English)
许光辉; 胡光锐
2005-01-01
A new Kalman filtering algorithm based on estimation of spread spectrum signal before suppression of narrowband interference (NBI) in spread spectrum systems, using the dependence of autoregressive (AR) interference, is presented compared with performance of the ACM nonlinear filtering algorithm, simulation results show that the proposed algorithm has preferable performance, there is about 5 dB SNR improvement in average.
DETERMINING AGES OF APOGEE GIANTS WITH KNOWN DISTANCES
Energy Technology Data Exchange (ETDEWEB)
Feuillet, Diane K.; Holtzman, Jon [Department of Astronomy, New Mexico State University, Las Cruces, NM 88003 (United States); Bovy, Jo [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5S 3H4 (Canada); Girardi, Léo [Osservatorio Astronomico di Padova—INAF, Vicolo dell’Osservatorio 5, I-35122 Padova (Italy); MacDonald, Nick [Department of Astronomy, University of Washington, Seattle, WA 98195 (United States); Majewski, Steven R. [Department of Astronomy, University of Virginia, Charlottesville, VA 22904 (United States); Nidever, David L., E-mail: feuilldk@nmsu.edu [Large Synoptic Survey Telescope, 950 North Cherry Avenue, Tucson, AZ 85719 (United States)
2016-01-20
We present a sample of 705 local giant stars observed using the New Mexico State University 1 m telescope with the Sloan Digital Sky Survey-III/Apache Point Observatory Galactic Evolution Experiment (APOGEE) spectrograph, for which we estimate stellar ages and the local star formation history (SFH). The high-resolution (R ∼ 22,500), near infrared (1.51–1.7 μm) APOGEE spectra provide measurements of stellar atmospheric parameters (temperature, surface gravity, [M/H], and [α/M]). Due to the smaller uncertainties in surface gravity possible with high-resolution spectra and accurate Hipparcos distance measurements, we are able to calculate the stellar masses to within 30%. For giants, the relatively rapid evolution up the red giant branch allows the age to be constrained by the mass. We examine methods of estimating age using both the mass–age relation directly and a Bayesian isochrone matching of measured parameters, assuming a constant SFH. To improve the SFH prior, we use a hierarchical modeling approach to constrain the parameters of the model SFH using the age probability distribution functions of the data. The results of an α-dependent Gaussian SFH model show a clear age–[α/M] relation at all ages. Using this SFH model as the prior for an empirical Bayesian analysis, we determine ages for individual stars. The resulting age–metallicity relation is flat, with a slight decrease in [M/H] at the oldest ages and a ∼0.5 dex spread in metallicity across most ages. For stars with ages ≲1 Gyr we find a smaller spread, consistent with radial migration having a smaller effect on these young stars than on the older stars.
Directory of Open Access Journals (Sweden)
Rojali Rojali
2012-12-01
Full Text Available The exchange of traffic information in cyberspace grows fast. In all areas of life utilize technology to exchange information. One of the media owned by many people is mobile device such as mobile phone and tablet computer. In fact many people have been using mobile devices for information exchange function, and expect information to be transmitted quickly, accurately, and safely. The information security sent will be very important when the information is confidential. One way to secure information sent is the concealment of information into a media so that information hidden is beyond recognition by the human senses, which iscommonly referred to steganography. This research studied and implemented steganography using spread spectrum Method on Android-based mobile devices. The results showed that the inserted image before and after the message was inserted is not different with PSNR value of about 75.
A Remote Direct Sequence Spread Spectrum Communications Lab Utilising the Emona DATEx
Directory of Open Access Journals (Sweden)
Cosmas Mwikirize
2012-12-01
Full Text Available Remote labs have become popular learning aids due to their versatility and considerable ease of utilisation as compared to their physical counterparts. At Makerere University, the remote labs are based on the standard Massachusetts Institute of Technology (MIT iLabs Shared Architecture (ISA - a scalable and generic platform. Presented in this paper is such a lab, addressing the key practical aspects of Direct Sequence Spread Spectrum (DSSS communication. The lab is built on the National Instruments Educational Laboratory Virtual Instrumentation Suite (NI ELVIS with the Emona Digital and Analog Telecommunications Experimenter (DATEx add-on board. It also incorporates switching hardware. The lab facilitates real-time control of the equipment, with users able to set, manipulate and observe signal parameters in both the frequency and the time domains. Simulation and data Acquisition modes of the experiment are supported to provide a richer learning experience.
International Nuclear Information System (INIS)
Cullings, Harry M.; Fujita, Shoichiro; Egbert, Stephen D.; Maruyama, Takashi; Hoshi, Masaharu
2005-01-01
The overall agreement between measurement and calculation continues to be good for DS02, as it was for DS86. In Hiroshima, the overall agreement is somewhat better for DS02 than for DS86. Agreement near the hypocenter in Hiroshima is excellent with DS02 based on the methods described in this work. Agreement at middle and longer distances in Hiroshima is better for DS02 than for DS86, although there remain some indications of measured values exceeding calculated values at longer distances. These indications must be qualified by a careful consideration of issues related to background as described in this chapter. (J.P.N.)
Edoh, Thierry
2018-04-10
The risk of spreading diseases within (ad-hoc)crowds and the need to pervasively screen asymptomatic individuals to protect the population against emerging infectious diseases, request permanentcrowd surveillance., particularly in high-risk regions. Thecase of Ebola epidemic in West Africa in recent years has shown the need for pervasive screening. The trend today in diseases surveillance is consisting of epidemiological data collection about emerging infectious diseases using social media, wearable sensors systems, or mobile applications and data analysis. This approach presents various limitations. This paper proposes a novel approach for diseases monitoring and risk prevention of spreading infectious diseases. The proposed approach, aiming at overcoming the limitation of existing disease surveillance approaches, combines the hybrid crowdsensing paradigm with sensing individuals' bio-signals using optical sensors for monitoring any risks of spreading emerging infectious diseases in any (ad-hoc) crowds. A proof-of-concept has been performed using a drone armed with a cat s60 smartphone featuring a Forward Looking Infra-Red (FLIR) camera. According to the results of the conducted experiment, the concept has the potential to improve the conventional epidemiological data collection. The measurement is reliable, and the recorded data are valid. The measurement error rates are about 8%.
DsJ(2860) as the First Radial Excitation of Ds0*(2317)
van Beveren, Eef; Rupp, George
2006-11-01
A coupled-channel model previously employed to describe the narrow Ds0*(2317) and broad D0*(2400) charmed scalar mesons is generalized so as to include all ground-state pseudoscalar-pseudoscalar and vector-vector two-meson channels. All parameters are chosen fixed at published values, except for the overall coupling constant, which is fine-tuned to reproduce the Ds0*(2317) mass. Thus, the radial excitations Ds0*(2850) and D0*(2740) are predicted, both with a width of about 50 MeV. The former state appears to correspond to the new DsJ(2860) resonance decaying to DK announced by BABAR in the course of this work. Also, the D0*(2400) resonance is roughly reproduced, though perhaps with a somewhat too low central resonance peak.
Performance of DS-UWB in MB-OFDM and multi-user interference over Nakagami-m fading channels
Mehbodniya, Abolfazl; Aissa, Sonia
2011-01-01
The mutual interference between the two ultra wideband (UWB) technologies, which use the same frequency spectrum, will be a matter of concern in the near future. In this context, we present a performance analysis of direct-sequence (DS) UWB
Murdock, Kelly L
2011-01-01
Updated version of the bestselling 3ds Max book on the market 3ds Max 2012 Bible is one of the most popular 3ds Max how-tos on the market. If you're a beginner just itching to create something right away, the Quick Start project in Part 1 is for you. If you're an experienced user checking out 3ds Max 2012's latest and greatest features, you'll love the fact that the 3ds Max 2012 Bible continues to be the most comprehensive reference on this highly complex application.Find out what's new, what's tried and true, and how creative you can get using the tips, tricks, and techniques in this must-hav
Measurement of the branching fractions of Ds+→η′X and Ds+→η′ρ+ in e+e−→Ds+Ds−
Directory of Open Access Journals (Sweden)
M. Ablikim
2015-11-01
Full Text Available We study Ds+ decays to final states involving the η′ with a 482 pb−1 data sample collected at s=4.009 GeV with the BESIII detector at the BEPCII collider. We measure the branching fractions B(Ds+→η′X=(8.8±1.8±0.5% and B(Ds+→η′ρ+=(5.8±1.4±0.4% where the first uncertainty is statistical and the second is systematic. In addition, we estimate an upper limit on the non-resonant branching ratio B(Ds+→η′π+π0<5.1% at the 90% confidence level. Our results are consistent with CLEO's recent measurements and help to resolve the disagreement between the theoretical prediction and CLEO's previous measurement of B(Ds+→η′ρ+.
National Aeronautics and Space Administration — SAOImage DS9 is an astronomical imaging and data visualization application. DS9 supports FITS images and binary tables, multiple frame buffers, region manipulation,...
Measurement of the Ds l(+)ve branching fractions and the decay constant fDs+
Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bakina, O.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Farinelli, R.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, R. P.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Y.; Huang, Z. L.; Hussain, T.; Andersson, W. Ikegami; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. W.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kiese, P.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kupsc, A.; Koehn, W.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, Q. Y.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Y. B.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. B.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ripka, M.; Rong, G.; Rosner, Ch.; Ruan, X. D.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Shi, M.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Tiemens, M.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, W.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, H.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. N.; Zhang, Y. T.; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.
2016-01-01
Using 482 pb(-1) of e(+) e(-) collision data collected at a center-of-mass energy of root s = 4.009 GeV with the BESIII detector, we measure the branching fractions of the decays D-s(+) -> u(+)v(u) and D-s(+) -> tau(+)v(tau). By constraining the ratio of decay rates of Ds(+) to tau(+)v(u) and to
Nonlinear Multiuser Receiver for Optimized Chaos-Based DS-CDMA Systems
Directory of Open Access Journals (Sweden)
S. Shaerbaf
2011-09-01
Full Text Available Chaos based communications have drawn increasing attention over the past years. Chaotic signals are derived from non-linear dynamic systems. They are aperiodic, broadband and deterministic signals that appear random in the time domain. Because of these properties, chaotic signals have been proposed to generate spreading sequences for wide-band secure communication recently. Like conventional DS-CDMA systems, chaos-based CDMA systems suffer from multi-user interference (MUI due to other users transmitting in the cell. In this paper, we propose a novel method based on radial basis function (RBF for both blind and non-blind multiuser detection in chaos-based DS-CDMA systems. We also propose a new method for optimizing generation of binary chaotic sequences using Genetic Algorithm. Simulation results show that our proposed nonlinear receiver with optimized chaotic sequences outperforms in comparison to other conventional detectors such as a single-user detector, decorrelating detector and minimum mean square error detector, particularly for under-loaded CDMA condition, which the number of active users is less than processing gain.
Chiliveri, Sai Chaitanya; Deshmukh, Mandar V
2014-02-15
The association of RDE-4 (RNAi defective 4), a protein containing two dsRBDs (dsRNA-binding domains), with long dsRNA and Dcr-1 (Dicer1 homologue) initiates the siRNA pathway in Caenorhabditis elegans. Unlike its homologues in higher eukaryotes, RDE-4 dsRBDs possess weak (micromolar) affinity for short dsRNA. With increasing length of dsRNA, RDE-4 exhibits enhanced affinity due to co-operativity. The linker and dsRBD2 are indispensable for RDE-4's simultaneous interaction with dsRNA and Dcr-1. In the present study, we have determined the solution structures of RDE-4 constructs that contain both dsRBDs and the linker region. In addition to the canonical dsRBD fold, both dsRBDs of RDE-4 show modified structural features such as truncation in the β1-β2 loop that rationalize RDE-4's relatively weak dsRNA affinity. Structure and binding studies demonstrate that dsRBD2 plays a decisive role in the RDE-4-dsRNA interaction; however, in contrast with previous findings, we found ephemeral interaction of RDE-4 dsRBD1 with dsRNA. More importantly, mutations in two tandem lysine residues (Lys217 and Lys218) in dsRBD2 impair RDE-4's dsRNA-binding ability and could obliterate RNAi initiation in C. elegans. Additionally, we postulate a structural basis for the minimal requirement of linker and dsRBD2 for RDE-4's association with dsRNA and Dcr-1.
International Nuclear Information System (INIS)
Kaul, Dean C.; Egbert, Stephen D.; Woolson, William A.
2005-01-01
In order to avoid the pitfalls that so discredited DS86 and its uncertainty estimates, and to provide DS02 uncertainties that are both defensible and credible, this report not only presents the ensemble uncertainties assembled from uncertainties in individual computational elements and radiation dose components but also describes how these relate to comparisons between observed and computed quantities at critical intervals in the computational process. These comparisons include those between observed and calculated radiation free-field components, where observations include thermal- and fast-neutron activation and gamma-ray thermoluminescence, which are relevant to the estimated systematic uncertainty for DS02. The comparisons also include those between calculated and observed survivor shielding, where the observations consist of biodosimetric measurements for individual survivors, which are relevant to the estimated random uncertainty for DS02. (J.P.N.)
Spread Spectrum Based Energy Efficient Collaborative Communication in Wireless Sensor Networks.
Ghani, Anwar; Naqvi, Husnain; Sher, Muhammad; Khan, Muazzam Ali; Khan, Imran; Irshad, Azeem
2016-01-01
Wireless sensor networks consist of resource limited devices. Most crucial of these resources is battery life, as in most applications like battle field or volcanic area monitoring, it is often impossible to replace or recharge the power source. This article presents an energy efficient collaborative communication system based on spread spectrum to achieve energy efficiency as well as immunity against jamming, natural interference, noise suppression and universal frequency reuse. Performance of the proposed system is evaluated using the received signal power, bit error rate (BER) and energy consumption. The results show a direct proportionality between the power gain and the number of collaborative nodes as well as BER and signal-to-noise ratio (Eb/N0). The analytical and simulation results of the proposed system are compared with SISO system. The comparison reveals that SISO perform better than collaborative communication in case of small distances whereas collaborative communication performs better than SISO in case of long distances. On the basis of these results it is safe to conclude that collaborative communication in wireless sensor networks using wideband systems improves the life time of nodes in the networks thereby prolonging the network's life time.
Measurement of the absolute branching fraction of Ds0 *(2317 )±→π0Ds±
Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bai, Y.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, P. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garzia, I.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, S.; Gu, Y. T.; Guo, A. Q.; Guo, L. B.; Guo, R. P.; Guo, Y. P.; Haddadi, Z.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jin, Y.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Khoukaz, A.; Kiese, P.; Kliemt, R.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuessner, M.; Kuhlmann, M.; Kupsc, A.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leiber, S.; Leithoff, H.; Leng, C.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, J. Q.; Li, K. J.; Li, Kang; Li, Ke; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. M.; Liu, Huanhuan; Liu, Huihui; Liu, J. B.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, X. L.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Meng, Z. X.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Morello, G.; Muchnoi, N. Yu.; Muramatsu, H.; Musiol, P.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Pitka, A.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rolo, M.; Rong, G.; Rosner, Ch.; Ruan, X. D.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, L.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, Meng; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, X.; Xia, Y.; Xiao, D.; Xiao, H.; Xiao, Y. J.; Xiao, Z. J.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Yang, Yifan; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yang; Zhang, Yao; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhou, Y. X.; Zhu, J.; Zhu, J.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Besiii Collaboration
2018-03-01
The process e+e-→Ds*+Ds0 *(2317 )-+c .c . is observed for the first time with the data sample of 567 pb-1 collected with the BESIII detector operating at the BEPCII collider at a center-of-mass energy √{s }=4.6 GeV . The statistical significance of the Ds0 *(2317 )± signal is 5.8 σ and the mass is measured to be (2318.3 ±1.2 ±1.2 ) MeV /c2 . The absolute branching fraction B (Ds0 *(2317 )±→π0Ds±) is measured as 1.00-0.14+0.00(stat)-0.14+0.00(syst) for the first time. The uncertainties are statistical and systematic, respectively.
Leptonic decays of the $D_s$ meson
Heister, A.; Barate, R.; De Bonis, I.; Decamp, D.; Goy, C.; Lees, J.P.; Merle, E.; Minard, M.N.; Pietrzyk, B.; Boix, G.; Bravo, S.; Casado, M.P.; Chmeissani, M.; Crespo, J.M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Grauges, E.; Martinez, M.; Merino, G.; Miquel, R.; Mir, L.M.; Pacheco, A.; Ruiz, H.; Colaleo, A.; Creanza, D.; de Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Azzurri, P.; Buchmuller, O.; Cattaneo, M.; Cerutti, F.; Clerbaux, B.; Drevermann, H.; Forty, R.W.; Frank, M.; Gianotti, F.; Greening, T.C.; Hansen, J.B.; Harvey, J.; Hutchcroft, D.E.; Janot, P.; Jost, B.; Kado, M.; Mato, P.; Moutoussi, A.; Ranjard, F.; Rolandi, Gigi; Schlatter, D.; Schneider, O.; Sguazzoni, G.; Tejessy, W.; Teubert, F.; Valassi, A.; Videau, I.; Ward, J.; Badaud, F.; Falvard, A.; Gay, P.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Waananen, A.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Bonneaud, G.; Brient, J.C.; Rouge, A.; Rumpf, M.; Swynghedauw, M.; Verderi, M.; Videau, H.; Ciulli, V.; Focardi, E.; Parrini, G.; Antonelli, A.; Antonelli, M.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Spagnolo, P.; Halley, A.; Lynch, J.G.; Negus, P.; O'Shea, V.; Raine, C.; Thompson, A.S.; Wasserbaech, S.; Cavanaugh, R.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E.E.; Putzer, A.; Sommer, J.; Stenzel, H.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Marinelli, N.; Sedgbeer, J.K.; Thompson, J.C.; Ghete, V.M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bouhova-Thacker, E.; Bowdery, C.K.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Pearson, M.R.; Robertson, N.A.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Sander, H.G.; Wachsmuth, H.; Zeitnitz, C.; Bonissent, A.; Carr, J.; Coyle, P.; Leroy, O.; Payre, P.; Rousseau, D.; Talby, M.; Ragusa, F.; David, A.; Dietl, H.; Ganis, G.; Huttmann, K.; Lutjens, G.; Mannert, C.; Manner, W.; Moser, H.G.; Settles, R.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, P.; Jacholkowska, A.; Lefrancois, J.; Veillet, J.J.; Yuan, C.; Bagliesi, Giuseppe; Boccali, T.; Foa, L.; Giammanco, A.; Giassi, A.; Ligabue, F.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciaba, A.; Tenchini, R.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Cowan, G.; Green, M.G.; Medcalf, T.; Misiejuk, A.; Strong, J.A.; Teixeira-Dias, P.; von Wimmersperg-Toeller, J.H.; Clifft, R.W.; Edgecock, T.R.; Norton, P.R.; Tomalin, I.R.; Bloch-Devaux, Brigitte; Colas, P.; Emery, S.; Kozanecki, W.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.F.; Roussarie, A.; Schuller, J.P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Konstantinidis, N.; Litke, A.M.; Taylor, G.; Booth, C.N.; Cartwright, S.; Combley, F.; Lehto, M.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Grupen, C.; Ngac, A.; Prange, G.; Sieler, U.; Giannini, G.; He, H.; Putz, J.; Rothberg, J.; Armstrong, S.R.; Berkelman, Karl; Cranmer, K.; Ferguson, D.P.S.; Gao, Y.; Gonzalez, S.; Hayes, O.J.; Hu, H.; Jin, S.; Kile, J.; McNamara, P.A., III; Nielsen, J.; Pan, Y.B.; von Wimmersperg-Toeller, J.H.; Wiedenmann, W.; Wu, J.; Wu, Sau Lan; Wu, X.; Zobernig, G.; Dissertori, G.
2002-01-01
The purely leptonic decays Ds -> tau nu and Ds -> mu nu are studied in a sample of four million hadronic Z decays collected with the ALEPH detector at the LEP e+e- collider from 1991 to 1995. The branching fractions are extracted from a combination of two analyses, one optimized to select Ds -> tau nu decays with tau -> e nu nubar or mu nu nubar, and the other optimized for Ds-> mu nu decays. The results are used to evaluate the Ds decay constant, within the Standard Model: fDs = [285 +- 19(stat) +- 40 (syst)] MeV.
DS-CDMA Receiver Based on a Five-Port Technology
Directory of Open Access Journals (Sweden)
Elvino S. Sousa
2005-07-01
Full Text Available High data rates, low-power consumption, and low complexity will be the most important parameters in the design of the next-generation mobile terminals. In this paper we are introducing a new paradigm in the design of direct sequence spread spectrum receiver by combining analog and digital signal processing. The main difference with respect to the conventional all-digital receiver design approach is that the proposed mixed analog/digital processing results in a symbol rate sampling rather than the high-rate subchip sampling. Analog signal despreading is the key part of the proposed receiver solution, which is based on a five-port device, a passive RF square-law-type device. It is used to perform two important tasks at the same time, namely, the direct conversion and analog despreading. To achieve lower complexity, the proposed receiver uses rectangular instead of pulse-matched despreading at the cost of only a small performance degradation. Also, we propose a new noncoherent pseudonoise (PN code tracking scheme based on error signal generated through the L1 norm. This results in comparable or even better PN code tracking performance than L2 norm circuitry, using less complex hardware. Further, we explore how this technology can be applied in the design of DS-CDMA RAKE receiver for mobile terminals. Depending on how the pilot signal is multiplexed, we propose two types of RAKE receivers. It is shown that under Rayleigh fading channel such receiver structures offer robustness and high performance, while maintaining the low complexity achievable through the five-port device.
Delay Estimation in Long-Code Asynchronous DS/CDMA Systems Using Multiple Antennas
Directory of Open Access Journals (Sweden)
Sirbu Marius
2004-01-01
Full Text Available The problem of propagation delay estimation in asynchronous long-code DS-CDMA multiuser systems is addressed. Almost all the methods proposed so far in the literature for propagation delay estimation are derived for short codes and the knowledge of the codes is exploited by the estimators. In long-code CDMA, the spreading code is aperiodic and the methods developed for short codes may not be used or may increase the complexity significantly. For example, in the subspace-based estimators, the aperiodic nature of the code may require subspace tracking. In this paper we propose a novel method for simultaneous estimation of the propagation delays of several active users. A specific multiple-input multiple-output (MIMO system model is constructed in a multiuser scenario. In such model the channel matrix contains information about both the users propagation delays and channel impulse responses. Consequently, estimates of the delays are obtained as a by-product of the channel estimation task. The channel matrix has a special structure that is exploited in estimating the delays. The proposed delay estimation method lends itself to an adaptive implementation. Thus, it may be applied to joint channel and delay estimation in uplink DS-CDMA analogously to the method presented by the authors in 2003. The performance of the proposed method is studied in simulation using realistic time-varying channel model and different SNR levels in the face of near-far effects, and using low spreading factor (high data rates.
Spread spectrum image data hiding in the encrypted discrete cosine transform coefficients
Zhang, Xiaoqiang; Wang, Z. Jane
2013-10-01
Digital watermarking and data hiding are important tools for digital rights protection of media data. Spread spectrum (SS)-based watermarking and data-hiding approaches are popular due to their outstanding robustness, but their security might not be sufficient. To improve the security of SS, a SS-based image data-hiding approach is proposed by encrypting the discrete cosine transform coefficients of the host image with the piecewise linear chaotic map, before the operation of watermark embedding. To evaluate the performance of the proposed approach, simulations and analyses of its robustness and security are carried out. The average bit-error-rate values on 100 real images from the Berkeley segmentation dataset under the JPEG compression, additive Gaussian noise, salt and pepper noise, and cropping attacks are reported. Experimental results show that the proposed approach can maintain the high robustness of traditional SS schemes and, meanwhile, also improve the security. The proposed approach can extend the key space of traditional SS schemes from 10 to 10 and thus can resist brute-force attack and unauthorized detection watermark attack.
Design and Analysis of Hybrid Solar Lighting and Full-Spectrum Solar Energy Systems
International Nuclear Information System (INIS)
Muhs, J.D.
2001-01-01
This paper describes a systems-level design and analysis of a new approach for improving the energy efficiency and affordability of solar energy in buildings, namely, hybrid solar lighting and full-spectrum solar energy systems. By using different portions of the solar spectrum simultaneously for multiple end-use applications in buildings, the proposed system offers unique advantages over other alternatives for using sunlight to displace electricity (conventional topside daylighting and solar technologies). Our preliminary work indicates that hybrid solar lighting, a method of collecting and distributing direct sunlight for lighting purposes, will alleviate many of the problems with passive daylighting systems of today, such as spatial and temporal variability, glare, excess illumination, cost, and energy efficiency. Similarly, our work suggests that the most appropriate use of the visible portion of direct, nondiffuse sunlight from an energy-savings perspective is to displace electric light rather than generate electricity. Early estimates detailed in this paper suggest an anticipated system cost of well under$2.0/Wp and 5-11(cents)/kWh for displaced and generated electricity in single-story commercial building applications. Based on a number of factors discussed in the paper, including sunlight availability, building use scenarios, time-of-day electric utility rates, cost, and efficacy of the displaced electric lights, the simple payback of this approach in many applications could eventually be well under 5 years
Hennelly, B. M.; Javidi, B.; Sheridan, J. T.
2005-09-01
A number of methods have been recently proposed in the literature for the encryption of 2-D information using linear optical systems. In particular the double random phase encoding system has received widespread attention. This system uses two Random Phase Keys (RPK) positioned in the input spatial domain and the spatial frequency domain and if these random phases are described by statistically independent white noises then the encrypted image can be shown to be a white noise. Decryption only requires knowledge of the RPK in the frequency domain. The RPK may be implemented using a Spatial Light Modulators (SLM). In this paper we propose and investigate the use of SLMs for secure optical multiplexing. We show that in this case it is possible to encrypt multiple images in parallel and multiplex them for transmission or storage. The signal energy is effectively spread in the spatial frequency domain. As expected the number of images that can be multiplexed together and recovered without loss is proportional to the ratio of the input image and the SLM resolution. Many more images may be multiplexed with some loss in recovery. Furthermore each individual encryption is more robust than traditional double random phase encoding since decryption requires knowledge of both RPK and a lowpass filter in order to despread the spectrum and decrypt the image. Numerical simulations are presented and discussed.
Production of D$^{**}_{s}$ mesons in hadronic Z decays
Heister, A.; Barate, R.; De Bonis, I.; Decamp, D.; Goy, C.; Lees, J.P.; Merle, E.; Minard, M.N.; Pietrzyk, B.; Boix, G.; Bravo, S.; Casado, M.P.; Chmeissani, M.; Crespo, J.M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Grauges, E.; Martinez, M.; Merino, G.; Miquel, R.; Mir, L.M.; Pacheco, A.; Ruiz, H.; Colaleo, A.; Creanza, D.; de Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Azzurri, P.; Buchmuller, O.; Cattaneo, M.; Cerutti, F.; Clerbaux, B.; Drevermann, H.; Forty, R.W.; Frank, M.; Gianotti, F.; Greening, T.C.; Hansen, J.B.; Harvey, J.; Hutchcroft, D.E.; Janot, P.; Jost, B.; Kado, M.; Mato, P.; Moutoussi, A.; Ranjard, F.; Rolandi, Gigi; Schlatter, D.; Schneider, O.; Sguazzoni, G.; Tejessy, W.; Teubert, F.; Valassi, A.; Videau, I.; Ward, J.; Badaud, F.; Falvard, A.; Gay, P.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Waananen, A.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Bonneaud, G.; Brient, J.C.; Rouge, A.; Rumpf, M.; Swynghedauw, M.; Verderi, M.; Videau, H.; Ciulli, V.; Focardi, E.; Parrini, G.; Antonelli, A.; Antonelli, M.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Spagnolo, P.; Halley, A.; Lynch, J.G.; Negus, P.; O'Shea, V.; Raine, C.; Thompson, A.S.; Wasserbaech, S.; Cavanaugh, R.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E.E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Marinelli, N.; Sedgbeer, J.K.; Thompson, J.C.; Ghete, V.M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bouhova-Thacker, E.; Bowdery, C.K.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Pearson, M.R.; Robertson, N.A.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Sander, H.G.; Wachsmuth, H.; Zeitnitz, C.; Bonissent, A.; Carr, J.; Coyle, P.; Leroy, O.; Payre, P.; Rousseau, D.; Talby, M.; Ragusa, F.; David, A.; Dietl, H.; Ganis, G.; Huttmann, K.; Lutjens, G.; Mannert, C.; Manner, W.; Moser, H.G.; Settles, R.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, P.; Jacholkowska, A.; Lefrancois, J.; Veillet, J.J.; Yuan, C.; Bagliesi, Giuseppe; Boccali, T.; Foa, L.; Giammanco, A.; Giassi, A.; Ligabue, F.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciaba, A.; Tenchini, R.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Cowan, G.; Green, M.G.; Medcalf, T.; Misiejuk, A.; Strong, J.A.; Teixeira-Dias, P.; von Wimmersperg-Toeller, J.H.; Clifft, R.W.; Edgecock, T.R.; Norton, P.R.; Tomalin, I.R.; Bloch-Devaux, Brigitte; Colas, P.; Emery, S.; Kozanecki, W.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.F.; Roussarie, A.; Schuller, J.P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Konstantinidis, N.; Litke, A.M.; Taylor, G.; Booth, C.N.; Cartwright, S.; Combley, F.; Lehto, M.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Grupen, C.; Ngac, A.; Prange, G.; Sieler, U.; Giannini, G.; Rothberg, J.; Armstrong, S.R.; Berkelman, Karl; Cranmer, K.; Ferguson, D.P.S.; Gao, Y.; Gonzalez, S.; Hayes, O.J.; Hu, H.; Jin, S.; Kile, J.; McNamara, P.A., III; Nielsen, J.; Pan, Y.B.; von Wimmersperg-Toeller, J.H.; Wiedenmann, W.; Wu, J.; Wu, Sau Lan; Wu, X.; Zobernig, G.; Dissertori, G.
2002-01-01
The production rates of the orbitally excited Ds** mesons, Ds1 and Ds2*, are measured with the 4.1 million hadronic Z decays recorded by the ALEPH detector during 1991--1995. The Ds** mesons are reconstructed in the decay modes Ds1+ -> D*+ K0, Ds1+ -> D*0 K+ and Ds2*+ -> D0 K+. The production rate of the Ds1 is measured to be n(Z->Ds1+-)=(0.52+-0.09+-0.06)%, under the assumption that the two considered decay modes of the Ds1 saturate the branching ratio. The production rate of the Ds2* is determined to be n(Z->Ds2*+-)=(0.83+-0.29+0.07-0.13)%, assuming that the branching fraction of the decay Ds2*+ -> D0 K+ is 45%. The production rates in Z->cc and Z->bbar decays are measured separately.
J /ψ →Ds ,dπ , Ds ,dK decays with perturbative QCD approach
Sun, Junfeng; Yang, Yueling; Gao, Jie; Chang, Qin; Huang, Jinshu; Lu, Gongru
2016-08-01
Besides the conventional strong and electromagnetic decay modes, the J /ψ particle can also decay via the weak interaction in the standard model. In this paper, nonleptonic J /ψ →Ds ,dπ , Ds ,dK weak decays, corresponding to the externally emitted virtual W boson process, are investigated with the perturbative QCD approach. It is found that the branching ratio for the Cabibbo-favored J /ψ →Dsπ decay can reach up to O (10-10), which might be potentially measurable at the future high-luminosity experiments.
Mastering Autodesk 3ds Max 2013
Harper, Jeffrey
2012-01-01
Get professional training in 3ds Max from this Autodesk Official Training Guide Extremely popular with video game designers as well as architects, 3ds Max offers integrated 3D modeling, animation, rendering, and compositing tools designed to streamline production. If you already have a working knowledge of 3ds Max basics, this official guide will take your skills to the next level. Detailed tutorials cover all the latest features of 3ds Max. From modeling, texturing, animation, and architectural visualization to high-level techniques for film, television, games, and more, this book provides
Modulation of repetitive genes in the parent forms of heterozygous corn hybrids
International Nuclear Information System (INIS)
Gilyazetdinov, S.Ya.; Zimnitskii, A.N.; Yakhin, I.A.; Bikbaeva, E.S.
1987-01-01
The number of copies of the genes of high-molecular-weight rRNA, 5 S r RNA, and certain other families of repetitive sequences of DNA in the genome of different forms of corn is not coordinated but is stably inherited in the same strains. The authors present the results of their investigations into the repetition of the genes of tRNA, 5 S rRNA, histones, and the controlling element Ds of corn for the highly heterozygous hybrid Slava (VIR 44 x VIR 38), the medium-heterozygous hybrid Svetoch (VIR 40 x VIR 43), the low heterozygous hybrid Iskra (VIR 26 x VIR 27), and their parent strains. The relative content of these sequences was studied by the molecular hybridization of DNA immobilized on nitrocellulose filters with [ 125 I]tRNA labeled in vitro, 5 S rRNA, histone DNA of Drosophila, and the Ds-element of corn. The DNA preparations were isolated from the zones of the meristem (1.5-2mm), elongation (4-5mm), differentiation of the roots (3 cm), of 3-4 day seedlings, and from isolated embryos of 4 h and 24 h seedlings. The DNA of the embryos immobilized on the filters was preliminarily incubated with unlabeled high-molecular-weight rRNA in the experiments with tRNA and 5 S rRNA, while when histone DNA and the Ds element of corn were used in the hybridization reaction, it was preliminary incubated with plasmid DNA
Noninvasive hemoglobin measurement using dynamic spectrum
Yi, Xiaoqing; Li, Gang; Lin, Ling
2017-08-01
Spectroscopy methods for noninvasive hemoglobin (Hgb) measurement are interfered by individual difference and particular weak signal. In order to address these problems, we have put forward a series of improvement methods based on dynamic spectrum (DS), including instrument design, spectrum extraction algorithm, and modeling approach. The instrument adopts light sources composed of eight laser diodes with the wavelength range from 600 nm to 1100 nm and records photoplethysmography signals at eight wavelengths synchronously. In order to simplify the optical design, we modulate the light sources with orthogonal square waves and design the corresponding demodulation algorithm, instead of adopting a beam-splitting system. A newly designed algorithm named difference accumulation has been proved to be effective in improving the accuracy of dynamic spectrum extraction. 220 subjects are involved in the clinical experiment. An extreme learning machine calibration model between the DS data and the Hgb levels is established. Correlation coefficient and root-mean-square error of prediction sets are 0.8645 and 8.48 g/l, respectively. The results indicate that the Hgb level can be derived by this approach noninvasively with acceptable precision and accuracy. It is expected to achieve a clinic application in the future.
d+s wave superconductivity: analysis of the electronic Raman data of YBa2Cu3O7-δ and other cuprates
International Nuclear Information System (INIS)
Nemetschek, R.; Hackl, R.; Opel, M.; Philipp, R.; Beal-Monod, M.T.; Bieri, J.B.; Maki, K.; Erb, A.; Walker, E.
1998-01-01
After briefly recalling the d+s model valid for some anisotropic high T c superconductors, we present a theory of electronic Raman spectra in that model and then compare it with new experimental data obtained for an overdoped Y123 single crystal. The d+s model appears to describe satisfactorily the experimental results, indicating a possible doping dependence of the mixing ratio. We note that the Raman spectrum of the overdoped Bi2212 could also be accounted for by the d+s superconductivity model. The case of Hg1212 (or Hg1223) is reexamined. It appears that the spontaneous breakdown of d-wave symmetry may be rather universal in high T c cuprates. (orig.)
Semi-Blind Error Resilient SLM for PAPR Reduction in OFDM Using Spread Spectrum Codes
Elhelw, Amr M.; Badran, Ehab F.
2015-01-01
High peak to average power ratio (PAPR) is one of the major problems of OFDM systems. Selected mapping (SLM) is a promising choice that can elegantly tackle this problem. Nevertheless, side information (SI) index is required to be transmitted which reduces the overall throughput. This paper proposes a semi-blind error resilient SLM system that utilizes spread spectrum codes for embedding the SI index in the transmitted symbols. The codes are embedded in an innovative manner which does not increase the average energy per symbol. The use of such codes allows the correction of probable errors in the SI index detection. A new receiver, which does not require perfect channel state information (CSI) for the detection of the SI index and has relatively low computational complexity, is proposed. Simulations results show that the proposed system performs well both in terms SI index detection error and bit error rate. PMID:26018504
Semi-Blind Error Resilient SLM for PAPR Reduction in OFDM Using Spread Spectrum Codes.
Directory of Open Access Journals (Sweden)
Amr M Elhelw
Full Text Available High peak to average power ratio (PAPR is one of the major problems of OFDM systems. Selected mapping (SLM is a promising choice that can elegantly tackle this problem. Nevertheless, side information (SI index is required to be transmitted which reduces the overall throughput. This paper proposes a semi-blind error resilient SLM system that utilizes spread spectrum codes for embedding the SI index in the transmitted symbols. The codes are embedded in an innovative manner which does not increase the average energy per symbol. The use of such codes allows the correction of probable errors in the SI index detection. A new receiver, which does not require perfect channel state information (CSI for the detection of the SI index and has relatively low computational complexity, is proposed. Simulations results show that the proposed system performs well both in terms SI index detection error and bit error rate.
Subramaniam, R; Shanthalingam, S; Bavananthasivam, J; Kugadas, A; Raghavan, B; Batra, S A; Herndon, C N; Rodriguez, J; Tibary, A; Nelson, D; Potter, K A; Foreyt, W J; Srikumaran, S
2014-06-04
Bighorn sheep (BHS, Ovis canadensis) are much more susceptible than domestic sheep (DS, Ovis aries) to pneumonia caused by leukotoxin (Lkt)-producing members of the Family Pasteurellaceae, particularly Mannheimia haemolytica and Bibersteinia trehalosi. Leukotoxin is widely accepted as the critical virulence factor of these bacteria since Lkt-negative mutants do not cause death of BHS. Typically, DS carry Lkt-positive M. haemolytica and/or B. trehalosi as commensal bacteria in their nasopharynx. In contrast, most BHS do not carry Lkt-positive M. haemolytica or B. trehalosi, or carry Lkt-negative strains in their nasopharynx. In previous studies, we demonstrated that unimmunized DS resist M. haemolytica challenge while BHS succumb to it. We hypothesized that Lkt-neutralizing antibodies, induced by Lkt-positive M. haemolytica and/or B. trehalosi innately carried by DS in their nasopharynx, render them less susceptible to infection by these bacteria. In this study we developed BHS×DS F1 hybrids by artificial insemination of domestic ewes with BHS semen. F1 hybrids were fertile, and produced F2 hybrids and back-crosses. The F1, F2, and back-crosses were raised together with domestic ewes. All these animals acquired Lkt-positive M. haemolytica and/or B. trehalosi, and developed high titers of Lkt-neutralizing antibodies in the absence of vaccination. Furthermore, all of these animals resisted challenge with lethal dose of M. haemolytica. These results suggest that lack of previous exposure to Lkt is at least partially responsible for fatal pneumonia in BHS when they acquire Lkt-positive M. haemolytica and/or B. trehalosi from DS when the two species commingle. Copyright © 2014 Elsevier B.V. All rights reserved.
Carter, John C; Capone, George T; Gray, Robert M; Cox, Christiane S; Kaufmann, Walter E
2007-01-05
The present study extends our previous work characterizing the behavioral features of autistic-spectrum disorder (ASD) in Down syndrome (DS) using the Aberrant Behavior Checklist (ABC) and Autism Behavior Checklist (AutBehav). We examined which specific behaviors distinguished the behavioral phenotype of DS + ASD from other aberrant behavior disorders in DS, by determining the relative contribution of ABC and AutBehav subscales and items to the diagnosis of ASD. A total of 127 subjects (aged 2-24 years; mean age: 8.4 years; approximately 70% male), comprising: a cohort of 64 children and adolescents with DS and co-morbid ASD (DS + ASD), 19 with DS and stereotypic movement disorder (DS + SMD), 18 with DS and disruptive behaviors (DS + DB), and 26 with DS and no co-morbid behavior disorders (DS + none) were examined using the aforementioned measures of aberrant behavior. We found that subjects with DS + ASD showed the most severe aberrant behavior, especially stereotypy compared to DS + none and lethargy/social withdrawal and relating problems compared to DS + SMD. Specifically, relatively simple stereotypic behavior differentiated DS + ASD from DS + DB, whereas odd/bizarre stereotypic and anxious behavior characterized DS + ASD relative to DS + SMD and DS + none. Additionally, in a subset of subjects with DS + ASD and anxiety, social withdrawal was particularly pronounced. Overall, our findings indicate that a diagnosis of DS + ASD represents a distinctive set of aberrant behaviors marked by characteristic odd/bizarre stereotypic behavior, anxiety, and social withdrawal.
Directory of Open Access Journals (Sweden)
Gerstacker WolfgangH
2010-01-01
Full Text Available A well-known receiver strategy for direct-sequence code-division multiple-access (DS-CDMA transmission is iterative soft decision interference cancellation. For calculation of soft estimates used for cancellation, the distribution of residual interference is commonly assumed to be Gaussian. In this paper, we analyze matched filter-based iterative soft decision interference cancellation (MF ISDIC when utilizing an approximation of the actual probability density function (pdf of residual interference. In addition, a hybrid scheme is proposed, which reduces computational complexity by considering the strongest residual interferers according to their pdf while the Gaussian assumption is applied to the weak residual interferers. It turns out that the bit error ratio decreases already noticeably when only a small number of residual interferers is regarded according to their pdf. For the considered DS-CDMA transmission the bit error ratio decreases by 80% for high signal-to-noise ratios when modeling all residual interferers but the strongest three to be Gaussian distributed.
Wavepacket propagation and current startup near the lower hybrid frequency in the torus
International Nuclear Information System (INIS)
Ohkubo, K.; Matsumura, Y.; Mizuno, M.; Matsuoka, M.; Matsuura, K.
1987-08-01
In addition to the two-dimensional propagation of wavepacket, electron heating and current drive by a lower hybrid wave in afterglow plasmas are investigated in a small torus. Because the wavepacket, which has a wide frequency spectrum, spreads in space and time due to dispersion, the pulse width of a received wavepacket accompanied with frequency shift increases. The experimental results including the direct observed group and phase velocities agree with the theoretical analysis. Lower hybrid waves with low power ( < 10 W and ≅ 100 μs) above the threshold power (≅ 0.3 W) are observed which heat electrons and drive the toroidal current. The power threshold is related to the power dependence on parametric instability. It is pointed out that parametrically excited lower hybrid waves take part in both electron heating and filling up the spectral gap which is closely related to current startup. (author)
Dual-Source Swept-Source Optical Coherence Tomography Reconstructed on Integrated Spectrum
Directory of Open Access Journals (Sweden)
Shoude Chang
2012-01-01
Full Text Available Dual-source swept-source optical coherence tomography (DS-SSOCT has two individual sources with different central wavelengths, linewidth, and bandwidths. Because of the difference between the two sources, the individually reconstructed tomograms from each source have different aspect ratio, which makes the comparison and integration difficult. We report a method to merge two sets of DS-SSOCT raw data in a common spectrum, on which both data have the same spectrum density and a correct separation. The reconstructed tomographic image can seamlessly integrate the two bands of OCT data together. The final image has higher axial resolution and richer spectroscopic information than any of the individually reconstructed tomography image.
Adaptive, full-spectrum solar energy system
Muhs, Jeffrey D.; Earl, Dennis D.
2003-08-05
An adaptive full spectrum solar energy system having at least one hybrid solar concentrator, at least one hybrid luminaire, at least one hybrid photobioreactor, and a light distribution system operably connected to each hybrid solar concentrator, each hybrid luminaire, and each hybrid photobioreactor. A lighting control system operates each component.
International Nuclear Information System (INIS)
Billaud, Y; Kaiss, A; Drissi, M; Pizzo, Y; Porterie, B; Zekri, N; Acem, Z; Collin, A; Boulet, P; Santoni, P-A; Bosseur, F
2012-01-01
This paper presents the latest developments and validation results of a hybrid model which combines a broad-scale stochastic small-world network model with a macroscopic deterministic approach, to simulate the effects of large fires burning in heterogeneous landscapes. In the extended version of the model, vegetation is depicted as an amorphous network of combustible cells, and both radiation and convection from the flaming zone are considered in the preheating process of unburned cells. Examples are given to illustrate small-world effects and fire behavior near the percolation threshold. The model is applied to a Mediterranean fire that occurred in Corsica in 2009 showing a good agreement in terms of rate of spread, and area and shape of the burn. A study, based on a fractional factorial plan, is conducted to evaluate the influence of variations of model parameters on fire propagation.
Subband Adaptive Array for DS-CDMA Mobile Radio
Directory of Open Access Journals (Sweden)
Tran Xuan Nam
2004-01-01
Full Text Available We propose a novel scheme of subband adaptive array (SBAA for direct-sequence code division multiple access (DS-CDMA. The scheme exploits the spreading code and pilot signal as the reference signal to estimate the propagation channel. Moreover, instead of combining the array outputs at each output tap using a synthesis filter and then despreading them, we despread directly the array outputs at each output tap by the desired user's code to save the synthesis filter. Although its configuration is far different from that of 2D RAKEs, the proposed scheme exhibits relatively equivalent performance of 2D RAKEs while having less computation load due to utilising adaptive signal processing in subbands. Simulation programs are carried out to explore the performance of the scheme and compare its performance with that of the standard 2D RAKE.
Schwartz, Chad; Fang, Huaming; Huang, Lisa; Guo, Peixuan
2012-03-01
Many cells and double-stranded DNA (dsDNA) viruses contain an AAA(+) ATPase that assembles into oligomers, often hexamers, with a central channel. The dsDNA packaging motor of bacteriophage phi29 also contains an ATPase to translocate dsDNA through a dodecameric channel. The motor ATPase has been investigated substantially in the context of the entire procapsid. Here, we report the sequential action between the ATPase and additional motor components. It is suggested that the contact of ATPase to ATP resulted in its conformational change to a higher binding affinity toward dsDNA. It was found that ATP hydrolysis led to the departure of dsDNA from the ATPase/dsDNA complex, an action that is speculated to push dsDNA to pass the connector channel. Our results suggest that dsDNA packaging goes through a combined effort of both the gp16 ATPase for pushing and the channel as a one-way valve to control the dsDNA translocation direction. Many packaging models have previously been proposed, and the packaging mechanism has been contingent upon the number of nucleotides packaged per ATP relative to the 10.5 bp per helical turn for B-type dsDNA. Both 2 and 2.5 bp per ATP have been used to argue for four, five or six discrete steps of dsDNA translocation. Combination of the two distinct roles of gp16 and connector renews the perception of previous dsDNA packaging energy calculations and provides insight into the discrepancy between 2 and 2.5 bp per ATP.
Crossing the borders and the cultural gaps for educating PhDs in software engineering
DEFF Research Database (Denmark)
Sørensen, Lene Tolstrup; Knutas, Antti; Seffah, Ahmed
2017-01-01
PhDs and educators. While large universities and research centres have the required expertise and infrastructure to providing a cost-effective training by research as well as covering wide spectrum of software engineering topics, the situation in small universities with limited resources...... is challenging. This is even more difficult for some countries where the discipline of software engineering is totally new, which is the case of emerging countries. This paper describes the Pathways to PhDs project funded by the European Commission. The long-term aim is to support the development, modernization...... and international visibility and excellence of higher education, namely education by research at the PhD level in Europe, while helping partner countries to develop new PhD programs and consolidate existing ones in the field of computing in the area of software engineering. This paper presents the creation...
Performance of DS-UWB in MB-OFDM and multi-user interference over Nakagami-m fading channels
Mehbodniya, Abolfazl
2011-01-18
The mutual interference between the two ultra wideband (UWB) technologies, which use the same frequency spectrum, will be a matter of concern in the near future. In this context, we present a performance analysis of direct-sequence (DS) UWB communication in the presence of multiband orthogonal frequency division multiplexing (MB-OFDM) UWB interfering transmissions. The channel fading is modeled according to Nakagami-m distribution, and multi-user interference is taken into account. The DS-UWB system performance is evaluated in terms of bit error rate (BER). Specifically, using the characteristic function approach, an analytical expression for the average BER is derived conditioned on the channel impulse response. Numerical and simulation results are provided and compared for different coexistence scenarios. © 2011 John Wiley & Sons, Ltd.
International Nuclear Information System (INIS)
Xu, Yuanpei; Xuan, Yimin; Yang, Lili
2015-01-01
Highlights: • A novel photon management method is proposed for hybrid photovoltaic–thermoelectric systems. • Composite structured surfaces enable creditable ultra-broadband anti-reflection property. • Incorporation of anti-reflection and light-trapping brings spectral absorption and transmission. • The efficient photon management of the structured surface is also omnidirectional. - Abstract: In this paper, a novel ultra-broadband photon management structure is proposed for crystalline silicon thin-film solar cells used in the photovoltaic–thermoelectric hybrid system. Nanostructures are employed on both front and back side. Optical behavior of the structure in ultra-broadband (300–2500 nm) are investigated through the Finite Difference Time Domain method. By combing moth-eye and inverted-parabolic surface, a new composite surface structure is proposed for anti-reflection in the ultra-broadband wavelengths. Front metallic nanoparticles, plasmonic back reflector and metallic gratings are studied for light-trapping and the effect of plasmonic back reflector is validated by the experimental data of the external quantum efficiency. The effects of incident angle are discussed for metallic gratings. Numerical computation shows that the incorporation of anti-reflection and light-trapping can obtain high absorption in the solar cell and ensure the rest incident light transmits to the thermoelectric generator efficiently. This work shows potential full-spectrum utilization of solar energy for various photovoltaic devices related with hybrid photovoltaic–thermoelectric systems
Directory of Open Access Journals (Sweden)
Buzzi Stefano
2006-01-01
Full Text Available The problem of joint channel estimation, equalization, and multiuser detection for a multiantenna DS/CDMA system operating over a frequency-selective fading channel and adopting long aperiodic spreading codes is considered in this paper. First of all, we present several channel estimation and multiuser data detection schemes suited for multiantenna long-code DS/CDMA systems. Then, a multipass strategy, wherein the data detection and the channel estimation procedures exchange information in a recursive fashion, is introduced and analyzed for the proposed scenario. Remarkably, this strategy provides, at the price of some attendant computational complexity increase, excellent performance even when very short training sequences are transmitted, and thus couples together the conflicting advantages of both trained and blind systems, that is, good performance and no wasted bandwidth, respectively. Space-time coded systems are also considered, and it is shown that the multipass strategy provides excellent results for such systems also. Likewise, it is also shown that excellent performance is achieved also when each user adopts the same spreading code for all of its transmit antennas. The validity of the proposed procedure is corroborated by both simulation results and analytical findings. In particular, it is shown that adopting the multipass strategy results in a remarkable reduction of the channel estimation mean-square error and of the optimal length of the training sequence.
Parker, Greg S; Eckert, Debra M; Bass, Brenda L
2006-05-01
In organisms ranging from Arabidopsis to humans, Dicer requires dsRNA-binding proteins (dsRBPs) to carry out its roles in RNA interference (RNAi) and micro-RNA (miRNA) processing. In Caenorhabditis elegans, the dsRBP RDE-4 acts with Dicer during the initiation of RNAi, when long dsRNA is cleaved to small interfering RNAs (siRNAs). RDE-4 is not required in subsequent steps, and how RDE-4 distinguishes between long dsRNA and short siRNA is unclear. We report the first detailed analysis of RDE-4 binding, using purified recombinant RDE-4 and various truncated proteins. We find that, similar to other dsRBPs, RDE-4 is not sequence-specific. However, consistent with its in vivo roles, RDE-4 binds with higher affinity to long dsRNA. We also observe that RDE-4 is a homodimer in solution, and that the C-terminal domain of the protein is required for dimerization. Using extracts from wild-type and rde-4 mutant C. elegans, we show that the C-terminal dimerization domain is required for the production of siRNA. Our findings suggest a model for RDE-4 function during the initiation of RNAi.
Moss, Jo; Richards, Caroline; Nelson, Lisa; Oliver, Chris
2013-01-01
We evaluated the proportion of individuals with Down syndrome (DS: N = 108) who met criteria for autism spectrum disorder (ASD) on the Social Communication Questionnaire and the severity of ASD-related symptomatology in this group. The proportions of individuals with DS meeting the cut-off for ASD and autism in this sample were 19% and 8%,…
Directory of Open Access Journals (Sweden)
Ratana Tacharoenmuang
Full Text Available The emergence and rapid spread of unusual DS-1-like intergenogroup reassortant rotavirus strains have been recently reported in Asia, Australia, and Europe. During rotavirus surveillance in Thailand in 2013-2014, novel DS-1-like intergenogroup reassortant strains having G8P[8] genotypes (i.e., strains KKL-17, PCB-79, PCB-84, PCB-85, PCB-103, SKT-107, SWL-12, NP-130, PCB-656, SKT-457, SSKT-269, and SSL-55 were identified in stool samples from hospitalized children with severe diarrhea. In this study, we determined and characterized the complete genomes of these 12 strains (seven strains, KKL-17, PCB-79, PCB-84, PCB-85, PCB-103, SKT-107, and SWL-12, found in 2013 (2013 strains, and five, NP-130, PCB-656, SKT-457, SSKT-269, and SSL-55, in 2014 (2014 strains. On full genomic analysis, all 12 strains showed a unique genotype constellation comprising a mixture of genogroup 1 and 2 genes: G8-P[8]-I2-R2-C2-M2-A2-N2-T2-E2-H2. With the exception of the G genotype, the unique genotype constellation of the 12 strains (P[8]-I2-R2-C2-M2-A2-N2-T2-E2-H2 was found to be shared with DS-1-like intergenogroup reassortant strains. On phylogenetic analysis, six of the 11 genes of the 2013 strains (VP4, VP2, VP3, NSP1, NSP3, and NSP5 appeared to have originated from DS-1-like intergenogroup reassortant strains, while the remaining four (VP7, VP6, VP1, and NSP2 and one (NSP4 gene appeared to be of bovine and human origin, respectively. Thus, the 2013 strains appeared to be reassortant strains as to DS-1-like intergenogroup reassortant, bovine, bovine-like human, and/or human rotaviruses. On the other hand, five of the 11 genes of the 2014 strains (VP4, VP2, VP3, NSP1, and NSP3 appeared to have originated from DS-1-like intergenogroup reassortant strains, while three (VP7, VP1, and NSP2 and one (NSP4 were assumed to be of bovine and human origin, respectively. Notably, the remaining two genes, VP6 and NSP5, of the 2014 strains appeared to have originated from locally
Suppressing epidemic spreading in multiplex networks with social-support
Chen, Xiaolong; Wang, Ruijie; Tang, Ming; Cai, Shimin; Stanley, H. Eugene; Braunstein, Lidia A.
2018-01-01
Although suppressing the spread of a disease is usually achieved by investing in public resources, in the real world only a small percentage of the population have access to government assistance when there is an outbreak, and most must rely on resources from family or friends. We study the dynamics of disease spreading in social-contact multiplex networks when the recovery of infected nodes depends on resources from healthy neighbors in the social layer. We investigate how degree heterogeneity affects the spreading dynamics. Using theoretical analysis and simulations we find that degree heterogeneity promotes disease spreading. The phase transition of the infected density is hybrid and increases smoothly from zero to a finite small value at the first invasion threshold and then suddenly jumps at the second invasion threshold. We also find a hysteresis loop in the transition of the infected density. We further investigate how an overlap in the edges between two layers affects the spreading dynamics. We find that when the amount of overlap is smaller than a critical value the phase transition is hybrid and there is a hysteresis loop, otherwise the phase transition is continuous and the hysteresis loop vanishes. In addition, the edge overlap allows an epidemic outbreak when the transmission rate is below the first invasion threshold, but suppresses any explosive transition when the transmission rate is above the first invasion threshold.
Linear theory of equatorial spread F
International Nuclear Information System (INIS)
Hudson, M.K.; Kennel, C.F.
1975-01-01
A fluid dispersion relation for the drift and interchange (Rayleigh-Taylor) modes in a collisional plasma forms the basis for a linear theory of equatorial spread F. The collisional drift mode growth rate will exceed the growth rate of the Rayleigh-Taylor mode at short perpendicular wavelengths and density gradient scale lengths, and the drift mode can grow on top side as well as on bottom side density gradients. However, below the F peak, where spread F predominates, it is concluded that both the drift and the Rayleigh-Taylor modes contribute to the total spread F spectrum, the Rayleigh-Taylor mode dominating at long and the drift mode at short perpendicular wavelengths above the ion Larmor radius
Directory of Open Access Journals (Sweden)
Masahiro Yasukawa
2018-05-01
Full Text Available In this study, pressure-retarded osmosis (PRO performance of a 5-inch scale cellulose triacetate (CTA-based hollow fiber (HF membrane module was evaluated under a wide range of operating conditions (0.0–6.0 MPa of applied pressure, 0.5–2.0 L/min feed solution (FS inlet flow rate, 1.0–6.0 L/min DS inlet flow rate and 0.1–0.9 M draw solution (DS concentration by using a PRO/reverse osmosis (RO hybrid system. The subsequent RO system for DS regeneration enabled the evaluation of the steady-stated module performance. In the case of pilot-scale module operation, since the DS dilution and the feed solution (FS up-concentration had occurred and was not negligible, unlike the lab-scale experiment, PRO performance strongly depended on operating conditions such as inlet flow rates of both the DS and FS concentration. To compare the module performance with different configurations, we proposed a converted parameter in which a difference of the packing density between the spiral wound (SW and the HF module was fairly considered. In the case of HF configuration, because of high packing density, volumetric-based performance was higher than that of SW module, that is, the required number of the module would be less than that of SW module in a full-scale PRO plant.
[A quick algorithm of dynamic spectrum photoelectric pulse wave detection based on LabVIEW].
Lin, Ling; Li, Na; Li, Gang
2010-02-01
Dynamic spectrum (DS) detection is attractive among the numerous noninvasive blood component detection methods because of the elimination of the main interference of the individual discrepancy and measure conditions. DS is a kind of spectrum extracted from the photoelectric pulse wave and closely relative to the artery blood. It can be used in a noninvasive blood component concentration examination. The key issues in DS detection are high detection precision and high operation speed. The precision of measure can be advanced by making use of over-sampling and lock-in amplifying on the pick-up of photoelectric pulse wave in DS detection. In the present paper, the theory expression formula of the over-sampling and lock-in amplifying method was deduced firstly. Then in order to overcome the problems of great data and excessive operation brought on by this technology, a quick algorithm based on LabVIEW and a method of using external C code applied in the pick-up of photoelectric pulse wave were presented. Experimental verification was conducted in the environment of LabVIEW. The results show that by the method pres ented, the speed of operation was promoted rapidly and the data memory was reduced largely.
Eufrasio, R. T.; Lehmer, B. D.; Zezas, A.; Dwek, E.; Arendt, R. G.; Basu-Zych, A.; Wiklind, T.; Yukita, M.; Fragos, T.; Hornschemeier, A. E.; Markwardt, L.; Ptak, A.; Tzanavaris, P.
2017-12-01
We present LIGHTNING, a new spectral energy distribution fitting procedure, capable of quickly and reliably recovering star formation history (SFH) and extinction parameters. The SFH is modeled as discrete steps in time. In this work, we assumed lookback times of 0-10 Myr, 10-100 Myr, 0.1-1 Gyr, 1-5 Gyr, and 5-13.6 Gyr. LIGHTNING consists of a fully vectorized inversion algorithm to determine SFH step intensities and combines this with a grid-based approach to determine three extinction parameters. We apply our procedure to the extensive far-UV-to-far-IR photometric data of M51, convolved to a common spatial resolution and pixel scale, and make the resulting maps publicly available. We recover, for M51a, a peak star formation rate (SFR) between 0.1 and 5 Gyr ago, with much lower star formation activity over the past 100 Myr. For M51b, we find a declining SFR toward the present day. In the outskirt regions of M51a, which includes regions between M51a and M51b, we recover an SFR peak between 0.1 and 1 Gyr ago, which corresponds to the effects of the interaction between M51a and M51b. We utilize our results to (1) illustrate how UV+IR hybrid SFR laws vary across M51 and (2) provide first-order estimates for how the IR luminosity per unit stellar mass varies as a function of the stellar age. From the latter result, we find that IR emission from dust heated by stars is not always associated with young stars and that the IR emission from M51b is primarily powered by stars older than 5 Gyr.
DS-Connect: The Down Syndrome Registry
... for Caregivers (NDSS) (10 MB PDF) Now Recruiting Attitudes towards usage of Green tea extract (EGCG) in Individuals with DS If ... the Indiana University to rec... Read more about Attitudes towards usage of Green tea extract (EGCG) in Individuals with DS Alzheimer's ...
A bio-hybrid DNA rotor-stator nanoengine that moves along predefined tracks.
Valero, Julián; Pal, Nibedita; Dhakal, Soma; Walter, Nils G; Famulok, Michael
2018-06-01
Biological motors are highly complex protein assemblies that generate linear or rotary motion, powered by chemical energy. Synthetic motors based on DNA nanostructures, bio-hybrid designs or synthetic organic chemistry have been assembled. However, unidirectionally rotating biomimetic wheel motors with rotor-stator units that consume chemical energy are elusive. Here, we report a bio-hybrid nanoengine consisting of a catalytic stator that unidirectionally rotates an interlocked DNA wheel, powered by NTP hydrolysis. The engine consists of an engineered T7 RNA polymerase (T7RNAP-ZIF) attached to a dsDNA nanoring that is catenated to a rigid rotating dsDNA wheel. The wheel motor produces long, repetitive RNA transcripts that remain attached to the engine and are used to guide its movement along predefined ssDNA tracks arranged on a DNA nanotube. The simplicity of the design renders this walking nanoengine adaptable to other biological nanoarchitectures, facilitating the construction of complex bio-hybrid structures that achieve NTP-driven locomotion.
Measurement of the $D_s^+ - D_s^-$ production asymmetry in 7 TeV pp collisions
Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li, Y; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Miglioranzi, S; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A
2012-01-01
Heavy quark production in 7 TeV centre-of-mass energy $pp$ collisions at the LHC is not necessarily flavour symmetric. The production asymmetry, $A_P$, between $D_s^+$ and $D_s^-$ mesons is studied using the $\\phi\\pi^\\pm$ decay mode in a data sample of 1.0 fb$^{-1}$ collected with the LHCb detector. The difference between $\\pi^+$ and $\\pi^-$ detection efficiencies is determined using the ratios of fully reconstructed to partially reconstructed $D^{*\\pm}$ decays. The overall production asymmetry in the $D_s$ rapidity region 2.0 to 4.5 with transverse momentum larger than 2 GeV is measured to be $A_P=(-0.33 \\pm 0.22 \\pm 0.10)\\%$. This result can constrain models of heavy flavour production.
Introducing Autodesk 3ds Max 2011
Derakhshani, Dariush
2010-01-01
An Autodesk Official Training Guide to 3ds Max 2011. 3ds Max is a popular 3D animation-and-effects software used in movies, visual effects, games, cartoons, short films, commercials, and other animation. However, it also presents a number of challenges to newcomers. This introduction to the latest version breaks down the complexities of learning 3D software and walks you through the basics of modeling, texturing, animating, and using visual effects. Real-world examples from talented beginning 3ds max users motivate you to learn the software and helpful tutorials offer realistic, professional c
International Nuclear Information System (INIS)
Arata, Yoshiaki; Zhang, Yue Chang
2000-01-01
We observed a new phenomena that the enormous amount of deuterium/hydrogen can be absorbed quickly as a 'solute-atom' into fine metal powders embedded inside a double-structure (DS) cathode in the electrolyses of D 2 O and H 2 O-electrolytes, respectively, but such highly deuterated powders can be produced only using DS-cathode immersed in D 2 O-electrolyte; [DS-D 2 O], and never generated in H 2 O-electrolyte even using the DS-cathode; [DS-H 2 O]. On the other hand, [Bulk-D 2 O] with bulk-cathode made by the bulk Pd metal never produces highly deuterated metal as mentioned above even though using D 2 O-electrolyte. In short, the deuterium-concentration generating in [Bulk-D 2 O] is found to be much lower than that in [DS-D 2 O]. As a result, because of reason mentioned above, in marked contrast to the case with the [DS-D 2 O], neither excess heat nor 4 He production are observed with both [DS-H 2 O] and [Bulk-D 2 O]. (author)
Kaminski, Krzysztof
2017-01-01
The multifunctional ligands application is an emerging approach in drug delivery, mainly in the treatment of diseases with complex pathology, such as Alzheimer's, cancer, and epilepsy. Using this method many biomolecules with different properties are combined to form a single unit that can provide a complex broad spectrum activity. Thus, a new type of hybrid anticonvulsants based on the pyrrolidine-2,5-dione frame are detailed with the aim of acquiring more effective antiepileptic drugs (AED) that could suppress various human convulsions. These hybrid molecules attach to the chemical particles of clinically relevant AEDs such as ethosuximide, levetiracetam, and lacosamide. As a result of this hybridization process the compounds obtained were effective in three most important animal epilepsy models, namely the maximal electroshock seizure (MES) test, the subcutaneous pentylenetetrazole (scPTZ) test, and the six-Hertz (6 Hz) model in mice. These substances displayed wider spectrum of protection, more potent efficacy, and better safety profile than the aforementioned AEDs. Several compounds were also active in the formalin model of persistent pain in mice. The in vitro ligand binding studies have proved that the most conceivable molecular mechanism of anticonvulsant and antinociceptive action was the influence on the neuronal voltage-sensitive sodium and L-type calcium channels. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
A fluorescence sedimentation assay for dsDNA antibodies
DEFF Research Database (Denmark)
Duus, K; Draborg, A H; Güven, E
2017-01-01
The Farr assay is a radioimmunoassay (RIA) for dsDNA antibodies, based on antibody precipitation using ammonium sulphate and quantification using radio-labelled dsDNA. The RIA-Farr assay offers outstanding clinical specificity and sensitivity for systemic lupus erythematosus (SLE) compared to other...... on precipitation with polyethylene glycol (PEG) and fluorescence of EvaGreen intercalated in dsDNA as detection principle. As dsDNA antibodies are quantified using fluorescence, the disadvantages of working with radioactivity are eliminated. The Fluoro-Farr assay was developed and validated, and the diagnostic...
Directory of Open Access Journals (Sweden)
Yanlong Wang
Full Text Available We previously screened the novel gene Ds-26-16 from a 4 M salt-stressed Dunaliella salina cDNA library and discovered that this gene conferred salt tolerance to broad-spectrum organisms, including E. coli (Escherichia coli, Haematococcus pluvialis and tobacco. To determine the mechanism of this gene conferring salt tolerance, we studied the proteome of E. coli overexpressing the full-length cDNA of Ds-26-16 using the iTRAQ (isobaric tags for relative and absolute quantification approach. A total of 1,610 proteins were identified, which comprised 39.4% of the whole proteome. Of the 559 differential proteins, 259 were up-regulated and 300 were down-regulated. GO (gene ontology and KEGG (Kyoto encyclopedia of genes and genomes enrichment analyses identified 202 major proteins, including those involved in amino acid and organic acid metabolism, energy metabolism, carbon metabolism, ROS (reactive oxygen species scavenging, membrane proteins and ABC (ATP binding cassette transporters, and peptidoglycan synthesis, as well as 5 up-regulated transcription factors. Our iTRAQ data suggest that Ds-26-16 up-regulates the transcription factors in E. coli to enhance salt resistance through osmotic balance, energy metabolism, and oxidative stress protection. Changes in the proteome were also observed in E. coli overexpressing the ORF (open reading frame of Ds-26-16. Furthermore, pH, nitric oxide and glycerol content analyses indicated that Ds-26-16 overexpression increases nitric oxide content but has no effect on glycerol content, thus confirming that enhanced nitric oxide synthesis via lower intercellular pH was one of the mechanisms by which Ds-26-16 confers salt tolerance to E. coli.
Energy Technology Data Exchange (ETDEWEB)
Endo, Satoru; Hoshi, Masaharu; Takada, Jun [Hiroshima Univ. (Japan). Research Inst. for Radiation Biology and Medicine; Iwatani, Kazuo; Oka, Takamitsu; Shizuma, Kiyoshi; Imanaka, Tetsuji; Fujita, Shoichiro; Hasai, Hiromi
1999-06-01
The depth profile of {sup 152}Eu activity induced in a large granite stone pillar by Hiroshima atomic bomb neutrons was calculated by a Monte Carlo N-Particle Transport Code (MCNP). The pillar was on the Motoyasu Bridge, located at a distance of 132 m (WSW) from the hypocenter. It was a square column with a horizontal sectional size of 82.5 cm x 82.5 cm and height of 179 cm. Twenty-one cells from the north to south surface at the central height of the column were specified for the calculation and {sup 152}Eu activities for each cell were calculated. The incident neutron spectrum was assumed to be the angular fluence data of the Dosimetry System 1986 (DS86). The angular dependence of the spectrum was taken into account by dividing the whole solid angle into twenty-six directions. The calculated depth profile of specific activity did not agree with the measured profile. A discrepancy was found in the absolute values at each depth with a mean multiplication factor of 0.58 and also in the shape of the relative profile. The results indicated that a reassessment of the neutron energy spectrum in DS86 is required for correct dose estimation. (author)
Data Analysis Details (DS): SE40_DS1 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available tware without cut off value and peaks are extracted from the text files by PowerFT ...SE40_DS1 PowerGet analysis for detection of all peaks Raw data files are converted to text file by MSGet sof
Data Analysis Details (DS): SE41_DS1 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available tware without cut off value and peaks are extracted from the text files by PowerFT ...SE41_DS1 PowerGet analysis for detection of all peaks Raw data files are converted to text file by MSGet sof
Blind Multiuser Detection by Kurtosis Maximization for Asynchronous Multirate DS/CDMA Systems
Directory of Open Access Journals (Sweden)
Peng Chun-Hsien
2006-01-01
Full Text Available Chi et al. proposed a fast kurtosis maximization algorithm (FKMA for blind equalization/deconvolution of multiple-input multiple-output (MIMO linear time-invariant systems. This algorithm has been applied to blind multiuser detection of single-rate direct-sequence/code-division multiple-access (DS/CDMA systems and blind source separation (or independent component analysis. In this paper, the FKMA is further applied to blind multiuser detection for multirate DS/CDMA systems. The ideas are to properly formulate discrete-time MIMO signal models by converting real multirate users into single-rate virtual users, followed by the use of FKMA for extraction of virtual users' data sequences associated with the desired user, and recovery of the data sequence of the desired user from estimated virtual users' data sequences. Assuming that all the users' spreading sequences are given a priori, two multirate blind multiuser detection algorithms (with either a single receive antenna or multiple antennas, which also enjoy the merits of superexponential convergence rate and guaranteed convergence of the FKMA, are proposed in the paper, one based on a convolutional MIMO signal model and the other based on an instantaneous MIMO signal model. Some simulation results are then presented to demonstrate their effectiveness and to provide a performance comparison with some existing algorithms.
Ac-induced disruption of the doubleDs structure in tomato
Rommens, Caius M.T.; Biezen, Erik A. van der; Ouwerkerk, Pieter B.F.; Nijkamp, H. John J.; Hille, Jacques
1991-01-01
The maize doubleDs element is stably maintained in the tomato genome. Upon the subsequent introduction of Ac into a plant containing doubleDs, disruption of the doubleDs structure and DNA rearrangements at the site of the doubleDs element were observed. No indications were obtained for excision of
Greening, E
2013-01-01
A search for non-resonant $D^{+}_{(s)} \\rightarrow \\pi^+ \\mu^+ \\mu^-$ and $D^{+}_{(s)} \\rightarrow \\pi^- \\mu^+ \\mu^+$ decays is performed using 1.0 $fb^{-1}$ of proton-proton collisions at s = 7 TeV recorded by the LHCb experiment. No signals are observed and the world's best limits on the branching fractions are set.
Directory of Open Access Journals (Sweden)
Dongxiao Niu
2012-01-01
Full Text Available Because clean energy and traditional energy have different advantages and disadvantages, it is of great significance to evaluate comprehensive benefits for hybrid power systems. Based on thorough analysis of important characters on hybrid power systems, an index system including security, economic benefit, environmental benefit, and social benefit is established in this paper. Due to advantages of processing abundant uncertain and fuzzy information, vague set is used to determine the decision matrix. Convert vague decision matrix to real one by vague combination ruleand determine uncertain degrees of different indexes by grey incidence analysis, then the mass functions of different comment set in different indexes are obtained. Information can be fused in accordance with Dempster-Shafer (D-S combination rule and the evaluation result is got by vague set and D-S evidence theory. A simulation of hybrid power system including thermal power, wind power, and photovoltaic power in China is provided to demonstrate the effectiveness and potential of the proposed design scheme. It can be clearly seen that the uncertainties in decision making can be dramatically decreased compared with existing methods in the literature. The actual implementation results illustrate that the proposed index system and evaluation model based on vague set and D-S evidence theory are effective and practical to evaluate comprehensive benefit of hybrid power system.
Directory of Open Access Journals (Sweden)
Bharat Rekhi
2011-01-01
Full Text Available Benign nerve sheath tumors include schwannomas, neurofibromas and perineuriomas. The malignant counterpart of a nerve sheath tumor is designated as a malignant peripheral nerve sheath tumor (MPNST. Lately, benign nerve sheath tumors comprising more than one component have been described, including hybrid schwannomas/perineuriomas. However, malignant transformation in a hybrid schwannoma/perineurioma has not been documented so far. Herein, we present a rare case of a young adult male who presented with a soft tissue mass in his right thigh that was excised elsewhere and submitted to us for histopathological review. One of the tissue sections displayed histopathological features of a hybrid schwannoma/perineurioma, including alternate arrangement of benign schwann and perineurial cells, reinforced with S100-P and epithelial membrane antigen positivity, respectively, along with low MIB1 and negative p53 immunostaining. The other two tissue sections showed a spindly sarcomatous tumor that was immunohistochemically positive for S100-P, CD34, p53 and exhibited high MIB1 (30-40%. Diagnosis of a MPNST arising in a hybrid schwannoma/perineurioma was made. This unusual case forms yet another addition to the spectrum of a MPNST.
Measurement of the CP-Violating Phase phi(s) in (B)over-bar(s)(0) -> Ds+Ds- Decays
Aaij, R.; Abellan Beteta, C.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Anderson, J.; Andreassen, R.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Battista, V.; Bay, A.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Onderwater, G.; Pellegrino, A.; Wilschut, H. W.
2014-01-01
We present a measurement of the CP-violating weak mixing phase phi(s) using the decay (B) over bar (0)(s) -> Ds+Ds- in a data sample corresponding to 3.0 fb(-1) of integrated luminosity collected with the LHCb detector in pp collisions at center-of-mass energies of 7 and 8 TeV. An analysis of the
Bona, Ana Caroline Dalla; Chitolina, Rodrigo Faitta; Fermino, Marise Lopes; de Castro Poncio, Lisiane; Weiss, Avital; Lima, José Bento Pereira; Paldi, Nitzan; Bernardes, Emerson Soares; Henen, Jonathan; Maori, Eyal
2016-07-14
Mosquitoes host and pass on to humans a variety of disease-causing pathogens such as infectious viruses and other parasitic microorganisms. The emergence and spread of insecticide resistance is threatening the effectiveness of current control measures for common mosquito vector borne diseases, such as malaria, dengue and Zika. Therefore, the emerging resistance to the widely used pyrethroid insecticides is an alarming problem for public health. Herein we demonstrated the use of RNA interference (RNAi) to increase susceptibility of adult mosquitoes to a widely used pyrethroid insecticide. Experiments were performed on a field-collected pyrethroid resistant strain of Ae. aegypti (Rio de Janeiro; RJ). Larvae from the resistant Ae. aegypti population were soaked with double-stranded RNAs (dsRNAs) that correspond either to voltage-gate sodium channel (VGSC), P-glycoprotein, or P450 detoxification genes and reared to adulthood. Adult mortality rates in the presence of various Deltamethrin pyrethroid concentrations were used to assess mosquito insecticide susceptibility. We characterized the RJ Ae. aegypti strain with regard to its level of resistance to a pyrethroid insecticide and found that it was approximately 6 times more resistant to Deltamethrin compared to the laboratory Rockefeller strain. The RJ strain displayed a higher frequency of Val1016Ile and Phe1534Cys substitutions of the VGSC gene. The resistant strain also displayed a higher basal expression level of VGSC compared to the Rockefeller strain. When dsRNA-treated mosquitoes were subjected to a standard pyrethroid contact bioassay, only dsRNA targeting VGSC increased the adult mortality of the pyrethroid resistant strain. The dsRNA treatment proved effective in increasing adult mosquito susceptibility over a range of pyrethroid concentrations and these results were associated with dsRNA-specific small interfering RNAs in treated adults, and the corresponding specific down regulation of VGSC gene expression
Aad, Georges; Abdallah, Jalal; Abdinov, Ovsat; Aben, Rosemarie; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abreu, Ricardo; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Affolder, Tony; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Ahlen, Steven; Ahmadov, Faig; Aielli, Giulio; Akerstedt, Henrik; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alberghi, Gian Luigi; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alexa, Calin; Alexander, Gideon; Alexopoulos, Theodoros; Alhroob, Muhammad; Alimonti, Gianluca; Alio, Lion; Alison, John; Alkire, Steven Patrick; Allbrooke, Benedict; Allport, Phillip; Aloisio, Alberto; Alonso, Alejandro; Alonso, Francisco; Alpigiani, Cristiano; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Άlvarez Piqueras, Damián; Alviggi, Mariagrazia; Amadio, Brian Thomas; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Amidei, Dante; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anders, John Kenneth; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Angelidakis, Stylianos; Angelozzi, Ivan; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Arabidze, Giorgi; Arai, Yasuo; Araque, Juan Pedro; Arce, Ayana; Arduh, Francisco Anuar; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arnold, Hannah; Arratia, Miguel; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ashkenazi, Adi; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Axen, Bradley; Ayoub, Mohamad Kassem; Azuelos, Georges; Baak, Max; Baas, Alessandra; Bacci, Cesare; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bain, Travis; Baines, John; Baker, Oliver Keith; Balek, Petr; Balestri, Thomas; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Bannoura, Arwa A E; Bansil, Hardeep Singh; Barak, Liron; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnes, Sarah Louise; Barnett, Bruce; Barnett, Michael; Barnovska, Zuzana; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Basalaev, Artem; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batista, Santiago Juan; Batley, Richard; Battaglia, Marco; Bauce, Matteo; Bauer, Florian; Bawa, Harinder Singh; Beacham, James Baker; Beattie, Michael David; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Kathrin; Becker, Maurice; Becker, Sebastian; Beckingham, Matthew; Becot, Cyril; Beddall, Andrew; Beddall, Ayda; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Janna Katharina; Belanger-Champagne, Camille; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bender, Michael; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Bentvelsen, Stan; Beresford, Lydia; Beretta, Matteo; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Beringer, Jürg; Bernard, Clare; Bernard, Nathan Rogers; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertoli, Gabriele; Bertolucci, Federico; Bertsche, Carolyn; Bertsche, David; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia Bylund, Olga; Bessner, Martin Florian; Besson, Nathalie; Betancourt, Christopher; Bethke, Siegfried; Bevan, Adrian John; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blanco, Jacobo Ezequiel; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Bock, Christopher; Boehler, Michael; Bogaerts, Joannes Andreas; Bogavac, Danijela; Bogdanchikov, Alexander; Bohm, Christian; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Boldyrev, Alexey; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Borisov, Anatoly; Borissov, Guennadi; Borroni, Sara; Bortfeldt, Jonathan; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boudreau, Joseph; Bouffard, Julian; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozic, Ivan; Bracinik, Juraj; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brazzale, Simone Federico; Breaden Madden, William Dmitri; Brendlinger, Kurt; Brennan, Amelia Jean; Brenner, Lydia; Brenner, Richard; Bressler, Shikma; Bristow, Kieran; Bristow, Timothy Michael; Britton, Dave; Britzger, Daniel; Brochu, Frederic; Brock, Ian; Brock, Raymond; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Brown, Jonathan; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Bruscino, Nello; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Buchholz, Peter; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Buehrer, Felix; Bugge, Lars; Bugge, Magnar Kopangen; Bulekov, Oleg; Bullock, Daniel; Burckhart, Helfried; Burdin, Sergey; Burghgrave, Blake; Burke, Stephen; Burmeister, Ingo; Busato, Emmanuel; Büscher, Daniel; Büscher, Volker; Bussey, Peter; Butler, John; Butt, Aatif Imtiaz; Buttar, Craig; Butterworth, Jonathan; Butti, Pierfrancesco; Buttinger, William; Buzatu, Adrian; Buzykaev, Aleksey; Cabrera Urbán, Susana; Caforio, Davide; Cairo, Valentina; Cakir, Orhan; Calafiura, Paolo; Calandri, Alessandro; Calderini, Giovanni; Calfayan, Philippe; Caloba, Luiz; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarda, Stefano; Camarri, Paolo; Cameron, David; Caminada, Lea Michaela; Caminal Armadans, Roger; Campana, Simone; Campanelli, Mario; Campoverde, Angel; Canale, Vincenzo; Canepa, Anadi; Cano Bret, Marc; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Caputo, Regina; Cardarelli, Roberto; Cardillo, Fabio; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Casolino, Mirkoantonio; Castaneda-Miranda, Elizabeth; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catastini, Pierluigi; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Caudron, Julien; Cavaliere, Viviana; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerio, Benjamin; Cerny, Karel; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cerv, Matevz; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chalupkova, Ina; Chang, Philip; Chapleau, Bertrand; Chapman, John Derek; Charlton, Dave; Chau, Chav Chhiv; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chegwidden, Andrew; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Liming; Chen, Shenjian; Chen, Xin; Chen, Ye; Cheng, Hok Chuen; Cheng, Yangyang; Cheplakov, Alexander; Cheremushkina, Evgenia; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Childers, John Taylor; Chiodini, Gabriele; Chisholm, Andrew; Chislett, Rebecca Thalatta; Chitan, Adrian; Chizhov, Mihail; Choi, Kyungeon; Chouridou, Sofia; Chow, Bonnie Kar Bo; Christodoulou, Valentinos; Chromek-Burckhart, Doris; Chudoba, Jiri; Chuinard, Annabelle Julia; Chwastowski, Janusz; Chytka, Ladislav; Ciapetti, Guido; Ciftci, Abbas Kenan; Cinca, Diane; Cindro, Vladimir; Cioara, Irina Antonela; Ciocio, Alessandra; Citron, Zvi Hirsh; Ciubancan, Mihai; Clark, Allan G; Clark, Brian Lee; Clark, Philip James; Clarke, Robert; Cleland, Bill; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coffey, Laurel; Cogan, Joshua Godfrey; Cole, Brian; Cole, Stephen; Colijn, Auke-Pieter; Collot, Johann; Colombo, Tommaso; Compostella, Gabriele; Conde Muiño, Patricia; Coniavitis, Elias; Connell, Simon Henry; Connelly, Ian; Consonni, Sofia Maria; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Côté, David; Cottin, Giovanna; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Cree, Graham; Crépé-Renaudin, Sabine; Crescioli, Francesco; Cribbs, Wayne Allen; Crispin Ortuzar, Mireia; Cristinziani, Markus; Croft, Vince; Crosetti, Giovanni; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cuthbert, Cameron; Czirr, Hendrik; Czodrowski, Patrick; D'Auria, Saverio; D'Onofrio, Monica; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dafinca, Alexandru; Dai, Tiesheng; Dale, Orjan; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Dandoy, Jeffrey Rogers; Dang, Nguyen Phuong; Daniells, Andrew Christopher; Danninger, Matthias; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darmora, Smita; Dassoulas, James; Dattagupta, Aparajita; Davey, Will; David, Claire; Davidek, Tomas; Davies, Eleanor; Davies, Merlin; Davison, Peter; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Castro, Stefano; De Cecco, Sandro; De Groot, Nicolo; de Jong, Paul; De la Torre, Hector; De Lorenzi, Francesco; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dedovich, Dmitri; Deigaard, Ingrid; Del Peso, Jose; Del Prete, Tarcisio; Delgove, David; Deliot, Frederic; Delitzsch, Chris Malena; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Dell'Orso, Mauro; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; DeMarco, David; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deterre, Cecile; Deviveiros, Pier-Olivier; Dewhurst, Alastair; Dhaliwal, Saminder; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Domenico, Antonio; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Diaconu, Cristinel; Diamond, Miriam; Dias, Flavia; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Diglio, Sara; Dimitrievska, Aleksandra; Dingfelder, Jochen; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Djuvsland, Julia Isabell; Barros do Vale, Maria Aline; Dobos, Daniel; Dobre, Monica; Doglioni, Caterina; Dohmae, Takeshi; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dova, Maria-Teresa; Doyle, Tony; Drechsler, Eric; Dris, Manolis; Dubreuil, Emmanuelle; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Duflot, Laurent; Duguid, Liam; Dührssen, Michael; Dunford, Monica; Duran Yildiz, Hatice; Düren, Michael; Durglishvili, Archil; Duschinger, Dirk; Dyndal, Mateusz; Eckardt, Christoph; Ecker, Katharina Maria; Edgar, Ryan Christopher; Edson, William; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Elliot, Alison; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Endo, Masaki; Erdmann, Johannes; Ereditato, Antonio; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Esposito, Bellisario; Etienvre, Anne-Isabelle; Etzion, Erez; Evans, Hal; Ezhilov, Alexey; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Falla, Rebecca Jane; Faltova, Jana; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Faucci Giannelli, Michele; Favareto, Andrea; Fayard, Louis; Federic, Pavol; Fedin, Oleg; Fedorko, Wojciech; Feigl, Simon; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Feremenga, Last; Fernandez Martinez, Patricia; Fernandez Perez, Sonia; Ferrando, James; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filipčič, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Adam; Fischer, Cora; Fischer, Julia; Fisher, Wade Cameron; Fitzgerald, Eric Andrew; Fleck, Ivor; Fleischmann, Philipp; Fleischmann, Sebastian; Fletcher, Gareth Thomas; Fletcher, Gregory; Fletcher, Rob Roy MacGregor; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Flowerdew, Michael; Formica, Andrea; Forti, Alessandra; Fournier, Daniel; Fox, Harald; Fracchia, Silvia; Francavilla, Paolo; Franchini, Matteo; Francis, David; Franconi, Laura; Franklin, Melissa; Frate, Meghan; Fraternali, Marco; Freeborn, David; French, Sky; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fulsom, Bryan Gregory; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gadatsch, Stefan; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gao, Jun; Gao, Yanyan; Gao, Yongsheng; Garay Walls, Francisca; Garberson, Ford; García, Carmen; García Navarro, José Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gatti, Claudio; Gaudiello, Andrea; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gauzzi, Paolo; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Ge, Peng; Gecse, Zoltan; Gee, Norman; Geerts, Daniël Alphonsus Adrianus; Geich-Gimbel, Christoph; Geisler, Manuel Patrice; Gemme, Claudia; Genest, Marie-Hélène; Gentile, Simonetta; George, Matthias; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghazlane, Hamid; Giacobbe, Benedetto; Giagu, Stefano; Giangiobbe, Vincent; Giannetti, Paola; Gibbard, Bruce; Gibson, Stephen; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gilles, Geoffrey; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giorgi, Filippo Maria; Giorgi, Francesco Michelangelo; Giraud, Pierre-Francois; Giromini, Paolo; Giugni, Danilo; Giuliani, Claudia; Giulini, Maddalena; Gjelsten, Børge Kile; Gkaitatzis, Stamatios; Gkialas, Ioannis; Gkougkousis, Evangelos Leonidas; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glaysher, Paul; Glazov, Alexandre; Goblirsch-Kolb, Maximilian; Goddard, Jack Robert; Godlewski, Jan; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez-Sevilla, Sergio; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gössling, Claus; Gostkin, Mikhail Ivanovitch; Goujdami, Driss; Goussiou, Anna; Govender, Nicolin; Gozani, Eitan; Grabas, Herve Marie Xavier; Graber, Lars; Grabowska-Bold, Iwona; Grafström, Per; Grahn, Karl-Johan; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Gray, Heather; Graziani, Enrico; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grivaz, Jean-Francois; Grohs, Johannes Philipp; Grohsjean, Alexander; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Grout, Zara Jane; Guan, Liang; Guenther, Jaroslav; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Guo, Jun; Gupta, Shaun; Gustavino, Giuliano; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haddad, Nacim; Haefner, Petra; Hageböck, Stephan; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Haley, Joseph; Hall, David; Halladjian, Garabed; Hallewell, Gregory David; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamer, Matthias; Hamilton, Andrew; Hamity, Guillermo Nicolas; Hamnett, Phillip George; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Hanke, Paul; Hanna, Remie; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Maike Christina; Hansen, Peter Henrik; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Hariri, Faten; Harkusha, Siarhei; Harrington, Robert; Harrison, Paul Fraser; Hartjes, Fred; Hasegawa, Makoto; Hasegawa, Satoshi; Hasegawa, Yoji; Hasib, A; Hassani, Samira; Haug, Sigve; Hauser, Reiner; Hauswald, Lorenz; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayashi, Takayasu; Hayden, Daniel; Hays, Chris; Hays, Jonathan Michael; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heim, Timon; Heinemann, Beate; Heinrich, Lukas; Hejbal, Jiri; Helary, Louis; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, James; Henderson, Robert; Heng, Yang; Hengler, Christopher; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Herbert, Geoffrey Henry; Hernández Jiménez, Yesenia; Herrberg-Schubert, Ruth; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hetherly, Jeffrey Wayne; Hickling, Robert; Higón-Rodriguez, Emilio; Hill, Ewan; Hill, John; Hiller, Karl Heinz; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hinman, Rachel Reisner; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoenig, Friedrich; Hohlfeld, Marc; Hohn, David; Holmes, Tova Ray; Homann, Michael; Hong, Tae Min; Hooft van Huysduynen, Loek; Hopkins, Walter; Horii, Yasuyuki; Horton, Arthur James; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hrynevich, Aliaksei; Hsu, Catherine; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Qipeng; Hu, Xueye; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hülsing, Tobias Alexander; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Ideal, Emma; Idrissi, Zineb; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikematsu, Katsumasa; Ikeno, Masahiro; Ilchenko, Iurii; Iliadis, Dimitrios; Ilic, Nikolina; Inamaru, Yuki; Ince, Tayfun; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Iturbe Ponce, Julia Mariana; Iuppa, Roberto; Ivarsson, Jenny; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jabbar, Samina; Jackson, Brett; Jackson, Matthew; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jakubek, Jan; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansky, Roland; Janssen, Jens; Janus, Michel; Jarlskog, Göran; Javadov, Namig; Javůrek, Tomáš; Jeanty, Laura; Jejelava, Juansher; Jeng, Geng-yuan; Jennens, David; Jenni, Peter; Jentzsch, Jennifer; Jeske, Carl; Jézéquel, Stéphane; Ji, Haoshuang; Jia, Jiangyong; Jiang, Yi; Jiggins, Stephen; Jimenez Pena, Javier; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Joergensen, Morten Dam; Johansson, Per; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tim; Jongmanns, Jan; Jorge, Pedro; Joshi, Kiran Daniel; Jovicevic, Jelena; Ju, Xiangyang; Jung, Christian; Jussel, Patrick; Juste Rozas, Aurelio; Kaci, Mohammed; Kaczmarska, Anna; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kahn, Sebastien Jonathan; Kajomovitz, Enrique; Kalderon, Charles William; Kama, Sami; Kamenshchikov, Andrey; Kanaya, Naoko; Kaneda, Michiru; Kaneti, Steven; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karamaoun, Andrew; Karastathis, Nikolaos; Kareem, Mohammad Jawad; Karnevskiy, Mikhail; Karpov, Sergey; Karpova, Zoya; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Katre, Akshay; Katzy, Judith; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Kazarinov, Makhail; Keeler, Richard; Kehoe, Robert; Keller, John; Kempster, Jacob Julian; Keoshkerian, Houry; Kepka, Oldrich; Kerševan, Borut Paul; Kersten, Susanne; Keyes, Robert; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharlamov, Alexey; Khoo, Teng Jian; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hee Yeun; Kim, Hyeon Jin; Kim, Shinhong; Kim, Young-Kee; Kimura, Naoki; Kind, Oliver Maria; King, Barry; King, Matthew; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kiss, Florian; Kiuchi, Kenji; Kivernyk, Oleh; Kladiva, Eduard; Klein, Matthew Henry; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klioutchnikova, Tatiana; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Aine; Kobayashi, Dai; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohlmann, Simon; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kolanoski, Hermann; Koletsou, Iro; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kondrashova, Nataliia; Köneke, Karsten; König, Adriaan; König, Sebastian; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Köpke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Kortner, Oliver; Kortner, Sandra; Kosek, Tomas; Kostyukhin, Vadim; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumeli-Charalampidi, Athina; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kramarenko, Viktor; Kramberger, Gregor; Krasnopevtsev, Dimitriy; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kreiss, Sven; Kretz, Moritz; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Peter; Krizka, Karol; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Krumnack, Nils; Krumshteyn, Zinovii; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kucuk, Hilal; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuger, Fabian; Kuhl, Andrew; Kuhl, Thorsten; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunigo, Takuto; Kupco, Alexander; Kurashige, Hisaya; Kurochkin, Yurii; Kurumida, Rie; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwan, Tony; Kyriazopoulos, Dimitrios; La Rosa, Alessandro; La Rosa Navarro, Jose Luis; La Rotonda, Laura; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Lambourne, Luke; Lammers, Sabine; Lampen, Caleb; Lampl, Walter; Lançon, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lange, J örn Christian; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Lasagni Manghi, Federico; Lassnig, Mario; Laurelli, Paolo; Lavrijsen, Wim; Law, Alexander; Laycock, Paul; Lazovich, Tomo; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; LeBlanc, Matthew Edgar; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire Alexandra; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leight, William Axel; Leisos, Antonios; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Leney, Katharine; Lenz, Tatjana; Lenzi, Bruno; Leone, Robert; Leone, Sandra; Leonidopoulos, Christos; Leontsinis, Stefanos; Leroy, Claude; Lester, Christopher; Levchenko, Mikhail; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Levy, Mark; Lewis, Adrian; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Haifeng; Li, Ho Ling; Li, Lei; Li, Liang; Li, Shu; Li, Yichen; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Liblong, Aaron; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Lin, Simon; Lin, Tai-Hua; Linde, Frank; Lindquist, Brian Edward; Linnemann, James; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Hao; Liu, Jian; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanwen; Livan, Michele; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loginov, Andrey; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Long, Brian Alexander; Long, Jonathan David; Long, Robin Eamonn; Looper, Kristina Anne; Lopes, Lourenco; Lopez Mateos, David; Lopez Paredes, Brais; Lopez Paz, Ivan; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Lösel, Philipp Jonathan; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lu, Nan; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lundberg, Olof; Lund-Jensen, Bengt; Lynn, David; Lysak, Roman; Lytken, Else; Ma, Hong; Ma, Lian Liang; Maccarrone, Giovanni; Macchiolo, Anna; Macdonald, Calum Michael; Machado Miguens, Joana; Macina, Daniela; Madaffari, Daniele; Madar, Romain; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeland, Steffen; Maeno, Tadashi; Maevskiy, Artem; Magradze, Erekle; Mahboubi, Kambiz; Mahlstedt, Joern; Maiani, Camilla; Maidantchik, Carmen; Maier, Andreas Alexander; Maier, Thomas; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mamuzic, Judita; Mancini, Giada; Mandelli, Beatrice; Mandelli, Luciano; Mandić, Igor; Mandrysch, Rocco; Maneira, José; Manfredini, Alessandro; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Mantifel, Rodger; Mantoani, Matteo; Mapelli, Livio; March, Luis; Marchiori, Giovanni; Marcisovsky, Michal; Marino, Christopher; Marjanovic, Marija; Marley, Daniel; Marroquim, Fernando; Marsden, Stephen Philip; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian Thomas; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Mario; Martin-Haugh, Stewart; Martoiu, Victor Sorin; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massa, Lorenzo; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Mättig, Peter; Mattmann, Johannes; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazza, Simone Michele; Mazzaferro, Luca; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; McMahon, Steve; McPherson, Robert; Medinnis, Michael; Meehan, Samuel; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mercurio, Kevin Michael; Mergelmeyer, Sebastian; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Middleton, Robin; Miglioranzi, Silvia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Milesi, Marco; Milic, Adriana; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Minaenko, Andrey; Minami, Yuto; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Miucci, Antonio; Miyagawa, Paul; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Mochizuki, Kazuya; Mohapatra, Soumya; Mohr, Wolfgang; Molander, Simon; Moles-Valls, Regina; Mönig, Klaus; Monini, Caterina; Monk, James; Monnier, Emmanuel; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Morange, Nicolas; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Morgenstern, Marcus; Morii, Masahiro; Morinaga, Masahiro; Morisbak, Vanja; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Mortensen, Simon Stark; Morton, Alexander; Morvaj, Ljiljana; Mosidze, Maia; Moss, Josh; Motohashi, Kazuki; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Muanza, Steve; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Klemens; Mueller, Ralph Soeren Peter; Mueller, Thibaut; Muenstermann, Daniel; Mullen, Paul; Mullier, Geoffrey; Munwes, Yonathan; Murillo Quijada, Javier Alberto; Murray, Bill; Musheghyan, Haykuhi; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagai, Yoshikazu; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagata, Kazuki; Nagel, Martin; Nagy, Elemer; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Naranjo Garcia, Roger Felipe; Narayan, Rohin; Naumann, Thomas; Navarro, Gabriela; Nayyar, Ruchika; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Nef, Pascal Daniel; Negri, Andrea; Negrini, Matteo; Nektarijevic, Snezana; Nellist, Clara; Nelson, Andrew; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neves, Ricardo; Nevski, Pavel; Newman, Paul; Nguyen, Duong Hai; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Nielsen, Jason; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolopoulos, Konstantinos; Nilsen, Jon Kerr; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nomachi, Masaharu; Nomidis, Ioannis; Nooney, Tamsin; Norberg, Scarlet; Nordberg, Markus; Novgorodova, Olga; Nowak, Sebastian; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; Nuti, Francesco; O'Brien, Brendan Joseph; O'grady, Fionnbarr; O'Neil, Dugan; O'Shea, Val; Oakham, Gerald; Oberlack, Horst; Obermann, Theresa; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Ochoa-Ricoux, Juan Pedro; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohman, Henrik; Oide, Hideyuki; Okamura, Wataru; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olivares Pino, Sebastian Andres; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, António; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Owen, Rhys Edward; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagáčová, Martina; Pagan Griso, Simone; Paganis, Efstathios; Pahl, Christoph; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palestini, Sandro; Palka, Marek; Pallin, Dominique; Palma, Alberto; Pan, Yibin; Panagiotopoulou, Evgenia; Pandini, Carlo Enrico; Panduro Vazquez, William; Pani, Priscilla; Panitkin, Sergey; Pantea, Dan; Paolozzi, Lorenzo; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Michael Andrew; Parker, Kerry Ann; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pasqualucci, Enrico; Passaggio, Stefano; Pastore, Fernanda; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Pauly, Thilo; Pearce, James; Pearson, Benjamin; Pedersen, Lars Egholm; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Pelikan, Daniel; Peng, Haiping; Penning, Bjoern; Penwell, John; Perepelitsa, Dennis; Perez Codina, Estel; Pérez García-Estañ, María Teresa; Perini, Laura; Pernegger, Heinz; Perrella, Sabrina; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petrolo, Emilio; Petrucci, Fabrizio; Pettersson, Nora Emilia; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Pickering, Mark Andrew; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, João Antonio; Pinamonti, Michele; Pinfold, James; Pingel, Almut; Pinto, Belmiro; Pires, Sylvestre; Pitt, Michael; Pizio, Caterina; Plazak, Lukas; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Pluth, Daniel; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Polesello, Giacomo; Poley, Anne-luise; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Prell, Soeren; Price, Darren; Price, Lawrence; Primavera, Margherita; Prince, Sebastien; Proissl, Manuel; Prokofiev, Kirill; Prokoshin, Fedor; Protopapadaki, Eftychia-sofia; Protopopescu, Serban; Proudfoot, James; Przybycien, Mariusz; Ptacek, Elizabeth; Puddu, Daniele; Pueschel, Elisa; Puldon, David; Purohit, Milind; Puzo, Patrick; Qian, Jianming; Qin, Gang; Qin, Yang; Quadt, Arnulf; Quarrie, David; Quayle, William; Queitsch-Maitland, Michaela; Quilty, Donnchadha; Raddum, Silje; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Rados, Pere; Ragusa, Francesco; Rahal, Ghita; Rajagopalan, Srinivasan; Rammensee, Michael; Rangel-Smith, Camila; Rauscher, Felix; Rave, Stefan; Ravenscroft, Thomas; Raymond, Michel; Read, Alexander Lincoln; Readioff, Nathan Peter; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Rehnisch, Laura; Reisin, Hernan; Relich, Matthew; Rembser, Christoph; Ren, Huan; Renaud, Adrien; Rescigno, Marco; Resconi, Silvia; Rezanova, Olga; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Richter, Stefan; Richter-Was, Elzbieta; Ricken, Oliver; Ridel, Melissa; Rieck, Patrick; Riegel, Christian Johann; Rieger, Julia; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Ristić, Branislav; Ritsch, Elmar; Riu, Imma; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Roda, Chiara; Roe, Shaun; Røhne, Ole; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romano Saez, Silvestre Marino; Romero Adam, Elena; Rompotis, Nikolaos; Ronzani, Manfredi; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Peyton; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Rud, Viacheslav; Rudolph, Christian; Rudolph, Matthew Scott; Rühr, Frederik; Ruiz-Martinez, Aranzazu; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Russell, Heather; Rutherfoord, John; Ruthmann, Nils; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Saavedra, Aldo; Sabato, Gabriele; Sacerdoti, Sabrina; Saddique, Asif; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Saimpert, Matthias; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sampsonidis, Dimitrios; Sanchez, Arturo; Sánchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sandbach, Ruth Laura; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sannino, Mario; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, João; Sarrazin, Bjorn; Sasaki, Osamu; Sasaki, Yuichi; Sato, Koji; Sauvage, Gilles; Sauvan, Emmanuel; Savage, Graham; Savard, Pierre; Sawyer, Craig; Sawyer, Lee; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Scarfone, Valerio; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schaefer, Ralph; Schaeffer, Jan; Schaepe, Steffen; Schaetzel, Sebastian; Schäfer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Schiavi, Carlo; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Sebastian; Schmitt, Stefan; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schopf, Elisabeth; Schorlemmer, Andre Lukas; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schramm, Steven; Schreyer, Manuel; Schroeder, Christian; Schuh, Natascha; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwanenberger, Christian; Schwartzman, Ariel; Schwarz, Thomas Andrew; Schwegler, Philipp; Schweiger, Hansdieter; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Sciacca, Gianfranco; Scifo, Estelle; Sciolla, Gabriella; Scuri, Fabrizio; Scutti, Federico; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Seema, Pienpen; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Sekhon, Karishma; Sekula, Stephen; Seliverstov, Dmitry; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Serre, Thomas; Sessa, Marco; Seuster, Rolf; Severini, Horst; Sfiligoj, Tina; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shang, Ruo-yu; Shank, James; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Shaw, Savanna Marie; Shcherbakova, Anna; Shehu, Ciwake Yusufu; Sherwood, Peter; Shi, Liaoshan; Shimizu, Shima; Shimmin, Chase Owen; Shimojima, Makoto; Shiyakova, Mariya; Shmeleva, Alevtina; Shoaleh Saadi, Diane; Shochet, Mel; Shojaii, Seyedruhollah; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Shushkevich, Stanislav; Sicho, Petr; Sidiropoulou, Ourania; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silva, José; Silver, Yiftah; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simon, Dorian; Simoniello, Rosa; Sinervo, Pekka; Sinev, Nikolai; Siragusa, Giovanni; Sisakyan, Alexei; Sivoklokov, Serguei; Sjölin, Jörgen; Sjursen, Therese; Skinner, Malcolm Bruce; Skottowe, Hugh Philip; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Slawinska, Magdalena; Sliwa, Krzysztof; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Matthew; Smith, Russell; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snyder, Scott; Sobie, Randall; Socher, Felix; Soffer, Abner; Soh, Dart-yin; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solodkov, Alexander; Soloshenko, Alexei; Solovyanov, Oleg; Solovyev, Victor; Sommer, Philip; Song, Hong Ye; Soni, Nitesh; Sood, Alexander; Sopczak, Andre; Sopko, Bruno; Sopko, Vit; Sorin, Veronica; Sosa, David; Sosebee, Mark; Sotiropoulou, Calliope Louisa; Soualah, Rachik; Soukharev, Andrey; South, David; Sowden, Benjamin; Spagnolo, Stefania; Spalla, Margherita; Spanò, Francesco; Spearman, William Robert; Spettel, Fabian; Spighi, Roberto; Spigo, Giancarlo; Spiller, Laurence Anthony; Spousta, Martin; Spreitzer, Teresa; St Denis, Richard Dante; Staerz, Steffen; Stahlman, Jonathan; Stamen, Rainer; Stamm, Soren; Stanecka, Ewa; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staszewski, Rafal; Stavina, Pavel; Steinberg, Peter; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stern, Sebastian; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoicea, Gabriel; Stolte, Philipp; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Stramaglia, Maria Elena; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Stroynowski, Ryszard; Strubig, Antonia; Stucci, Stefania Antonia; Stugu, Bjarne; Styles, Nicholas Adam; Su, Dong; Su, Jun; Subramaniam, Rajivalochan; Succurro, Antonella; Sugaya, Yorihito; Suhr, Chad; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Siyuan; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Shota; Suzuki, Yu; Svatos, Michal; Swedish, Stephen; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Taccini, Cecilia; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Shuji; Tannenwald, Benjamin Bordy; Tannoury, Nancy; Tapprogge, Stefan; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Teoh, Jia Jian; Tepel, Fabian-Phillipp; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Therhaag, Jan; Theveneaux-Pelzer, Timothée; Thomas, Juergen; Thomas-Wilsker, Joshuha; Thompson, Emily; Thompson, Paul; Thompson, Ray; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thun, Rudolf; Tibbetts, Mark James; Ticse Torres, Royer Edson; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tiouchichine, Elodie; Tipton, Paul; Tisserant, Sylvain; Todorov, Theodore; Todorova-Nova, Sharka; Tojo, Junji; Tokár, Stanislav; Tokushuku, Katsuo; Tollefson, Kirsten; Tolley, Emma; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Trischuk, William; Trocmé, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; True, Patrick; Truong, Loan; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsuno, Soshi; Tsybychev, Dmitri; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turra, Ruggero; Turvey, Andrew John; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ugland, Maren; Uhlenbrock, Mathias; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Unverdorben, Christopher; Urban, Jozef; Urquijo, Phillip; Urrejola, Pedro; Usai, Giulio; Usanova, Anna; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valderanis, Chrysostomos; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Den Wollenberg, Wouter; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; Van Der Leeuw, Robin; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vanguri, Rami; Vaniachine, Alexandre; Vannucci, Francois; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vassilakopoulos, Vassilios; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veloce, Laurelle Maria; Veloso, Filipe; Velz, Thomas; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigne, Ralph; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vogel, Marcelo; Vokac, Petr; Volpi, Guido; Volpi, Matteo; von der Schmitt, Hans; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vorobev, Konstantin; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Peter; Wagner, Wolfgang; Wahlberg, Hernan; Wahrmund, Sebastian; Wakabayashi, Jun; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wang, Chao; Wang, Fuquan; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Xiaoxiao; Wanotayaroj, Chaowaroj; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Warsinsky, Markus; Washbrook, Andrew; Wasicki, Christoph; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Webster, Jordan S; Weidberg, Anthony; Weinert, Benjamin; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; Wharton, Andrew Mark; White, Andrew; White, Martin; White, Ryan; White, Sebastian; Whiteson, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wildauer, Andreas; Wilkens, Henric George; Williams, Hugh; Williams, Sarah; Willis, Christopher; Willocq, Stephane; Wilson, Alan; Wilson, John; Wingerter-Seez, Isabelle; Winklmeier, Frank; Winter, Benedict Tobias; Wittgen, Matthias; Wittkowski, Josephine; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wu, Mengqing; Wu, Miles; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yakabe, Ryota; Yamada, Miho; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Shimpei; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Yi; Yao, Weiming; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yeletskikh, Ivan; Yen, Andy L; Yildirim, Eda; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jiaming; Yu, Jie; Yuan, Li; Yurkewicz, Adam; Yusuff, Imran; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zalieckas, Justas; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zengel, Keith; Zenin, Oleg; Ženiš, Tibor; Zerwas, Dirk; Zhang, Dongliang; Zhang, Fangzhou; Zhang, Huijun; Zhang, Jinlong; Zhang, Lei; Zhang, Ruiqi; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Xiandong; Zhao, Yongke; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Chen; Zhou, Lei; Zhou, Li; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zhukov, Konstantin; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Stephanie; Zinonos, Zinonas; Zinser, Markus; Ziolkowski, Michael; Živković, Lidija; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zurzolo, Giovanni; Zwalinski, Lukasz
2016-01-05
The decays $B_c^+ \\to J/\\psi D_s^+$ and $B_c^+ \\to J/\\psi D_s^{*+}$ are studied with the ATLAS detector at the LHC using a dataset corresponding to integrated luminosities of 4.9 fb$^{-1}$ and 20.6 fb$^{-1}$ of $pp$ collisions collected at centre-of-mass energies $\\sqrt{s} = 7$ TeV and 8 TeV, respectively. Signal candidates are identified through $J/\\psi\\to\\mu^+\\mu^-$ and $D_s^{(*)+}\\to\\phi\\pi^+(\\gamma/\\pi^0)$ decays. With a two-dimensional likelihood fit involving the $B_c^+$ reconstructed invariant mass and an angle between the $\\mu^+$ and $D_s^+$ candidate momenta in the muon pair rest frame, the yields of $B_c^+ \\to J/\\psi D_s^+$ and $B_c^+ \\to J/\\psi D_s^{*+}$, and the transverse polarisation fraction in $B_c^+ \\to J/\\psi D_s^{*+}$ decay are measured. The transverse polarisation fraction is determined to be $\\Gamma_{\\pm\\pm}(B_c^+ \\to J/\\psi D_s^{*+})/\\Gamma(B_c^+ \\to J/\\psi D_s^{*+}) = 0.38 \\pm 0.23 \\pm 0.07$, and the derived ratio of the branching fractions of the two modes is $\\mathcal{B}_{B_c^+ \\to J/...
Im, Sung-Ju; Choi, Jungwon; Lee, Jung-Gil; Jeong, Sanghyun; Jang, Am
2018-03-01
A new concept of volume-retarded osmosis and low-pressure membrane (VRO-LPM) hybrid process was developed and evaluated for the first time in this study. Commercially available forward osmosis (FO) and ultrafiltration (UF) membranes were employed in a VRO-LPM hybrid process to overcome energy limitations of draw solution (DS) regeneration and production of permeate in the FO process. To evaluate its feasibility as a water reclamation process, and to optimize the operational conditions, cross-flow FO and dead-end mode UF processes were individually evaluated. For the FO process, a DS concentration of 0.15 g mL -1 of polysulfonate styrene (PSS) was determined to be optimal, having a high flux with a low reverse salt flux. The UF membrane with a molecular weight cut-off of 1 kDa was chosen for its high PSS rejection in the LPM process. As a single process, UF (LPM) exhibited a higher flux than FO, but this could be controlled by adjusting the effective membrane area of the FO and UF membranes in the VRO-LPM system. The VRO-LPM hybrid process only required a circulation pump for the FO process. This led to a decrease in the specific energy consumption of the VRO-LPM process for potable water production, that was similar to the single FO process. Therefore, the newly developed VRO-LPM hybrid process, with an appropriate DS selection, can be used as an energy efficient water production method, and can outperform conventional water reclamation processes. Copyright © 2017 Elsevier Ltd. All rights reserved.
Im, Sung-Ju; Choi, Jungwon; Lee, Jung Gil; Jeong, Sanghyun; Jang, Am
2017-01-01
A new concept of volume-retarded osmosis and low-pressure membrane (VRO-LPM) hybrid process was developed and evaluated for the first time in this study. Commercially available forward osmosis (FO) and ultrafiltration (UF) membranes were employed in a VRO-LPM hybrid process to overcome energy limitations of draw solution (DS) regeneration and production of permeate in the FO process. To evaluate its feasibility as a water reclamation process, and to optimize the operational conditions, cross-flow FO and dead-end mode UF processes were individually evaluated. For the FO process, a DS concentration of 0.15 g mL−1 of polysulfonate styrene (PSS) was determined to be optimal, having a high flux with a low reverse salt flux. The UF membrane with a molecular weight cut-off of 1 kDa was chosen for its high PSS rejection in the LPM process. As a single process, UF (LPM) exhibited a higher flux than FO, but this could be controlled by adjusting the effective membrane area of the FO and UF membranes in the VRO-LPM system. The VRO-LPM hybrid process only required a circulation pump for the FO process. This led to a decrease in the specific energy consumption of the VRO-LPM process for potable water production, that was similar to the single FO process. Therefore, the newly developed VRO-LPM hybrid process, with an appropriate DS selection, can be used as an energy efficient water production method, and can outperform conventional water reclamation processes.
Im, Sung-Ju
2017-11-15
A new concept of volume-retarded osmosis and low-pressure membrane (VRO-LPM) hybrid process was developed and evaluated for the first time in this study. Commercially available forward osmosis (FO) and ultrafiltration (UF) membranes were employed in a VRO-LPM hybrid process to overcome energy limitations of draw solution (DS) regeneration and production of permeate in the FO process. To evaluate its feasibility as a water reclamation process, and to optimize the operational conditions, cross-flow FO and dead-end mode UF processes were individually evaluated. For the FO process, a DS concentration of 0.15 g mL−1 of polysulfonate styrene (PSS) was determined to be optimal, having a high flux with a low reverse salt flux. The UF membrane with a molecular weight cut-off of 1 kDa was chosen for its high PSS rejection in the LPM process. As a single process, UF (LPM) exhibited a higher flux than FO, but this could be controlled by adjusting the effective membrane area of the FO and UF membranes in the VRO-LPM system. The VRO-LPM hybrid process only required a circulation pump for the FO process. This led to a decrease in the specific energy consumption of the VRO-LPM process for potable water production, that was similar to the single FO process. Therefore, the newly developed VRO-LPM hybrid process, with an appropriate DS selection, can be used as an energy efficient water production method, and can outperform conventional water reclamation processes.
Measurement of the CP-Violating Phase phi(s) in (B)over-bar(s)(0) -> Ds+Ds- Decays
Aaij, R.; Ali, S.; De Bruyn, K.; Farinelli, C.; Heijne, V.A.M.; Ketel, T.J.; Koopman, R.F.; Kozlinskiy, A.; van Leerdam, J.; Merk, M.H.M.; Oggero, S.; Pellegrino, A.; Raven, H.G.; Snoek, H.; Syropoulos, V.; David, P.N.Y.; Tolk, S.; LHCb, Collaboration
2014-01-01
We present a measurement of the CP-violating weak mixing phase φs using the decay B¯s0→Ds+Ds- in a data sample corresponding to 3.0fb-1 of integrated luminosity collected with the LHCb detector in pp collisions at center-of-mass energies of 7 and 8 TeV. An analysis of the time evolution of the
H1DS: A new web-based data access system
Energy Technology Data Exchange (ETDEWEB)
Pretty, D.G., E-mail: david.pretty@anu.edu.au; Blackwell, B.D.
2014-05-15
Highlights: • We present H1DS, a new RESTful web service for accessing fusion data. • We examine the scalability and extensibility of H1DS. • We present a fast and user friendly web browser client for the H1DS web service. • A summary relational database is presented as an application of the H1DS API. - Abstract: A new data access system, H1DS, has been developed and deployed for the H-1 Heliac at the Australian Plasma Fusion Research Facility. The data system provides access to fusion data via a RESTful web service. With the URL acting as the API to the data system, H1DS provides a scalable and extensible framework which is intuitive to new users, and allows access from any internet connected device. The H1DS framework, originally designed to work with MDSplus, has a modular design which can be extended to provide access to alternative data storage systems.
H1DS: A new web-based data access system
International Nuclear Information System (INIS)
Pretty, D.G.; Blackwell, B.D.
2014-01-01
Highlights: • We present H1DS, a new RESTful web service for accessing fusion data. • We examine the scalability and extensibility of H1DS. • We present a fast and user friendly web browser client for the H1DS web service. • A summary relational database is presented as an application of the H1DS API. - Abstract: A new data access system, H1DS, has been developed and deployed for the H-1 Heliac at the Australian Plasma Fusion Research Facility. The data system provides access to fusion data via a RESTful web service. With the URL acting as the API to the data system, H1DS provides a scalable and extensible framework which is intuitive to new users, and allows access from any internet connected device. The H1DS framework, originally designed to work with MDSplus, has a modular design which can be extended to provide access to alternative data storage systems
Biodegradation of furfural by Bacillus subtilis strain DS3.
Zheng, Dan; Bao, Jianguo; Lu, Jueming; Lv, Quanxi
2015-07-01
An aerobic bacterial strain DS3, capable of growing on furfural as sole carbon source, was isolated from actived sludge of wastewater treatment plant in a diosgenin factory after enrichment. Based on morphological physiological tests as well as 16SrDNA sequence and Biolog analyses it was identified as Bacillus subtilis. The study revealed that strain DS3 utilized furfural, as analyzed by high-performance liquid chromatography (HPLC). Under following conditions: pH 8.0, temperature 35 degrees C, 150 rpm and 10% inoculum, strain DS3 showed 31.2% furfural degradation. Furthermore, DS3 strain was found to tolerate furfural concentration as high as 6000 mg(-1). The ability of Bacillus subtilis strain DS3 to degrade furfural has been demonstrated for the first time in the present study.
Distribution of Ds-like sequences in genomes of cereals
International Nuclear Information System (INIS)
Vershinin, A.V.; Salina, E.A.; Shumnii, V.K.; Svitashev, S.K.
1986-01-01
It has been suggested that insertions of Ds-elements may alter the effectiveness of transcription or translation of the genetic loci and the normal processing of introns and exons, and that they may impair coding frames, etc. The object of the present study was to determine the frequency of occurence of DNA sequences similar to the Ds-controlling elements of mazie (Ds-like sequences) among other representatives of cereals. The conservative feature of the primary structure of transposons from different eukaryotic species served as a basis in this investigation. By means of the ''nick-translation'' reaction with the aid of DNA-polymerase I (alpha- 32 P) dCTP or TTP was introduced into the Ds-element. The specific radioactivity of the preparations obtained was 5 x 10 7 to 1 x 10 8 cpm/gamma. From the results obtained, it is suggested that the genomes of cereals examined contain a collection of Ds-like sequences. The Ds-element may have a significant effect on gene expression in the presence of Ac-like or other sequences, which undergo transposition
Energy spectrum control for modulated proton beams
International Nuclear Information System (INIS)
Hsi, Wen C.; Moyers, Michael F.; Nichiporov, Dmitri; Anferov, Vladimir; Wolanski, Mark; Allgower, Chris E.; Farr, Jonathan B.; Mascia, Anthony E.; Schreuder, Andries N.
2009-01-01
In proton therapy delivered with range modulated beams, the energy spectrum of protons entering the delivery nozzle can affect the dose uniformity within the target region and the dose gradient around its periphery. For a cyclotron with a fixed extraction energy, a rangeshifter is used to change the energy but this produces increasing energy spreads for decreasing energies. This study investigated the magnitude of the effects of different energy spreads on dose uniformity and distal edge dose gradient and determined the limits for controlling the incident spectrum. A multilayer Faraday cup (MLFC) was calibrated against depth dose curves measured in water for nonmodulated beams with various incident spectra. Depth dose curves were measured in a water phantom and in a multilayer ionization chamber detector for modulated beams using different incident energy spreads. Some nozzle entrance energy spectra can produce unacceptable dose nonuniformities of up to ±21% over the modulated region. For modulated beams and small beam ranges, the width of the distal penumbra can vary by a factor of 2.5. When the energy spread was controlled within the defined limits, the dose nonuniformity was less than ±3%. To facilitate understanding of the results, the data were compared to the measured and Monte Carlo calculated data from a variable extraction energy synchrotron which has a narrow spectrum for all energies. Dose uniformity is only maintained within prescription limits when the energy spread is controlled. At low energies, a large spread can be beneficial for extending the energy range at which a single range modulator device can be used. An MLFC can be used as part of a feedback to provide specified energy spreads for different energies.
International Nuclear Information System (INIS)
Marckhoff, Jan; Wimschulte, Jens
2009-01-01
In electricity markets, not only does the risk of substantial price variations over time exist, but so does the risk of price variations over space, as prices between locations can differ due to transmission congestion. To manage this risk, Contracts for Difference (CfDs), i.e., forwards on the spread between a particular area price and the (unconstrained) system price, were introduced at the Scandinavian electricity exchange Nord Pool at the end of 2000. We empirically investigate the pricing of these CfDs over the period 2001 through 2006 and find that CfD prices contain significant risk premia. Their sign and magnitude, however, differ substantially between areas and delivery periods, because areas are subject to transmission congestion to a varying extent. While the relation between risk premia and time-to-maturity is not uniform for CfDs, there is a negative relation for implied area and system forwards, which can be explained by the relative hedging demand of market participants. In addition, we find that risk premia of CfDs and implied area forwards vary systematically with the variance and skewness of the underlying spot prices. This confirms both implications of the Bessembinder and Lemmon [Bessembinder, H., Lemmon, M.L., 2002. Equilibrium pricing and optimal hedging in electricity forward markets. Journal of Finance, 57, 1347-1382] model. (author)
Directory of Open Access Journals (Sweden)
Kris Evers
2014-01-01
Full Text Available Emotion recognition problems are frequently reported in individuals with an autism spectrum disorder (ASD. However, this research area is characterized by inconsistent findings, with atypical emotion processing strategies possibly contributing to existing contradictions. In addition, an attenuated saliency of the eyes region is often demonstrated in ASD during face identity processing. We wanted to compare reliance on mouth versus eyes information in children with and without ASD, using hybrid facial expressions. A group of six-to-eight-year-old boys with ASD and an age- and intelligence-matched typically developing (TD group without intellectual disability performed an emotion labelling task with hybrid facial expressions. Five static expressions were used: one neutral expression and four emotional expressions, namely, anger, fear, happiness, and sadness. Hybrid faces were created, consisting of an emotional face half (upper or lower face region with the other face half showing a neutral expression. Results showed no emotion recognition problem in ASD. Moreover, we provided evidence for the existence of top- and bottom-emotions in children: correct identification of expressions mainly depends on information in the eyes (so-called top-emotions: happiness or in the mouth region (so-called bottom-emotions: sadness, anger, and fear. No stronger reliance on mouth information was found in children with ASD.
Evers, Kris; Kerkhof, Inneke; Steyaert, Jean; Noens, Ilse; Wagemans, Johan
2014-01-01
Emotion recognition problems are frequently reported in individuals with an autism spectrum disorder (ASD). However, this research area is characterized by inconsistent findings, with atypical emotion processing strategies possibly contributing to existing contradictions. In addition, an attenuated saliency of the eyes region is often demonstrated in ASD during face identity processing. We wanted to compare reliance on mouth versus eyes information in children with and without ASD, using hybrid facial expressions. A group of six-to-eight-year-old boys with ASD and an age- and intelligence-matched typically developing (TD) group without intellectual disability performed an emotion labelling task with hybrid facial expressions. Five static expressions were used: one neutral expression and four emotional expressions, namely, anger, fear, happiness, and sadness. Hybrid faces were created, consisting of an emotional face half (upper or lower face region) with the other face half showing a neutral expression. Results showed no emotion recognition problem in ASD. Moreover, we provided evidence for the existence of top- and bottom-emotions in children: correct identification of expressions mainly depends on information in the eyes (so-called top-emotions: happiness) or in the mouth region (so-called bottom-emotions: sadness, anger, and fear). No stronger reliance on mouth information was found in children with ASD.
Hybrid epidemics--a case study on computer worm conficker.
Directory of Open Access Journals (Sweden)
Changwang Zhang
Full Text Available Conficker is a computer worm that erupted on the Internet in 2008. It is unique in combining three different spreading strategies: local probing, neighbourhood probing, and global probing. We propose a mathematical model that combines three modes of spreading: local, neighbourhood, and global, to capture the worm's spreading behaviour. The parameters of the model are inferred directly from network data obtained during the first day of the Conficker epidemic. The model is then used to explore the tradeoff between spreading modes in determining the worm's effectiveness. Our results show that the Conficker epidemic is an example of a critically hybrid epidemic, in which the different modes of spreading in isolation do not lead to successful epidemics. Such hybrid spreading strategies may be used beneficially to provide the most effective strategies for promulgating information across a large population. When used maliciously, however, they can present a dangerous challenge to current internet security protocols.
Hybrid epidemics--a case study on computer worm conficker.
Zhang, Changwang; Zhou, Shi; Chain, Benjamin M
2015-01-01
Conficker is a computer worm that erupted on the Internet in 2008. It is unique in combining three different spreading strategies: local probing, neighbourhood probing, and global probing. We propose a mathematical model that combines three modes of spreading: local, neighbourhood, and global, to capture the worm's spreading behaviour. The parameters of the model are inferred directly from network data obtained during the first day of the Conficker epidemic. The model is then used to explore the tradeoff between spreading modes in determining the worm's effectiveness. Our results show that the Conficker epidemic is an example of a critically hybrid epidemic, in which the different modes of spreading in isolation do not lead to successful epidemics. Such hybrid spreading strategies may be used beneficially to provide the most effective strategies for promulgating information across a large population. When used maliciously, however, they can present a dangerous challenge to current internet security protocols.
Hybrid Epidemics—A Case Study on Computer Worm Conficker
Zhang, Changwang; Zhou, Shi; Chain, Benjamin M.
2015-01-01
Conficker is a computer worm that erupted on the Internet in 2008. It is unique in combining three different spreading strategies: local probing, neighbourhood probing, and global probing. We propose a mathematical model that combines three modes of spreading: local, neighbourhood, and global, to capture the worm’s spreading behaviour. The parameters of the model are inferred directly from network data obtained during the first day of the Conficker epidemic. The model is then used to explore the tradeoff between spreading modes in determining the worm’s effectiveness. Our results show that the Conficker epidemic is an example of a critically hybrid epidemic, in which the different modes of spreading in isolation do not lead to successful epidemics. Such hybrid spreading strategies may be used beneficially to provide the most effective strategies for promulgating information across a large population. When used maliciously, however, they can present a dangerous challenge to current internet security protocols. PMID:25978309
Spreading Sequence Design and Theoretical Limits for Quasisynchronous CDMA Systems
Directory of Open Access Journals (Sweden)
Fan Pingzhi
2004-01-01
Full Text Available For various quasisynchronous (QS CDMA systems such as LAS-CDMA system which emerged recently, in order to reduce or eliminate the multiple access interference and multipath interference, it is required to design a set of spreading sequences which are mutually orthogonal within a designed shift zone, called orthogonal zone. For traditional orthogonal sequences, such as Walsh sequences and orthogonal Gold sequences, the orthogonality can only be achieved at the inphase point; in other words, the orthogonality is destroyed whenever there is a relative shift between the sequences, that is, their orthogonal zone is 0. In this paper, new concepts of generalized orthogonality (GO and generalized quasiorthogonality (GQO for spreading sequence design in both direct sequence (DS QS-CDMA systems and time/frequency hopping (TH/FH QS-CDMA systems are presented. Besides, selected GO/GQO sequence designs and general theoretical periodic and aperiodic limits, together with several applications in QS-CDMA systems, are also reviewed and analyzed.
Data Analysis Details (DS): SE37_DS4 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available SE37_DS4 Labeled peak search by ShiftedIonsFinder The candidate labeled peaks were ...searched by comparing the peak list from a sample labeled with a stable isotope against the peak list from an unlabele...hiftedIonsFinder and the labeled ions were searched with parameters (Max fold: C
Kim, Jung Eun
2018-01-01
A hybrid forward osmosis (FO) and reverse osmosis (RO)/nanofiltration (NF) system in a closed-loop operation with selected draw solutes was evaluated to treat coal mine impaired water. This study provides an insight of selecting the most suitable draw solution (DS) by conducting environmental and economic life cycle assessment (LCA). Baseline environmental LCA showed that the dominant components to energy use and global warming are the DS recovery processes (i.e. RO or NF processes) and FO membrane materials, respectively. When considering the DS replenishment in FO, the contribution of chemical use to the overall global warming impact was significant for all hybrid systems. Furthermore, from an environmental perspective, the FO-NF hybrid system with Na2SO4 shows the lowest energy consumption and global warming with additional considerations of final product water quality and FO brine disposal. From an economic perspective, the FO-NF with Na2SO4 showed the lowest total operating cost due to its lower DS loss and relatively low solute cost. In a closed-loop system, FO-NF with NaCl and Na2SO4 had the lowest total water cost at optimum NF recovery rates of 90 and 95%, respectively. FO-NF with Na2SO4 had the lowest environmental and economic impacts. Overall, draw solute performances and cost in FO and recovery rate in RO/NF play a crucial role in determining the total water cost and environmental impact of FO hybrid systems in a closed-loop operation.
Performance of Generalized Multicarrier DS-CDMA over Nakagami-$m$ Fading Channels
Yang, L-L.; Hanzo, L.
2002-01-01
A class of generalized multicarrier direct sequence code-division multiple-access (MC DS-CDMA) schemes is defined and its performance is considered over multipath Nakagamifading channels. The spacing between two adjacent subcarriers of the generalized MC DS-CDMA is a variable, allowing us to gain insight into the effects of the spacing on the bit error rate (BER) performance of MC DS-CDMA systems. This generalized MC DS-CDMA scheme includes the subclasses of multitone DS-CDMA and orthogonal M...
A General Model for Performance Evaluation in DS-CDMA Systems with Variable Spreading Factors
Chiaraluce, Franco; Gambi, Ennio; Righi, Giorgia
This paper extends previous analytical approaches for the study of CDMA systems to the relevant case of multipath environments where users can operate at different bit rates. This scenario is of interest for the Wideband CDMA strategy employed in UMTS, and the model permits the performance comparison of classic and more innovative spreading signals. The method is based on the characteristic function approach, that allows to model accurately the various kinds of interferences. Some numerical examples are given with reference to the ITU-R M. 1225 Recommendations, but the analysis could be extended to different channel descriptions.
Noor Safiza Mohamad Nor; Nur Shahida Abdul Aziz; Cheong Siew Man; Rashidah Ambak; Mohd Azahadi Omar
2015-01-01
Introduction: Autism Spectrum Disorders (ASD), Down Syndrome (DS) and Cerebral Palsy (CP) are the most common disabilities among children. Nutritional status assessment is important as these children are at risk of underweight, overweight or obesity. Therefore, the objectives of this review were to identify evidence on the prevalence of nutritional status of children with DS, CP and ASD, and to determine tools and indicators to measure the nutritional status of these children. Methods: This s...
Diclofenac sodium (DS) loaded bioerodible polymer based constructs
Piras, M.; Chiellini, F.; Nikkola, L.; Ashammakhi, N.; Chiellini, E.
2008-02-01
Pain is a prevalent problem that can raise morbidity of patients. Pain killer releasing biodegradable materials have been developed by using different techniques and biomaterials. The objective of the current study is to evaluate the use of a new bioerodible polymer for release of diclofenac sodium (DS). 1-butanol hemiester poly(maleic anhydride-alt-2-methoxyethyl vinyl ether) (PAM14) was prepared in the university of Pisa and selected as polymer of choice for the study. Polymer solutions of 5-10% (in ethanol or in acetic acid) were prepared, half of them containing 2% DS. The solutions were then electrospun to produce nanomats that were subsequently characterized using SEM. Fiber diameter was 160 nm 1 μm. Increasing polymer concentration increased the size of the fibers but reduced the number of beads (with or without DS). In the specimens obtained from acetic acid solution, the addition of DS resulted in a reduction in fiber diameter and an increase in the inter-bead distance. Corresponding ethanol solutions gave more homogeneous specimens than did acetic acid, having a lower number of beads. With the addition of DS a reduction in fiber diameter was observed for the acetic acid specimens. However, in ethanol, adding DS resulted in increased fiber diameter. Accordingly, it can be concluded that it is feasible to develop electrospun diclofenac releasing bioerodible nanostructures that have potential use in pain management. Their further evaluation is however, needed both in vitro and in vivo.
International Nuclear Information System (INIS)
Bender, D.J.
1978-01-01
The hybrid reactor studies are reviewed. The optimization of the point design and work on a reference design are described. The status of the nuclear analysis of fast spectrum blankets, systems studies for fissile fuel producing hybrid reactor, and the mechanical design of the machine are reviewed
Observation of $B^+_c \\rightarrow J/\\psi D_s^+$ and $B^+_c \\rightarrow J/\\psi D_s^{*+}$ decays
Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A
2013-01-01
The decays $B^+_c \\rightarrow J/\\psi D_s^+$ and $B^+_c \\rightarrow J/\\psi D_s^{*+}$ are observed for the first time using a dataset, corresponding to an integrated luminosity of 3$fb^{-1}$, collected by the LHCb experiment in proton-proton collisions at centre-of-mass energies of $\\sqrt{s}$=7 and 8 TeV. The statistical significance for both signals is in excess of 9 standard deviations. The following ratios of branching fractions are measured to be \\begin{equation*}BR( B^+_c \\rightarrow J/\\psi D_s^+)/BR( B^+_c \\rightarrow J/\\psi \\pi+ ) = 2.90 \\pm 0.57 \\pm 0.24$,\\end{equation*} \\begin{equation*}BR( B^+_c \\rightarrow J/\\psi D_s^{*+} ) / BR ( B^+_c \\rightarrow J/\\psi D_s^+ ) = 2.37 \\pm 0.56 \\pm 0.10, \\end{equation*} where the first uncertainties are statistical and the second systematic. The mass of the $B^+_c$ meson is measured to be \\begin{equation*}m_{B^+_c} = 6276.28 \\pm 1.44 (stat) \\pm 0.36(syst) MeV/c^2,\\end{equation*} using the $B^+_c \\rightarrow J/\\psi D_...
Hidding, E.; Swaab, H.; de Sonneville, L. M J; van Engeland, H.; Vorstman, J. A S
2016-01-01
This paper examines how COMT158 genotypes and plasma proline levels are associated with variable penetrance of social behavioural and social cognitive problems in 22q11.2 deletion syndrome (22q11DS). Severity of autistic spectrum symptoms of 45 participants with 22q11DS was assessed using the Autism
DS Mesons in Asymmetric Hot and Dense Hadronic Matter
Directory of Open Access Journals (Sweden)
Divakar Pathak
2015-01-01
Full Text Available The in-medium properties of DS mesons are investigated within the framework of an effective hadronic model, which is a generalization of a chiral SU(3 model, to SU(4, in order to study the interactions of the charmed hadrons. In the present work, the DS mesons are observed to experience net attractive interactions in a dense hadronic medium, hence reducing the masses of the DS+ and DS- mesons from the vacuum values. While this conclusion holds in both nuclear and hyperonic media, the magnitude of the mass drop is observed to intensify with the inclusion of strangeness in the medium. Additionally, in hyperonic medium, the mass degeneracy of the DS mesons is observed to be broken, due to opposite signs of the Weinberg-Tomozawa interaction term in the Lagrangian density. Along with the magnitude of the mass drops, the mass splitting between DS+ and DS- mesons is also observed to grow with an increase in baryonic density and strangeness content of the medium. However, all medium effects analyzed are found to be weakly dependent on isospin asymmetry and temperature. We discuss the possible implications emanating from this analysis, which are all expected to make a significant difference to observables in heavy ion collision experiments, especially the upcoming Compressed Baryonic Matter (CBM experiment at the future Facility for Antiproton and Ion Research (FAIR, GSI, where matter at high baryonic densities is planned to be produced.
Dicer uses distinct modules for recognizing dsRNA termini.
Sinha, Niladri K; Iwasa, Janet; Shen, Peter S; Bass, Brenda L
2018-01-19
Invertebrates rely on Dicer to cleave viral double-stranded RNA (dsRNA), and Drosophila Dicer-2 distinguishes dsRNA substrates by their termini. Blunt termini promote processive cleavage, while 3' overhanging termini are cleaved distributively. To understand this discrimination, we used cryo-electron microscopy to solve structures of Drosophila Dicer-2 alone and in complex with blunt dsRNA. Whereas the Platform-PAZ domains have been considered the only Dicer domains that bind dsRNA termini, unexpectedly, we found that the helicase domain is required for binding blunt, but not 3' overhanging, termini. We further showed that blunt dsRNA is locally unwound and threaded through the helicase domain in an adenosine triphosphate-dependent manner. Our studies reveal a previously unrecognized mechanism for optimizing antiviral defense and set the stage for the discovery of helicase-dependent functions in other Dicers. Copyright © 2018 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.
Tulpová, Zuzana; Luo, Ming-Cheng; Toegelová, Helena; Visendi, Paul; Hayashi, Satomi; Vojta, Petr; Paux, Etienne; Kilian, Andrzej; Abrouk, Michaël; Bartoš, Jan; Hajdúch, Marián; Batley, Jacqueline; Edwards, David; Doležel, Jaroslav; Šimková, Hana
2018-03-08
Bread wheat (Triticum aestivum L.) is a staple food for a significant part of the world's population. The growing demand on its production can be satisfied by improving yield and resistance to biotic and abiotic stress. Knowledge of the genome sequence would aid in discovering genes and QTLs underlying these traits and provide a basis for genomics-assisted breeding. Physical maps and BAC clones associated with them have been valuable resources from which to generate a reference genome of bread wheat and to assist map-based gene cloning. As a part of a joint effort coordinated by the International Wheat Genome Sequencing Consortium, we have constructed a BAC-based physical map of bread wheat chromosome arm 7DS consisting of 895 contigs and covering 94% of its estimated length. By anchoring BAC contigs to one radiation hybrid map and three high resolution genetic maps, we assigned 73% of the assembly to a distinct genomic position. This map integration, interconnecting a total of 1713 markers with ordered and sequenced BAC clones from a minimal tiling path, provides a tool to speed up gene cloning in wheat. The process of physical map assembly included the integration of the 7DS physical map with a whole-genome physical map of Aegilops tauschii and a 7DS Bionano genome map, which together enabled efficient scaffolding of physical-map contigs, even in the non-recombining region of the genetic centromere. Moreover, this approach facilitated a comparison of bread wheat and its ancestor at BAC-contig level and revealed a reconstructed region in the 7DS pericentromere. Copyright © 2018. Published by Elsevier B.V.
DS read-out transcription in transgenic tomato plants
Rudenko, George N.; Nijkamp, H. John J.; Hille, Jacques
1994-01-01
To select for Ds transposition in transgenic tomato plants a phenotypic excision assay, based on restoration of hygromycin phosphotransferase (HPT II) gene expression, was employed. Some tomato plants, however, expressed the marker gene even though the Ds had not excised. Read-out transcriptional
Davis, Matthew A Cody; Spriggs, Amy; Rodgers, Alexis; Campbell, Jonathan
2018-06-01
Deficits in social skills are often exhibited in individuals with comorbid Down syndrome (DS) and autism spectrum disorder (ASD), and there is a paucity of research to help guide intervention for this population. In the present study, a multiple probe study across behaviors, replicated across participants, assessed the effectiveness of peer-delivered simultaneous prompting in teaching socials skills to adults with DS-ASD using visual analysis techniques and Tau-U statistics to measure effect. Peer-mediators with DS and intellectual disability (ID) delivered simultaneous prompting sessions reliably (i.e., > 80% reliability) to teach social skills to adults with ID and a dual-diagnoses of DS-ASD with small (Tau Weighted = .55, 90% CI [.29, .82]) to medium effects (Tau Weighted = .75, 90% CI [.44, 1]). Statistical and visual analysis findings suggest a promising social skills intervention for individuals with DS-ASD as well as reliable delivery of simultaneous prompting procedures by individuals with DS.
Wilson, Jesse W; Park, Jong Kang; Warren, Warren S; Fischer, Martin C
2015-03-01
The lock-in amplifier is a critical component in many different types of experiments, because of its ability to reduce spurious or environmental noise components by restricting detection to a single frequency and phase. One example application is pump-probe microscopy, a multiphoton technique that leverages excited-state dynamics for imaging contrast. With this application in mind, we present here the design and implementation of a high-speed lock-in amplifier on the field-programmable gate array (FPGA) coprocessor of a data acquisition board. The most important advantage is the inherent ability to filter signals based on more complex modulation patterns. As an example, we use the flexibility of the FPGA approach to enable a novel pump-probe detection scheme based on spread-spectrum communications techniques.
Methodology and Implementation on DSP of Heuristic Multiuser DS/CDMA Detectors
Directory of Open Access Journals (Sweden)
Alex Miyamoto Mussi
2010-12-01
Full Text Available The growing number of users of mobile communications networks and the scarcity of the electromagnetic spectrum make the use of diversity techniques and detection/decoding efficient, such as the use of multiple antennas at the transmitter and/or receiver, multiuser detection (MuD – Multiuser Detection, among others, have an increasingly prominent role in the telecommunications landscape. This paper presents a design methodology based on digital signal processors (DSP – Digital Signal Processor with a view to the implementation of multiuser heuristics detectors in systems DS/CDMA (Direct Sequence Code Division Multiple Access. Heuristics detection techniques result in near-optimal performance in order to approach the performance of maximum-likelihood (ML. In this work, was employed the DSP development platform called the C6713 DSK, which is based in Texas TMS320C6713 processor. The heuristics techniques proposed are based on well established algorithms in the literature. The efficiency of the algorithms implemented in DSP has been evaluated numerically by computing the measure of bit error rate (BER. Finally, the feasibility of implementation in DSP could then be verified by comparing results from multiple Monte-Carlo simulation in Matlab, with those obtained from implementation on DSP. It also demonstrates the effective increase in performance and system capacity of DS/CDMA with the use of heuristic multiuser detection techniques, implemented directly in the DSP.
$B0 \\to Ds^{(*)}Ds^{(*)}$ and outlook of $B0 \\to D^{(*)}D$ at LHCb
Belloli, Nicoletta
2016-01-01
The measurement of the inclusive branching fraction of $B0s \\to Ds^{(*)+} Ds^{(*)-}$ decay together with its contribution to the determination of $\\Delta \\Gamma{s}/ \\Gamma {s}$ are presented. The branching fraction value is compatible with results from previous experiments, improving the world average. The $B0 \\to D^+D^-$ and $B0 \\to D^*D^{(*)}$ decays are used to measure the parameters associated with $CP$ Violation in those channels; while the analysis associated to the second channel is at an initial stage the first one is almost concluded, the values obtained for the sensitivity on the $CP$ observables show that LHCb can rival the results obtained by previous experiments.
Spread Spectrum Modulation by Using Asymmetric-Carrier Random PWM
DEFF Research Database (Denmark)
Mathe, Laszlo; Lungeanu, Florin; Sera, Dezso
2012-01-01
is very effective and is independent from the modulation index. The flat motor current spectrum generates an acoustical noise close to the white noise, which improves the acoustical performance of the drive. The new carrier wave is easy to implement digitally, without employing any external circuits...
Excited delirium syndrome (ExDS): treatment options and considerations.
Vilke, Gary M; Bozeman, William P; Dawes, Donald M; Demers, Gerard; Wilson, Michael P
2012-04-01
The term Excited Delirium Syndrome (ExDS) has traditionally been used in the forensic literature to describe findings in a subgroup of patients with delirium who suffered lethal consequences from their untreated severe agitation.(1-5) Excited delirium syndrome, also known as agitated delirium, is generally defined as altered mental status and combativeness or aggressiveness. Although the exact signs and symptoms are difficult to define precisely, clinical findings often include many of the following: tolerance to significant pain, rapid breathing, sweating, severe agitation, elevated temperature, delirium, non-compliance or poor awareness to direction from police or medical personnel, lack of fatiguing, unusual or superhuman strength, and inappropriate clothing for the current environment. It has become increasingly recognized that individuals displaying ExDS are at high risk for sudden death, and ExDS therefore represents a true medical emergency. Recently the American College of Emergency Physicians (ACEP) published the findings of a white paper on the topic of ExDS to better find consensus on the issues of definition, diagnosis, and treatment.(6) In so doing, ACEP joined the National Association of Medical Examiners (NAME) in recognizing ExDS as a medical condition. For both paramedics and physicians, the difficulty in diagnosing the underlying cause of ExDS in an individual patient is that the presenting clinical signs and symptoms of ExDS can be produced by a wide variety of clinical disease processes. For example, agitation, combativeness, and altered mental status can be produced by hypoglycemia, thyroid storm, certain kinds of seizures, and these conditions can be difficult to distinguish from those produced by cocaine or methamphetamine intoxication.(7) Prehospital personnel are generally not expected to differentiate between the multiple possible causes of the patient's presentation, but rather simply to recognize that the patient has a medical emergency
A novel pathway to detect and cope with exogenous dsDNA.
Kobayashi, Shouhei; Haraguchi, Tokuko
2015-01-01
How a living cell responds to exogenous materials is one of the fundamental questions in the life sciences. In particular, understanding the mechanisms by which a cell recognizes exogenous double-stranded DNA (dsDNA) is important for immunology research because it will facilitate the control of pathogen infections that entail the presence of exogenous dsDNA in the cytoplasm of host cells. Several cytosolic dsDNA sensor proteins that trigger innate immune responses have been identified and the downstream signaling pathways have been investigated. However, the events that occur at the site of exogenous dsDNA when it is exposed to the cytosol of the host cell remain unknown. Using dsDNA-coated polystyrene beads incorporated into living cells, we recently found that barrier-to-autointegration factor (BAF) binds to the exogenous dsDNA immediately after its appearance in the cytosol and plays a role in DNA avoidance of autophagy. Our findings reveal a novel pathway in which BAF plays a key role in the detection of and response to exogenous dsDNA.
Data Analysis Details (DS): SE53_DS03 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available SE53_DS03 In-house software An original data file (.wiff) was converted to an uniqu...e binary file (.kiff) using in-house software (nondisclosure). Peak picking and alignment were performed usi...s including internal standards, peaks were annotated automatically using the same software. For normalizatio...ng the another in-house software (nondisclosure), peaks were picked and aligned among samples automatically.
DNA hybridization sensor based on pentacene thin film transistor.
Kim, Jung-Min; Jha, Sandeep Kumar; Chand, Rohit; Lee, Dong-Hoon; Kim, Yong-Sang
2011-01-15
A DNA hybridization sensor using pentacene thin film transistors (TFTs) is an excellent candidate for disposable sensor applications due to their low-cost fabrication process and fast detection. We fabricated pentacene TFTs on glass substrate for the sensing of DNA hybridization. The ss-DNA (polyA/polyT) or ds-DNA (polyA/polyT hybrid) were immobilized directly on the surface of the pentacene, producing a dramatic change in the electrical properties of the devices. The electrical characteristics of devices were studied as a function of DNA immobilization, single-stranded vs. double-stranded DNA, DNA length and concentration. The TFT device was further tested for detection of λ-phage genomic DNA using probe hybridization. Based on these results, we propose that a "label-free" detection technique for DNA hybridization is possible through direct measurement of electrical properties of DNA-immobilized pentacene TFTs. Copyright © 2010 Elsevier B.V. All rights reserved.
Mathematical model for spreading dynamics of social network worms
International Nuclear Information System (INIS)
Sun, Xin; Liu, Yan-Heng; Han, Jia-Wei; Liu, Xue-Jie; Li, Bin; Li, Jin
2012-01-01
In this paper, a mathematical model for social network worm spreading is presented from the viewpoint of social engineering. This model consists of two submodels. Firstly, a human behavior model based on game theory is suggested for modeling and predicting the expected behaviors of a network user encountering malicious messages. The game situation models the actions of a user under the condition that the system may be infected at the time of opening a malicious message. Secondly, a social network accessing model is proposed to characterize the dynamics of network users, by which the number of online susceptible users can be determined at each time step. Several simulation experiments are carried out on artificial social networks. The results show that (1) the proposed mathematical model can well describe the spreading dynamics of social network worms; (2) weighted network topology greatly affects the spread of worms; (3) worms spread even faster on hybrid social networks
Invasive hybridization in a threatened species is accelerated by climate change
Muhlfeld, Clint C.; Kovach, Ryan P.; Jones, Leslie A.; Al-Chokhachy, Robert K.; Boyer, Matthew C.; Leary, Robb F.; Lowe, Winsor H.; Luikart, Gordon; Allendorf, Fred W.
2014-01-01
Climate change will decrease worldwide biodiversity through a number of potential pathways, including invasive hybridization (cross-breeding between invasive and native species). How climate warming influences the spread of hybridization and loss of native genomes poses difficult ecological and evolutionary questions with little empirical information to guide conservation management decisions. Here we combine long-term genetic monitoring data with high-resolution climate and stream temperature predictions to evaluate how recent climate warming has influenced the spatio-temporal spread of human-mediated hybridization between threatened native westslope cutthroat trout (Oncorhynchus clarkii lewisi) and non-native rainbow trout (Oncorhynchus mykiss), the world’s most widely introduced invasive fish. Despite widespread release of millions of rainbow trout over the past century within the Flathead River system, a large relatively pristine watershed in western North America, historical samples revealed that hybridization was prevalent only in one (source) population. During a subsequent 30-year period of accelerated warming, hybridization spread rapidly and was strongly linked to interactions between climatic drivers—precipitation and temperature—and distance to the source population. Specifically, decreases in spring precipitation and increases in summer stream temperature probably promoted upstream expansion of hybridization throughout the system. This study shows that rapid climate warming can exacerbate interactions between native and non-native species through invasive hybridization, which could spell genomic extinction for many species.
Invasive hybridization in a threatened species is accelerated by climate change
Muhlfeld, Clint C.; Kovach, Ryan P.; Jones, Leslie A.; Al-Chokhachy, Robert; Boyer, Matthew C.; Leary, Robb F.; Lowe, Winsor H.; Luikart, Gordon; Allendorf, Fred W.
2014-07-01
Climate change will decrease worldwide biodiversity through a number of potential pathways, including invasive hybridization (cross-breeding between invasive and native species). How climate warming influences the spread of hybridization and loss of native genomes poses difficult ecological and evolutionary questions with little empirical information to guide conservation management decisions. Here we combine long-term genetic monitoring data with high-resolution climate and stream temperature predictions to evaluate how recent climate warming has influenced the spatio-temporal spread of human-mediated hybridization between threatened native westslope cutthroat trout (Oncorhynchus clarkii lewisi) and non-native rainbow trout (Oncorhynchus mykiss), the world's most widely introduced invasive fish. Despite widespread release of millions of rainbow trout over the past century within the Flathead River system, a large relatively pristine watershed in western North America, historical samples revealed that hybridization was prevalent only in one (source) population. During a subsequent 30-year period of accelerated warming, hybridization spread rapidly and was strongly linked to interactions between climatic drivers--precipitation and temperature--and distance to the source population. Specifically, decreases in spring precipitation and increases in summer stream temperature probably promoted upstream expansion of hybridization throughout the system. This study shows that rapid climate warming can exacerbate interactions between native and non-native species through invasive hybridization, which could spell genomic extinction for many species.
Autodesk 3ds Max 2012 Essentials
Derakhshani, Randi L
2011-01-01
Get a jump-start on Autodesk 3ds Max 2012 essentials-with the Essentials! The new Essentials books from Sybex are beautiful, task-based, full-color Autodesk Official Training Guides that help you get up to speed on Autodesk topics quickly and easily. Autodesk 3ds Max 2012 Essentials thoroughly covers the fundamentals of this popular 3D animation effects, and visualization software, teaching you what you need to become quickly productive. By following the book's clear explanations, practical tutorials, and step-by-step exercises, you'll cover all the bases. Topics include modeling, animation,
Wu, Jie; Liu, Baibai; Ren, Zhenxing; Ni, Mengying; Li, Can; Gong, Yinyan; Qin, Wei; Huang, Yongli; Sun, Chang Q; Liu, Xinjuan
2018-05-01
To make full use of the solar energy, it remains a great challenge for semiconductor photocatalysts to harvest the full solar light spectrum from ultraviolet (UV) to visible even the near infrared (NIR) wavelength. Here we show firstly the CuS/RGO (reduced graphene oxide) hybrid photocatalyst synthesized via a microwave assisted method with full solar light (UV-Vis-NIR) active for efficient Cr(VI) reduction. The CuS/RGO displays high absorption and catalytic activity in the UV, visible and even the NIR light regions. As co-catalyst, RGO can separate and inhibit the recombination of charge carriers, consequently improving the catalytic activity. Only 1wt% RGO emersions can reduce 90% of Cr(VI) under the radiation of light over the full spectrum. Findings may provide a new strategy and substance to expand the utilization range of solar light from UV to visible even the NIR energy. Copyright © 2017. Published by Elsevier Inc.
Measurement of the CP-violating phase ϕs in Bs(0)→Ds(+)Ds(-) decays.
Aaij, R; Abellán Beteta, C; Adeva, B; Adinolfi, M; Affolder, A; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Anderson, J; Andreassen, R; Andreotti, M; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Borsato, M; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; Brett, D; Britsch, M; Britton, T; Brodzicka, J; Brook, N H; Brown, H; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Calabrese, R; Calvi, M; Calvo Gomez, M; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chefdeville, M; Chen, S; Cheung, S-F; Chiapolini, N; Chrzaszcz, M; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coco, V; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Corvo, M; Counts, I; Couturier, B; Cowan, G A; Craik, D C; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Dalseno, J; David, P; David, P N Y; Davis, A; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Donleavy, S; Dordei, F; Dorigo, M; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dreimanis, K; Dujany, G; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elena, E; Elsasser, Ch; Ely, S; Esen, S; Evans, H-M; Evans, T; Falabella, A; Färber, C; Farinelli, C; Farley, N; Farry, S; Fay, R F; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fol, P; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Fu, J; Furfaro, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; García Pardiñas, J; Garofoli, J; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gavardi, L; Gavrilov, G; Geraci, A; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianelle, A; Gianì, S; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grillo, L; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Henry, L; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Hunt, P; Hussain, N; Hutchcroft, D; Hynds, D; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jalocha, J; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Karodia, S; Kelsey, M; Kenyon, I R; Ketel, T; Khanji, B; Khurewathanakul, C; Klaver, S; Klimaszewski, K; Kochebina, O; Kolpin, M; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanfranchi, G; Langenbruch, C; Langhans, B; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Likhomanenko, T; Liles, M; Lindner, R; Linn, C; Lionetto, F; Liu, B; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lowdon, P; Lucchesi, D; Luo, H; Lupato, A; Luppi, E; Lupton, O; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Malinin, A; Manca, G; Mancinelli, G; Mapelli, A; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marino, P; Märki, R; Marks, J; Martellotti, G; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Mazurov, A; McCann, M; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M-N; Moggi, N; Molina Rodriguez, J; Monteil, S; Morandin, M; Morawski, P; Mordà, A; Morello, M J; Moron, J; Morris, A-B; Mountain, R; Muheim, F; Müller, K; Mussini, M; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Novoselov, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Onderwater, G; Orlandea, M; Otalora Goicochea, J M; Otto, A; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palombo, F; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrignani, C; Pazos Alvarez, A; Pearce, A; Pellegrino, A; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Pistone, A; Playfer, S; Plo Casasus, M; Polci, F; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Price, E; Price, J D; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rachwal, B; Rademacker, J H; Rakotomiaramanana, B; Rama, M; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redi, F; Reichert, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rotondo, M; Rouvinet, J; Ruf, T; Ruiz, H; Ruiz Valls, P; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrie, M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Sepp, I; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Shires, A; Silva Coutinho, R; Simi, G; Sirendi, M; Skidmore, N; Skillicorn, I; Skwarnicki, T; Smith, N A; Smith, E; Smith, E; Smith, J; Smith, M; Snoek, H; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Steinkamp, O; Stenyakin, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Straticiuc, M; Straumann, U; Stroili, R; Subbiah, V K; Sun, L; Sutcliffe, W; Swientek, K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szilard, D; Szumlak, T; T'Jampens, S; Teklishyn, M; Tellarini, G; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Todd, J; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vieites Diaz, M; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; de Vries, J A; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wilkinson, G; Williams, M P; Williams, M; Wilschut, H W; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wright, S; Wyllie, K; Xie, Y; Xing, Z; Xu, Z; Yang, Z; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L
2014-11-21
We present a measurement of the CP-violating weak mixing phase ϕs using the decay Bs(0)→Ds(+)Ds(-) in a data sample corresponding to 3.0 fb(-1) of integrated luminosity collected with the LHCb detector in pp collisions at center-of-mass energies of 7 and 8 TeV. An analysis of the time evolution of the system, which does not use the constraint |λ|=1 to allow for the presence of CP violation in decay, yields ϕs=0.02±0.17(stat)±0.02(syst) rad, |λ|=0.91(-0.15)(+0.18)(stat)±0.02(syst). This result is consistent with the standard model expectation.
Pompey, Justine M; Foda, Bardees; Singh, Upinder
2015-01-01
Dicer enzymes process double-stranded RNA (dsRNA) into small RNAs that target gene silencing through the RNA interference (RNAi) pathway. Dicer enzymes are complex, multi-domain RNaseIII proteins, however structural minimalism of this protein has recently emerged in parasitic and fungal systems. The most minimal Dicer, Saccharomyces castellii Dicer1, has a single RNaseIII domain and two double stranded RNA binding domains. In the protozoan parasite Entamoeba histolytica 27nt small RNAs are abundant and mediate silencing, yet no canonical Dicer enzyme has been identified. Although EhRNaseIII does not exhibit robust dsRNA cleavage in vitro, it can process dsRNA in the RNAi-negative background of Saccharomyces cerevisiae, and in conjunction with S. castellii Argonaute1 can partially reconstitute the RNAi pathway. Thus, although EhRNaseIII lacks the domain architecture of canonical or minimal Dicer enzymes, it has dsRNA processing activity that contributes to gene silencing via RNAi. Our data advance the understanding of small RNA biogenesis in Entamoeba as well as broaden the spectrum of non-canonical Dicer enzymes that contribute to the RNAi pathway.
Directory of Open Access Journals (Sweden)
Justine M Pompey
Full Text Available Dicer enzymes process double-stranded RNA (dsRNA into small RNAs that target gene silencing through the RNA interference (RNAi pathway. Dicer enzymes are complex, multi-domain RNaseIII proteins, however structural minimalism of this protein has recently emerged in parasitic and fungal systems. The most minimal Dicer, Saccharomyces castellii Dicer1, has a single RNaseIII domain and two double stranded RNA binding domains. In the protozoan parasite Entamoeba histolytica 27nt small RNAs are abundant and mediate silencing, yet no canonical Dicer enzyme has been identified. Although EhRNaseIII does not exhibit robust dsRNA cleavage in vitro, it can process dsRNA in the RNAi-negative background of Saccharomyces cerevisiae, and in conjunction with S. castellii Argonaute1 can partially reconstitute the RNAi pathway. Thus, although EhRNaseIII lacks the domain architecture of canonical or minimal Dicer enzymes, it has dsRNA processing activity that contributes to gene silencing via RNAi. Our data advance the understanding of small RNA biogenesis in Entamoeba as well as broaden the spectrum of non-canonical Dicer enzymes that contribute to the RNAi pathway.
A Study on the Security Levels of Spread-Spectrum Embedding Schemes in the WOA Framework.
Wang, Yuan-Gen; Zhu, Guopu; Kwong, Sam; Shi, Yun-Qing
2017-08-23
Security analysis is a very important issue for digital watermarking. Several years ago, according to Kerckhoffs' principle, the famous four security levels, namely insecurity, key security, subspace security, and stego-security, were defined for spread-spectrum (SS) embedding schemes in the framework of watermarked-only attack. However, up to now there has been little application of the definition of these security levels to the theoretical analysis of the security of SS embedding schemes, due to the difficulty of the theoretical analysis. In this paper, based on the security definition, we present a theoretical analysis to evaluate the security levels of five typical SS embedding schemes, which are the classical SS, the improved SS (ISS), the circular extension of ISS, the nonrobust and robust natural watermarking, respectively. The theoretical analysis of these typical SS schemes are successfully performed by taking advantage of the convolution of probability distributions to derive the probabilistic models of watermarked signals. Moreover, simulations are conducted to illustrate and validate our theoretical analysis. We believe that the theoretical and practical analysis presented in this paper can bridge the gap between the definition of the four security levels and its application to the theoretical analysis of SS embedding schemes.
In-medium properties of pseudoscalar D_s and B_s mesons
Chhabra, Rahul; Kumar, Arvind
2017-11-01
We calculate the shift in the masses and decay constants of D_s(1968) and B_s(5370) mesons in hot and dense asymmetric strange hadronic matter using QCD sum rules and chiral SU(3) model. In-medium strange quark condensates _{ρ _B}, and gluon condensates _{ρ _B}, to be used in the QCD sum rules for pseudoscalar D_s and B_s mesons, are calculated using a chiral SU(3) model. As an application of our present work, we calculate the in-medium decay widths of the excited (c\\bar{s}) states D_s^*(2715) and D_s^*(2860) decaying to (D_s(1968),η ) mesons. The medium effects in their decay widths are incorporated through the mass modification of the D_s(1968) and η mesons. The results of the present investigation may be helpful in understanding the possible outcomes of the future experiments like CBM and PANDA under the FAIR facility.
Sensitivity of Multicarrier Two-Dimensional Spreading Schemes to Synchronization Errors
Directory of Open Access Journals (Sweden)
Geneviève Jourdain
2008-06-01
Full Text Available This paper presents the impact of synchronization errors on the performance of a downlink multicarrier two-dimensional spreading OFDM-CDMA system. This impact is measured by the degradation of the signal to interference and noise ratio (SINR obtained after despreading and equalization. The contribution of this paper is twofold. First, we use some properties of random matrix and free probability theories to derive a new expression of the SINR. This expression is then independent of the actual value of the spreading codes while still accounting for the orthogonality between codes. This model is validated by means of Monte Carlo simulations. Secondly, the model is exploited to derive the SINR degradation of OFDM-CDMA systems due to synchronization errors which include a timing error, a carrier frequency offset, and a sampling frequency offset. It is also exploited to compare the sensitivities of MC-CDMA and MC-DS-CDMA systems to these errors in a frequency selective channel. This work is carried out for zero-forcing and minimum mean square error equalizers.
Autodesk 3ds Max 2013 essentials
Derakhshani, Dariush
2012-01-01
A four-color, task-based Autodesk Official Training Guide covering the core features of 3ds Max Beginning users of this popular 3D animation and effects software will find everything they need for a thorough understanding of the software's key features and functions in this colorful guide. The authors break down the complexities of learning 3D software and get you going right away with interesting, job-related projects. You'll learn the basics of modeling, texturing, animating, lighting, visualization, and visual effects with 3ds Max, exploring the methods and why they are used as they are.
Murdock, Kelly L
2013-01-01
A complete reference covering the newest version of 3ds Max software Autodesk 3ds Max is the popular 3D modeling, animation, rendering, and compositing software preferred by game developers and graphic designers in film and television. This comprehensive reference not only introduces beginners to this pricey and complex software, but also serves as a reference for experienced users. Packed with expert advice from popular author Kelly Murdock, it begins with a Quick Start tutorial to get you up and running, then continues with more than 150 step-by-step tutorials, advanced coverage, and plenty
Phuntsho, Sherub
2016-12-30
This study presents simulation of a closed-loop forward osmosis (FO)-nanofiltration (NF) hybrid system using fertiliser draw solution (DS) based on thermodynamic mass balance in a full-scale system neglecting the non-idealities such as finite membrane area that may exist in a real process. The simulation shows that the DS input parameters such as initial concentrations and its flow rates cannot be arbitrarily selected for a plant with defined volume output. For a fixed FO-NF plant capacity and feed concentration, the required initial DS flow rate varies inversely with the initial DS concentration or vice-versa. The net DS mass flow rate, a parameter constant for a fixed plant capacity but that increases linearly with the plant capacity and feed concentration, is the most important operational parameter of a closed-loop system. Increasing either of them or both increases the mass flow rate to the system directly affecting the final concentration of the diluted DS with direct energy implications to the NF process. Besides, the initial DS concentration and flow rates are also limited by the optimum recovery rates at which NF process can be operated which otherwise also have direct implications to the NF energy. This simulation also presents quantitative analysis of the reverse diffusion of fertiliser nutrients towards feed brine and the gradual accumulation of feed solutes within the closed system.
$B_{s}^{0} \\rightarrow D_{s}^{+(*)} D_{s}^{-(*)}$ decays in LHCb
Pritchard, A
2014-01-01
The decay of a $B_{s}^{0}$ meson to two oppositely charged $D_{s}$ mesons is one that is postulated to be almost exclusively CP even. Measuring the properties of this decay can therefore give important information about the behaviour of the $B_{s}^{0}$ system. This poster presents two of these measurements, made by LHCb, using data from run 1 of the LHC.
Examining the Overlap between Autism Spectrum Disorder and 22q11.2 Deletion Syndrome.
Ousley, Opal; Evans, A Nichole; Fernandez-Carriba, Samuel; Smearman, Erica L; Rockers, Kimberly; Morrier, Michael J; Evans, David W; Coleman, Karlene; Cubells, Joseph
2017-05-18
22q11.2 deletion syndrome (22q11.2DS) is a genomic disorder reported to associate with autism spectrum disorders (ASDs) in 15-50% of cases; however, others suggest that individuals with 22q11.2DS present psychiatric or behavioral features associated with ASDs, but do not meet full criteria for ASD diagnoses. Such wide variability in findings may arise in part due to methodological differences across studies. Our study sought to determine whether individuals with 22q11.2DS meet strict ASD diagnostic criteria using research-based guidelines from the Collaborative Programs of Excellence in Autism (CPEA), which required a gathering of information from three sources: the Autism Diagnostic Interview-Revised (ADI-R), the Autism Diagnostic Observational Schedule (ADOS), and a clinician's best-estimate diagnosis. Our study examined a cohort of children, adolescents, and young adults ( n = 56) with 22q11.2DS, who were ascertained irrespective of parents' behavioral or developmental concerns, and found that 17.9% ( n = 10) of the participants met CPEA criteria for an ASD diagnosis, and that a majority showed some level of social-communication impairment or the presence of repetitive behaviors. We conclude that strictly defined ASDs occur in a substantial proportion of individuals with 22q11.2DS, and recommend that all individuals with 22q11.2DS be screened for ASDs during early childhood.
Synchronization in spread spectrum laser radar systems based on PMD-DLL
Buxbaum, Bernd; Schwarte, Rudolf; Ringbeck, Thorsten; Luan, Xuming; Zhang, Zhigang; Xu, Zhanping; Hess, H.
2000-09-01
.g., heterodyne techniques), in this contribution only so called quasi-heterodyne techniques - - also known as phase shifting methods -- are discussed and used for the implementation. The light modulation schemes described in this contribution are square-wave as well as pseudo-noise modulation. The latter approach, inspired by the wide spread use in communication as well as in position detection (e.g., IS-95 and GPS), offers essential advantages and is the most promising modulation method for the ranging approach. So called CDMA (code division multiple access) systems form a major task in communication technology investigations since the third generation mobile phone standard is also partly based on this principle. Fast and reliable synchronization in direct sequence spread spectrum communication systems (DSSS) differs hardly from the already mentioned ranging approach and will also be discussed. The possibility to integrate all components in a monolithic PMD based DLL design is also presented and discussed. This method might offer the feature to integrate complete lines or matrixes of PMD based DLLs for highly parallel, multidimensional ranging. Finally, an outlook is given with regard to further optimized PMD front ends. An estimation of the expected characteristics concerning accuracy and speed of the distance measurement is given in conclusion.
Professional BlazeDS Creating Rich Internet Applications with Flex and Java
Tiwari, Shashank
2009-01-01
A hands-on guide to creating Rich Internet Applications (RIA) using BlazeDS. BlazeDS enables you to easily connect to back-end distributed data and push data in real time to Adobe Flex and Adobe AIR applications in order to garner more responsive Rich Internet Application (RIA) experiences. It is a scalable option for Flex and Java integration and allows you to create excellent RIAs with both Flex and Java. This informative resource provides you with detailed examples and walkthroughs that explain the best practices for creating RIAs using BlazeDS. You'll begin with the essentials of BlazeDS a
Minimum BER Receiver Filters with Block Memory for Uplink DS-CDMA Systems
Directory of Open Access Journals (Sweden)
Debbah Mérouane
2008-01-01
Full Text Available Abstract The problem of synchronous multiuser receiver design in the case of direct-sequence single-antenna code division multiple access (DS-CDMA uplink networks is studied over frequency selective fading channels. An exact expression for the bit error rate (BER is derived in the case of BPSK signaling. Moreover, an algorithm is proposed for finding the finite impulse response (FIR receiver filters with block memory such that the exact BER of the active users is minimized. Several properties of the minimum BER FIR filters with block memory are identified. The algorithm performance is found for scenarios with different channel qualities, spreading code lengths, receiver block memory size, near-far effects, and channel mismatch. For the BPSK constellation, the proposed FIR receiver structure with block memory has significant better BER with respect to and near-far resistance than the corresponding minimum mean square error (MMSE filters with block memory.
van Uitert, Edo; Joachimi, Benjamin; Joudaki, Shahab; Amon, Alexandra; Heymans, Catherine; Köhlinger, Fabian; Asgari, Marika; Blake, Chris; Choi, Ami; Erben, Thomas; Farrow, Daniel J.; Harnois-Déraps, Joachim; Hildebrandt, Hendrik; Hoekstra, Henk; Kitching, Thomas D.; Klaes, Dominik; Kuijken, Konrad; Merten, Julian; Miller, Lance; Nakajima, Reiko; Schneider, Peter; Valentijn, Edwin; Viola, Massimo
2018-06-01
We present cosmological parameter constraints from a joint analysis of three cosmological probes: the tomographic cosmic shear signal in ˜450 deg2 of data from the Kilo Degree Survey (KiDS), the galaxy-matter cross-correlation signal of galaxies from the Galaxies And Mass Assembly (GAMA) survey determined with KiDS weak lensing, and the angular correlation function of the same GAMA galaxies. We use fast power spectrum estimators that are based on simple integrals over the real-space correlation functions, and show that they are practically unbiased over relevant angular frequency ranges. We test our full pipeline on numerical simulations that are tailored to KiDS and retrieve the input cosmology. By fitting different combinations of power spectra, we demonstrate that the three probes are internally consistent. For all probes combined, we obtain S_8≡ σ _8 √{Ω _m/0.3}=0.800_{-0.027}^{+0.029}, consistent with Planck and the fiducial KiDS-450 cosmic shear correlation function results. Marginalizing over wide priors on the mean of the tomographic redshift distributions yields consistent results for S8 with an increase of 28 {per cent} in the error. The combination of probes results in a 26 per cent reduction in uncertainties of S8 over using the cosmic shear power spectra alone. The main gain from these additional probes comes through their constraining power on nuisance parameters, such as the galaxy intrinsic alignment amplitude or potential shifts in the redshift distributions, which are up to a factor of 2 better constrained compared to using cosmic shear alone, demonstrating the value of large-scale structure probe combination.
International Nuclear Information System (INIS)
Eeg, J.O.; Fajfer, S.; Prapotnik, A.
2005-01-01
The amplitudes for decays of the type B d,s →D s,d D s,d , have no factorizable contributions, while B d,s →D s,d D * s,d , and B d,s →D * s,d D * s,d have relatively small factorizable contributions through the annihilation mechanism. The dominant contributions to the decay amplitudes arise from chiral loop contributions and tree level amplitudes which can be obtained in terms of soft gluon emissions forming a gluon condensate. We predict that the branching ratios for the processes anti B 0 d →D s + D s - , anti B 0 d →D s +* D s - and anti B 0 d →D s + D s -* are all of order (2-3) x 10 -4 , while anti B 0 s →D d + D d - , anti B 0 s →D d +* D d - and anti B 0 s →D d + D d -* are of order (4-7) x 10 -3 . We obtain branching ratios for two D * 's in the final state of order two times bigger. (orig.)
Pathak, Nirenkumar; Li, Sheng; Kim, Youngjin; Chekli, Laura; Phuntsho, Sherub; Jang, Am; Ghaffour, NorEddine; Leiknes, TorOve; Shon, Ho Kyong
2018-01-01
A novel approach was employed to study removal of organic micropollutants (OMPs) in a baffled osmotic membrane bioreactor-microfiltration (OMBR-MF) hybrid system under oxic–anoxic conditions. The performance of OMBR-MF system was examined employing three different draw solutes (DS), and three model OMPs. The highest forward osmosis (FO) membrane rejection was attained with atenolol (100 %) due to its higher molar mass and positive charge. With inorganic DS caffeine (94-100 %) revealed highest removal followed by atenolol (89-96 %) and atrazine (16-40 %) respectively. All three OMPs exhibited higher removal with organic DS as compared to inorganic DS. Significant anoxic removal was observed for atrazine under very different redox conditions with extended anoxic cycle time. This can be linked with possible development of different microbial consortia responsible for diverse enzymes secretion. Overall, the OMBR-MF process showed effective removal of total organic carbon (98%) and nutrients (phosphate 97% and total nitrogen 85%), respectively.
Pathak, Nirenkumar
2018-04-14
A novel approach was employed to study removal of organic micropollutants (OMPs) in a baffled osmotic membrane bioreactor-microfiltration (OMBR-MF) hybrid system under oxic–anoxic conditions. The performance of OMBR-MF system was examined employing three different draw solutes (DS), and three model OMPs. The highest forward osmosis (FO) membrane rejection was attained with atenolol (100 %) due to its higher molar mass and positive charge. With inorganic DS caffeine (94-100 %) revealed highest removal followed by atenolol (89-96 %) and atrazine (16-40 %) respectively. All three OMPs exhibited higher removal with organic DS as compared to inorganic DS. Significant anoxic removal was observed for atrazine under very different redox conditions with extended anoxic cycle time. This can be linked with possible development of different microbial consortia responsible for diverse enzymes secretion. Overall, the OMBR-MF process showed effective removal of total organic carbon (98%) and nutrients (phosphate 97% and total nitrogen 85%), respectively.
Graviton localization and Newton law for a dS4 brane in a 5D bulk
International Nuclear Information System (INIS)
Kehagias, A; Tamvakis, K
2002-01-01
We consider a dS 4 brane embedded in a five-dimensional bulk with a positive, vanishing or negative bulk cosmological constant and derive the localized graviton spectrum that consists of a normalizable zero mode separated by a gap from a continuum of massive states. We estimate the massive sector contribution to the static potential at short distances and find that only in the case of a negative bulk cosmological constant is there a range, determined by the effective four-dimensional and bulk cosmological constants, where the conventional Newton law is valid. (letter to the editor)
Multicarrier Block-Spread CDMA for Broadband Cellular Downlink
Directory of Open Access Journals (Sweden)
Leus Geert
2004-01-01
Full Text Available Effective suppression of multiuser interference (MUI and mitigation of frequency-selective fading effects within the complexity constraints of the mobile constitute major challenges for broadband cellular downlink transceiver design. Existing wideband direct-sequence (DS code division multiple access (CDMA transceivers suppress MUI statistically by restoring the orthogonality among users at the receiver. However, they call for receive diversity and multichannel equalization to improve the fading effects caused by deep channel fades. Relying on redundant block spreading and linear precoding, we design a so-called multicarrier block-spread- (MCBS-CDMA transceiver that preserves the orthogonality among users and guarantees symbol detection, regardless of the underlying frequency-selective fading channels. These properties allow for deterministic MUI elimination through low-complexity block despreading and enable full diversity gains, irrespective of the system load. Different options to perform equalization and decoding, either jointly or separately, strike the trade-off between performance and complexity. To improve the performance over multi-input multi-output (MIMO multipath fading channels, our MCBS-CDMA transceiver combines well with space-time block-coding (STBC techniques, to exploit both multiantenna and multipath diversity gains, irrespective of the system load. Simulation results demonstrate the superior performance of MCBS-CDMA compared to competing alternatives.
Use of bacterially expressed dsRNA to downregulate Entamoeba histolytica gene expression.
Directory of Open Access Journals (Sweden)
Carlos F Solis
Full Text Available BACKGROUND: Modern RNA interference (RNAi methodologies using small interfering RNA (siRNA oligonucleotide duplexes or episomally synthesized hairpin RNA are valuable tools for the analysis of gene function in the protozoan parasite Entamoeba histolytica. However, these approaches still require time-consuming procedures including transfection and drug selection, or costly synthetic molecules. PRINCIPAL FINDINGS: Here we report an efficient and handy alternative for E. histolytica gene down-regulation mediated by bacterial double-stranded RNA (dsRNA targeting parasite genes. The Escherichia coli strain HT115 which is unable to degrade dsRNA, was genetically engineered to produce high quantities of long dsRNA segments targeting the genes that encode E. histolytica beta-tubulin and virulence factor KERP1. Trophozoites cultured in vitro were directly fed with dsRNA-expressing bacteria or soaked with purified dsRNA. Both dsRNA delivery methods resulted in significant reduction of protein expression. In vitro host cell-parasite assays showed that efficient downregulation of kerp1 gene expression mediated by bacterial dsRNA resulted in significant reduction of parasite adhesion and lytic capabilities, thus supporting a major role for KERP1 in the pathogenic process. Furthermore, treatment of trophozoites cultured in microtiter plates, with a repertoire of eighty-five distinct bacterial dsRNA segments targeting E. histolytica genes with unknown function, led to the identification of three genes potentially involved in the growth of the parasite. CONCLUSIONS: Our results showed that the use of bacterial dsRNA is a powerful method for the study of gene function in E. histolytica. This dsRNA delivery method is also technically suitable for the study of a large number of genes, thus opening interesting perspectives for the identification of novel drug and vaccine targets.
Lu, Yuqing; Yao, Miaomiao; Zhang, Jinpeng; Song, Liqiang; Liu, Weihua; Yang, Xinming; Li, Xiuquan; Li, Lihui
2016-09-01
A novel broad-spectrum powdery mildew resistance gene PmPB74 was identified in wheat- Agropyron cristatum introgression line Pubing 74. Development of wheat cultivars with broad-spectrum, durable resistance to powdery mildew has been restricted by lack of superior genetic resources. In this study, a wheat-A. cristatum introgression line Pubing 74, originally selected from a wide cross between the common wheat cultivar Fukuhokomugi (Fukuho) and Agropyron cristatum (L.) Gaertn (2n = 4x = 28; genome PPPP), displayed resistance to powdery mildew at both the seedling and adult stages. The putative alien chromosomal fragment in Pubing 74 was below the detection limit of genomic in situ hybridization (GISH), but evidence for other non-GISH-detectable introgressions was provided by the presence of three STS markers specific to A. cristatum. Genetic analysis indicated that Pubing 74 carried a single dominant gene for powdery mildew resistance, temporarily designated PmPB74. Molecular mapping showed that PmPB74 was located on wheat chromosome arm 5DS, and flanked by markers Xcfd81 and HRM02 at genetic distances of 2.5 and 1.7 cM, respectively. Compared with other lines with powdery mildew resistance gene(s) on wheat chromosome arm 5DS, Pubing 74 was resistant to all 28 Blumeria graminis f. sp tritici (Bgt) isolates from different wheat-producing regions of northern China. Allelism tests indicated that PmPB74 was not allelic to PmPB3558 or Pm2. Our work showed that PmPB74 is a novel gene with broad resistance to powdery mildew, and hence will be helpful in broadening the genetic basis of powdery mildew resistance in wheat.
Higher spin realization of the DS/CFT correspondence
International Nuclear Information System (INIS)
Anninos, Dionysios; Hartman, Thomas; Strominger, Andrew
2017-01-01
We conjecture that Vasiliev’s theory of higher spin gravity in four-dimensional de Sitter space (dS 4 ) is holographically dual to a three-dimensional conformal field theory (CFT 3 ) living on the spacelike boundary of dS 4 at future timelike infinity. The CFT 3 is the Euclidean Sp ( N ) vector model with anticommuting scalars. The free CFT 3 flows under a double-trace deformation to an interacting CFT 3 in the IR. We argue that both CFTs are dual to Vasiliev dS 4 gravity but with different future boundary conditions on the bulk scalar field. Our analysis rests heavily on analytic continuations of bulk and boundary correlators in the proposed duality relating the O ( N ) model with Vasiliev gravity in AdS 4 . (paper)
A Unified Approach to the Analysis of Multicarrier DS-CDMA over Nakagami-$M$ Fading Channels
Yang, L-L.; Hanzo, L.
2001-01-01
A class of unified multicarrier DS-CDMA (MC DS-CDMA) schemes is defined and its performance is considered over multipath Nakagami-$M$ fading channels. The spacing between two adjacent subcarriers of the unified MC DS-CDMA scheme is a variable, allowing us to gain insight into the effects of the spacing on the bit error rate (BER) performance of MC DS-CDMA systems. This unified MC DS-CDMA scheme includes the subclasses of multitone DS-CDMA and orthogonal MC DS-CDMA as special cases. The optimu...
Directory of Open Access Journals (Sweden)
Thibaud Delerue
2017-07-01
Full Text Available The spread of extended-spectrum beta-lactamase-producing Enterobacteriaceae (ESBL-PE in the hospital and also the community is worrisome. Neonates particularly are exposed to the risk of ESBL-PE acquisition and, owing to the immaturity of their immune system, to a higher secondary risk of ESBL-PE-related infection. Reducing the risk of acquisition in the hospital is usually based on a bundle of measures, including screening policies at admission, improving hand hygiene compliance, and decreasing antibiotic consumption. However, recent scientific data suggest new prevention opportunities based on microbiota modifications.
Hyperthyroidism in a population with Down syndrome (DS).
Goday-Arno, Alberto; Cerda-Esteva, Mariaina; Flores-Le-Roux, Juana Antonia; Chillaron-Jordan, Juan José; Corretger, Josep Maria; Cano-Pérez, Juan Francisco
2009-07-01
Thyroid disorders are frequent in patients with Down syndrome (DS). It is well-known that the prevalence of hypothyroidism is high but data on hyperthyroidism are scarce. To assess the prevalence, aetiology, clinical characteristics, evolution and treatment of hyperthyroidism in a population with DS attending a specialized medical centre. Data were gathered by systematic review of 1832 medical records from the Catalan DS Foundation, in Spain, registered between January 1991 and February 2006. Patients with the diagnosis of hyperthyroidism were identified and data on clinical features, physical examination, laboratory and imaging tests, treatment and evolution were collected. Twelve patients with hyperthyroidism were recorded (6.5 cases/1000 patients with DS). There were 5 males and 7 females, with a mean age at diagnosis of 16.8 years. The most common presenting symptoms were decreased heat tolerance, sweating, increased irritability and weight loss. All patients had diffuse goitre at physical examination and two patients presented with exophthalmia. Clinical diagnosis was confirmed biochemically. Thyroid-stimulating immunoglobulin levels were raised (mean 128.1 U/l) and imaging tests confirmed the diagnosis of Graves' disease in all cases. Patients started treatment with carbimazole at diagnosis and after a mean period of 40 months without clinical remission, they required definitive therapy with radioactive iodine. Subjects developed hypothyroidism after radio-iodine therapy and replacement therapy with levothyroxine was necessary. Hyperthyroidism is more prevalent in patients with DS than in the general population and has no gender predominance. It is caused mainly by Graves' disease. Anti-thyroid drugs were not effective in achieving remission and radioactive iodine as a definitive treatment was required in all cases.
Examining the Overlap between Autism Spectrum Disorder and 22q11.2 Deletion Syndrome
Directory of Open Access Journals (Sweden)
Opal Ousley
2017-05-01
Full Text Available 22q11.2 deletion syndrome (22q11.2DS is a genomic disorder reported to associate with autism spectrum disorders (ASDs in 15–50% of cases; however, others suggest that individuals with 22q11.2DS present psychiatric or behavioral features associated with ASDs, but do not meet full criteria for ASD diagnoses. Such wide variability in findings may arise in part due to methodological differences across studies. Our study sought to determine whether individuals with 22q11.2DS meet strict ASD diagnostic criteria using research-based guidelines from the Collaborative Programs of Excellence in Autism (CPEA, which required a gathering of information from three sources: the Autism Diagnostic Interview-Revised (ADI-R, the Autism Diagnostic Observational Schedule (ADOS, and a clinician’s best-estimate diagnosis. Our study examined a cohort of children, adolescents, and young adults (n = 56 with 22q11.2DS, who were ascertained irrespective of parents’ behavioral or developmental concerns, and found that 17.9% (n = 10 of the participants met CPEA criteria for an ASD diagnosis, and that a majority showed some level of social-communication impairment or the presence of repetitive behaviors. We conclude that strictly defined ASDs occur in a substantial proportion of individuals with 22q11.2DS, and recommend that all individuals with 22q11.2DS be screened for ASDs during early childhood.
Mass production of shortleaf x slash pine hybrids by pollinating unbagged female flowers
Philip C. Wakeley; O.O. Wells; T.E. Campbell
1966-01-01
A simple method of mass-producing shortleaf x slash pine hybrids was attempted. Large quantities of slash pine pollen were spread on unbagged shortleaf flowers in the hope of recovering a high percentage of hybrid progeny and thus materially reducing the cost of producing such hybrids by conventional controlled pollination. The hybrid is very promising, but, as Snyder...
Correlation between CHA2DS2-VASc Score and Glaucoma Treatment and Prognosis.
Pikkel, Yoav Y; Krebs, Daniel; Igal, Vadim; Sharabi-Nov, Adi; Epstein, Irena; Pikkel, Joseph
2018-01-01
To find if CHA 2 DS 2 -VASc scale can accurately predict the treatment, prognosis, and outcome for primary open-angle glaucoma (POAG). A survey of 250,000 patient years was taken, using the records of the Ophthalmology Department at Ziv Medical Center. Data was collected regarding the retinal nerve fiber layer (RNFL), visual field (VF), line of treatment (LOT) of glaucoma, and all the data needed to accurately calculate CHA 2 DS 2 -VASc score for each patient. Sixty-seven patients were included in the statistical analysis. The mean age was 72.5 years. The mean CHA 2 DS 2 -VASc score was 3.27 + -1.7. Positive Pearson's correlation coefficients were found for LOT and CHA 2 DS 2 -VASc score, 0.35, and for RNFL grade and CHA2DS2-VASc score, 0.37. The correlation was negative for RNFL width and CHA2DS2-VASc score, -0.35. CHA 2 DS 2 -VASc score was shown to be correlated with glaucoma. This correlation was manifested positively by the LOT needed to stop glaucoma progression, with higher CHA 2 DS 2 -VASc scores correlated with more aggressive treatment. Since glaucoma is a disease with a progressing nature, it is important to treat patients aggressively on one hand, while offering the most benign treatment as possible on the other hand. Modification of the CHA 2 DS 2 -VASc score could achieve an even higher correlation.
Minimum BER Receiver Filters with Block Memory for Uplink DS-CDMA Systems
Directory of Open Access Journals (Sweden)
Mérouane Debbah
2008-05-01
Full Text Available The problem of synchronous multiuser receiver design in the case of direct-sequence single-antenna code division multiple access (DS-CDMA uplink networks is studied over frequency selective fading channels. An exact expression for the bit error rate (BER is derived in the case of BPSK signaling. Moreover, an algorithm is proposed for finding the finite impulse response (FIR receiver filters with block memory such that the exact BER of the active users is minimized. Several properties of the minimum BER FIR filters with block memory are identified. The algorithm performance is found for scenarios with different channel qualities, spreading code lengths, receiver block memory size, near-far effects, and channel mismatch. For the BPSK constellation, the proposed FIR receiver structure with block memory has significant better BER with respect to Eb/N0 and near-far resistance than the corresponding minimum mean square error (MMSE filters with block memory.
Capability of ds-DNA duplex structure in growing fluorescent silver nanoclusters
International Nuclear Information System (INIS)
Wu, Tao; Lin, Fan; Hu, Yuehua; Wang, Ying; Zhou, Xiaoshun; Shao, Yong
2016-01-01
Silver nanoclusters (AgNCs) have attracted wide interests in variant fields due to their easy synthesis and practical tunability in fluorescence properties. DNA has been generally used as the host to grow AgNCs due to the sequence-dependent fluorescence behavior. Actually, in such DNA, various ss-DNA segments that are structurally confined by the rigid ds-DNA counterparts have been used as the AgNCsГ—Ві growth sites. However, whether the ds-DNA structure plays somewhat role in AgNCsГ—Ві creation has not been well elucidated. Herein, we found that ds-DNA can also accommodate the growth of fluorescent AgNCs. The fluorescent AgNCs grown on ds-DNA should be separated each other and the G/C base pairs with right context sequences are the growth sites of fluorescent AgNCs. The intermediate A/T base pair among the continuous G/C ones seems to quench the growth of fluorescent AgNCs. For the repeat sequences, the fluorescence band position of AgNCs is not changed but the intensity is enhanced upon increasing the ds-DNA length, which is different from the results obtained with the previously reported ss-DNAs. AgNCs should be grown on the ds-DNA major groove, as convinced by the cytosine methylation experiment. Our work demonstrates that besides the ss-DNA role in defining AgNCs, one should also take into account the critical role of the ds-DNA segment in tuning the AgNCsГ—Ві fluorescence property.
Chung, Sharon A.; Taylor, Kimberly E.; Graham, Robert R.; Nititham, Joanne; Lee, Annette T.; Ortmann, Ward A.; Jacob, Chaim O.; Alarcón-Riquelme, Marta E.; Tsao, Betty P.; Harley, John B.; Gaffney, Patrick M.; Moser, Kathy L.; Petri, Michelle; Demirci, F. Yesim; Kamboh, M. Ilyas; Manzi, Susan; Gregersen, Peter K.; Langefeld, Carl D.; Behrens, Timothy W.; Criswell, Lindsey A.
2011-01-01
Systemic lupus erythematosus (SLE) is a clinically heterogeneous, systemic autoimmune disease characterized by autoantibody formation. Previously published genome-wide association studies (GWAS) have investigated SLE as a single phenotype. Therefore, we conducted a GWAS to identify genetic factors associated with anti–dsDNA autoantibody production, a SLE–related autoantibody with diagnostic and clinical importance. Using two independent datasets, over 400,000 single nucleotide polymorphisms (SNPs) were studied in a total of 1,717 SLE cases and 4,813 healthy controls. Anti–dsDNA autoantibody positive (anti–dsDNA +, n = 811) and anti–dsDNA autoantibody negative (anti–dsDNA –, n = 906) SLE cases were compared to healthy controls and to each other to identify SNPs associated specifically with these SLE subtypes. SNPs in the previously identified SLE susceptibility loci STAT4, IRF5, ITGAM, and the major histocompatibility complex were strongly associated with anti–dsDNA + SLE. Far fewer and weaker associations were observed for anti–dsDNA – SLE. For example, rs7574865 in STAT4 had an OR for anti–dsDNA + SLE of 1.77 (95% CI 1.57–1.99, p = 2.0E-20) compared to an OR for anti–dsDNA – SLE of 1.26 (95% CI 1.12–1.41, p = 2.4E-04), with pheterogeneity<0.0005. SNPs in the SLE susceptibility loci BANK1, KIAA1542, and UBE2L3 showed evidence of association with anti–dsDNA + SLE and were not associated with anti–dsDNA – SLE. In conclusion, we identified differential genetic associations with SLE based on anti–dsDNA autoantibody production. Many previously identified SLE susceptibility loci may confer disease risk through their role in autoantibody production and be more accurately described as autoantibody propensity loci. Lack of strong SNP associations may suggest that other types of genetic variation or non-genetic factors such as environmental exposures have a greater impact on susceptibility to anti–dsDNA – SLE. PMID
Directory of Open Access Journals (Sweden)
Sharon A Chung
2011-03-01
Full Text Available Systemic lupus erythematosus (SLE is a clinically heterogeneous, systemic autoimmune disease characterized by autoantibody formation. Previously published genome-wide association studies (GWAS have investigated SLE as a single phenotype. Therefore, we conducted a GWAS to identify genetic factors associated with anti-dsDNA autoantibody production, a SLE-related autoantibody with diagnostic and clinical importance. Using two independent datasets, over 400,000 single nucleotide polymorphisms (SNPs were studied in a total of 1,717 SLE cases and 4,813 healthy controls. Anti-dsDNA autoantibody positive (anti-dsDNA +, n = 811 and anti-dsDNA autoantibody negative (anti-dsDNA -, n = 906 SLE cases were compared to healthy controls and to each other to identify SNPs associated specifically with these SLE subtypes. SNPs in the previously identified SLE susceptibility loci STAT4, IRF5, ITGAM, and the major histocompatibility complex were strongly associated with anti-dsDNA + SLE. Far fewer and weaker associations were observed for anti-dsDNA - SLE. For example, rs7574865 in STAT4 had an OR for anti-dsDNA + SLE of 1.77 (95% CI 1.57-1.99, p = 2.0E-20 compared to an OR for anti-dsDNA - SLE of 1.26 (95% CI 1.12-1.41, p = 2.4E-04, with p(heterogeneity<0.0005. SNPs in the SLE susceptibility loci BANK1, KIAA1542, and UBE2L3 showed evidence of association with anti-dsDNA + SLE and were not associated with anti-dsDNA - SLE. In conclusion, we identified differential genetic associations with SLE based on anti-dsDNA autoantibody production. Many previously identified SLE susceptibility loci may confer disease risk through their role in autoantibody production and be more accurately described as autoantibody propensity loci. Lack of strong SNP associations may suggest that other types of genetic variation or non-genetic factors such as environmental exposures have a greater impact on susceptibility to anti-dsDNA - SLE.
Robu, Adrian C; Popescu, Laurentiu; Munteanu, Cristian V A; Seidler, Daniela G; Zamfir, Alina D
2015-09-15
In the central nervous system, chondroitin/dermatan sulfate (CS/DS) glycosaminoglycans (GAGs) modulate neurotrophic effects and glial cell maturation during brain development. Previous reports revealed that GAG composition could be responsible for CS/DS activities in brain. In this work, for the structural characterization of DS- and CS-rich domains in hybrid GAG chains extracted from neural tissue, we have developed an advanced approach based on high-resolution mass spectrometry (MS) using nanoelectrospray ionization Orbitrap in the negative ion mode. Our high-resolution MS and multistage MS approach was developed and applied to hexasaccharides obtained from 4- and 14-week-old mouse brains by GAG digestion with chondroitin B and in parallel with AC I lyase. The expression of DS- and CS-rich domains in the two tissues was assessed comparatively. The analyses indicated an age-related structural variability of the CS/DS motifs. The older brain was found to contain more structures and a higher sulfation of DS-rich regions, whereas the younger brain was found to be characterized by a higher sulfation of CS-rich regions. By multistage MS using collision-induced dissociation, we also demonstrated the incidence in mouse brain of an atypical [4,5-Δ-GlcAGalNAc(IdoAGalNAc)2], presenting a bisulfated CS disaccharide formed by 3-O-sulfate-4,5-Δ-GlcA and 6-O-sulfate-GalNAc moieties. Copyright © 2015 Elsevier Inc. All rights reserved.
Topology-selective jamming of fully-connected, code-division random-access networks
Polydoros, Andreas; Cheng, Unjeng
1990-01-01
The purpose is to introduce certain models of topology selective stochastic jamming and examine its impact on a class of fully-connected, spread-spectrum, slotted ALOHA-type random access networks. The theory covers dedicated as well as half-duplex units. The dominant role of the spatial duty factor is established, and connections with the dual concept of time selective jamming are discussed. The optimal choices of coding rate and link access parameters (from the users' side) and the jamming spatial fraction are numerically established for DS and FH spreading.
Does the KIR2DS5 gene protect from some human diseases?
Directory of Open Access Journals (Sweden)
Izabela Nowak
Full Text Available BACKGROUND: KIR2DS5 gene encodes an activating natural killer cell receptor whose ligand is not known. It was recently reported to affect the outcome of hematopoietic stem cell transplantation. METHODOLOGY/PRINCIPAL FINDINGS: In our studies on KIR2DS5 gene associations with human diseases, we compared the frequencies of this gene in patients and relevant controls. Typing for KIR2DS5 gene was performed by either individual or multiplex polymerase chain reactions which, when compared in the same samples, gave concordant results. We noted an apparently protective effect of KIR2DS5 gene presence in several clinical conditions, but not in others. Namely, this effect was observed in ankylosing spondylitis (p=0.003, odds ratio [OR]=0.47, confidence interval [CI]=0.28-0.79, endometriosis (p=0.03, OR=0.25, CI = 0.07-0.82 and acute rejection of kidney graft (p=0.0056, OR=0.44, CI=0.24-0.80, but not in non-small-cell lung carcinoma, rheumatoid arthritis, spontaneous abortion, or leukemia (all p>0.05. In addition, the simultaneous presence of KIR2DS5 gene and HLA-C C1 allotype exhibited an even stronger protective effect on ankylosing spondylitis (p=0.0003, OR=0.35, CI=0.19-0.65, whereas a lack of KIR2DS5 and the presence of the HLA-C C2 allotype was associated with ankylosing spondylitis (p=0.0017, OR=1.92, CI=1.28-2.89, whereas a lack of KIR2DS5 and presence of C1 allotype was associated with rheumatoid arthritis (p=0.005, OR=1.47, CI=1.13-1.92. The presence of both KIR2DS5 and C1 seemed to protect from acute kidney graft rejection (p=0.017, OR=0.47, CI=0.25-0.89, whereas lack of KIR2DS5 and presence of C2 seemed to favor rejection (p=0.0015, OR=2.13, CI=1.34-3.37. CONCLUSIONS/SIGNIFICANCE: Our results suggest that KIR2DS5 may protect from endometriosis, ankylosing spondylitis, and acute rejection of kidney graft.
Rijnen, M.W.L.M.; De Mooij, E.B.C.; Traversaro, S.; Nori, F.; Van De Wouw, N.; Saccon, A.; Nijmeijer, H.
2017-01-01
This work explores the stabilization of desired dynamic motion tasks involving hard impacts at non-negligible speed for humanoid robots. To this end, a so-called reference spreading hybrid control law is designed showing promising results in simulation. The simulations are performed employing a
Chinook Abundance - Linear Features [ds181
California Natural Resource Agency — The dataset 'ds181_Chinook_ln' is a product of the CalFish Adult Salmonid Abundance Database. Data in this shapefile are collected from stream sections or reaches...
Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A
2013-07-23
A search for non-resonant $D^{+}_{(s)} \\rightarrow \\pi^{+} \\mu^{+} \\mu^{-}$ and $D^{+}_{(s)} \\rightarrow \\pi^{-} \\mu^{+} \\mu^{+}$ decays is performed using proton-proton collision data, corresponding to an integrated luminosity of 1.0 fb$^{-1}$, at $\\sqrt{s}=7$ TeV recorded by the LHCb experiment in 2011. No signals are observed and the $90\\% \\, (95\\%)$ confidence level (CL) limits on the branching fractions are found to be \\begin{eqnarray*} \\mathcal{B}(D^{+} \\rightarrow \\pi^{+} \\mu^{+} \\mu^{-}) < 7.3 \\, (8.3) \\times 10^{-8},\\\\ \\mathcal{B}(D^{+}_{s} \\rightarrow \\pi^{+} \\mu^{+} \\mu^{-}) < 4.1 \\, (4.8) \\times 10^{-7},\\\\ \\mathcal{B}(D^{+} \\rightarrow \\pi^{-} \\mu^{+} \\mu^{+}) < 2.2 \\, (2.5) \\times 10^{-8},\\\\ \\mathcal{B}(D^{+}_{s} \\rightarrow \\pi^{-} \\mu^{+} \\mu^{+}) < 1.2 \\, (1.4) \\times 10^{-7}.\\\\ \\end{eqnarray*} These limits are the most stringent to date.
Ji, N. Y.; Capone, G. T.; Kaufmann, W. E.
2011-01-01
Background: The diagnostic validity of autism spectrum disorder (ASD) based on Diagnostic and Statistical Manual of Mental Disorders (DSM) has been challenged in Down syndrome (DS), because of the high prevalence of cognitive impairments in this population. Therefore, we attempted to validate DSM-based diagnoses via an unbiased categorisation of…
From hybrid swarms to swarms of hybrids
Stohlgren, Thomas J.; Szalanski, Allen L; Gaskin, John F.; Young, Nicholas E.; West, Amanda; Jarnevich, Catherine S.; Tripodi, Amber
2014-01-01
Science has shown that the introgression or hybridization of modern humans (Homo sapiens) with Neanderthals up to 40,000 YBP may have led to the swarm of modern humans on earth. However, there is little doubt that modern trade and transportation in support of the humans has continued to introduce additional species, genotypes, and hybrids to every country on the globe. We assessed the utility of species distributions modeling of genotypes to assess the risk of current and future invaders. We evaluated 93 locations of the genus Tamarix for which genetic data were available. Maxent models of habitat suitability showed that the hybrid, T. ramosissima x T. chinensis, was slightly greater than the parent taxa (AUCs > 0.83). General linear models of Africanized honey bees, a hybrid cross of Tanzanian Apis mellifera scutellata and a variety of European honey bee including A. m. ligustica, showed that the Africanized bees (AUC = 0.81) may be displacing European honey bees (AUC > 0.76) over large areas of the southwestern U.S. More important, Maxent modeling of sub-populations (A1 and A26 mitotypes based on mDNA) could be accurately modeled (AUC > 0.9), and they responded differently to environmental drivers. This suggests that rapid evolutionary change may be underway in the Africanized bees, allowing the bees to spread into new areas and extending their total range. Protecting native species and ecosystems may benefit from risk maps of harmful invasive species, hybrids, and genotypes.
Stability of the spreading in small-world network with predictive controller
International Nuclear Information System (INIS)
Bao, Z.J.; Jiang, Q.Y.; Yan, W.J.; Cao, Y.J.
2010-01-01
In this Letter, we apply the predictive control strategy to suppress the propagation of diseases or viruses in small-world network. The stability of small-world spreading model with predictive controller is investigated. The sufficient and necessary stability condition is given, which is closely related to the controller parameters and small-world rewiring probability p. Our simulations discover a phenomenon that, with the fixed predictive controller parameters, the spreading dynamics become more and more stable when p decreases from a larger value to a smaller one, and the suitable controller parameters can effectively suppress the spreading behaviors even when p varies within the whole spectrum, and the unsuitable controller parameters can lead to oscillation when p lies within a certain range.
Goatpoxvirus ATPase activity is increased by dsDNA and decreased by zinc ion.
Lee, Ming-Liang; Hsu, Wei-Li; Wang, Chi-Young; Chen, Hui-Yu; Lin, Fong-Yuan; Chang, Ming-Huang; Chang, Hong-You; Wong, Min-Liang; Chan, Kun-Wei
2016-10-01
Viral-encoded ATPase can act as a part of molecular motor in genome packaging of DNA viruses, such as vaccinia virus and adenovirus, by ATP hydrolysis and interaction with DNA. Poxviral ATPase (also called A32) is involved in genomic double-stranded DNA (dsDNA) encapsidation, and inhibition of the expression of A32 causes formation of immature virions lacking viral DNA. However, the role of A32 in goatpoxvirus genome packaging and its dsDNA binding property are not known. In this study, purified recombinant goatpoxvirus A32 protein (rA32) was examined for its dsDNA binding property as well as the effect of dsDNA on ATP hydrolysis. We found that rA32 could bind dsDNA, and its ATPase activity was significant increased with dsDNA binding. Effects of magnesium and calcium ions on ATP hydrolysis were investigated also. The ATPase activity was dramatically enhanced by dsDNA in the presence of Mg(2+); in contrast, ATPase function was not altered by Ca(2+). Furthermore, the enzyme activity of rA32 was completely blocked by Zn(2+). Regarding DNA-protein interaction, the rA32-ATP-Mg(2+) showed lower dsDNA binding affinity than that of rA32-ATP-Ca(2+). The DNA-protein binding was stronger in the presence of zinc ion. Our results implied that A32 may play a role in viral genome encapsidation and DNA condensation.
SuDS and human behaviour: Co-developing solutions to encourage sustainable behaviour
Directory of Open Access Journals (Sweden)
Everett Glyn
2016-01-01
Full Text Available Sustainable Drainage Systems (SuDS are today widely considered to be a more progressive and environmentally sensitive approach to Flood Risk Management (FRM. However, this paper argues that the sustainability of SuDS should not be so simply presumed. Devices will depend upon correct behaviour from those local to them in order to function properly over time, and for Green Infrastructure SuDS to flourish and deliver their promised multiple benefits. This paper looks to the potential value in using Social Practice Theory as a lens for understanding current behaviours around SuDS devices, and for assessing possible strategies for encouraging positive behaviour amongst affected communities. It concludes in arguing that involving local people as much as possible in the co-design of systems and then working to maintain involvement and awareness will be the most cost-effective means by which SuDS might be made to live up to the sustainability they are celebrated for.
Primordial anisotropies in gauged hybrid inflation
Akbar Abolhasani, Ali; Emami, Razieh; Firouzjahi, Hassan
2014-05-01
We study primordial anisotropies generated in the model of gauged hybrid inflation in which the complex waterfall field is charged under a U(1)gauge field. Primordial anisotropies are generated either actively during inflation or from inhomogeneities modulating the surface of end of inflation during waterfall transition. We present a consistent δN mechanism to calculate the anisotropic power spectrum and bispectrum. We show that the primordial anisotropies generated at the surface of end of inflation do not depend on the number of e-folds and therefore do not produce dangerously large anisotropies associated with the IR modes. Furthermore, one can find the parameter space that the anisotropies generated from the surface of end of inflation cancel the anisotropies generated during inflation, therefore relaxing the constrains on model parameters imposed from IR anisotropies. We also show that the gauge field fluctuations induce a red-tilted power spectrum so the averaged power spectrum from the gauge field can change the total power spectrum from blue to red. Therefore, hybrid inflation, once gauged under a U(1) field, can be consistent with the cosmological observations.
Primordial anisotropies in gauged hybrid inflation
International Nuclear Information System (INIS)
Abolhasani, Ali Akbar; Emami, Razieh; Firouzjahi, Hassan
2014-01-01
We study primordial anisotropies generated in the model of gauged hybrid inflation in which the complex waterfall field is charged under a U(1)gauge field. Primordial anisotropies are generated either actively during inflation or from inhomogeneities modulating the surface of end of inflation during waterfall transition. We present a consistent δN mechanism to calculate the anisotropic power spectrum and bispectrum. We show that the primordial anisotropies generated at the surface of end of inflation do not depend on the number of e-folds and therefore do not produce dangerously large anisotropies associated with the IR modes. Furthermore, one can find the parameter space that the anisotropies generated from the surface of end of inflation cancel the anisotropies generated during inflation, therefore relaxing the constrains on model parameters imposed from IR anisotropies. We also show that the gauge field fluctuations induce a red-tilted power spectrum so the averaged power spectrum from the gauge field can change the total power spectrum from blue to red. Therefore, hybrid inflation, once gauged under a U(1) field, can be consistent with the cosmological observations
Wang, Rui-Rong; Yu, Xiao-Qing; Zheng, Shu-Wang; Ye, Yang
2016-01-01
Location based services (LBS) provided by wireless sensor networks have garnered a great deal of attention from researchers and developers in recent years. Chirp spread spectrum (CSS) signaling formatting with time difference of arrival (TDOA) ranging technology is an effective LBS technique in regards to positioning accuracy, cost, and power consumption. The design and implementation of the location engine and location management based on TDOA location algorithms were the focus of this study; as the core of the system, the location engine was designed as a series of location algorithms and smoothing algorithms. To enhance the location accuracy, a Kalman filter algorithm and moving weighted average technique were respectively applied to smooth the TDOA range measurements and location results, which are calculated by the cooperation of a Kalman TDOA algorithm and a Taylor TDOA algorithm. The location management server, the information center of the system, was designed with Data Server and Mclient. To evaluate the performance of the location algorithms and the stability of the system software, we used a Nanotron nanoLOC Development Kit 3.0 to conduct indoor and outdoor location experiments. The results indicated that the location system runs stably with high accuracy at absolute error below 0.6 m.
dsRNA binding properties of RDE-4 and TRBP reflect their distinct roles in RNAi.
Parker, Greg S; Maity, Tuhin Subhra; Bass, Brenda L
2008-12-26
Double-stranded RNA (dsRNA)-binding proteins facilitate Dicer functions in RNA interference. Caenorhabditis elegans RDE-4 facilitates cleavage of long dsRNA to small interfering RNA (siRNA), while human trans-activation response RNA-binding protein (TRBP) functions downstream to pass siRNA to the RNA-induced silencing complex. We show that these distinct in vivo roles are reflected in in vitro binding properties. RDE-4 preferentially binds long dsRNA, while TRBP binds siRNA with an affinity that is independent of dsRNA length. These properties are mechanistically based on the fact that RDE-4 binds cooperatively, via contributions from multiple domains, while TRBP binds noncooperatively. Our studies offer a paradigm for how dsRNA-binding proteins, which are not sequence specific, discern dsRNA length. Additionally, analyses of the ability of RDE-4 deletion constructs and RDE-4/TRBP chimeras to reconstitute Dicer activity suggest RDE-4 promotes activity using its dsRNA-binding motif 2 to bind dsRNA, its linker region to interact with Dicer, and its C-terminus for Dicer activation.
Ebolavirus VP35 uses a bimodal strategy to bind dsRNA for innate immune suppression
Energy Technology Data Exchange (ETDEWEB)
Kimberlin, Christopher R.; Bornholdt, Zachary A.; Li, Sheng; Woods, Jr., Virgil L.; MacRae, Ian J.; Saphire, Erica Ollmann (Scripps); (UCSD)
2010-03-12
Ebolavirus causes a severe hemorrhagic fever and is divided into five distinct species, of which Reston ebolavirus is uniquely nonpathogenic to humans. Disease caused by ebolavirus is marked by early immunosuppression of innate immune signaling events, involving silencing and sequestration of double-stranded RNA (dsRNA) by the viral protein VP35. Here we present unbound and dsRNA-bound crystal structures of the dsRNA-binding domain of Reston ebolavirus VP35. The structures show that VP35 forms an unusual, asymmetric dimer on dsRNA binding, with each of the monomers binding dsRNA in a different way: one binds the backbone whereas the other caps the terminus. Additional SAXS, DXMS, and dsRNA-binding experiments presented here support a model of cooperative dsRNA recognition in which binding of the first monomer assists binding of the next monomer of the oligomeric VP35 protein. This work illustrates how ebolavirus VP35 could mask key recognition sites of molecules such as RIG-I, MDA-5, and Dicer to silence viral dsRNA in infection.
Neisseria gonorrhoeae strain with reduced susceptibilities to extended-spectrum cephalosporins.
Nguyen, Duylinh; Gose, Severin; Castro, Lina; Chung, Kathleen; Bernstein, Kyle; Samuel, Micheal; Bauer, Heidi; Pandori, Mark
2014-07-01
The spread of Neisseria gonorrhoeae strains with reduced susceptibility to extended-spectrum cephalosporins is an increasing public health threat. Using Etest and multiantigen sequence typing, we detected sequence type 1407, which is associated with reduced susceptibilities to extended-spectrum cephalosporins, in 4 major populated regions in California, USA, in 2012.
Norm for betonkonstruktioner DS411
DEFF Research Database (Denmark)
Hertz, Kristian
The fire chapter of the Danish Code of Practice for the structural use of concrete DS 411 contains methods and data for design of fire exposed concrete structures, all of them derived and documented by Kristian Hertz, who is a member of the two project teams writing the chapter. A considerable do...
Yang, Qiguang; Liu, Xu; Wu, Wan; Kizer, Susan; Baize, Rosemary R.
2016-01-01
A hybrid stream PCRTM-SOLAR model has been proposed for fast and accurate radiative transfer simulation. It calculates the reflected solar (RS) radiances with a fast coarse way and then, with the help of a pre-saved matrix, transforms the results to obtain the desired high accurate RS spectrum. The methodology has been demonstrated with the hybrid stream discrete ordinate (HSDO) radiative transfer (RT) model. The HSDO method calculates the monochromatic radiances using a 4-stream discrete ordinate method, where only a small number of monochromatic radiances are simulated with both 4-stream and a larger N-stream (N = 16) discrete ordinate RT algorithm. The accuracy of the obtained channel radiance is comparable to the result from N-stream moderate resolution atmospheric transmission version 5 (MODTRAN5). The root-mean-square errors are usually less than 5x10(exp -4) mW/sq cm/sr/cm. The computational speed is three to four-orders of magnitude faster than the medium speed correlated-k option MODTRAN5. This method is very efficient to simulate thousands of RS spectra under multi-layer clouds/aerosols and solar radiation conditions for climate change study and numerical weather prediction applications.
A hybrid modelling approach to simulating foot-and-mouth disease outbreaks in Australian livestock
Directory of Open Access Journals (Sweden)
Richard A Bradhurst
2015-03-01
Full Text Available Foot-and-mouth disease (FMD is a highly contagious and economically important viral disease of cloven-hoofed animals. Australia's freedom from FMD underpins a valuable trade in live animals and animal products. An outbreak of FMD would result in the loss of export markets and cause severe disruption to domestic markets. The prevention of, and contingency planning for, FMD are of key importance to government, industry, producers and the community. The spread and control of FMD is complex and dynamic due to a highly contagious multi-host pathogen operating in a heterogeneous environment across multiple jurisdictions. Epidemiological modelling is increasingly being recognized as a valuable tool for investigating the spread of disease under different conditions and the effectiveness of control strategies. Models of infectious disease can be broadly classified as: population-based models that are formulated from the top-down and employ population-level relationships to describe individual-level behaviour, individual-based models that are formulated from the bottom-up and aggregate individual-level behaviour to reveal population-level relationships, or hybrid models which combine the two approaches into a single model.The Australian Animal Disease Spread (AADIS hybrid model employs a deterministic equation-based model (EBM to model within-herd spread of FMD, and a stochastic, spatially-explicit agent-based model (ABM to model between-herd spread and control. The EBM provides concise and computationally efficient predictions of herd prevalence and clinical signs over time. The ABM captures the complex, stochastic and heterogeneous environment in which an FMD epidemic operates. The AADIS event-driven hybrid EBM/ABM architecture is a flexible, efficient and extensible framework for modelling the spread and control of disease in livestock on a national scale. We present an overview of the AADIS hybrid approach and a description of the model
Fusion--fission hybrid concepts for laser-induced fusion
International Nuclear Information System (INIS)
Maniscalco, J.
1976-01-01
Fusion-fission hybrid concepts are viewed as subcritical fission reactors driven and controlled by high-energy neutrons from a laser-induced fusion reactor. Blanket designs encompassing a substantial portion of the spectrum of different fission reactor technologies are analyzed and compared by calculating their fissile-breeding and fusion-energy-multiplying characteristics. With a large number of different fission technologies to choose from, it is essential to identify more promising hybrid concepts that can then be subjected to in-depth studies that treat the engineering safety, and economic requirements as well as the neutronic aspects. In the course of neutronically analyzing and comparing several fission blanket concepts, this work has demonstrated that fusion-fission hybrids can be designed to meet a broad spectrum of fissile-breeding and fusion-energy-multiplying requirements. The neutronic results should prove to be extremely useful in formulating the technical scope of future studies concerned with evaluating the technical and economic feasibility of hybrid concepts for laser-induced fusion
Sestini, Lorenzo
2015-01-01
The Bs -> Ds* K and Bs -> Ds* \\pi decays are of paramount interest as they can be used, combined with Bs -> Ds K and Bd -> D* \\pi, to measure the weak phase \\gamma. We present the first observation of the Bs -> Ds* K decay, where Ds* are reconstructed through the decay chain Ds* -> Ds (-> K K \\pi) \\gamma, using an integrated luminosity of 3.0 fb^{-1} recorded by the LHCb experiment.
[22q11.2DS Syndrome as a Genetic Subtype of Schizophrenia].
Huertas-Rodríguez, Cindy Katherin; Payán-Gómez, César; Forero-Castro, Ruth Maribel
2015-01-01
The 22q11.2 deletion syndrome (22q11.2DS) is associated with the microdeletion of this chromosomal region, and represents the second most common genetic syndrome after Down's syndrome. In patients with schizophrenia, 22q11.2DS has a prevalence of 2%, and in selected groups can be increased to between 32-53%. To describe the generalities of 22q11.2DS syndrome as a genetic subtype of schizophrenia, its clinical characteristics, molecular genetic aspects, and frequency in different populations. A review was performed from 1967 to 2013 in scientific databases, compiling articles about 22q11.2DS syndrome and its association with schizophrenia. The 22q11.2 DS syndrome has a variable phenotype associated with other genetic syndromes, birth defects in many tissues and organs, and a high rate of psychiatric disorders, particularly schizophrenia. Likewise, it has been identified in clinical populations with schizophrenia selected by the presence of common syndromic characteristics. FISH, qPCR and MLPA techniques, and recently, aCGH and NGS technologies, are being used to diagnose this microdeletion. It is important in clinical practice to remember that people suffering the 22q11.2DS have a high genetic risk for developing schizophrenia, and it is considered that the simultaneous presence of this disease and 22q11.2DS represents a genetic subtype of schizophrenia. There are clear phenotypic criteria, molecular and cytogenetic methods to diagnose this group of patients, and to optimize a multidisciplinary approach in their monitoring. Copyright © 2014 Asociación Colombiana de Psiquiatría. Publicado por Elsevier España. All rights reserved.
Directory of Open Access Journals (Sweden)
M.A. Badshah
2014-02-01
Full Text Available Tillering is an important agronomic trait for rice grain production. To evaluate yield and tillering response, Liangyoupeijiu (super hybrid rice was grown in Hunan, China during 2011–2012 under different methods of tillage (conventional and no-tillage system and crop establishment methods (transplanting at a spacing of 20 cm × 20 cm with one seedling per hill and direct seeding at a seeding rate of 22.5 kg ha− 1. Our results revealed that, at maximum tillering (Max. and at maturity (MA stages, direct seeding (DS resulted in 22% more tillers than transplanting (TP irrespective of tillage system. Tiller mortality reached a peak between panicle initiation (PI and booting (BT stages, and was 16% higher under conventional tillage (CT than under no-tillage (NT. Transplanting required 29% more time for the completion of tillering and less for DS. Tillering rate was 43% higher in DS than TP under either CT or NT. There was a positive correlation between panicle number per m2 and maximum tiller number per m2, but not panicle-bearing tiller rate. The panicle bearing tiller rate was higher under DS than TP and higher under NT than CT. Tiller dry weight gradually increased up to heading (HD stage, and was 14% higher under TP than DS. Leaf area (cm2 tiller− 1 gradually increased from Max. to HD stage and then decreased by 34% in conventional tillage transplanting (CTTP and 45% in no-tillage transplanting (NTTP from 12DAH–24DAH (days after heading, but was similar (35% under DS under either CT or NT. Grain yield was higher under CTTP owing to the larger sink size (heavier panicle, more spikelets in per cm length of panicle than under DS.
International Nuclear Information System (INIS)
Govindarajan, T R; Kaul, R K; Suneeta, V
2002-01-01
We study quantum gravity on dS 3 using the Chern-Simons formulation of three-dimensional gravity. We derive an exact expression for the partition function for quantum gravity on dS 3 in a Euclidean path integral approach. We show that the topology of the space relevant for studying de Sitter entropy is a solid torus. The quantum fluctuations of de Sitter space are sectors of configurations of point masses taking a discrete set of values. The partition function gives the correct semiclassical entropy. The sub-leading correction to the entropy is logarithmic in horizon area, with a coefficient -1. We discuss this correction in detail, and show that the sub-leading correction to the entropy from the dS/CFT correspondence agrees with our result. A comparison with the corresponding results for the AdS 3 BTZ black hole is also presented
Energy Technology Data Exchange (ETDEWEB)
Byard D. Wood; Jeff D. Muhs
2004-08-01
This RD&D project is a three year team effort to develop a hybrid solar lighting (HSL) system that transports daylight from a paraboloidal dish concentrator to a luminaire via a bundle of small core or a large core polymer fiber optics. The luminaire can be a device to distribute sunlight into a space for the production of algae or it can be a device that is a combination of daylighting and electric lighting for space/task lighting. In this project, the sunlight is collected using a one-meter paraboloidal concentrator dish with two-axis tracking. For the second generation (alpha) system, the secondary mirror is an ellipsoidal mirror that directs the visible light into a bundle of small-core fibers. The IR spectrum is filtered out to minimize unnecessary heating at the fiber entrance region. This report describes the following investigations of various aspects of the system. Taken as a whole, they confirm significant progress towards the technical feasibility and commercial viability of this technology. (1) TRNSYS Modeling of a Hybrid Lighting System: Building Energy Loads and Chromaticity Analysis; (2) High Lumens Screening Test Setup for Optical Fibers; (3) Photo-Induced Heating in Plastic Optical Fiber Bundles; (4) Low-Cost Primary Mirror Development; (5) Potential Applications for Hybrid Solar Lighting; (6) Photobioreactor Population Experiments and Productivity Measurements; and (7) Development of a Microalgal CO2-Biofixation Photobioreactor.
Solar Deployment System (SolarDS) Model: Documentation and Sample Results
Energy Technology Data Exchange (ETDEWEB)
Denholm, P.; Drury, E.; Margolis, R.
2009-09-01
The Solar Deployment System (SolarDS) model is a bottom-up, market penetration model that simulates the potential adoption of photovoltaics (PV) on residential and commercial rooftops in the continental United States through 2030. NREL developed SolarDS to examine the market competitiveness of PV based on regional solar resources, capital costs, electricity prices, utility rate structures, and federal and local incentives. The model uses the projected financial performance of PV systems to simulate PV adoption for building types and regions then aggregates adoption to state and national levels. The main components of SolarDS include a PV performance simulator, a PV annual revenue calculator, a PV financial performance calculator, a PV market share calculator, and a regional aggregator. The model simulates a variety of installed PV capacity for a range of user-specified input parameters. PV market penetration levels from 15 to 193 GW by 2030 were simulated in preliminary model runs. SolarDS results are primarily driven by three model assumptions: (1) future PV cost reductions, (2) the maximum PV market share assumed for systems with given financial performance, and (3) PV financing parameters and policy-driven assumptions, such as the possible future cost of carbon emissions.
Energy Technology Data Exchange (ETDEWEB)
Riegger, Peter; Schalk, Johannes; Schmalzing, Claus-Oliver [MTU Friedrichshafen GmbH, Friedrichshafen (Germany). Bereich Forschung Technologieentwicklung
2013-10-15
By hybrid drives, fuel consumption in off-road applications can be significantly reduced. However, the additional power train components and degrees of freedom required in the design of hybridised systems involve an increase in system variants. To keep the number of variants as low as possible whilst simultaneously ensuring that hybrid drives can serve as wide a spectrum of applications as possible, MTU has developed a modular system of components. This makes it possible to use customer requirements as a basis for creating innovative drive systems for the widest range of applications. (orig.)
Nonminimally coupled hybrid inflation
International Nuclear Information System (INIS)
Koh, Seoktae; Minamitsuji, Masato
2011-01-01
We discuss the hybrid inflation model where the inflaton field is nonminimally coupled to gravity. In the Jordan frame, the potential contains φ 4 term as well as terms in the original hybrid inflation model. In our model, inflation can be classified into the type (I) and the type (II). In the type (I), inflation is terminated by the tachyonic instability of the waterfall field, while in the type (II) by the violation of slow-roll conditions. In our model, the reheating takes place only at the true minimum and even in the case (II) finally the tachyonic instability occurs after the termination of inflation. For a negative nonminimal coupling, inflation takes place in the vacuum-dominated region, in the large field region, or near the local minimum/maximum. Inflation in the vacuum-dominated region becomes either the type (I) or (II), resulting in a blue or red spectrum of the curvature perturbations, respectively. Inflation around the local maximum can be either the type (I) or the type (II), which results in the red spectrum of the curvature perturbations, while around the local minimum it must be the type (I), which results in the blue spectrum. In the large field region, to terminate inflation, potential in the Einstein frame must be positively tilted, always resulting in the red spectrum. We then numerically solve the equations of motion to investigate the whole dynamics of inflaton and confirm that the spectrum of curvature perturbations changes from red to blue ones as scales become smaller.
Spectrum of a linear antenna in a cold magnetized plasma
International Nuclear Information System (INIS)
Eldridge, O.; Kritz, A.H.
1975-04-01
The fields radiated by a linear antenna in a cold magnetized plasma are calculated. The principal results are expressed in the input impedance and power spectrum of the near field, expressed as a function of the wavenumber or index of refraction parallel to the field. For frequencies below the electron plasma frequency and above the lower hybrid frequency the spectrum shows a broad maximum for short parallel wavelengths. The parallel index of refraction at this maximum is approximately the ratio of free space wavelength to antenna length. A spectrum of this sort is required by the accessibility conditions for heating at the lower hybrid resonance from a wave launched in a region of lower density. The impedance of a short antenna in this region is capacitive and a few hundred ohms in magnitude. (U.S.)
Creating opportunities for science PhDs to pursue careers in high school education.
Doyle, Kari M H; Vale, Ronald D
2013-11-01
The United States is confronting important challenges at both the early and late stages of science education. At the level of K-12 education, a recent National Research Council report (Successful K-12 STEM Education) proposed a bold restructuring of how science is taught, moving away from memorizing facts and emphasizing hands-on, inquiry-based learning and a deeper understanding of the process of science. At higher levels of training, limited funding for science is leading PhDs to seek training and careers in areas other than research. Might science PhDs play a bigger role in the future of K-12 education, particularly at the high school level? We explore this question by discussing the roles that PhDs can play in high school education and the current and rather extensive barriers to PhDs entering the teaching profession and finally suggest ways to ease the entrance of qualified PhDs into high school education.
Creating opportunities for science PhDs to pursue careers in high school education
Doyle, Kari M. H.; Vale, Ronald D.
2013-01-01
The United States is confronting important challenges at both the early and late stages of science education. At the level of K–12 education, a recent National Research Council report (Successful K–12 STEM Education) proposed a bold restructuring of how science is taught, moving away from memorizing facts and emphasizing hands-on, inquiry-based learning and a deeper understanding of the process of science. At higher levels of training, limited funding for science is leading PhDs to seek training and careers in areas other than research. Might science PhDs play a bigger role in the future of K–12 education, particularly at the high school level? We explore this question by discussing the roles that PhDs can play in high school education and the current and rather extensive barriers to PhDs entering the teaching profession and finally suggest ways to ease the entrance of qualified PhDs into high school education. PMID:24174464
Pair of accelerated black holes in a de Sitter background: The dS C metric
International Nuclear Information System (INIS)
Dias, Oscar J.C.; Lemos, Jose P.S.
2003-01-01
Following the work of Kinnersley and Walker for flat spacetimes, we analyzed the anti-de Sitter C metric in a previous paper. In this paper we study the de Sitter C metric (dS C metric). The C metric with a generic cosmological constant and other extra parameters was introduced by Plebanski and Demianski. When one then sets to zero some of the extra parameters, and works with a positive cosmological constant, one has the dS C metric which has been analyzed and physically interpreted by Podolsky and Griffiths. It describes a pair of accelerated black holes in the dS background with the acceleration being provided (in addition to the cosmological constant) by a strut that pushes away the two black holes or, alternatively, by a string that pulls them. We extend their analysis mainly in four directions. First, we draw the Carter-Penrose diagrams of the massless uncharged dS C metric, of the massive uncharged dS C metric and of the massive charged dS C metric. These diagrams allow us to clearly identify the presence of two dS black holes and to conclude that they cannot interact gravitationally. Second, we reexamine the embedding of the dS C metric in the 5D Minkowski spacetime and we represent the motion of the dS C metric origin in the dS 4-hyperboloid as well as the localization of the strut. Third, we comment on the physical properties of the strut that connects the two black holes. Finally, we find the range of parameters that correspond to nonextreme black holes, extreme black holes, and naked particles
Spread F bubbles - Nonlinear Rayleigh-Taylor mode in two dimensions
Hudson, M. K.
1978-01-01
The paper discusses long-wavelength developed bottomside spread F which has been attributed to the Rayleigh-Taylor instability. The nonlinear saturation amplitude and the k spectrum of the inertia-dominated Rayleigh-Taylor instability is found in two directions: east-west and vertical. As in the collisional case (Chaturvedi and Ossakow, 1977), the dominant nonlinearity is found to be two-dimensional. It is found that the linearly most unstable modes, which are primarily horizontal, saturate by the nonlinear generation of vertical spatial harmonics. The harmonics are damped by diffusion or recombination. The resulting amplitude spectrum indicates that bubbles are vertically elongated in both inertial and collisional regimes.
Energy Technology Data Exchange (ETDEWEB)
Stucki, R. (Colenco Power Consulting AG, Baden (Switzerland)); Mueller, W. (Jaeggi AG, Bern (Switzerland)); Haltiner, E.W.
1992-09-11
Condensation turbo groups facilitate the utilization of thermal energy from vapor production plants, for example from garbage incineration. Through an optimum design of the cooling system, the profitable electric energy can be increased through the maximum spreading of the condensation temperature and the live steam temperature. The hybrid dry cooling guarantees unsurpassable operating conditions. (orig.).
Stream Habitat Reach Summary - NCWAP [ds158
California Natural Resource Agency — The Stream Habitat - NCWAP - Reach Summary [ds158] shapefile contains in-stream habitat survey data summarized to the stream reach level. It is a derivative of the...
International Nuclear Information System (INIS)
Gritli, Hassène; Belghith, Safya
2015-01-01
Highlights: • A numerical calculation method of the Lyapunov exponents in the compass-gait model under OGY control is proposed. • A new linearization method of the impulsive hybrid dynamics around a one-periodic hybrid limit cycle is achieved. • We develop a simple analytical expression of a controlled hybrid Poincaré map. • A dimension reduction of the hybrid Poincaré map is realized. • We describe the numerical computation procedure of the Lyapunov exponents via the designed hybrid Poincaré map. - Abstract: This paper aims at providing a numerical calculation method of the spectrum of Lyapunov exponents in a four-dimensional impulsive hybrid nonlinear dynamics of a passive compass-gait model under the OGY control approach by means of a controlled hybrid Poincaré map. We present a four-dimensional simplified analytical expression of such hybrid map obtained by linearizing the uncontrolled impulsive hybrid nonlinear dynamics around a desired one-periodic passive hybrid limit cycle. In order to compute the spectrum of Lyapunov exponents, a dimension reduction of the controlled hybrid Poincaré map is realized. The numerical calculation of the spectrum of Lyapunov exponents using the reduced-dimension controlled hybrid Poincaré map is given in detail. In order to show the effectiveness of the developed method, the spectrum of Lyapunov exponents is calculated as the slope (bifurcation) parameter varies and hence used to predict the walking dynamics behavior of the compass-gait model under the OGY control.
On ray stochasticity during lower hybrid current drive in tokamaks
International Nuclear Information System (INIS)
Bizarro, J.P.; Moreau, D.
1992-08-01
A comprehensive and detailed analysis is presented on the importance of toroidally induced ray stochasticity for the modelling of lower hybrid current drive and for the dynamics of the launched power spectrum. A combined ray tracing and Fokker-Planck code is used and the injected lower hybrid power distribution in poloidal angle and in parallel wave index is accurately represented by taking into account the poloidal extent of the antenna ad by efficiently covering the full range of its radiated spectrum. The importance of the balance between the wave damping and the exponential divergence of nearby ray trajectories in determining the shape of the predicted lower hybrid power deposition profiles is emphasized. When a sufficiently large number of rays is used to densely cover the region of the launched power spectrum which is affected by stochastic effects, code predictions are shown to be stable with respect to small changes in initial conditions and plasma parameters and to be consistent with experimental data
Structural Basis for dsRNA Recognition by NS1 Protein of Influenza A Virus
Energy Technology Data Exchange (ETDEWEB)
Cheng, A.; Wong, S; Yuan, Y
2009-01-01
Influenza A viruses are important human pathogens causing periodic pandemic threats. Nonstructural protein 1 (NS1) protein of influenza A virus (NS1A) shields the virus against host defense. Here, we report the crystal structure of NS1A RNA-binding domain (RBD) bound to a double-stranded RNA (dsRNA) at 1.7A. NS1A RBD forms a homodimer to recognize the major groove of A-form dsRNA in a length-independent mode by its conserved concave surface formed by dimeric anti-parallel alpha-helices. dsRNA is anchored by a pair of invariable arginines (Arg38) from both monomers by extensive hydrogen bonds. In accordance with the structural observation, isothermal titration calorimetry assay shows that the unique Arg38-Arg38 pair and two Arg35-Arg46 pairs are crucial for dsRNA binding, and that Ser42 and Thr49 are also important for dsRNA binding. Agrobacterium co-infiltration assay further supports that the unique Arg38 pair plays important roles in dsRNA binding in vivo.
Hybrid Models of Alternative Current Filter for Hvdc
Directory of Open Access Journals (Sweden)
Ufa Ruslan A.
2017-01-01
Full Text Available Based on a hybrid simulation concept of HVDC, the developed hybrid AC filter models, providing the sufficiently full and adequate modeling of all single continuous spectrum of quasi-steady-state and transient processes in the filter, are presented. The obtained results suggest that usage of the hybrid simulation approach is carried out a methodically accurate with guaranteed instrumental error solution of differential equation systems of mathematical models of HVDC.
Design of Spreading-Codes-Assisted Active Imaging System
Directory of Open Access Journals (Sweden)
Alexey Volkov
2015-07-01
Full Text Available This work discusses an innovative approach to imaging which can improve the robustness of existing active-range measurement methods and potentially enhance their use in a variety of outdoor applications. By merging a proven modulation technique from the domain of spread-spectrum communications with the bleeding-edge CMOS sensor technology, the prototype of the modulated range sensor is designed and evaluated. A suitable set of application-specific spreading codes is proposed, evaluated and tested on the prototype. Experimental results show that the introduced modulation technique significantly reduces the impacts of environmental factors such as sunlight and external light sources, as well as mutual interference of identical devices. The proposed approach can be considered as a promising basis for a new generation of robust and cost-efficient range-sensing solutions for automotive applications, autonomous vehicles or robots.
Directory of Open Access Journals (Sweden)
Then Sue-Mian
2012-01-01
Full Text Available Abstract Background Down syndrome (DS neurons are more susceptible to oxidative stress and previous studies have shown that vitamin E was able to reduce oxidative stress and improve DS neurons' viability. Therefore, this study was done to investigate the protective role of γ-tocotrienol (γT3 in DS neurons from hydrogen peroxide (H2O2 -induced oxidative stress. The pro-apoptosis tendency of γT3 was compared to α-tocopherol (αT in non-stress condition as well. Methods Primary culture of DS and euploid neurons were divided into six groups of treatment: control, H2O2, γT3 pre-treatment with H2O2, γT3 only, αT pre-treatment with H2O2 and αT only. The treatments were assessed by MTS assay and apoptosis assay by single-stranded DNA (ssDNA apoptosis ELISA assay, Hoechst and Neu-N immunofluorescence staining. The cellular uptake of γT3 and αT was determined by HPLC while protein expressions were determined by Western blot. Comparison between groups was made by the Student's t test, one-way ANOVA and Bonferroni adjustment as well as two-way ANOVA for multiple comparisons. Results One day incubation of γT3 was able to reduced apoptosis of DS neurons by 10%, however γT3 was cytotoxic at longer incubation period (14 days and at concentrations ≥ 100 μM. Pre-treatment of αT and γT3 only attenuate apoptosis and increase cell viability in H2O2-treated DS and euploid neurons by 10% in which the effects were minimal to maintain most of the DS cells' morphology. γT3 act as a free radical scavenger by reducing ROS generated by H2O2. In untreated controls, DS neurons showed lower Bcl-2/Bax ratio and p53 expression compared to normal neurons, while cPKC and PKC-δ expressions were higher in DS neurons. On the other hand, pre-treatment of γT3 in H2O2-treated DS neurons have reduced Bcl-2/Bax ratio, which was not shown in euploid neurons. This suggests that pre-treatment of γT3 did not promote DS cell survival. Meanwhile γT3 and αT treatments
Physical characteristics of GE Senographe Essential and DS digital mammography detectors
International Nuclear Information System (INIS)
Ghetti, Caterina; Borrini, Adriano; Ortenzia, Ornella; Rossi, Raffaella; Ordonez, Pedro L.
2008-01-01
The purpose of this study was to investigate physical characteristics of two full field digital mammography (FFDM) systems (GE Senographe Essential and DS). Both are indirect conversion (x ray to light) a-Si flat panels coupled with a CsI(Tl) scintillator. The examined systems have the same pixel size (100 μm) but a different field of view: a conventional size 23x19.2 cm 2 and a large field 24x30.7 cm 2 , specifically designed to image large breasts. In the GE Senographe Essential model relevant improvements in flat panel design were implemented and new deposition tools for metal, a-Si, and CsI(Tl) were introduced by GE. These changes in detector design are expected to be beneficial for advanced applications such as breast tomosynthesis. The presampling modulation transfer function (MTF), normalized noise power spectrum (NNPS), and detective quantum efficiency (DQE) were measured for a wide range of exposure (25-240 μGy) with a RQA-M2 technique (28 kVp with a Mo/Mo target/filter combination and 2 mm of additional aluminum filtration). At 1, 2, and at 4 lp/mm MTF is equal to 0.9, 0.76, and 0.46 for the conventional field detector and to 0.85, 0.59, and 0.24 for the large field detector. The latter detector exhibits an improved NNPS due to a lower electronic noise and a better DQE that reaches 60%. In addition a contrast-detail analysis was performed with CDMAM 3.4 phantom and CDCOM software: GE Senographe DS showed statistically significant poorer detection ability in comparison with the GE Senographe Essential. These results could have been expected, at least qualitatively, considering the relative DQE of the two systems
Joudaki, Shahab; Blake, Chris; Johnson, Andrew; Amon, Alexandra; Asgari, Marika; Choi, Ami; Erben, Thomas; Glazebrook, Karl; Harnois-Déraps, Joachim; Heymans, Catherine; Hildebrandt, Hendrik; Hoekstra, Henk; Klaes, Dominik; Kuijken, Konrad; Lidman, Chris; Mead, Alexander; Miller, Lance; Parkinson, David; Poole, Gregory B.; Schneider, Peter; Viola, Massimo; Wolf, Christian
2018-03-01
We perform a combined analysis of cosmic shear tomography, galaxy-galaxy lensing tomography, and redshift-space multipole power spectra (monopole and quadrupole) using 450 deg2 of imaging data by the Kilo Degree Survey (KiDS-450) overlapping with two spectroscopic surveys: the 2-degree Field Lensing Survey (2dFLenS) and the Baryon Oscillation Spectroscopic Survey (BOSS). We restrict the galaxy-galaxy lensing and multipole power spectrum measurements to the overlapping regions with KiDS, and self-consistently compute the full covariance between the different observables using a large suite of N-body simulations. We methodically analyse different combinations of the observables, finding that the galaxy-galaxy lensing measurements are particularly useful in improving the constraint on the intrinsic alignment amplitude, while the multipole power spectra are useful in tightening the constraints along the lensing degeneracy direction. The fully combined constraint on S_8 ≡ σ _8 √{Ω _m/0.3}=0.742± 0.035, which is an improvement by 20 per cent compared to KiDS alone, corresponds to a 2.6σ discordance with Planck, and is not significantly affected by fitting to a more conservative set of scales. Given the tightening of the parameter space, we are unable to resolve the discordance with an extended cosmology that is simultaneously favoured in a model selection sense, including the sum of neutrino masses, curvature, evolving dark energy and modified gravity. The complementarity of our observables allows for constraints on modified gravity degrees of freedom that are not simultaneously bounded with either probe alone, and up to a factor of three improvement in the S8 constraint in the extended cosmology compared to KiDS alone.
Yoon, June-Sun; Gurusamy, Dhandapani; Palli, Subba Reddy
2017-11-01
RNA interference (RNAi) efficiency varies among insects studied. The barriers for successful RNAi include the presence of double-stranded ribonucleases (dsRNase) in the lumen and hemolymph that could potentially digest double-stranded RNA (dsRNA) and the variability in the transport of dsRNA into and within the cells. We recently showed that the dsRNAs are transported into lepidopteran cells, but they are not processed into small interference RNAs (siRNAs) because they are trapped in acidic bodies. In the current study, we focused on the identification of acidic bodies in which dsRNAs accumulate in Sf9 cells. Time-lapse imaging studies showed that dsRNAs enter Sf9 cells and accumulate in acidic bodies within 20 min after their addition to the medium. CypHer-5E-labeled dsRNA also accumulated in the midgut and fat body dissected from Spodoptera frugiperda larvae with similar patterns observed in Sf9 cells. Pharmacological inhibitor assays showed that the dsRNAs use clathrin mediated endocytosis pathway for transport into the cells. We investigated the potential dsRNA accumulation sites employing LysoTracker and double labeling experiments using the constructs to express a fusion of green fluorescence protein with early or late endosomal marker proteins and CypHer-5E-labeled dsRNA. Interestingly, CypHer-5E-labeled dsRNA accumulated predominantly in early and late endosomes. These data suggest that entrapment of internalized dsRNA in endosomes is one of the major factors contributing to inefficient RNAi response in lepidopteran insects. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Monika Dybdahl Jakobsen
Full Text Available This study aims to investigate the prevalence of self-reported food hypersensitivity, (SFH, the characteristics of women with SFH, and whether SFH is associated with multiple health complaints among the participants of the Norwegian Women and Cancer study (NOWAC.We conducted a cross-sectional study among 64,316 women aged 41-76 years. The women were randomly selected from the Norwegian Central Person Register. Information on SFH and all covariates except age and place of residence was collected by questionnaires in 2002-2005.The prevalence of SFH in our study sample was 6.8% (95% confidence interval: 6.7-7.0. Logistic regression analysis showed a negative association between SFH and age (odds ratio [OR] 0.97. The odds of SFH increased among women living in or near urban centers, women with more than 9 years of education, women who did not have full-time work, women who had experienced poor economic conditions in childhood, those living without a partner, and those who did not consume alcohol or smoke (OR varied from 1.10 to 1.70. Women with a low body mass index had higher odds of SFH (OR 1.37 than those with a moderate body mass index. SFH was positively associated with poor self-perceived health (OR 2.56. The odds of SFH increased with the number of concurrent health complaints, with an OR for 5-6 comorbidities of 4.93.We found an association between SFH, poor health, and different socio demographic and lifestyle characteristics. Women with SFH had increased odds of reporting multiple health complaints.
Jakobsen, Monika Dybdahl; Braaten, Tonje; Obstfelder, Aud; Abelsen, Birgit
2016-01-01
This study aims to investigate the prevalence of self-reported food hypersensitivity, (SFH), the characteristics of women with SFH, and whether SFH is associated with multiple health complaints among the participants of the Norwegian Women and Cancer study (NOWAC). We conducted a cross-sectional study among 64,316 women aged 41-76 years. The women were randomly selected from the Norwegian Central Person Register. Information on SFH and all covariates except age and place of residence was collected by questionnaires in 2002-2005. The prevalence of SFH in our study sample was 6.8% (95% confidence interval: 6.7-7.0). Logistic regression analysis showed a negative association between SFH and age (odds ratio [OR] 0.97). The odds of SFH increased among women living in or near urban centers, women with more than 9 years of education, women who did not have full-time work, women who had experienced poor economic conditions in childhood, those living without a partner, and those who did not consume alcohol or smoke (OR varied from 1.10 to 1.70). Women with a low body mass index had higher odds of SFH (OR 1.37) than those with a moderate body mass index. SFH was positively associated with poor self-perceived health (OR 2.56). The odds of SFH increased with the number of concurrent health complaints, with an OR for 5-6 comorbidities of 4.93. We found an association between SFH, poor health, and different socio demographic and lifestyle characteristics. Women with SFH had increased odds of reporting multiple health complaints.
Energy Technology Data Exchange (ETDEWEB)
Byard D. Wood; Jeff D. Muhs
2002-09-01
This RD&D project is a three year team effort to develop a hybrid solar lighting (HSL) system that transports day light from a paraboloidal dish concentrator to a luminaire via a large core polymer fiber optic. The luminaire can be a device to distribute sunlight into a space for the production of algae or it can be a device that is a combination of day lighting and fluorescent lighting for office lighting. In this project, the sunlight is collected using a one-meter paraboloidal concentrator dish with two-axis tracking. The secondary mirror consists of eight planar-segmented mirrors that direct the visible part of the spectrum to eight fibers (receiver) and subsequently to eight luminaires. This results in about 8,200 lumens incident at each fiber tip. Each fiber can illuminate about 16.7 m{sup 2} (180 ft{sup 2}) of office space. The IR spectrum is directed to a thermophotovoltaic array to produce electricity. This report describes eleven investigations on various aspects of the system. Taken as a whole, they confirm the technical feasibility of this technology.
An efficient digital signal processing method for RRNS-based DS-CDMA systems
Directory of Open Access Journals (Sweden)
Peter Olsovsky
2017-09-01
Full Text Available This paper deals with an efficient method for achieving low power and high speed in advanced Direct-Sequence Code Division Multiple-Access (DS-CDMA wireless communication systems based on the Residue Number System (RNS. A modified algorithm for multiuser DS-CDMA signal generation in MATLAB is proposed and investigated. The most important characteristics of the generated PN code are also presented. Subsequently, a DS-CDMA system based on the combination of the RNS or the so-called Redundant Residue Number System (RRNS is proposed. The enhanced method using a spectrally efficient 8-PSK data modulation scheme to improve the bandwidth efficiency for RRNS-based DS-CDMA systems is presented. By using the C-measure (complexity measure of the error detection function, it is possible to estimate the size of the circuit. Error detection function in RRNSs can be efficiently implemented by LookUp Table (LUT cascades.
Zinzula, Luca; Esposito, Francesca; Pala, Daniela; Tramontano, Enzo
2012-03-01
The Ebola viruses (EBOVs) VP35 protein is a multifunctional major virulence factor involved in EBOVs replication and evasion of the host immune system. EBOV VP35 is an essential component of the viral RNA polymerase, it is a key participant of the nucleocapsid assembly and it inhibits the innate immune response by antagonizing RIG-I like receptors through its dsRNA binding function and, hence, by suppressing the host type I interferon (IFN) production. Insights into the VP35 dsRNA recognition have been recently revealed by structural and functional analysis performed on its C-terminus protein. We report the biochemical characterization of the Zaire ebolavirus (ZEBOV) full-length recombinant VP35 (rVP35)-dsRNA binding function. We established a novel in vitro magnetic dsRNA binding pull down assay, determined the rVP35 optimal dsRNA binding parameters, measured the rVP35 equilibrium dissociation constant for heterologous in vitro transcribed dsRNA of different length and short synthetic dsRNA of 8bp, and validated the assay for compound screening by assessing the inhibitory ability of auryntricarboxylic acid (IC(50) value of 50μg/mL). Furthermore, we compared the dsRNA binding properties of full length wt rVP35 with those of R305A, K309A and R312A rVP35 mutants, which were previously reported to be defective in dsRNA binding-mediated IFN inhibition, showing that the latter have measurably increased K(d) values for dsRNA binding and modified migration patterns in mobility shift assays with respect to wt rVP35. Overall, these results provide the first characterization of the full-length wt and mutants VP35-dsRNA binding functions. Copyright © 2012 Elsevier B.V. All rights reserved.
Nuclear factor 90 uses an ADAR2-like binding mode to recognize specific bases in dsRNA.
Jayachandran, Uma; Grey, Heather; Cook, Atlanta G
2016-02-29
Nuclear factors 90 and 45 (NF90 and NF45) form a protein complex involved in the post-transcriptional control of many genes in vertebrates. NF90 is a member of the dsRNA binding domain (dsRBD) family of proteins. RNA binding partners identified so far include elements in 3' untranslated regions of specific mRNAs and several non-coding RNAs. In NF90, a tandem pair of dsRBDs separated by a natively unstructured segment confers dsRNA binding activity. We determined a crystal structure of the tandem dsRBDs of NF90 in complex with a synthetic dsRNA. This complex shows surprising similarity to the tandem dsRBDs from an adenosine-to-inosine editing enzyme, ADAR2 in complex with a substrate RNA. Residues involved in unusual base-specific recognition in the minor groove of dsRNA are conserved between NF90 and ADAR2. These data suggest that, like ADAR2, underlying sequences in dsRNA may influence how NF90 recognizes its target RNAs. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.
Fu, Qinqin; Yuan, Y Adam
2013-03-01
Intensive research interest has focused on small RNA-processing machinery and the RNA-induced silencing complex (RISC), key cellular machines in RNAi pathways. However, the structural mechanism regarding RISC assembly, the primary step linking small RNA processing and RNA-mediated gene silencing, is largely unknown. Human RNA helicase A (DHX9) was reported to function as an RISC-loading factor, and such function is mediated mainly by its dsRNA-binding domains (dsRBDs). Here, we report the crystal structures of human RNA helicase A (RHA) dsRBD1 and dsRBD2 domains in complex with dsRNAs, respectively. Structural analysis not only reveals higher siRNA duplex-binding affinity displayed by dsRBD1, but also identifies a crystallographic dsRBD1 pair of physiological significance in cooperatively recognizing dsRNAs. Structural observations are further validated by isothermal titration calorimetric (ITC) assay. Moreover, co-immunoprecipitation (co-IP) assay coupled with mutagenesis demonstrated that both dsRBDs are required for RISC association, and such association is mediated by dsRNA. Hence, our structural and functional efforts have revealed a potential working model for siRNA recognition by RHA tandem dsRBDs, and together they provide direct structural insights into RISC assembly facilitated by RHA.
Diab, Mohamad; Hamze, Monzer; Bonnet, Richard; Saras, Estelle; Madec, Jean-Yves; Haenni, Marisa
2017-11-01
Raw milk has recently been reported as a source of extended-spectrum beta-lactamase (ESBL) and carbapenemase genes. We thus investigated the prevalence of ESBL- and carbapenemase-producing Enterobacteriaceae in raw milk in Lebanon in order to assess the risk of transfer of these bacteria to humans. A high prevalence (30.2 %) of CTX-M-15-producing K. pneumoniae was detected in raw bovine milk. Three main K. pneumoniae clones were identified by PFGE and MLST typing. Southern blot experiments revealed that one of these clones carried the blaCTX-M-15 gene chromosomally. Moreover, one OXA-48-producing K. pneumoniae ST530 and seven CTX-M-15-producing Escherichia coli sharing the same ST were also detected. These findings highlight the spread of dominant CTX-M-15-producing K. pneumoniae clones and OXA-48-producing isolates in the food chain. Milk, which is mostly consumed raw in Lebanon, may be a source of human exposure to ESBLs and carbapenemases.
KSHV strategies for host dsDNA sensing machinery.
Gao, Hang; Song, Yanyan; Liu, Chengrong; Liang, Qiming
2016-12-01
The innate immune system utilizes pattern recognition receptors cyclic GMP-AMP synthase (cGAS) to sense cytosolic double-stranded (ds) DNA and initiate type 1 interferon signaling and autophagy pathway, which collaborate to limit pathogen infections as well as alarm the adaptive immune response. The genomes of herpesviruses are large dsDNA, which represent a major class of pathogen signatures recognized by cellular DNA sensor cGAS. However, to successfully establish the persistent infection, herpesviruses have evolved their viral genes to modulate different aspects of host immune signaling. This review summarizes the evasion strategies of host cGAS DNA sensing pathway by Kaposi's Sarcoma-associated Herpesvirus (KSHV) and their contributions to KSHV life cycles.
Timing-Free Blind Multiuser Detection for Multicarrier DS/CDMA Systems with Multiple Antennae
Directory of Open Access Journals (Sweden)
Stefano Buzzi
2004-05-01
Full Text Available The problem of blind multiuser detection for an asynchronous multicarrier DS-CDMA system employing multiple transmit and receive antennae over a Rayleigh fading channel is considered in this paper. The solutions that we develop require prior knowledge of the spreading code of the user to be decoded only, while no further information either on the user to be decoded or on the other active users is required. Several combining rules for the observables at the output of each receive antenna are proposed and assessed, and the implications of the different options are studied in depth in terms of both detection performance and computational complexity. A closed form expression is also derived for the conditional error probability and a lower bound for the near-far resistance is provided. Results confirm that the proposed blind receivers can cope with both multiple access interference suppression and channel estimation at the price of a limited performance loss as compared to the ideal linear receivers which assume perfect channel state information.
Universal dS vacua in STU-models
Energy Technology Data Exchange (ETDEWEB)
Blåbäck, J. [Institut de Physique Théorique, Université Paris Saclay, CEA, CNRS,F-91191 Gif-sur-Yvette Cedex (France); Danielsson, UniversityH.; Dibitetto, G.; Vargas, S.C. [Institutionen för fysik och astronomi, University of Uppsala,Box 803, SE-751 08 Uppsala (Sweden)
2015-10-09
Stable de Sitter solutions in minimal F-term supergravity are known to lie close to Minkowski critical points. We consider a class of STU-models arising from type IIB compactifications with generalised fluxes. There, we apply an analytical method for solving the equations of motion for the moduli fields based on the idea of treating derivatives of the superpotential of different orders up to third as independent objects. In particular, supersymmetric and no-scale Minkowski solutions are singled out by physical reasons. Focusing on the study of dS vacua close to supersymmetric Minkowski points, we are able to elaborate a complete analytical treatment of the mass matrix based on the sGoldstino bound. This leads to a class of interesting universal dS vacua. We finally explore a similar possibility around no-scale Minkowski points and discuss some examples.
Martin, Gary E; Barstein, Jamie; Hornickel, Jane; Matherly, Sara; Durante, Genna; Losh, Molly
The ability to indicate a failure to understand a message is a critical pragmatic (social) language skill for managing communication breakdowns and supporting successful communicative exchanges. The current study examined the ability to signal noncomprehension across different types of confusing message conditions in children and adolescents with fragile X syndrome (FXS), Down syndrome (DS), autism spectrum disorder (ASD), and typical development (TD). Controlling for nonverbal mental age and receptive vocabulary skills, youth with comorbid FXS and ASD and those with DS were less likely than TD controls to signal noncomprehension of confusing messages. Youth with FXS without ASD and those with idiopathic ASD did not differ from controls. No sex differences were detected in any group. Findings contribute to current knowledge of pragmatic profiles in different forms of genetically-based neurodevelopmental disorders associated with intellectual disability, and the role of sex in the expression of such profiles. Upon completion of this article, readers will have learned about: (1) the social-communicative profiles of youth with FXS, DS, and ASD, (2) the importance of signaling noncomprehension in response to a confusing message, and (3) the similarities and differences in noncomprehension signaling in youth with FXS (with and without ASD), DS, idiopathic ASD, and TD. Copyright © 2017 Elsevier Inc. All rights reserved.
KiDS-450: testing extensions to the standard cosmological model
Joudaki, Shahab; Mead, Alexander; Blake, Chris; Choi, Ami; de Jong, Jelte; Erben, Thomas; Fenech Conti, Ian; Herbonnet, Ricardo; Heymans, Catherine; Hildebrandt, Hendrik; Hoekstra, Henk; Joachimi, Benjamin; Klaes, Dominik; Köhlinger, Fabian; Kuijken, Konrad; McFarland, John; Miller, Lance; Schneider, Peter; Viola, Massimo
2017-10-01
We test extensions to the standard cosmological model with weak gravitational lensing tomography using 450 deg2 of imaging data from the Kilo Degree Survey (KiDS). In these extended cosmologies, which include massive neutrinos, non-zero curvature, evolving dark energy, modified gravity and running of the scalar spectral index, we also examine the discordance between KiDS and cosmic microwave background (CMB) measurements from Planck. The discordance between the two data sets is largely unaffected by a more conservative treatment of the lensing systematics and the removal of angular scales most sensitive to non-linear physics. The only extended cosmology that simultaneously alleviates the discordance with Planck and is at least moderately favoured by the data includes evolving dark energy with a time-dependent equation of state (in the form of the w0 - wa parametrization). In this model, the respective S_8=σ _8√{Ω m/0.3} constraints agree at the 1σ level, and there is 'substantial concordance' between the KiDS and Planck data sets when accounting for the full parameter space. Moreover, the Planck constraint on the Hubble constant is wider than in Λ cold dark matter (ΛCDM) and in agreement with the Riess et al. (2016) direct measurement of H0. The dark energy model is moderately favoured as compared to ΛCDM when combining the KiDS and Planck measurements, and marginalized constraints in the w0-wa plane are discrepant with a cosmological constant at the 3σ level. KiDS further constrains the sum of neutrino masses to 4.0 eV (95% CL), finds no preference for time or scale-dependent modifications to the metric potentials, and is consistent with flatness and no running of the spectral index.
DEFF Research Database (Denmark)
Sørensen, Lars Schiøtt
Ignition and flame spread properties on selected types of wood and wall papers are elaborated. Tests are established in a new test setup in which the test specimen can be fixed in different angles due to a horizontal level. The heat exposing the test objects is arranged as a convective flux......, established from a Bunsen burners pilot flame. This principal is somewhat in contrast to the more typical radiation established fluxes. For instance, the ISO 9239 (DS 2000) test method is based on a gas fired radiant panel. And in the ISO 5657 standard, the ignition properties are investigated on test...
Energy Technology Data Exchange (ETDEWEB)
Cheng, Xiaofei [Southern Crop Protection and Food Research Centre, Agriculture and Agri-Food Canada, London, Ontario N5V 4T3 (Canada); College of Life and Environmental Sciences, Hangzhou Normal University, Hangzhou, Zhejiang 310036 (China); Deng, Ping; Cui, Hongguang [Southern Crop Protection and Food Research Centre, Agriculture and Agri-Food Canada, London, Ontario N5V 4T3 (Canada); Wang, Aiming, E-mail: aiming.wang@agr.gc.ca [Southern Crop Protection and Food Research Centre, Agriculture and Agri-Food Canada, London, Ontario N5V 4T3 (Canada)
2015-11-15
Double-stranded RNA (dsRNA) is an important type of RNA that plays essential roles in diverse cellular processes in eukaryotic organisms and a hallmark in infections by positive-sense RNA viruses. Currently, no in vivo technology has been developed for visualizing dsRNA in living cells. Here, we report a dsRNA binding-dependent fluorescence complementation (dRBFC) assay that can be used to efficiently monitor dsRNA distribution and dynamics in vivo. The system consists of two dsRNA-binding proteins, which are fused to the N- and C-terminal halves of the yellow fluorescent protein (YFP). Binding of the two fusion proteins to a common dsRNA brings the split YFP halves in close proximity, leading to the reconstitution of the fluorescence-competent structure and restoration of fluorescence. Using this technique, we were able to visualize the distribution and trafficking of the replicative RNA intermediates of positive-sense RNA viruses in living cells. - Highlights: • A live-cell imaging system was developed for visualizing dsRNA in vivo. • It uses dsRNA binding proteins fused with two halves of a fluorescent protein. • Binding to a common dsRNA enables the reporter to become fluorescent. • The system can efficiently monitor viral RNA replication in living cells.
International Nuclear Information System (INIS)
Cheng, Xiaofei; Deng, Ping; Cui, Hongguang; Wang, Aiming
2015-01-01
Double-stranded RNA (dsRNA) is an important type of RNA that plays essential roles in diverse cellular processes in eukaryotic organisms and a hallmark in infections by positive-sense RNA viruses. Currently, no in vivo technology has been developed for visualizing dsRNA in living cells. Here, we report a dsRNA binding-dependent fluorescence complementation (dRBFC) assay that can be used to efficiently monitor dsRNA distribution and dynamics in vivo. The system consists of two dsRNA-binding proteins, which are fused to the N- and C-terminal halves of the yellow fluorescent protein (YFP). Binding of the two fusion proteins to a common dsRNA brings the split YFP halves in close proximity, leading to the reconstitution of the fluorescence-competent structure and restoration of fluorescence. Using this technique, we were able to visualize the distribution and trafficking of the replicative RNA intermediates of positive-sense RNA viruses in living cells. - Highlights: • A live-cell imaging system was developed for visualizing dsRNA in vivo. • It uses dsRNA binding proteins fused with two halves of a fluorescent protein. • Binding to a common dsRNA enables the reporter to become fluorescent. • The system can efficiently monitor viral RNA replication in living cells.
Particle Filtering for Multiple Access DS/CDMA Systems DS/CDMA Channel Estimation
Directory of Open Access Journals (Sweden)
Rafael Oliveira Ribeiro
2013-09-01
Full Text Available This article discusses computational implementation aspects and performance of a Bayesian methodology, namely particle filter (PF. The PF channel estimation technique is directly applied to the channel coefficients estimation of DS/CDMA systems. Simulation results for non-line-of-sight (NLOS Rayleigh fading channel propagation have indicated that the bootstrap PF estimator is capable to provide RMSE in the range of [10-3 ; 10-2] for a wide range of multiple access interference (MAI levels and signal-noise ratio (SNR, and still be able to offer robustness to near-far ratio (NFR effect.
Czech Academy of Sciences Publication Activity Database
Wong, K. T.; Tichavský, Petr; Cheung, S. K.; Liao, G.
2006-01-01
Roč. 5, č. 10 (2006), s. 2932-2944 ISSN 1536-1276 R&D Projects: GA ČR GA102/01/0021 Institutional research plan: CEZ:AV0Z10750506 Keywords : antenna arrays * mobile communications * spread spectrum communications Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.184, year: 2006
Efficient DS-UWB MUD Algorithm Using Code Mapping and RVM
Directory of Open Access Journals (Sweden)
Pingyan Shi
2016-01-01
Full Text Available A hybrid multiuser detection (MUD using code mapping and a wrong code recognition based on relevance vector machine (RVM for direct sequence ultra wide band (DS-UWB system is developed to cope with the multiple access interference (MAI and the computational efficiency. A new MAI suppression mechanism is studied in the following steps: firstly, code mapping, an optimal decision function, is constructed and the output candidate code of the matched filter is mapped to a feature space by the function. In the feature space, simulation results show that the error codes caused by MAI and the single user mapped codes can be classified by a threshold which is related to SNR of the receiver. Then, on the base of code mapping, use RVM to distinguish the wrong codes from the right ones and finally correct them. Compared with the traditional MUD approaches, the proposed method can considerably improve the bit error ratio (BER performance due to its special MAI suppression mechanism. Simulation results also show that the proposed method can approximately achieve the BER performance of optimal multiuser detection (OMD and the computational complexity approximately equals the matched filter. Moreover, the proposed method is less sensitive to the number of users.
Nonlinear theory of the collisional Rayleigh-Taylor instability in equatorial spread F
International Nuclear Information System (INIS)
Chaturvedi, P.K.; Ossakow, S.L.
1977-01-01
The nonlinear behavior of the collisional Rayleigh-Taylor instability is studied in equatorial Spread F by including a dominant two-dimensional nonlinearity. It is found that on account of this nonlinearity the instability saturates by generating damped higher spatial harmonics. The saturated power spectrum for the density fluctuations is discussed. A comparison between experimental observations and theory is presented
Directory of Open Access Journals (Sweden)
Lifeng Zhai
2018-04-01
Full Text Available A novel hepta-segmented double-stranded RNA (dsRNA virus was isolated and characterized from the strain FJ-4 of the phytopathogenic fungus Colletotrichum fructicola, and was named Colletotrichum fructicola chrysovirus 1 (CfCV1. The full-length cDNAs of dsRNA1–7 were 3620, 2801, 2687, 2437, 1750, 1536, and 1211 bp, respectively. The 5′- and 3′-untranslated regions of the seven dsRNAs share highly similar internal sequence and contain conserved sequence stretches, indicating that they have a common virus origin. The 5′-and 3′-UTRs of the seven dsRNAs were predicted to fold into stable stem-loop structures. CfCV1 contains spherical virions that are 35 nm in diameter consisting of seven segments. The largest dsRNA of CfCV1 encodes an RNA-dependent RNA polymerase (RdRp, and the second dsRNA encodes a viral capsid protein (CP. The dsRNA5 encodes a C2H2-type zinc finger protein containing an R-rich region and a G-rich region. The smallest dsRNA is a satellite-like RNA. The functions of the other proteins encoded by dsRNA3, dsRNA4, dsRNA6 are unknown. Phylogenetic analysis, based on RdRp and CP, indicated that CfCV1 is phylogenetically related to Botryosphaeria dothidea chrysovirus 1 (BdCV1, and Penicillium janczewskii chrysovirus 2 (PjCV2, a cluster of an independent cluster II group in the family Chrysoviridae. Importantly, all the seven segments of CfCV1 were transmitted successfully to other virus-free strains with an all-or-none fashion. CfCV1 exerts minor influence on the growth of C. fructicola but can confer hypovirulence to the fungal host. To our knowledge, this is the first report of a hepta-segmented tentative chrysovirus in C. fructicola.
Competing spreading processes on multiplex networks: awareness and epidemics.
Granell, Clara; Gómez, Sergio; Arenas, Alex
2014-07-01
Epidemiclike spreading processes on top of multilayered interconnected complex networks reveal a rich phase diagram of intertwined competition effects. A recent study by the authors [C. Granell et al., Phys. Rev. Lett. 111, 128701 (2013).] presented an analysis of the interrelation between two processes accounting for the spreading of an epidemic, and the spreading of information awareness to prevent infection, on top of multiplex networks. The results in the case in which awareness implies total immunization to the disease revealed the existence of a metacritical point at which the critical onset of the epidemics starts, depending on completion of the awareness process. Here we present a full analysis of these critical properties in the more general scenario where the awareness spreading does not imply total immunization, and where infection does not imply immediate awareness of it. We find the critical relation between the two competing processes for a wide spectrum of parameters representing the interaction between them. We also analyze the consequences of a massive broadcast of awareness (mass media) on the final outcome of the epidemic incidence. Importantly enough, the mass media make the metacritical point disappear. The results reveal that the main finding, i.e., existence of a metacritical point, is rooted in the competition principle and holds for a large set of scenarios.
Impressions of the Meson Spectrum: Hybrids & Exotics, present and future
Energy Technology Data Exchange (ETDEWEB)
Pennington, Michael R. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States)
2016-03-25
It has long been expected that the spectrum of hadrons in QCD would be far richer and extensive than experiment has so far revealed. While there have been experimental hints of this richness for some time, it is really only in the last few years that dramatic progress has been seen in the exploration both experimentally and in calculations on the lattice. Precision studies enabled by new technology both with detectors and high performance computations are converging on an understanding of the spectrum in strong coupling QCD. These methodologies are laying the foundation for a decade of potential discovery that electro and photoproduction experiments at Jefferson Lab, which when combined with key results on B and charmonium decays from both e+e? and pp colliders, should turn mere impressions of the light meson spectrum into a high definition picture.
Increased RNAi Efficacy in Spodoptera exigua via the Formulation of dsRNA With Guanylated Polymers
Directory of Open Access Journals (Sweden)
Olivier Christiaens
2018-04-01
Full Text Available Lepidoptera comprise some of the most devastating herbivorous pest insects worldwide. One of the most promising novel pest control strategies is exploiting the RNA interference (RNAi mechanism to target essential genes for knockdown and incite toxic effects in the target species without harming other organisms in the ecosystem. However, many insects are refractory to oral RNAi, often due to rapid degradation of ingested dsRNA in their digestive system. This is the case for many lepidopteran insects, including the beet armyworm Spodoptera exigua, which is characterized by a very alkaline gut environment (pH > 9.0 and a strong intestinal nucleolytic activity. In this research, guanidine-containing polymers were developed to protect dsRNA against nucleolytic degradation, specifically in high pH environments. First, their ability to protect dsRNA against nucleolytic degradation in gut juice of the beet armyworm S. exigua was investigated ex vivo. Polymers with high guanidine content provided a strong protection against nucleolytic degradation at pH 11, protecting the dsRNA for up to 30 h. Next, cellular uptake of the dsRNA and the polyplexes in lepidopteran CF203 midgut cells was investigated by confocal microscopy, showing that the polymer also enhanced cellular uptake of the dsRNA. Finally, in vivo feeding RNAi bioassays demonstrated that using these guanidine-containing polymer nanoparticles led to an increased RNAi efficiency in S. exigua. Targeting the essential gene chitin synthase B, we observed that the mortality increased to 53% in the polymer-protected dsRNA treatment compared to only 16% with the naked dsRNA and found that polymer-protected dsRNA completely halted the development of the caterpillars. These results show that using guanylated polymers as a formulation strategy can prevent degradation of dsRNA in the alkaline and strongly nucleolytic gut of lepidopteran insects. Furthermore, the polymer also enhances cellular uptake in
Directory of Open Access Journals (Sweden)
Benjamin K Dickerman
2013-10-01
Full Text Available The primary function of the dsRNA binding protein (dsRBP PACT/RAX is to activate the dsRNA dependent protein kinase PKR in response to stress signals. Additionally, it has been identified as a component of the small RNA processing pathway. A role for PACT/RAX in this pathway represents an important interplay between two modes of post-transcriptional gene regulation. The function of PACT/RAX in this context is poorly understood. Thus, additional models are required to clarify the mechanism by which PACT/RAX functions. In this study, Drosophila melanogaster was employed to identify functionally orthologous dsRNA-binding proteins. Transgenic Drosophila expressing human PACT were generated to determine whether PACT is capable of functionally substituting for the Drosophila dsRBP R2D2, which has a well-defined role in small RNA biogenesis. Results presented here indicate that PACT is unable to substitute for R2D2 at the whole organism level.
Energy Technology Data Exchange (ETDEWEB)
McEwen, Gerald D.; Chen Fan [Biological Engineering Program, Department of Biological and Irrigation Engineering, Utah State University, 4105 Old Main Hill, Logan, UT 84322-4105 (United States); Zhou Anhong, E-mail: Anhong.Zhou@usu.edu [Biological Engineering Program, Department of Biological and Irrigation Engineering, Utah State University, 4105 Old Main Hill, Logan, UT 84322-4105 (United States)
2009-06-08
Fundamental understanding of interfacial electron transfer (ET) among electrolyte/DNA/solid-surface will facilitate the design for electrical detection of DNA molecules. In this report, the electron transfer characteristics of synthetic DNA (sequence from pathogenic Cryptosporidium parvum) self-assembled on a gold surface was electrochemically studied. The effects of immobilization order on the interface ET related parameters such as diffusion coefficient (D{sub 0}), surface coverage ({theta}{sub R}), and monolayer thickness (d{sub i}) were determined by cyclic voltammetry (CV) and electrochemical impedance spectroscopy (EIS). DNA surface density ({Gamma}{sub DNA}) was determined by the integration of the charge of the electro-oxidation current peaks during the initial cyclic voltammetry scans. It was found that the DNA surface densities at different modifications followed the order: {Gamma}{sub DNA} (dsS-DNA/Au) > {Gamma}{sub DNA} (MCH/dsS-DNA/Au) > {Gamma}{sub DNA} (dsS-DNA/MCH/Au). It was also revealed that the electro-oxidation of the DNA modified gold surface would involve the oxidation of nucleotides (guanine and adenine) with a 5.51 electron transfer mechanism and the oxidative desorption of DNA and MCH molecules by a 3 electron transfer mechanism. STM topography and current image analysis indicated that the surface conductivity after each surface modification followed the order: dsS-DNA/Au < MCH/dsS-DNA/Au < oxidized MCH/dsS-DNA/Au < Hoechst/oxidized MCH/dsS-DNA/Au. The results from this study suggested a combination of variations in immobilization order may provide an alternative approach for the optimization of DNA hybridization and the further development for electrical detection of DNA.
Melcher, U; Brannan, C M; Gardner, C O; Essenberg, R C
1992-01-01
Plants not hosts for cauliflower mosaic virus (CaMV) may prevent systemic CaMV infection by interfering with dissemination of infection through the plant or by preventing viral replication and maturation. Leaf skeleton hybridization allows distinction between these two barriers. The technique assesses the spatial distribution of CaMV in an inoculated leaf by hybridization of a skeleton of the leaf with a CaMV DNA probe. Leaves or leaflets of soybean, cucumber, peanut, tomato, lettuce, spinach, pepper, onion, wheat, maize and barley, inoculated with CaMV DNA or CaMV virions were processed for leaf skeleton hybridization either immediately after inoculation or two weeks thereafter. Autoradiographic images of soybean and cucumber skeletons had many dark spots suggesting that CaMV DNA replication and local spread had occurred. Images of onion leaf skeletons prepared two weeks after inoculation with CaMV DNA had fewer spots. To test whether these spots resulted from CaMV replication, DNA was extracted from inoculated onion leaves and analyzed by electrophoresis, blotting and hybridization. Molecules recovered two weeks after inoculation resembled those inoculated, indicating absence of replication. For the other species, we found no evidence of local spread of CaMV infections. Thus, many plant species resist systemic CaMV infection by preventing replication or local spread of CaMV, while others solely prevent systemic movement of infection.
Clinical significance of changes of expression of anti-dsDNA antibody in serum in patients with SLE
International Nuclear Information System (INIS)
Chen Xingguo; Zhang Xiaoli; Liu Chunyan; Cao Jiwei; Du Tongxing; Wang Zizheng
2008-01-01
Objective: To investigate the significance of anti-dsDNA antibody in diagnosis and treatment of SLE through measurement of changes of serum anti-dsDNA antibody expression in patients with SLE. Methods: Serum anti-dsDNA antibody was detected with radioisotope method in 60 patients with SLE and 33 controls (consisted of patients with other collagen diseases including Sjogren syndrome, systemic sclerosis, rheumatoid arthritis, polymyositis, mixed connective tissue disease, ankylosing spondylitis). Clinical manifestation and laboratory findings in the SLE patients were studied in detail. Results: (1) Serum anti-dsDNA antibody was positive in 39 of the 60 SLE patients with only two false positive cases in the 33 controls: a sensitivity of 65% and specificity of 93. 3%. (2) In SLE patients, positivity of anti-dsDNA antibody was not correlated with positivity of anti-Sm antibody (P>0.05), but was correlated with positivity of anti-SSA antibody (P<0.05). (3) Incidences of alopecia, skin rashes, oral mucosal ulcer, proteinuria were significantly higher in SLE patients with positive anti-dsDNA antibody than those in SLE patients with negative anti-dsDNA antibody (P<0.05). (4) Incidences of leukopenia and thrombocytopenia were also significantly higher in SLE patients with positive anti-dsDNA antibody (P<0.05). Conclusion: Anti-dsDNA antibody could be taken as a specific marker of SLE and the serum expression were positively correlated with the activity and severity of the disease. (authors)
Directory of Open Access Journals (Sweden)
Carla M Startin
Full Text Available Down syndrome (DS is the most common genetic cause of intellectual disability (ID. Abilities relating to executive function, memory and language are particularly affected in DS, although there is a large variability across individuals. People with DS also show an increased risk of developing dementia. While assessment batteries have been developed for adults with DS to assess cognitive abilities, these batteries may not be suitable for those with more severe IDs, dementia, or visual / hearing difficulties. Here we report the development of an informant rated questionnaire, the Cognitive Scale for Down Syndrome (CS-DS, which focuses on everyday abilities relating to executive function, memory and language, and is suitable for assessing these abilities in all adults with DS regardless of cognitive ability. Complete questionnaires were collected about 128 individuals with DS. After final question selection we found high internal consistency scores across the total questionnaire and within the executive function, memory and language domains. CS-DS scores showed a wide range, with minimal floor and ceiling effects. We found high interrater (n = 55 and test retest (n = 36 intraclass correlations. CS-DS scores were significantly lower in those aged 41+ with significant cognitive decline compared to those without decline. Across all adults without cognitive decline, CS-DS scores correlated significantly to measures of general abilities. Exploratory factor analysis suggested five factors within the scale, relating to memory, self-regulation / inhibition, self-direction / initiation, communication, and focussing attention. The CS-DS therefore shows good interrater and test retest reliability, and appears to be a valid and suitable informant rating tool for assessing everyday cognitive abilities in a wide range of individuals with DS. Such a questionnaire may be a useful outcome measure for intervention studies to assess improvements to cognition, in
Performance Analysis of New Binary User Codes for DS-CDMA Communication
Usha, Kamle; Jaya Sankar, Kottareddygari
2016-03-01
This paper analyzes new binary spreading codes through correlation properties and also presents their performance over additive white Gaussian noise (AWGN) channel. The proposed codes are constructed using gray and inverse gray codes. In this paper, a n-bit gray code appended by its n-bit inverse gray code to construct the 2n-length binary user codes are discussed. Like Walsh codes, these binary user codes are available in sizes of power of two and additionally code sets of length 6 and their even multiples are also available. The simple construction technique and generation of code sets of different sizes are the salient features of the proposed codes. Walsh codes and gold codes are considered for comparison in this paper as these are popularly used for synchronous and asynchronous multi user communications respectively. In the current work the auto and cross correlation properties of the proposed codes are compared with those of Walsh codes and gold codes. Performance of the proposed binary user codes for both synchronous and asynchronous direct sequence CDMA communication over AWGN channel is also discussed in this paper. The proposed binary user codes are found to be suitable for both synchronous and asynchronous DS-CDMA communication.
Social and monetary reward processing in autism spectrum disorders.
Delmonte, Sonja; Balsters, Joshua H; McGrath, Jane; Fitzgerald, Jacqueline; Brennan, Sean; Fagan, Andrew J; Gallagher, Louise
2012-09-26
Social motivation theory suggests that deficits in social reward processing underlie social impairments in autism spectrum disorders (ASD). However, the extent to which abnormalities in reward processing generalize to other classes of stimuli remains unresolved. The aim of the current study was to examine if reward processing abnormalities in ASD are specific to social stimuli or can be generalized to other classes of reward. Additionally, we sought to examine the results in the light of behavioral impairments in ASD. Participants performed adapted versions of the social and monetary incentive delay tasks. Data from 21 unmedicated right-handed male participants with ASD and 21 age- and IQ-matched controls were analyzed using a factorial design to examine the blood-oxygen-level-dependent (BOLD) response during the anticipation and receipt of both reward types. Behaviorally, the ASD group showed less of a reduction in reaction time (RT) for rewarded compared to unrewarded trials than the control group. In terms of the fMRI results, there were no significant group differences in reward circuitry during reward anticipation. During the receipt of rewards, there was a significant interaction between group and reward type in the left dorsal striatum (DS). The ASD group showed reduced activity in the DS compared to controls for social rewards but not monetary rewards and decreased activation for social rewards compared to monetary rewards. Controls showed no significant difference between the two reward types. Increased activation in the DS during social reward processing was associated with faster response times for rewarded trials, compared to unrewarded trials, in both groups. This is in line with behavioral results indicating that the ASD group showed less of a reduction in RT for rewarded compared to unrewarded trials. Additionally, de-activation to social rewards was associated with increased repetitive behavior in ASD. In line with social motivation theory, the ASD
Energy Technology Data Exchange (ETDEWEB)
Chang, Qin [Henan Normal University, Institute of Particle and Nuclear Physics, Henan (China); Central China Normal University, Institute of Particle Physics, Wuhan (China); Chen, Ling-Xin; Zhang, Yun-Yun; Sun, Jun-Feng; Yang, Yue-Ling [Henan Normal University, Institute of Particle and Nuclear Physics, Henan (China)
2016-10-15
Motivated by the rapid development of heavy-flavor experiments, phenomenological studies of nonleptonic anti B{sub d,s} → D{sup *}{sub d,s}V and anti B{sup *}{sub d,s} → D{sub d,s}V (V = ρ, K*) decays are performed within the framework of QCD factorization. Relative to the previous work, the QCD corrections to the transverse amplitudes are evaluated at next-to-leading order. The theoretical predictions of the observables are updated. For the measured anti B{sub d,s} → D{sup *}{sub d,s}V decays, the tensions between theoretical results and experimental measurements, i.e. the ''R{sub ds}{sup V} puzzle'' and ''D*V (or R{sub V/l} {sub anti} {sub ν{sub l)}} puzzle'', are presented after detailed analyses. For the anti B{sup *}{sub d,s} → D{sub d,s}V decays, they have relatively large branching fractions of the order >or similar O(10{sup -9}) and are in the scope of Belle-II and LHCb experiments. Moreover, they also provide a way to crosscheck the possible puzzles mentioned above through the similar ratios R{sub ds}{sup 'V} and R{sup '}{sub V/l} {sub anti} {sub ν{sub l.}} More refined experimental measurements and theoretical efforts are required to confirm or refute such two anomalies. (orig.)
DNA/RNA hybrid substrates modulate the catalytic activity of purified AID.
Abdouni, Hala S; King, Justin J; Ghorbani, Atefeh; Fifield, Heather; Berghuis, Lesley; Larijani, Mani
2018-01-01
Activation-induced cytidine deaminase (AID) converts cytidine to uridine at Immunoglobulin (Ig) loci, initiating somatic hypermutation and class switching of antibodies. In vitro, AID acts on single stranded DNA (ssDNA), but neither double-stranded DNA (dsDNA) oligonucleotides nor RNA, and it is believed that transcription is the in vivo generator of ssDNA targeted by AID. It is also known that the Ig loci, particularly the switch (S) regions targeted by AID are rich in transcription-generated DNA/RNA hybrids. Here, we examined the binding and catalytic behavior of purified AID on DNA/RNA hybrid substrates bearing either random sequences or GC-rich sequences simulating Ig S regions. If substrates were made up of a random sequence, AID preferred substrates composed entirely of DNA over DNA/RNA hybrids. In contrast, if substrates were composed of S region sequences, AID preferred to mutate DNA/RNA hybrids over substrates composed entirely of DNA. Accordingly, AID exhibited a significantly higher affinity for binding DNA/RNA hybrid substrates composed specifically of S region sequences, than any other substrates composed of DNA. Thus, in the absence of any other cellular processes or factors, AID itself favors binding and mutating DNA/RNA hybrids composed of S region sequences. AID:DNA/RNA complex formation and supporting mutational analyses suggest that recognition of DNA/RNA hybrids is an inherent structural property of AID. Copyright © 2017 Elsevier Ltd. All rights reserved.
Hybrid classical/quantum simulation for infrared spectroscopy of water
Maekawa, Yuki; Sasaoka, Kenji; Ube, Takuji; Ishiguro, Takashi; Yamamoto, Takahiro
2018-05-01
We have developed a hybrid classical/quantum simulation method to calculate the infrared (IR) spectrum of water. The proposed method achieves much higher accuracy than conventional classical molecular dynamics (MD) simulations at a much lower computational cost than ab initio MD simulations. The IR spectrum of water is obtained as an ensemble average of the eigenvalues of the dynamical matrix constructed by ab initio calculations, using the positions of oxygen atoms that constitute water molecules obtained from the classical MD simulation. The calculated IR spectrum is in excellent agreement with the experimental IR spectrum.
Directory of Open Access Journals (Sweden)
Noor Safiza Mohamad Nor
2015-12-01
Full Text Available Introduction: Autism Spectrum Disorders (ASD, Down Syndrome (DS and Cerebral Palsy (CP are the most common disabilities among children. Nutritional status assessment is important as these children are at risk of underweight, overweight or obesity. Therefore, the objectives of this review were to identify evidence on the prevalence of nutritional status of children with DS, CP and ASD, and to determine tools and indicators to measure the nutritional status of these children. Methods: This scoping review was conducted using a framework suggested by Arksey and O'Maley. A comprehensive search was performed to identify published and unpublished works, reviews, grey literature and reports. Inclusion criteria for the search were articles in English published from 1990 to 2014 and related to children with ASD, DS and CP. Titles, abstract, and keywords for eligibility were examined independently by the researchers. Results: A total of 305,268 titles were extracted from electronic databases and other resources. Based on the inclusion criteria, 21 articles were selected for review. The prevalence of overweight or obese children with DS ranged from 33.5% to 43.5%. The prevalence of underweight children with CP was 22.2% to 78.2%. Children with ASD at a younger age were more likely to be overweight or obese compared with normal developing children. The common nutritional indicators used were z-scores for weight-for-age, height-for-age, body mass index-for-age, and head circumference-for-age. Conclusions: Overall, there is emerging evidence on the nutritional status of children with ASD, DS and CP although this is still very limited in developing countries including Malaysia. The evidence shows that children with CP were at risk of being underweight, while children with DS and ASD were at risk of being overweight or obese.
Analysis of the strong decays Ds3 *(2860) → DK, D*K with QCD sum rules
Wang, Zhi-Gang
2016-10-01
In this article, we assign the D_{s3}^{ast}(2860) to be a D-wave c bar{s} meson, study the hadronic coupling constants G_{D_{s3}^{ast}(2860)DK} and G_{D_{s3}^{ast} (2860)D^{ast}K} with the three-point QCD sum rules, and calculate the partial decay widths Γ (D_{s3}^{ast} (2860) → D^{ast}K) and Γ (D_{s3}^{ast}(2860) → DK) . The predicted ratio R = Γ (D_{s3}^{ast} (2860)→ D^{ast}K)/Γ (D_{s3}^{ast} (2860)→ DK) = 0.57± 0.38 cannot reproduce the experimental value R = Br(D_{sJ}^{ast} (2860)→ D^{ast}K)/Br (D_{sJ}^{ast} (2860)→ DK) = 1.10 ± 0.15 ± 0.19.
Evans, David W.; Canavera, Kristin; Kleinpeter, F. Lee; Maccubbin, Elise; Taga, Ken
2005-01-01
This study compared the fears and behavior problems of 25 children with an autism spectrum disorder (ASD), 43 children with Down syndrome (DS), 45 mental age (MA) matched children, and 37 chronologically age (CA) matched children. Children's fears, phobias, anxieties and behavioral problems were assessed using parent reports. Significant…
Heart failure: a weak link in CHA2 DS2 -VASc.
Friberg, Leif; Lund, Lars H
2018-02-15
In atrial fibrillation, stroke risk is assessed by the CHA 2 DS 2 -VASc score. Heart failure is included in CHA 2 DS 2 -VASc, but the rationale is uncertain. Our objective was to test if heart failure is a risk factor for stroke, independent of other risk factors in CHA 2 DS 2 -VASc. We studied 300 839 patients with atrial fibrillation in the Swedish Patient Register 2005-11. Three definitions of heart failure were used in order to assess the robustness of the results. In the main analysis, heart failure was defined by a hospital discharge diagnosis of heart failure as first or second diagnosis and a filled prescription of a diuretic within 3 months before index + 30 days. The second definition counted first or second discharge diagnoses failure diagnosis in open or hospital care before index + 30 days. Associations with outcomes were assessed with multivariable Cox analyses. Patients with heart failure were older (80.5 vs. 74.0 years, P failure and 3.1% without. Adjustment for the cofactors in CHA 2 DS 2 -VASc eradicated the difference in stroke risk between patients with and without heart failure (hazard ratio 1.01 with 95% confidence interval 0.96-1.05). The area under the receiver operating characteristic curve for CHA 2 DS 2 -VASc was not improved by points for heart failure. A clinical diagnosis of heart failure was not an independent risk factor for stroke in patients with atrial fibrillation, which may have implications for anticoagulation management. © 2018 The Authors. ESC Heart Failure published by John Wiley & Sons Ltd on behalf of the European Society of Cardiology.
On the completeness of the set of classical W-algebras obtained from DS reductions
International Nuclear Information System (INIS)
Feher, L.; Ruelle, P.; Tsutsui, I.
1993-04-01
We clarify the notions of the DS-generalized Drinfeld-Sokolov-reduction approach to classical W-algebras and collect evidence supporting the conjecture that the canonical W-algebras (called W S G -algebras), defined by the highest weights of the sl(2) embeddings S contains or equal to G into the simple Lie algebras, essentially exhaust the set of W-algebras that may be obtained by reducing the affine Kac-Moody (KM) Poisson bracket algebras in this approach. We first prove that an sl(2) embedding S contains or equal to G can be associated to every DS reduction and then derive restrictions on the possible cases belonging to the same sl(2) embedding. We find examples of noncanonical DS reductions, but in all those examples the resultant noncanonical W-algebra decouples into the direct product of the corresponding W S G -algebra and a system of 'free fields' with conformal weights Δ element of {0, 1/2, 1}. We also show that if the conformal weights of the generators of a W-algebra obtained from DS reduction are nonnegative Δ ≥ 0 (which is the case for all DS reductions known to date), then the Δ ≥ 3/2 subsectors of the weights are necessarily the same as in the corresponding W S G -algebra. The paper is concluded by a list of open problems concerning DS reductions and more general Hamiltonian KM reductions. (orig.)
Measurement of B_{s}^{0} and D_{s}^{-} Meson Lifetimes.
Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Balagura, V; Baldini, W; Baranov, A; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baryshnikov, F; Baszczyk, M; Batozskaya, V; Batsukh, B; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Beiter, A; Bel, L J; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Beranek, S; Berezhnoy, A; Bernet, R; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Birnkraut, A; Bitadze, A; Bizzeti, A; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bonivento, W; Bordyuzhin, I; Borgheresi, A; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britton, T; Brodzicka, J; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Cadeddu, S; Calabrese, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cavallero, G; Cenci, R; Chamont, D; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S-F; Chobanova, V; Chrzaszcz, M; Chubykin, A; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coco, V; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; David, P N Y; Davis, A; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C T; Decamp, D; Deckenhoff, M; Del Buono, L; Dembinski, H-P; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Di Nezza, P; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Dungs, K; Durante, P; Dzhelyadin, R; Dziewiecki, M; Dziurda, A; Dzyuba, A; Déléage, N; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fay, R; Fazzini, D; Ferguson, D; Fernandez, G; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Funk, W; Furfaro, E; Färber, C; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Govorkova, E; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greim, R; Griffith, P; Grillo, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hamilton, B; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hatch, M; He, J; Head, T; Heister, A; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, H; Huard, Z-C; Hulsbergen, W; Humair, T; Hushchyn, M; Hutchcroft, D; Idzik, M; Ilten, P; Jacobsson, R; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Karacson, M; Kariuki, J M; Karodia, S; Kecke, M; Kelsey, M; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Klimkovich, T; Koliiev, S; Kolpin, M; Komarov, I; Kopecna, R; Koppenburg, P; Kosmyntseva, A; Kotriakhova, S; Kozachuk, A; Kozeiha, M; Kravchuk, L; Kreps, M; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kurek, K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, T; Li, Y; Li, Z; Likhomanenko, T; Lindner, R; Lionetto, F; Liu, X; Loh, D; Longstaff, I; Lopes, J H; Lucchesi, D; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Maev, O; Maguire, K; Malde, S; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Manning, P; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marinangeli, M; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurice, E; Maurin, B; Mazurov, A; McCann, M; McNab, A; McNulty, R; Meadows, B; Meier, F; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Minard, M-N; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Monroy, I A; Monteil, S; Morandin, M; Morello, M J; Morgunova, O; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M; Mussini, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Nogay, A; Novoselov, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Oldeman, R; Onderwater, C J G; Ossowska, A; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palutan, M; Papanestis, A; Pappagallo, M; Pappalardo, L L; Pappenheimer, C; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pistone, A; Piucci, A; Placinta, V; Playfer, S; Plo Casasus, M; Poikela, T; Polci, F; Poli Lener, M; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Ponce, S; Popov, A; Popov, D; Popovici, B; Poslavskii, S; Potterat, C; Price, E; Prisciandaro, J; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, C; Qian, W; Quagliani, R; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rodriguez Perez, P; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Gonzalo, D; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schreiner, H F; Schubert, K; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Simone, S; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Soares Lavra, L; Sokoloff, M D; Soler, F J P; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefko, P; Stefkova, S; Steinkamp, O; Stemmle, S; Stenyakin, O; Stevens, H; Stoica, S; Stone, S; Storaci, B; Stracka, S; Stramaglia, M E; Straticiuc, M; Straumann, U; Sun, L; Sutcliffe, W; Swientek, K; Syropoulos, V; Szczekowski, M; Szumlak, T; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, E; van Tilburg, J; Tilley, M J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Toriello, F; Tourinho Jadallah Aoude, R; Tournefier, E; Tourneur, S; Trabelsi, K; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tully, A; Tuning, N; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagnoni, V; Valassi, A; Valat, S; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Venkateswaran, A; Verlage, T A; Vernet, M; Vesterinen, M; Viana Barbosa, J V; Viaud, B; Vieira, D; Vieites Diaz, M; Viemann, H; Vilasis-Cardona, X; Vitti, M; Volkov, V; Vollhardt, A; Voneki, B; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Vázquez Sierra, C; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Wark, H M; Watson, N K; Websdale, D; Weiden, A; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Winn, M A; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wyllie, K; Xie, Y; Xing, Z; Xu, Z; Yang, Z; Yang, Z; Yao, Y; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zarebski, K A; Zavertyaev, M; Zhang, L; Zhang, Y; Zhelezov, A; Zheng, Y; Zhu, X; Zhukov, V; Zucchelli, S
2017-09-08
We report on a measurement of the flavor-specific B_{s}^{0} lifetime and of the D_{s}^{-} lifetime using proton-proton collisions at center-of-mass energies of 7 and 8 TeV, collected by the LHCb experiment and corresponding to 3.0 fb^{-1} of integrated luminosity. Approximately 407 000 B_{s}^{0}→D_{s}^{(*)-}μ^{+}ν_{μ} decays are partially reconstructed in the K^{+}K^{-}π^{-}μ^{+} final state. The B_{s}^{0} and D_{s}^{-} natural widths are determined using, as a reference, kinematically similar B^{0}→D^{(*)-}μ^{+}ν_{μ} decays reconstructed in the same final state. The resulting differences between widths of B_{s}^{0} and B^{0} mesons and of D_{s}^{-} and D^{-} mesons are Δ_{Γ}(B)=-0.0115±0.0053(stat)±0.0041(syst) ps^{-1} and Δ_{Γ}(D)=1.0131±0.0117(stat)±0.0065(syst) ps^{-1}, respectively. Combined with the known B^{0} and D^{-} lifetimes, these yield the flavor-specific B_{s}^{0} lifetime, τ_{B_{s}^{0}}^{fs}=1.547±0.013(stat)±0.010(syst)±0.004(τ_{B}) ps and the D_{s}^{-} lifetime, τ_{D_{s}^{-}}=0.5064±0.0030(stat)±0.0017(syst)±0.0017(τ_{D}) ps. The last uncertainties originate from the limited knowledge of the B^{0} and D^{-} lifetimes. The results improve upon current determinations.
Jensen, Peter D; Zhang, Yuanji; Wiggins, B Elizabeth; Petrick, Jay S; Zhu, Jin; Kerstetter, Randall A; Heck, Gregory R; Ivashuta, Sergey I
2013-01-01
Long double-stranded RNAs (long dsRNAs) are precursors for the effector molecules of sequence-specific RNA-based gene silencing in eukaryotes. Plant cells can contain numerous endogenous long dsRNAs. This study demonstrates that such endogenous long dsRNAs in plants have sequence complementarity to human genes. Many of these complementary long dsRNAs have perfect sequence complementarity of at least 21 nucleotides to human genes; enough complementarity to potentially trigger gene silencing in targeted human cells if delivered in functional form. However, the number and diversity of long dsRNA molecules in plant tissue from crops such as lettuce, tomato, corn, soy and rice with complementarity to human genes that have a long history of safe consumption supports a conclusion that long dsRNAs do not present a significant dietary risk.
Radiation hybrid mapping of human chromosome 18
International Nuclear Information System (INIS)
Francke, U.; Moon, A.J.; Chang, E.; Foellmer, B.; Strauss, B.; Haschke, A.; Chihlin Hsieh; Geigl, E.M.; Welch, S.
1990-01-01
The authors have generated a Chinese hamster V79/380-6 HPRT minus x human leukocyte hybrid cell line (18/V79) with chromosome 18 as the only human chromosome that is retained at high frequency without specific selection. Hybrid cells were selected in HAT medium, and 164 individual colonies were isolated. Of 110 colonies screened for human DNA by PCR amplification using a primer specific for human Alu repeats 67 (61%) were positive. These were expanded in culture for large-scale DNA preparations. Retesting expanded clones by PCR with Alu and LINE primers has revealed unique patterns of amplification products. In situ hybridization of biotin labelled total human DNA to metaphase spreads from various hybrids revealed the presence of one or more human DNA fragments integrated in hamster chromosomes. The authors have generated a resource that should allow the construction of a radiation map, to be compared with the YAC contig map also under construction in their laboratory
Subthreshold social cognitive deficits may be a key to distinguish 22q11.2DS from schizophrenia.
Peyroux, Elodie; Rigard, Caroline; Saucourt, Guillaume; Poisson, Alice; Plasse, Julien; Franck, Nicolas; Demily, Caroline
2018-03-25
Social cognitive impairments are core features in 22q11.2 deletion syndrome (22q11.2DS) and schizophrenia (SCZ). Indeed, adults with 22q.11.2 DS often have poorer social competence as well as poorer performance on measures of social cognitive skills (emotion recognition and theory of mind, ToM) compared with typically developing people. However, studies comparing specific social cognitive components in 22q11.2DS and SCZ have not yet been widely conducted. In this study we compared performances of 22q11.2DS and SCZ on both facial emotion recognition and ToM. Patients with 22q11.2DS (n = 18) and matched SCZ patients were recruited. After neuropsychological testing, the facial emotion recognition test assessed the patients' ability to recognize six basic, universal emotions (joy, anger, sadness, fear, disgust, and contempt). The Versailles-situational intentional reading evaluated ToM with six scenes from movies showing characters in complex interactions (involving hints, lies, and indirect speech). We show that 22q11.2DS exhibited significantly lower performance in emotion recognition than SCZ patients did, especially for disgust, contempt, and fear. This impairment seems to be a core cognitive phenotype in 22q11.2DS, regardless of the presence of SCZ symptoms. Concerning ToM, our results may highlight the same impairment level in 22q11.2DS and SCZ but require to be replicated in a larger cohort. Our results document the existence of threshold social cognitive deficits distinguishing 22q11.2DS from SCZ. © 2018 John Wiley & Sons Australia, Ltd.
Characterization of HIP bonded DS-Cu/SS316L joints for fusion experimental reactors
Energy Technology Data Exchange (ETDEWEB)
Kanari, Moriyasu; Hatano, Toshihisa; Sato, Satoshi; Furuya, Kazuyuki; Kuroda, Toshimasa; Enoeda, Mikio; Abe, Tetsuya; Takatsu, Hideyuki [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment
1998-02-01
A shielding blanket design in a fusion reactor such as ITER has been proposed to be a modular structure integrated with the first wall. In view of the fabrication, HIP(Hot Isostatic Pressing) method has been proposed for the joining of dispersion strengthened copper (DS-Cu) and type 316L stainless steel (SS316L) at the first wall. Characterization of DS-Cu in HIP joints bonded at three different temperatures has been performed placing emphasis on metallurgical quality at the interfacial region of some hundred {mu}m by means of conventional observation and testing techniques. SEM(Scanning Electron Microscope) observation of these joints before and after intergranular corrosion to DS-Cu have shown that in two joints HIPed at 1253K and 1303K some voids of 1-4{mu}m exist in the vicinity to the interface, while in the other one HIPed at 1323K there is no void and the joint reveals good bondability. And in all the joints grain boundary has been developed parallel to the interface. SEM observation of DS-Cu grains have shown that in a joint at 1323K the grains have slightly coarsened to the size larger than as-received DS-Cu by a factor of 2, despite the hardness of that remains as as-received DS-Cu. While in the other two joints grain remains as large as as-received DS-Cu. EPMA(Electron Prove Microscopic Analysis) of aluminium in DS-Cu has shown that in all the joints accumulation of alumina has occurred in the vicinity to the interface and the length of the accumulated region increases as the increase of the HIP temperature and reaches up to 50{mu}m from the interface at 1323K. Vickers hardness test have shown that in a joint bonded at 1323K the hardness decreases to the level of an oxygen free copper in the vicinity to the interface, implying that the distribution of alumina has changed. From these experiments, it can be concluded that the joint at 1323K has exhibited the highest performance in terms of bondability. (J.P.N.)
Directory of Open Access Journals (Sweden)
Gaoquan Shi
2009-06-01
Full Text Available A novel water-soluble cationic conjugated oligopyrene derivative, oligo(N1,N1,N1,N4,N4,N4-hexamethyl-2-(4-(pyren-1-yl butane-1,4-diaminium bromide (OHPBDB, was synthesized by a combination of chemical and electrochemical synthesis techniques. Each oligomer chain has five pyrene derivative repeating units and brings 10 positive charges. OHPBDB showed high and rapid fluorescence quenching in aqueous media upon addition of trace amounts of single-stranded (ss and double-stranded (ds DNA. The Stern-Volmer constants for ss- and ds-DNA were measured to be as high as 1.3 × 108 mol-1·L and 1.2 × 108 mol-1·L, respectively. On the other hand, distinct fluorescence enhancement of OHPBDB upon addition of large amount of ss-DNA or ds-DNA was observed. Furthermore, ss-DNA showed much stronger fluorescence enhancement than that of ds-DNA, thus yielding a clear and simple signal useful for the discrimination between ss- and ds-DNA in aqueous media.
Directory of Open Access Journals (Sweden)
Mallika Sastry
Full Text Available Appropriate adjuvant selection may be essential to optimize the potency and to tailor the immune response of subunit vaccines. To induce protective responses against respiratory syncytial virus (RSV-a highly prevalent childhood pathogen without a licensed vaccine-we previously engineered a pre-fusion-stabilized trimeric RSV F (pre-F "DS-Cav1" immunogen, which induced high titer RSV-neutralizing antibodies, in mice and non-human primates, when formulated with adjuvants Poly (I:C and Poly (IC:LC, respectively. To assess the impact of different adjuvants, here we formulated RSV F DS-Cav1 with multiple adjuvants and assessed immune responses. Very high RSV-neutralizing antibody responses (19,006 EC50 were observed in naïve mice immunized with 2 doses of DS-Cav1 adjuvanted with Sigma adjuvant system (SAS, an oil-in-water adjuvant, plus Carbopol; high responses (3658-7108 were observed with DS-Cav1 adjuvanted with Alum, SAS alone, Adjuplex, Poly (I:C and Poly (IC:LC; and moderate responses (1251-2129 were observed with DS-Cav1 adjuvanted with the TLR4 agonist MPLA, Alum plus MPLA or AddaVax. In contrast, DS-Cav1 without adjuvant induced low-level responses (6. A balanced IgG1 and IgG2a (Th2/Th1 immune response was elicited in most of the high to very high response groups (all but Alum and Adjuplex. We also tested the immune response induced by DS-Cav1 in elderly mice with pre-existing DS-Cav1 immunity; we observed that DS-Cav1 adjuvanted with SAS plus Carbopol boosted the response 2-3-fold, whereas DS-Cav1 adjuvanted with alum boosted the response 5-fold. Finally, we tested whether a mixture of ISA 71 VG and Carbopol would enhanced the antibody response in DS-Cav1 immunized calves. While pre-F-stabilized bovine RSV F induced very high titers in mice when adjuvanted with SAS plus Carbopol, the addition of Carbopol to ISA 71 VG did not enhance immune responses in calves. The vaccine response to pre-F-stabilized RSV F is augmented by adjuvant, but the
Containers of DS-2 Decontaminating Solution
1982-03-01
percent sodium hydroxide, and the remainder is ethylene glycol monomethyl ether. Because of its reactivity, it must be protected from moisture and... carbon dioxide. It has been demonstrated that DS-2 does not corrode terneplate or steel. However, satisfactory terneplate and steel containers are...not produce a pail with a polyethylene insert. However, Mr. Wood told me that Hedwin Corporation (a subsidiary of Solvay ) does produce this kind of
van Dijkman, P R M; Kuijpers, Th J A; Blom, B M; van Herpen, G
2002-07-13
Assessment of the clinical applicability of DS-MRI for the detection of myocardial ischemia and myocardial viability. Prospective. In the period from 1 November 1999 to 31 October 2000, patients with suspected coronary artery disease who could not be studied by means of conventional bicycle ergometry underwent breath-hold DS-MRI (1 Tesla) 4 days after cessation of anti-ischemic medication. Three left ventricular short-axis planes were examined for the occurrence of disorders in wall movement during infusion of increasing doses of dobutamine (10, 20, 30 and 40 micrograms/kg/min). Temporary recovery of wall thickening in a previously diminished or non-contracting segment under 5 micrograms/kg/min of dobutamine was considered proof of viability. Development of hypo-, a- or dyskinesia at higher doses of dobutamine was taken to indicate ischemia. If the DS-MRI test was positive for ischemia, coronary angiography was performed. If indicated, this was followed by revascularisation. If DS-MRI did not reveal ischemia, the patient was seen at the outpatient department. Of the 100 patients (62 men and 38 women with an average age of 62 years, SD = 12) subjected to DS-MRI, 95 yielded results that were suitable for diagnosis. Of the 42 patients with DS-MRI scans that were considered positive for ischemia and in whom coronary angiography was subsequently performed, 41 had such coronary abnormalities that revascularisation was indicated. One patient was false-positive. All 53 patients with non-ischemic DS-MRI scans were followed-up for 11-23 months (mean 17 months). One patient died suddenly 2 weeks after the MRI-test. The other 52 patients did not experience any coronary events nor sudden cardiac death. The predictive value of a positive DS-MRI scan for ischemia was 98% and the predictive value of a negative DS-MRI scan was also 98%. DS-MRI is a safe diagnostic method for the detection or exclusion of myocardial ischemia and viability in patients with suspected coronary artery
Spreading convulsions, spreading depolarization and epileptogenesis in human cerebral cortex
DEFF Research Database (Denmark)
Dreier, Jens P; Major, Sebastian; Pannek, Heinz-Wolfgang
2012-01-01
Spreading depolarization of cells in cerebral grey matter is characterized by massive ion translocation, neuronal swelling and large changes in direct current-coupled voltage recording. The near-complete sustained depolarization above the inactivation threshold for action potential generating...... stimulations. Eventually, epileptic field potentials were recorded during the period that had originally seen spreading depression of activity. Such spreading convulsions are characterized by epileptic field potentials on the final shoulder of the large slow potential change of spreading depolarization. We...
The Folding of de Novo Designed Protein DS119 via Molecular Dynamics Simulations
Directory of Open Access Journals (Sweden)
Moye Wang
2016-04-01
Full Text Available As they are not subjected to natural selection process, de novo designed proteins usually fold in a manner different from natural proteins. Recently, a de novo designed mini-protein DS119, with a βαβ motif and 36 amino acids, has folded unusually slowly in experiments, and transient dimers have been detected in the folding process. Here, by means of all-atom replica exchange molecular dynamics (REMD simulations, several comparably stable intermediate states were observed on the folding free-energy landscape of DS119. Conventional molecular dynamics (CMD simulations showed that when two unfolded DS119 proteins bound together, most binding sites of dimeric aggregates were located at the N-terminal segment, especially residues 5–10, which were supposed to form β-sheet with its own C-terminal segment. Furthermore, a large percentage of individual proteins in the dimeric aggregates adopted conformations similar to those in the intermediate states observed in REMD simulations. These results indicate that, during the folding process, DS119 can easily become trapped in intermediate states. Then, with diffusion, a transient dimer would be formed and stabilized with the binding interface located at N-terminals. This means that it could not quickly fold to the native structure. The complicated folding manner of DS119 implies the important influence of natural selection on protein-folding kinetics, and more improvement should be achieved in rational protein design.
Commentary: PhDs in Biochemistry Education--5 Years Later
Offerdahl, Erika G.; Momsen, Jennifer L.; Osgood, Marcy
2014-01-01
In this commentary, the discussion of PhDs in biochemistry education research is expanded to explore a number of diverse pathways leading to a competitive research program in biochemistry education research.
Hybrid Bridge Structures Made of Frp Composite and Concrete
Rajchel, Mateusz; Siwowski, Tomasz
2017-09-01
Despite many advantages over the conventional construction materials, the contemporary development of FRP composites in bridge engineering is limited due to high initial cost, low stiffness (in case of glass fibers) and sudden composite failure mode. In order to reduce the given limitations, mixed (hybrid) solutions connecting the FRP composites and conventional construction materials, including concrete, have been tested in many countries for 20 years. Shaping the hybrid structures based on the attributes of particular materials, aims to increase stiffness and reduce cost without losing the carrying capacity, lightness and easiness of bridges that includes such hybrid girders, and to avoid the sudden dangerous failure mode. In the following article, the authors described examples of hybrid road bridges made of FRP composite and concrete within the time of 20 years and presented the first Polish hybrid FRP-concrete road bridge. Also, the directions of further research, necessary to spread these innovative, advanced and sustainable bridge structures were indicated.
Thermodynamics for the Formation of Double-Stranded DNA-Single-Walled Carbon Nanotube Hybrids.
Shiraki, Tomohiro; Tsuzuki, Akiko; Toshimitsu, Fumiyuki; Nakashima, Naotoshi
2016-03-24
For the first time, the thermodynamics are described for the formation of double-stranded DNA (ds-DNA)-single-walled carbon nanotube (SWNT) hybrids. This treatment is applied to the exchange reaction of sodium cholate (SC) molecules on SWNTs and the ds-DNAs d(A)20 -d(T)20 and nuclear factor (NF)-κB decoy. UV/Vis/near-IR spectroscopy with temperature variations was used for analyzing the exchange reaction on the SWNTs with four different chiralities: (n,m)=(8,3), (6,5), (7,5), and (8,6). Single-stranded DNAs (ss-DNAs), including d(A)20 and d(T)20, are also used for comparison. The d(A)20-d(T)20 shows a drastic change in its thermodynamic parameters around the melting temperature (Tm ) of the DNA oligomer. No such Tm dependency was measured, owing to high Tm in the NF-κB decoy DNA and no Tm in the ss-DNA. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Holloway, Ryan W; Regnery, Julia; Nghiem, Long D; Cath, Tzahi Y
2014-09-16
A hybrid ultrafiltration-osmotic membrane bioreactor (UFO-MBR) was investigated for over 35 days for nutrient and trace organic chemical (TOrC) removal from municipal wastewater. The UFO-MBR system uses both ultrafiltration (UF) and forward osmosis (FO) membranes in parallel to simultaneously extract clean water from an activated sludge reactor for nonpotable (or environmental discharge) and potable reuse, respectively. In the FO stream, water is drawn by osmosis from activated sludge through an FO membrane into a draw solution (DS), which becomes diluted during the process. A reverse osmosis (RO) system is then used to reconcentrate the diluted DS and produce clean water suitable for direct potable reuse. The UF membrane extracts water, dissolved salts, and some nutrients from the system to prevent their accumulation in the activated sludge of the osmotic MBR. The UF permeate can be used for nonpotable reuse purposes (e.g., irrigation and toilet flushing). Results from UFO-MBR investigation illustrated that the chemical oxygen demand, total nitrogen, and total phosphorus removals were greater than 99%, 82%, and 99%, respectively. Twenty TOrCs were detected in the municipal wastewater that was used as feed to the UFO-MBR system. Among these 20 TOrCs, 15 were removed by the hybrid UFO-MBR system to below the detection limit. High FO membrane rejection was observed for all ionic and nonionic hydrophilic TOrCs and lower rejection was observed for nonionic hydrophobic TOrCs. With the exceptions of bisphenol A and DEET, all TOrCs that were detected in the DS were well rejected by the RO membrane. Overall, the UFO-MBR can operate sustainably and has the potential to be utilized for direct potable reuse applications.
Directory of Open Access Journals (Sweden)
Rodrigo C. Oliveira
2015-01-01
Full Text Available We investigated in Brazilian women with SLE the prevalence and levels of high avidity (HA dsDNA antibodies and tested their correlation with lupus activity and biomarkers of renal disease. We also compared these correlations to those observed with total dsDNA antibodies and antibodies against nucleosome (ANuA. Autoantibodies were detected by ELISA, while C3 and C4 levels were determined by nephelometry. Urine protein/creatinine ratio was determined, and lupus activity was measured by SLEDAI-2K. The prevalence of total and HA dsDNA antibodies was similar to but lower than that verified for ANuA. The levels of the three types of antibodies were correlated, but the correlation was more significant between HA dsDNA antibodies and ANuA. High avidity dsDNA antibodies correlated positively with ESR and SLEDAI and inversely with C3 and C4. Similar correlations were observed for ANuA levels, whereas total dsDNA antibodies only correlated with SLEDAI and C3. The levels of HA dsDNA antibodies were higher in patients with proteinuria, but their levels of total dsDNA antibodies and ANuA were unaltered. High avidity dsDNA antibodies can be found in high prevalence in Brazilian women with SLE and are important biomarkers of active disease and kidney dysfunction.
Directory of Open Access Journals (Sweden)
Mohammad Vatanparast
Full Text Available Double-stranded RNA (dsRNA has been applied to control insect pests due to its induction of RNA interference (RNAi of a specific target gene expression. However, developing dsRNA-based insecticidal agent has been a great challenge especially against lepidopteran insect pests due to variations in RNAi efficiency. The objective of this study was to screen genes of chymotrypsins (SeCHYs essential for the survival of the beet armyworm, Spodoptera exigua, to construct insecticidal dsRNA. In addition, an optimal oral delivery method was developed using recombinant bacteria. At least 7 SeCHY genes were predicted from S. exigua transcriptomes. Subsequent analyses indicated that SeCHY2 was widely expressed in different developmental stages and larval tissues by RT-PCR and its expression knockdown by RNAi caused high mortality along with immunosuppression. However, a large amount of dsRNA was required to efficiently kill late instars of S. exigua because of high RNase activity in their midgut lumen. To minimize dsRNA degradation, bacterial expression and formulation of dsRNA were performed in HT115 Escherichia coli using L4440 expression vector. dsRNA (300 bp specific to SeCHY2 overexpressed in E. coli was toxic to S. exigua larvae after oral administration. To enhance dsRNA release from E. coli, bacterial cells were sonicated before oral administration. RNAi efficiency of sonicated bacteria was significantly increased, causing higher larval mortality at oral administration. Moreover, targeting young larvae possessing weak RNase activity in the midgut lumen significantly enhanced RNAi efficiency and subsequent insecticidal activity against S. exigua.
Ramesh Kumar, D; Saravana Kumar, P; Gandhi, M Rajiv; Al-Dhabi, Naif Abdullah; Paulraj, M Gabriel; Ignacimuthu, S
2016-05-01
RNA interference (RNAi) has been used as a gene silencing strategy by the introduction of long double stranded RNA (dsRNA) for the control of pest insects. The aim of the present study was to examine whether the expression of vg gene which is responsible for wing development, can be repressed by chitosan/dsRNA based nanoparticles in Aedes aegypti. The vestigial gene (vg) was amplified from adult mosquito and cloned in pLitmus28i vector. Genetically engineered recombinant plasmid was transformed into RNase III deficient strain for synthesis of bacterially expressed dsRNA. Nanoparticles were prepared via electrostatic interaction between cationic polymer chitosan and anionic nucleic acids (dsRNA). The formation of chitosan/dsRNAnanoparticles and their size were confirmed by Atomic force microscopy (AFM). Chitosan/dsRNA mediated knockdown of Enhanced Green Fluorescence Protein (EGFP) was demonstrated in Sf21 cells. Further, we tested whether such an approach could be used to target vg gene in Ae. aegypti. The results showed that chitosan/dsRNA caused significant mortality, delayed growth development and caused adult wing-malformation. A qRT-PCR analysis confirmed that the chitosan/dsRNA mediated transcriptional level was downregulated. Our findings suggest that vg gene intervention strategies through RNAi can emerge as viable option for pest control. Copyright © 2016 Elsevier B.V. All rights reserved.
Resource Distribution Approaches in Spectrum Sharing Systems
Directory of Open Access Journals (Sweden)
Friedrich K. Jondral
2008-05-01
Full Text Available It is increasingly difficult to satisfy growing demands for spectrum with the conventional policy of fixed spectrum allocation. To overcome this problem, flexible/dynamic spectrum sharing methods that can significantly improve spectrum utilization of the spectrum have gained increasing interest recently. This paper presents two dynamic spectrum sharing approaches, a centralized and a decentralized one. The centralized approach is based on hierarchical trading. Each level of hierarchy is composed of “markets†that are associated with a certain spatial area and trading occurrence frequency, whereas area size and trading occurrence frequency depend on the hierarchy level. The decentralized approach is based on game-theory. There, it is assumed that the operators are averse to unequal payoffs and act unselfishly, enabling a stable and sustainable community. Numerical results show that, in the observed scenario, both proposals outperform the reference case of fixed resource allocation significantly in terms of utilized bandwidth. Whereas, negotiation costs for spectrum brokerage appear in the centralized approach, nonnegligible amounts of spectrum are lost in the decentralized approach due to collisions. Thus, a hybrid of centralized and decentralized approach that exploits the benefits of both is also considered.
Discovery of the target for immunomodulatory drugs (IMiDs).
Ito, Takumi; Ando, Hideki; Handa, Hiroshi
2016-05-01
Half a century ago, the sedative thalidomide caused a serious drug disaster because of its teratogenicity and was withdrawn from the market. However, thalidomide, which has returned to the market, is now used for the treatment of leprosy and multiple myeloma (MM) under strict control. The mechanism of thalidomide action had been a long-standing question. We developed a new affinity bead technology and identified cereblon (CRBN) as a thalidomide-binding protein. We found that CRBN functions as a substrate receptor of an E3 cullin-Ring ligase complex 4 (CRL4) and is a primary target of thalidomide teratogenicity. Recently, new thalidomide derivatives, called immunomodulatory drugs (IMiDs), have been developed by Celgene. Among them, lenalidomide (Len) and pomalidomide (Pom) were shown to exert strong therapeutic effects against MM. It was found that Len and Pom both bind CRBN-CRL4 and recruit neomorphic substrates (Ikaros and Aiolos). More recently it was reported that casein kinase 1a (Ck1a) was identified as a substrate for CRBN-CRL4 in the presence of Len, but not Pom. Ck1a breakdown explains why Len is specifically effective for myelodysplastic syndrome with 5q deletion. It is now proposed that binding of IMiDs to CRBN appears to alter the substrate specificity of CRBN-CRL4. In this review, we introduce recent findings on IMiDs.
MC-DS-CDMA System based on DWT and STBC in ITU Multipath Fading Channels Model
Directory of Open Access Journals (Sweden)
Nader Abdullah Khadam
2018-03-01
Full Text Available In this paper, the performance of multicarrier direct sequence code division multiple access (MC-DS-CDMA in fixed MC-DS-CDMA and Mobile MC-DS-CDMA applications have been improved by using the compensations of space time block coding and Discrete Fast Fourier transforms (FFT or Discrete Wavelets transform DWT. These MC-DS-CDMA systems had been simulated using MATLAB 2015a. Through simulation of the proposed system, various parameters can be changed and tested. The Bit Error Rate (BERs of these systems are obtained over wide range of signal to noise ratio. All simulation results had been compared with each other using different subcarrier size of FFT or DWT with STBC for 1,2,3 and 4 antennas in transmitter and under different ITU multipath fading channels and different Doppler frequencies (fd. The proposed structures of STBC-MC-DS-CDMA system based on (DWT batter than based on (FFT in varies Doppler frequencies and subcarrier size. Also, proposed system with STBC based on 4 transmitters better than other systems based on 1 or 2 or 3 transmitters in all Doppler frequencies and subcarrier size in all simulation results.
Behavioral phenotype in children with 22q11Ds : Agreement between parents and teachers
Klaassen, Petra W J; Duijff, Sasja N.; Sinnema, Gerben; Beemer, Frits A.; Swanenburg de Veye, Henriëtte F N; Vorstman, Jacob A S
2015-01-01
Patients with the 22q11-deletion syndrome (22q11DS) are at an increased risk of developing schizophrenia. Besides the effects of genetic variation, environmental factors could also be important in modifying the risk of schizophrenia in 22q11DS patients. In particular, previous studies have shown the
Theoretical modeling of the absorption spectrum of aqueous riboflavin
Zanetti-Polzi, Laura; Aschi, Massimiliano; Daidone, Isabella; Amadei, Andrea
2017-02-01
In this study we report the modeling of the absorption spectrum of riboflavin in water using a hybrid quantum/classical mechanical approach, the MD-PMM methodology. By means of MD-PMM calculations, with which the effect of riboflavin internal motions and of solvent interactions on the spectroscopic properties can be explicitly taken into account, we obtain an absorption spectrum in very good agreement with the experimental spectrum. In particular, the calculated peak maxima show a consistent improvement with respect to previous computational approaches. Moreover, the calculations show that the interaction with the environment may cause a relevant recombination of the gas-phase electronic states.
Implementation of Distance Support (DS) to Reduce Total Ownership Cost (R-TOC)
2012-02-01
Policy of 22 Mar 2007, states that DS combines people, processes and technology into a collaborative infrastructure regardless of geographic location...Tech Assist Data for Submarine Enterprise 120 FTA Events Performed 164 MH Via On-Si te Support Average Cost Per Event (Based on $60.00 Per Hour...CFFC/Command Policy) 16% Success Rate Overa l l On Al l FTA Events 37% Success Rate On Out-Of-Area Events Average MHs Per Event 19 MH Via DS
Hayes, Stephanie A.; Watson, Shelley L.
2013-01-01
Researchers commonly report that families of children with autism spectrum disorder (ASD) experience more parenting stress than families of typically developing (TD) children or those diagnosed with other disabilities [e.g., Down syndrome (DS), cerebral palsy, intellectual disability]. The authors reexamined the research using comparison groups to…
Evaluation of geometrical contributions to the spread of the Compton-scatter energy distribution
International Nuclear Information System (INIS)
Hanson, A.L.; Gigante, G.E.; Dipartimento di Fisica, Universita degli Studi di Roma I, ''La Sapienza,'' Corso Vittorio Emanuele II, 244, 00186 Roma, Italy)
1989-01-01
The spectrum from Compton-scattered x rays is an inherently broad distribution. This distribution is the sum of several Gaussian-like distributions, which gives the sum its unique shape. The Gaussian-like distributions are the result of convoluting the so-called Compton profile, the spread in the scattered-x-ray energies due to the momentum distributions of the target electrons, with the detector response and the geometrical effects. The distribution is then further modified by the absorption within the sample. A formulation for both qualitatively and quantitatively determining the magnitude of the geometrical contributions is presented. This formulation is based on a recently devised approach to the scattering geometry [Hanson, Gigante, Meron, Phys. Rev. Lett. 61, 135 (1988)]. A methodology for determining the geometrical spread in the energy of the scattered x rays is presented. The results can be conveniently used to optimize scattering geometries for the reduction of the geometry-caused spread
Study of parametric instabilities during the Alcator C lower hybrid wave heating experiments
International Nuclear Information System (INIS)
Takase, Y.
1983-10-01
Parametric excitation of ion-cyclotron quasi-modes (ω/sub R/ approx. = nω/sub ci/) and ion-sound quasi-modes (ω/sub R/ approx. = k/sub parallel to/v/sub ti/) during lower hybrid wave heating of tokamak plasmas have been studied in detail. Such instabilities may significantly modify the incident wavenumber spectrum near the plasma edge. Convective losses for these instabilities are high if well-defined resonance cones exist, but they are significantly reduced if the resonance cones spread and fill the plasma volume (or some region of it). These instabilities preferentially excite lower hybrid waves with larger values of n/sub parallel to/ than themselves possess, and the new waves tend to be absorbed near the outer layers of the plasma. Parametric instabilities during lower hybrid heating of Alcator C plasmas have been investigated using rf probes (to study tilde phi and tilde n/sub i/) and CO 2 scattering technique (to study tilde n/sub e/). At lower densities (anti n/sub e/ less than or equal to 0.5 x 10 14 cm -3 ) where waves observed in the plasma interior using CO 2 scattering appear to be localized, parametric decay is very weak. Both ion-sound and ion-cyclotron parametric decay processes have been observed at higher densities (anti n greater than or equal to 1.5 x 10 14 cm -3 ) where waves appear to be unlocalized. Finally, at still higher densities (anti n /sub e/ greater than or equal to 2 x 10 4 cm -3 ) pump depletion has been observed. Above these densities heating and current drive efficiencies are expected to degrade significantly
Spreading Depression, Spreading Depolarizations, and the Cerebral Vasculature
DEFF Research Database (Denmark)
Ayata, Cenk; Lauritzen, Martin
2015-01-01
Spreading depression (SD) is a transient wave of near-complete neuronal and glial depolarization associated with massive transmembrane ionic and water shifts. It is evolutionarily conserved in the central nervous systems of a wide variety of species from locust to human. The depolarization spreads...
Impact of Antenna Placement on Frequency Domain Adaptive Antenna Array in Hybrid FRF Cellular System
Directory of Open Access Journals (Sweden)
Sri Maldia Hari Asti
2012-01-01
Full Text Available Frequency domain adaptive antenna array (FDAAA is an effective method to suppress interference caused by frequency selective fading and multiple-access interference (MAI in single-carrier (SC transmission. However, the performance of FDAAA receiver will be affected by the antenna placement parameters such as antenna separation and spread of angle of arrival (AOA. On the other hand, hybrid frequency reuse can be adopted in cellular system to improve the cellular capacity. However, optimal frequency reuse factor (FRF depends on the channel propagation and transceiver scheme as well. In this paper, we analyze the impact of antenna separation and AOA spread on FDAAA receiver and optimize the cellular capacity by using hybrid FRF.
Dekker, Alain D.; Sacco, Silvia; Carfi, Angelo; Benejam, Bessy; Vermeiren, Yannick; Beugelsdijk, Gonny; Schippers, Mieke; Hassefras, Lyanne; Eleveld, José; Grefelman, Sharina; Fopma, Roelie; Bomer-Veenboer, Monique; Boti, Mariángeles; Oosterling, G. Danielle E.; Scholten, Esther; Tollenaere, Marleen; Checkley, Laura; Strydom, André; Van Goethem, Gert; Onder, Graziano; Blesa, Rafael; zu Eulenburg, Christine; Coppus, Antonia M.W.; Rebillat, Anne-Sophie; Fortea, Juan; De Deyn, Peter P.
2018-01-01
People with Down syndrome (DS) are prone to develop Alzheimer’s disease (AD). Behavioral and psychological symptoms of dementia (BPSD) are core features, but have not been comprehensively evaluated in DS. In a European multidisciplinary study, the novel Behavioral and Psychological Symptoms of Dementia in Down Syndrome (BPSD-DS) scale was developed to identify frequency and severity of behavioral changes taking account of life-long characteristic behavior. 83 behavioral items in 12 clinically defined sections were evaluated. The central aim was to identify items that change in relation to the dementia status, and thus may differentiate between diagnostic groups. Structured interviews were conducted with informants of persons with DS without dementia (DS, n = 149), with questionable dementia (DS+Q, n = 65), and with diagnosed dementia (DS+AD, n = 67). First exploratory data suggest promising interrater, test-retest, and internal consistency reliability measures. Concerning item relevance, group comparisons revealed pronounced increases in frequency and severity in items of anxiety, sleep disturbances, agitation & stereotypical behavior, aggression, apathy, depressive symptoms, and eating/drinking behavior. The proportion of individuals presenting an increase was highest in DS+AD, intermediate in DS+Q, and lowest in DS. Interestingly, among DS+Q individuals, a substantial proportion already presented increased anxiety, sleep disturbances, apathy, and depressive symptoms, suggesting that these changes occur early in the course of AD. Future efforts should optimize the scale based on current results and clinical experiences, and further study applicability, reliability, and validity. Future application of the scale in daily care may aid caregivers to understand changes, and contribute to timely interventions and adaptation of caregiving. PMID:29689719
Dekker, Alain D; Sacco, Silvia; Carfi, Angelo; Benejam, Bessy; Vermeiren, Yannick; Beugelsdijk, Gonny; Schippers, Mieke; Hassefras, Lyanne; Eleveld, José; Grefelman, Sharina; Fopma, Roelie; Bomer-Veenboer, Monique; Boti, Mariángeles; Oosterling, G Danielle E; Scholten, Esther; Tollenaere, Marleen; Checkley, Laura; Strydom, André; Van Goethem, Gert; Onder, Graziano; Blesa, Rafael; Zu Eulenburg, Christine; Coppus, Antonia M W; Rebillat, Anne-Sophie; Fortea, Juan; De Deyn, Peter P
2018-01-01
People with Down syndrome (DS) are prone to develop Alzheimer's disease (AD). Behavioral and psychological symptoms of dementia (BPSD) are core features, but have not been comprehensively evaluated in DS. In a European multidisciplinary study, the novel Behavioral and Psychological Symptoms of Dementia in Down Syndrome (BPSD-DS) scale was developed to identify frequency and severity of behavioral changes taking account of life-long characteristic behavior. 83 behavioral items in 12 clinically defined sections were evaluated. The central aim was to identify items that change in relation to the dementia status, and thus may differentiate between diagnostic groups. Structured interviews were conducted with informants of persons with DS without dementia (DS, n = 149), with questionable dementia (DS+Q, n = 65), and with diagnosed dementia (DS+AD, n = 67). First exploratory data suggest promising interrater, test-retest, and internal consistency reliability measures. Concerning item relevance, group comparisons revealed pronounced increases in frequency and severity in items of anxiety, sleep disturbances, agitation & stereotypical behavior, aggression, apathy, depressive symptoms, and eating/drinking behavior. The proportion of individuals presenting an increase was highest in DS+AD, intermediate in DS+Q, and lowest in DS. Interestingly, among DS+Q individuals, a substantial proportion already presented increased anxiety, sleep disturbances, apathy, and depressive symptoms, suggesting that these changes occur early in the course of AD. Future efforts should optimize the scale based on current results and clinical experiences, and further study applicability, reliability, and validity. Future application of the scale in daily care may aid caregivers to understand changes, and contribute to timely interventions and adaptation of caregiving.
KiDS-450: tomographic cross-correlation of galaxy shear with Planck lensing
Harnois-Déraps, Joachim; Tröster, Tilman; Chisari, Nora Elisa; Heymans, Catherine; van Waerbeke, Ludovic; Asgari, Marika; Bilicki, Maciej; Choi, Ami; Erben, Thomas; Hildebrandt, Hendrik; Hoekstra, Henk; Joudaki, Shahab; Kuijken, Konrad; Merten, Julian; Miller, Lance; Robertson, Naomi; Schneider, Peter; Viola, Massimo
2017-10-01
We present the tomographic cross-correlation between galaxy lensing measured in the Kilo Degree Survey (KiDS-450) with overlapping lensing measurements of the cosmic microwave background (CMB), as detected by Planck 2015. We compare our joint probe measurement to the theoretical expectation for a flat Λ cold dark matter cosmology, assuming the best-fitting cosmological parameters from the KiDS-450 cosmic shear and Planck CMB analyses. We find that our results are consistent within 1σ with the KiDS-450 cosmology, with an amplitude re-scaling parameter AKiDS = 0.86 ± 0.19. Adopting a Planck cosmology, we find our results are consistent within 2σ, with APlanck = 0.68 ± 0.15. We show that the agreement is improved in both cases when the contamination to the signal by intrinsic galaxy alignments is accounted for, increasing A by ∼0.1. This is the first tomographic analysis of the galaxy lensing - CMB lensing cross-correlation signal, and is based on five photometric redshift bins. We use this measurement as an independent validation of the multiplicative shear calibration and of the calibrated source redshift distribution at high redshifts. We find that constraints on these two quantities are strongly correlated when obtained from this technique, which should therefore not be considered as a stand-alone competitive calibration tool.
Norm for last på konstruktioner DS410
DEFF Research Database (Denmark)
Hertz, Kristian
The fire chapter of the Danish Code of Practice for Loads for the Design of Structures DS410 contains definitions of basic concepts and principles of calculation and thermal fire load, and calculation methods for nominal fire courses and for parametric fire courses and modification for thermal in...
Benzoate-mediated changes on expression profile of soluble proteins in Serratia sp. DS001.
Pandeeti, E V P; Chinnaboina, M R; Siddavattam, D
2009-05-01
To assess differences in protein expression profile associated with shift in carbon source from succinate to benzoate in Serratia sp. DS001 using a proteomics approach. A basic proteome map was generated for the soluble proteins extracted from Serratia sp. DS001 grown in succinate and benzoate. The differently and differentially expressed proteins were identified using ImageMaster 2D Platinum software (GE Healthcare). The identity of the proteins was determined by employing MS or MS/MS. Important enzymes such as Catechol 1,2 dioxygenase and transcriptional regulators that belong to the LysR superfamily were identified. Nearly 70 proteins were found to be differentially expressed when benzoate was used as carbon source. Based on the protein identity and degradation products generated from benzoate it is found that ortho pathway is operational in Serratia sp. DS001. Expression profile of the soluble proteins associated with shift in carbon source was mapped. The study also elucidates degradation pathway of benzoate in Serratia sp. DS001 by correlating the proteomics data with the catabolites of benzoate.
BER analysis of DS-UWB system employing a laplace distribution model
Mehbodniya, Abolfazl
2011-01-01
This letter takes a new approach to extract a closed-form expression for the bit error rate (BER) of direct-sequence ultra wideband (DS-UWB) system. In the analysis, the main signal is impaired by multi-user interference (MUI) and an external source of interference originated by simultanously transmitting multiband orthogonal frequency division multiplexing (MB-OFDM) systems which are located in the vicinity of the DS-UWB receiver. All the transmission channels are affected by Nakagami-m fading. A Laplacian distribution is considered for MUI to comply more with real statistical behaviors of this kind of interference. © IEICE 2011.
Directory of Open Access Journals (Sweden)
Maria Jalbrzikowski
Full Text Available 22q11.2 Deletion Syndrome (22q11DS represents one of the greatest known genetic risk factors for the development of psychotic illness, and is also associated with high rates of autistic spectrum disorders (ASD in childhood. We performed integrated genomic analyses of 22q11DS to identify genes and pathways related to specific phenotypes.We used a high-resolution aCGH array to precisely characterize deletion breakpoints. Using peripheral blood, we examined differential expression (DE and networks of co-expressed genes related to phenotypic variation within 22q11DS patients. Whole-genome transcriptional profiling was performed using Illumina Human HT-12 microarrays. Data mining techniques were used to validate our results against independent samples of both peripheral blood and brain tissue from idiopathic psychosis and ASD cases.Eighty-five percent of 22q11DS individuals (N = 39 carried the typical 3 Mb deletion, with significant variability in deletion characteristics in the remainder of the sample (N = 7. DE analysis and weighted gene co-expression network analysis (WGCNA identified expression changes related to psychotic symptoms in patients, including a module of co-expressed genes which was associated with psychosis in 22q11DS and involved in pathways associated with transcriptional regulation. This module was enriched for brain-expressed genes, was not related to antipsychotic medication use, and significantly overlapped with transcriptional changes in idiopathic schizophrenia. In 22q11DS-ASD, both DE and WGCNA analyses implicated dysregulation of immune response pathways. The ASD-associated module showed significant overlap with genes previously associated with idiopathic ASD.These findings further support the use of peripheral tissue in the study of major mutational models of diseases affecting the brain, and point towards specific pathways dysregulated in 22q11DS carriers with psychosis and ASD.
Birth of an oceanic spreading center at a magma-poor rift system.
Gillard, Morgane; Sauter, Daniel; Tugend, Julie; Tomasi, Simon; Epin, Marie-Eva; Manatschal, Gianreto
2017-11-08
Oceanic crust is continuously created at mid-oceanic ridges and seafloor spreading represents one of the main processes of plate tectonics. However, if oceanic crust architecture, composition and formation at present-day oceanic ridges are largely described, the processes governing the birth of a spreading center remain enigmatic. Understanding the transition between inherited continental and new oceanic domains is a prerequisite to constrain one of the last major unsolved problems of plate tectonics, namely the formation of a stable divergent plate boundary. In this paper, we present newly released high-resolution seismic reflection profiles that image the complete transition from unambiguous continental to oceanic crusts in the Gulf of Guinea. Based on these high-resolution seismic sections we show that onset of oceanic seafloor spreading is associated with the formation of a hybrid crust in which thinned continental crust and/or exhumed mantle is sandwiched between magmatic intrusive and extrusive bodies. This crust results from a polyphase evolution showing a gradual transition from tectonic-driven to magmatic-driven processes. The results presented in this paper provide a characterization of the domain in which lithospheric breakup occurs and enable to define the processes controlling formation of a new plate boundary.
The translation research in a dental setting (TRiaDS programme protocol
Directory of Open Access Journals (Sweden)
McKee Lorna
2010-07-01
Full Text Available Abstract Background It is well documented that the translation of knowledge into clinical practice is a slow and haphazard process. This is no less true for dental healthcare than other types of healthcare. One common policy strategy to help promote knowledge translation is the production of clinical guidance, but it has been demonstrated that the simple publication of guidance is unlikely to optimise practice. Additional knowledge translation interventions have been shown to be effective, but effectiveness varies and much of this variation is unexplained. The need for researchers to move beyond single studies to develop a generalisable, theory based, knowledge translation framework has been identified. For dentistry in Scotland, the production of clinical guidance is the responsibility of the Scottish Dental Clinical Effectiveness Programme (SDCEP. TRiaDS (Translation Research in a Dental Setting is a multidisciplinary research collaboration, embedded within the SDCEP guidance development process, which aims to establish a practical evaluative framework for the translation of guidance and to conduct and evaluate a programme of integrated, multi-disciplinary research to enhance the science of knowledge translation. Methods Set in General Dental Practice the TRiaDS programmatic evaluation employs a standardised process using optimal methods and theory. For each SDCEP guidance document a diagnostic analysis is undertaken alongside the guidance development process. Information is gathered about current dental care activities. Key recommendations and their required behaviours are identified and prioritised. Stakeholder questionnaires and interviews are used to identify and elicit salient beliefs regarding potential barriers and enablers towards the key recommendations and behaviours. Where possible routinely collected data are used to measure compliance with the guidance and to inform decisions about whether a knowledge translation intervention is
Gravitational waves in hybrid quintessential inflationary models
International Nuclear Information System (INIS)
Sa, Paulo M; Henriques, Alfredo B
2011-01-01
The generation of primordial gravitational waves is investigated within the hybrid quintessential inflationary model. Using the method of continuous Bogoliubov coefficients, we calculate the full gravitational-wave energy spectrum. The post-inflationary kination period, characteristic of quintessential inflationary models, leaves a clear signature on the spectrum, namely, a sharp rise of the gravitational-wave spectral energy density Ω GW at high frequencies. For appropriate values of the parameters of the model, Ω GW can be as high as 10 -12 in the MHz-GHz range of frequencies.
Moraes, Alvaro
2016-01-06
Markovian pure jump processes can model many phenomena, e.g. chemical reactions at molecular level, protein transcription and translation, spread of epidemics diseases in small populations and in wireless communication networks among many others. In this work we present a novel hybrid algorithm for simulating individual trajectories which adaptively switches between the SSA and the Chernoff tauleap methods. This allows us to: (a) control the global exit probability of any simulated trajectory, (b) obtain accurate and computable estimates for the expected value of any smooth observable of the process with minimal computational work.
Moraes, Alvaro
2015-01-07
Markovian pure jump processes can model many phenomena, e.g. chemical reactions at molecular level, protein transcription and translation, spread of epidemics diseases in small populations and in wireless communication networks among many others. In this work we present a novel hybrid algorithm for simulating individual trajectories which adaptively switches between the SSA and the Chernoff tauleap methods. This allows us to: (a) control the global exit probability of any simulated trajectory, (b) obtain accurate and computable estimates for the expected value of any smooth observable of the process with minimal computational work.
Moraes, Alvaro
2014-01-06
Markovian pure jump processes can model many phenomena, e.g. chemical reactions at molecular level, protein transcription and translation, spread of epidemics diseases in small populations and in wireless communication networks among many others. In this work we present a novel hybrid algorithm for simulating individual trajectories which adaptively switches between the SSA and the Chernoff tauleap methods. This allows us to: (a) control the global exit probability of any simulated trajectory, (b) obtain accurate and computable estimates for the expected value of any smooth observable of the process with minimal computational work.
Directory of Open Access Journals (Sweden)
Shridhar Bale
2012-09-01
Full Text Available Filoviruses, including Marburg virus (MARV and Ebola virus (EBOV, cause fatal hemorrhagic fever in humans and non-human primates. All filoviruses encode a unique multi-functional protein termed VP35. The C-terminal double-stranded (dsRNA-binding domain (RBD of VP35 has been implicated in interferon antagonism and immune evasion. Crystal structures of the VP35 RBD from two ebolaviruses have previously demonstrated that the viral protein caps the ends of dsRNA. However, it is not yet understood how the expanses of dsRNA backbone, between the ends, are masked from immune surveillance during filovirus infection. Here, we report the crystal structure of MARV VP35 RBD bound to dsRNA. In the crystal structure, molecules of dsRNA stack end-to-end to form a pseudo-continuous oligonucleotide. This oligonucleotide is continuously and completely coated along its sugar-phosphate backbone by the MARV VP35 RBD. Analysis of dsRNA binding by dot-blot and isothermal titration calorimetry reveals that multiple copies of MARV VP35 RBD can indeed bind the dsRNA sugar-phosphate backbone in a cooperative manner in solution. Further, MARV VP35 RBD can also cap the ends of the dsRNA in solution, although this arrangement was not captured in crystals. Together, these studies suggest that MARV VP35 can both coat the backbone and cap the ends, and that for MARV, coating of the dsRNA backbone may be an essential mechanism by which dsRNA is masked from backbone-sensing immune surveillance molecules.
Search for the weak decays J/psi -> D-s(()*()-) e(+)nu(e) + c.c.
Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Chu, Y. P.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fu, C. D.; Gao, Q.; Gao, Y.; Garzia, I.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, T.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S; Han, Y. L.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Moeini, H.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Spruck, B.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.
2014-01-01
Using a sample of 2.25 x 10(8) J/psi events collected with the BESIII detector at the BEPCII collider, we search for the J/psi semileptonic weak decay J/psi -> D-s(-) e(+)nu(e) +c.c. with a much higher sensitivity than previous searches. We also perform the first search for J/psi -> D-s(*-) e(+)
Directory of Open Access Journals (Sweden)
Nassar Carl R
2004-01-01
Full Text Available We introduce a novel merger of direct sequence code division multiple access (DS-CDMA and smart antenna arrays. With regard to the DS-CDMA scheme, we employ carrier interferometry DS-CDMA (CI/DS-CDMA, a novel implementation of DS-CDMA where chips are decomposable into narrowband frequency components. With regard to the antenna array, we deploy the oscillating-beam smart array. Here, applying proper time-varying phases to the array elements, we create small movement (oscillation in the antenna array's pattern, while steering the antenna pattern main lobe to the position of the intended user. The oscillating antenna pattern creates a time-varying channel with a controllable coherence time. This, in turn, provides transmit diversity in the form of a time diversity gain at the mobile receiver side. At the receiver, three stages of combining are available: combining time components of the received signal within symbol duration (each experiencing a different fade to enhance performance via time diversity; combining frequency components which make up the CI/DS-CDMA chip to enhance the performance via frequency diversity; and combining across chips to eliminate the interfering users on the system. Merging CI/DS-CDMA with the oscillating-beam smart antenna at the base station, we achieve very high capacity via the merger of SDMA (available through directionality of the antenna array and code division multiple access (inherent in CI/DS-CDMA, and very high performance via the construction of receivers that exploit both transmit diversity and frequency diversity. We present the performance gains of the proposed merger.
Jammer Suppression in DS-CDMA Communications using Parafac-based Blind Separation
Directory of Open Access Journals (Sweden)
Xu Lingyun
2016-01-01
Full Text Available In this paper we propose to apply parafac-based source separation techniques for jammer suppression in direct spread spectrum communication systems. The jammer excision is formulated as an optimization problem and a new algorithm is presented which is based on the parafac tri-iterative least square algorithm. By jointly diagonalizing the time delay correlation matrix of the observed signals and using the new proposed method, a better solution is achieved. The proposed algorithm can successfully separate communication signals and jamming signals. Simulation results reveal that our proposed algorithm has the better blind signal separation performance than joint diagonalization method. Our proposed algorithm doesn’t require whitening processing. Moreover our proposed algorithm works well in the underdetermined condition, where the number of sources exceeds than the number of antennas.
Sequence Selection and Performance in DS/CDMA Systems
Directory of Open Access Journals (Sweden)
Jefferson Santos Ambrosio
2016-03-01
Full Text Available In this work key concepts on coding division multiple access (CDMA communication systems have been discussed. The sequence selection impact on the performance and capacity of direct sequence CDMA (DS/CDMA systems under AWGN and increasing system loading, as well as under multiple antennas channels was investigated.
Analysis of the DS86 atomic bomb radiation dosimetry methods using data on severe epilation
International Nuclear Information System (INIS)
Stram, D.O.; Mizuno, S.
1989-01-01
This report presents a reanalysis of the Hiroshima and Nagasaki data on severe epilation as an acute radiation effect using both the new DS86 and the old T65D dosimetries. The focus of the report is on several aspects of the data which have previously been examined by Jablon et al. The report examines the uniformity of epilation response across shielding category, across sex and age, and in terms of interactions between city, sex, age, and shielding category; it also investigates the apparent relative biological effectiveness (RBE) of neutrons in the DS86 dose compared with the T65D dose, using both within- and between-city information. In addition the report discusses evidence for nonlinearity in epilation response. The epilation response function exhibits nonlinearity in terms of both a marked increase in slope at about 0.75 Gy, and then, beginning at about 2.5 Gy, a leveling off and eventual decrease in response. The principal conclusions of the report are as follows. The use of the DS86 dosimetry rather than T65D increases the apparent RBE of neutrons compared with gamma dose from approximately 5 to 10. At these values of RBE the slope of the dose response, in a middle range from 0.75-2.5 Gy, is about 165% greater using DS86 than T65D. With respect to the interactions of sex, city, and shielding method, the size and significance of virtually all nonuniformities in epilation response seem using T65D are also evident with DS86. Additionally it seems difficult to find any evidence that DS86 is an improved predictor of epilation response over T65D. Finally, the fact that the nonlinearity in dose response and apparent actual downturn in epilation occurrence rate at the high end of dose is more striking with DS86 than with T65D is found to be due primarily to the common practice of truncating all T65D doses to 600 rad
The lightest hybrid meson supermultiplet in QCD
Energy Technology Data Exchange (ETDEWEB)
Dudek, Jozef J
2011-10-01
We interpret the spectrum of meson states recently obtained in non-perturbative lattice QCD calculations in terms of constituent quark-antiquark bound states and states, called 'hybrids', in which the q{bar q} pair is supplemented by an excitation of the gluonic field. We identify a lightest supermultiplet of hybrid mesons with J{sup PC} = (0,1,2){sup {-+}}, 1{sup -} built from a gluonic excitation of chromomagnetic character coupled to q{bar q} in an S-wave. The next lightest hybrids are suggested to be quark orbital excitations with the same gluonic excitation, while the next distinct gluonic excitation is significantly heavier. Existing models of gluonic excitations are compared to these findings and possible phenomenological consequences explored.
Uffmann, Madita; Rasche, Mareike; Zimmermann, Martin; von Neuhoff, Christine; Creutzig, Ursula; Dworzak, Michael; Scheffers, Lenie; Hasle, Henrik; Zwaan, C Michel; Reinhardt, Dirk; Klusmann, Jan-Henning
2017-06-22
Children with myeloid leukemia associated with Down syndrome (ML-DS) have superior outcome compared with non-DS patients, but suffer from higher constitutional cytotoxic drug susceptibility. We analyzed the outcome of 170 pediatric patients with ML-DS enrolled in the prospective, multicenter, open-label, nonrandomized ML-DS 2006 trial by Nordic Society for Pediatric Hematology and Oncology (NOPHO), Dutch Childhood Oncology Group (DCOG), and Acute Myeloid Leukemia-Berlin-Frankfurt-Münster (AML-BFM) study group. Compared with the historical control arm (reduced-intensity protocol for ML-DS patients from the AML-BFM 98 trial), treatment intensity was reduced by lowering the cumulative dose of etoposide (950 to 450 mg/m 2 ) and intrathecal central nervous system prophylaxis while omitting maintenance therapy. Still, 5-year overall survival (89% ± 3% vs 90% ± 4%; P log-rank = .64), event-free survival (EFS; 87% ± 3% vs 89% ± 4%; P log-rank = .71), and cumulative incidence of relapse/nonresponse (CIR/NR; 6% ± 3% vs 6% ± 2%; P Gray = .03) did not significantly differ between the ML-DS 2006 trial and the historical control arm. Poor early treatment response (5-year EFS, 58% ± 16% vs 88% ± 3%; P log rank = .0008) and gain of chromosome 8 (CIR/NR, 16% ± 7% vs 3% ± 2%, P Gray = .02; 5-year EFS, 73% ± 8% vs 91% ± 4%, P log rank = .018) were identified as independent prognostic factors predicting a worse EFS. Five of 7 relapsed patients (71%) with cytogenetic data had trisomy 8. Our study reveals prognostic markers for children with ML-DS and illustrates that reducing therapy did not impair excellent outcome. The trial was registered at EudraCT as #2007-006219-2. © 2017 by The American Society of Hematology.
Genomic and environmental selection patterns in two distinct lettuce crop-wild hybrid crosses
Hartman, Y.; Uwimana, B.; Hooftman, D.A.P.; Schranz, M.E.; Wiel, van de, C.C.M.; Smulders, M.J.M.; Visser, R.G.F.; Tienderen, van, P.H.
2013-01-01
Genomic selection patterns and hybrid performance influence the chance that crop (trans)genes can spread to wild relatives. We measured fitness(-related) traits in two different field environments employing two different crop?wild crosses of lettuce. We performed quantitative trait loci (QTL) analyses and estimated the fitness distribution of early- and late-generation hybrids. We detected consistent results across field sites and crosses for a fitness QTL at linkage group 7, where a selectiv...
Evading the Lyth bound in hybrid natural inflation
International Nuclear Information System (INIS)
Hebecker, A.; Kraus, S.C.; Westphal, Alexander
2013-05-01
Generically, the gravitational-wave or tensor-mode contribution to the primordial curvature spectrum of inflation is tiny if the field-range of the inflaton is much smaller than the Planck scale. We show that this pessimistic conclusion is naturally avoided in a rather broad class of small-field models. More specifically, we consider models where an axion-like shift symmetry keeps the inflaton potential flat (up to non-perturbative cosine-shaped modulations), but inflation nevertheless ends in a waterfall-regime, as is typical for hybrid inflation. In such hybrid natural inflation scenarios (examples are provided by Wilson line inflation and fluxbrane inflation), the slow-roll parameter ε can be sizable during an early period (relevant for the CMB spectrum). Subsequently, ε quickly becomes very small before the tachyonic instability eventually terminates the slow-roll regime. In this scenario, one naturally generates a considerable tensor-mode contribution in the curvature spectrum, collecting nevertheless the required amount of e-foldings during the final period of inflation. While non-observation of tensors by Planck is certainly not a problem, a discovery in the medium to long term future is realistic.
Evading the Lyth bound in hybrid natural inflation
Hebecker, A.; Kraus, S. C.; Westphal, A.
2013-12-01
Generically, the gravitational-wave or tensor-mode contribution to the primordial curvature spectrum of inflation is tiny if the field range of the inflaton is much smaller than the Planck scale. We show that this pessimistic conclusion is naturally avoided in a rather broad class of small-field models. More specifically, we consider models where an axionlike shift symmetry keeps the inflaton potential flat (up to nonperturbative cosine-shaped modulations), but inflation nevertheless ends in a waterfall regime, as is typical for hybrid inflation. In such hybrid natural inflation scenarios (examples are provided by Wilson line inflation and fluxbrane inflation), the slow-roll parameter ɛ can be sizable during an early period (relevant for the cosmic microwave background spectrum). Subsequently, ɛ quickly becomes very small before the tachyonic instability eventually terminates the slow-roll regime. In this scenario, one naturally generates a considerable tensor-mode contribution in the curvature spectrum, collecting nevertheless the required amount of e-foldings during the final period of inflation. While nonobservation of tensors by Planck is certainly not a problem, a discovery in the medium- to long-term future is realistic.
Evading the Lyth bound in hybrid natural inflation
Energy Technology Data Exchange (ETDEWEB)
Hebecker, A.; Kraus, S.C. [Heidelberg Univ. (Germany). Inst. fuer Theoretische Physik; Westphal, Alexander [Deutsches Elektronen-Synchrotron DESY, Hamburg (Germany). Theory Group
2013-05-15
Generically, the gravitational-wave or tensor-mode contribution to the primordial curvature spectrum of inflation is tiny if the field-range of the inflaton is much smaller than the Planck scale. We show that this pessimistic conclusion is naturally avoided in a rather broad class of small-field models. More specifically, we consider models where an axion-like shift symmetry keeps the inflaton potential flat (up to non-perturbative cosine-shaped modulations), but inflation nevertheless ends in a waterfall-regime, as is typical for hybrid inflation. In such hybrid natural inflation scenarios (examples are provided by Wilson line inflation and fluxbrane inflation), the slow-roll parameter {epsilon} can be sizable during an early period (relevant for the CMB spectrum). Subsequently, {epsilon} quickly becomes very small before the tachyonic instability eventually terminates the slow-roll regime. In this scenario, one naturally generates a considerable tensor-mode contribution in the curvature spectrum, collecting nevertheless the required amount of e-foldings during the final period of inflation. While non-observation of tensors by Planck is certainly not a problem, a discovery in the medium to long term future is realistic.
Kiiski, Hanni S. M.; Ní Riada, Sinéad; Lalor, Edmund C.; Gonçalves, Nuno R.; Nolan, Hugh; Whelan, Robert; Lonergan, Róisín; Kelly, Siobhán; O'Brien, Marie Claire; Kinsella, Katie; Bramham, Jessica; Burke, Teresa; Ó Donnchadha, Seán; Hutchinson, Michael; Tubridy, Niall; Reilly, Richard B.
2016-01-01
Conduction along the optic nerve is often slowed in multiple sclerosis (MS). This is typically assessed by measuring the latency of the P100 component of the Visual Evoked Potential (VEP) using electroencephalography. The Visual Evoked Spread Spectrum Analysis (VESPA) method, which involves modulating the contrast of a continuous visual stimulus over time, can produce a visually evoked response analogous to the P100 but with a higher signal-to-noise ratio and potentially higher sensitivity to individual differences in comparison to the VEP. The main objective of the study was to conduct a preliminary investigation into the utility of the VESPA method for probing and monitoring visual dysfunction in multiple sclerosis. The latencies and amplitudes of the P100-like VESPA component were compared between healthy controls and multiple sclerosis patients, and multiple sclerosis subgroups. The P100-like VESPA component activations were examined at baseline and over a 3-year period. The study included 43 multiple sclerosis patients (23 relapsing-remitting MS, 20 secondary-progressive MS) and 42 healthy controls who completed the VESPA at baseline. The follow-up sessions were conducted 12 months after baseline with 24 MS patients (15 relapsing-remitting MS, 9 secondary-progressive MS) and 23 controls, and again at 24 months post-baseline with 19 MS patients (13 relapsing-remitting MS, 6 secondary-progressive MS) and 14 controls. The results showed P100-like VESPA latencies to be delayed in multiple sclerosis compared to healthy controls over the 24-month period. Secondary-progressive MS patients had most pronounced delay in P100-like VESPA latency relative to relapsing-remitting MS and controls. There were no longitudinal P100-like VESPA response differences. These findings suggest that the VESPA method is a reproducible electrophysiological method that may have potential utility in the assessment of visual dysfunction in multiple sclerosis. PMID:26726800
Directory of Open Access Journals (Sweden)
Hanni S M Kiiski
Full Text Available Conduction along the optic nerve is often slowed in multiple sclerosis (MS. This is typically assessed by measuring the latency of the P100 component of the Visual Evoked Potential (VEP using electroencephalography. The Visual Evoked Spread Spectrum Analysis (VESPA method, which involves modulating the contrast of a continuous visual stimulus over time, can produce a visually evoked response analogous to the P100 but with a higher signal-to-noise ratio and potentially higher sensitivity to individual differences in comparison to the VEP. The main objective of the study was to conduct a preliminary investigation into the utility of the VESPA method for probing and monitoring visual dysfunction in multiple sclerosis. The latencies and amplitudes of the P100-like VESPA component were compared between healthy controls and multiple sclerosis patients, and multiple sclerosis subgroups. The P100-like VESPA component activations were examined at baseline and over a 3-year period. The study included 43 multiple sclerosis patients (23 relapsing-remitting MS, 20 secondary-progressive MS and 42 healthy controls who completed the VESPA at baseline. The follow-up sessions were conducted 12 months after baseline with 24 MS patients (15 relapsing-remitting MS, 9 secondary-progressive MS and 23 controls, and again at 24 months post-baseline with 19 MS patients (13 relapsing-remitting MS, 6 secondary-progressive MS and 14 controls. The results showed P100-like VESPA latencies to be delayed in multiple sclerosis compared to healthy controls over the 24-month period. Secondary-progressive MS patients had most pronounced delay in P100-like VESPA latency relative to relapsing-remitting MS and controls. There were no longitudinal P100-like VESPA response differences. These findings suggest that the VESPA method is a reproducible electrophysiological method that may have potential utility in the assessment of visual dysfunction in multiple sclerosis.
Hidding, E; Swaab, H; de Sonneville, L M J; van Engeland, H; Vorstman, J A S
2016-11-01
This paper examines how COMT 158 genotypes and plasma proline levels are associated with variable penetrance of social behavioural and social cognitive problems in 22q11.2 deletion syndrome (22q11DS). Severity of autistic spectrum symptoms of 45 participants with 22q11DS was assessed using the Autism Diagnostic Interview Revised. Face and facial emotion recognition was evaluated using standardized computer-based test-paradigms. Associations with COMT 158 genotypes and proline levels were examined. High proline levels and poor face recognition in individuals with the COMT MET allele, and poor facial emotion recognition, explained almost 50% of the variance in severity of autism symptomatology in individuals with 22q11DS. High proline levels and a decreased capacity to break down dopamine as a result of the COMT MET variant are both relevant in the expression of the social phenotype in patients. This epistatic interaction effect between the COMT 158 genotype and proline on the expression of social deficits in 22q11DS shows how factors other than the direct effects of the deletion itself can modulate the penetrance of associated cognitive and behavioural outcomes. These findings are not only relevant to our insight into 22q11DS, but also provide a model to better understand the phenomenon of variable penetrance in other pathogenic genetic variants. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Chu, Kuo-Chung; Huang, Yu-Shu; Tseng, Chien-Fu; Huang, Hsin-Jou; Wang, Chih-Huan; Tai, Hsin-Yi
2017-03-01
The purpose of this study is to examine the reliability of the clinical use of the self-built decision support system, diagnosis-supported attention deficit hyperactivity disorder (DS-ADHD), in an effort to develop the DS-ADHD system, by probing into the development of indicating patterns of past screening support systems for ADHD. The study collected data based on 107 subjects, who were divided into two groups, non-ADHD and ADHD, based on the doctor's determination, using the DSM-IV diagnostic standards. The two groups then underwent Test of Variables of Attention (TOVA) and DS-ADHD testing. The survey and testing results underwent one-way ANOVA and split-half method statistical analysis, in order to further understand whether there were any differences between the DS-ADHD and the identification tools used in today's clinical trials. The results of the study are as follows: 1) The ROC area between the TOVA and the clinical identification rate is 0.787 (95% confidence interval: 0.701-0.872); 2) The ROC area between the DS-ADHD and the clinical identification rate is 0.867 (95% confidence interval: 0.801-0.933). The study results show that DS-ADHD has the characteristics of screening for ADHD, based on its reliability and validity. It does not display any statistical differences when compared with TOVA systems that are currently on the market. However, the system is more effective and the accuracy rate is better than TOVA. It is a good tool to screen ADHD not only in Chinese children, but also in western country. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Simulations of Micro Gas Flows by the DS-BGK Method
Li, Jun
2011-01-01
For gas flows in micro devices, the molecular mean free path is of the same order as the characteristic scale making the Navier-Stokes equation invalid. Recently, some micro gas flows are simulated by the DS-BGK method, which is convergent to the BGK equation and very efficient for low-velocity cases. As the molecular reflection on the boundary is the dominant effect compared to the intermolecular collisions in micro gas flows, the more realistic boundary condition, namely the CLL reflection model, is employed in the DS-BGK simulation and the influence of the accommodation coefficients used in the molecular reflection model on the results are discussed. The simulation results are verified by comparison with those of the DSMC method as criteria. Copyright © 2011 by ASME.
Warner, G.; Howlin, P.; Salomone, E.; Moss, J.; Charman, T.
2017-01-01
Background: Recent research suggests that around 16% to 18% of children with Down syndrome (DS) also meet diagnostic criteria for autism spectrum disorder (ASD). However, there are indications that profiles of autism symptoms in this group may vary from those typically described in children with ASD. Method: Rates of autism symptoms and emotional…
Glueballs, hybrids, multiquarks
Energy Technology Data Exchange (ETDEWEB)
Klempt, Eberhard [Helmholtz-Institut fuer Strahlen-und Kernphysik der Rheinischen Friedrich-Wilhelms Universitaet, Nussallee 14-16, D-53115 Bonn (Germany)], E-mail: klempt@hiskp.uni-bonn.de; Zaitsev, Alexander [Institute for High-Energy Physics, Moscow Region, RU-142284 Protvino (Russian Federation)
2007-12-15
-channel resonances. Hybrids with non-exotic quantum numbers should appear as additional states. Light-quark mesons exhibit a spectrum of (squared) masses which are proportional to the sum of orbital angular momentum and radial quantum numbers. Two states do not fall under this classification. They are discussed as hybrid candidates. The concept of multiquark states has received revived interest due to new resonances in the spectrum of states with open and hidden charm. The new states are surprisingly narrow and their masses and their decay modes often do not agree with simple quark-model expectations. Lattice gauge theories have made strong claims that glueballs and hybrids should appear in the meson spectrum. However, the existence of a scalar glueball, at least with a reasonable width, is highly questionable. It is possible that hybrids will turn up in complex multibody final states even though so far, no convincing case has been made for them by experimental data. Lattice gauge theories fail to identify the nonet of scalar mesons. Thus, at the present status of approximations, lattice gauge theories seem not to provide a trustworthy guide into unknown territory in meson spectroscopy.
Gravitational waves in hybrid quintessential inflationary models
Energy Technology Data Exchange (ETDEWEB)
Sa, Paulo M [Departamento de Fisica, Faculdade de Ciencias e Tecnologia, Universidade do Algarve, Campus de Gambelas, 8005-139 Faro (Portugal); Henriques, Alfredo B, E-mail: pmsa@ualg.pt, E-mail: alfredo.henriques@ist.utl.pt [Centro Multidisciplinar de Astrofisica - CENTRA and Departamento de Fisica, Instituto Superior Tecnico, UTL, Av. Rovisco Pais, 1049-001 Lisboa (Portugal)
2011-09-22
The generation of primordial gravitational waves is investigated within the hybrid quintessential inflationary model. Using the method of continuous Bogoliubov coefficients, we calculate the full gravitational-wave energy spectrum. The post-inflationary kination period, characteristic of quintessential inflationary models, leaves a clear signature on the spectrum, namely, a sharp rise of the gravitational-wave spectral energy density {Omega}{sub GW} at high frequencies. For appropriate values of the parameters of the model, {Omega}{sub GW} can be as high as 10{sup -12} in the MHz-GHz range of frequencies.
Zhang, Neng-Li; Chao, David F.
2001-01-01
A new hybrid optical system, consisting of reflection-refracted shadowgraphy and top-view photography, is used to visualize flow phenomena and simultaneously measure the spreading and instant dynamic contact angle in a volatile-liquid drop on a nontransparent substrate. Thermocapillary convection in the drop, induced by evaporation, and the drop real-time profile data are synchronously recorded by video recording systems. Experimental results obtained from this unique technique clearly reveal that thermocapillary convection strongly affects the spreading process and the characteristics of dynamic contact angle of the drop. Comprehensive information of a sessile drop, including the local contact angle along the periphery, the instability of the three-phase contact line, and the deformation of the drop shape is obtained and analyzed.
Van Doorn, S.; Debray, T. P. A.; Kaasenbrood, F.; Hoes, A. W.; Rutten, F. H.; Moons, K. G. M.; Geersing, G. J.
2017-01-01
Essentials The widely recommended CHA2DS2-VASc shows conflicting results in contemporary validation studies. We performed a systematic review and meta-analysis of 19 studies validating CHA2DS2-VASc. There was high heterogeneity in stroke risks for different CHA2DS2-VASc scores. This was not
Stanić, Z; Girousi, S
2008-06-30
The interaction of copper(I) with double-stranded (ds) calf thymus DNA was studied in solution and at the electrode surface by means of transfer voltammetry using a carbon paste electrode (CPE) as working electrode in 0.2 M acetate buffer solution (pH 5.0). As a result of the interaction of Cu(I) between the base pairs of the dsDNA, the characteristic peaks of dsDNA, due to the oxidation of guanine and adenine, increased and after a certain concentration of Cu(I) a new peak at +1.37 V appeared, probably due to the formation of a purine-Cu(I) complex (dsDNA-Cu(I) complex). Accordingly, the interaction of copper(I) with calf thymus dsDNA was studied in solution as well as at the electrode surface using hanging mercury drop electrode (HMDE) by means of alternating current voltammetry (AC voltammetry) in 0.3 M NaCl and 50 mM sodium phosphate buffer (pH 8.5) as supporting electrolyte. Its interaction with DNA is shown to be time dependent. Significant changes in the characteristic peaks of dsDNA were observed after addition of higher concentration of Cu(I) to a solution containing dsDNA, as a result of the interaction between Cu(I) and dsDNA. All the experimental results indicate that Cu(I) can bind to DNA by electrostatic binding and form an association complex.
Complete genome sequence of Parvibaculum lavamentivorans type strain (DS-1(T)).
Schleheck, David; Weiss, Michael; Pitluck, Sam; Bruce, David; Land, Miriam L; Han, Shunsheng; Saunders, Elizabeth; Tapia, Roxanne; Detter, Chris; Brettin, Thomas; Han, James; Woyke, Tanja; Goodwin, Lynne; Pennacchio, Len; Nolan, Matt; Cook, Alasdair M; Kjelleberg, Staffan; Thomas, Torsten
2011-12-31
Parvibaculum lavamentivorans DS-1(T) is the type species of the novel genus Parvibaculum in the novel family Rhodobiaceae (formerly Phyllobacteriaceae) of the order Rhizobiales of Alphaproteobacteria. Strain DS-1(T) is a non-pigmented, aerobic, heterotrophic bacterium and represents the first tier member of environmentally important bacterial communities that catalyze the complete degradation of synthetic laundry surfactants. Here we describe the features of this organism, together with the complete genome sequence and annotation. The 3,914,745 bp long genome with its predicted 3,654 protein coding genes is the first completed genome sequence of the genus Parvibaculum, and the first genome sequence of a representative of the family Rhodobiaceae.
Commentary: PhDs in biochemistry education-5 years later.
Offerdahl, Erika G; Momsen, Jennifer L; Osgood, Marcy
2014-01-01
In this commentary, the discussion of PhDs in biochemistry education research is expanded to explore a number of diverse pathways leading to a competitive research program in biochemistry education research. © 2013 by The International Union of Biochemistry and Molecular Biology.
GLUT-1 DEFICIENCY: FROM PATHOPHYSILOGY AND GENETICS TO ABROAD CLINICAL SPECTRUM
Directory of Open Access Journals (Sweden)
Arsov Todor
2016-07-01
Full Text Available The classical GLUT-1 deficiency syndrome (GLUT-1 DS, De Vivo disease was described over 2 decades ago as a metabolic encephalopathy characterized by developmental delay, secondary microcephaly paroxysmal neurological symptoms (epilepsy and movement disorders. The biochemical parameters of this disease, used in diagnosis, are low levels of glucose in the cerebrospinal fluid, normal level of glucose in the blood and consequent low ratio of cerebrospinal fluid vs. blood glucose levels (<40-45%. So far, more than 200 cases of the classical GLUT-1 DS have been described in the literature. Genetic research demonstrated that this disease is caused by mutations in SLC2A1 gene coding for GLUT-1, a transporter of glucose across the blood brain barrier. Over the last few years the clinical spectrum of GLUT-1 deficiencywas expanded to include other rare diseases such as paroxysmal exertional dyskinesia and early-onset absence epilepsy, but also some more common diseases such as idiopathic generalised epilepsy (1-2%. GLUT-1 deficiency is an important pathophysiological basis of these diseases as early diagnosis (aided by DNA mutation testing and treatment (ketogenic diet could lead to improved disease outcomes.
First observation of the decays B̄(s)0→Ds+K -π+π- and B̄s0→D s1+π-
Aaij, R.; Abellan Beteta, C.; Adametz, A.; Adeva, B.; Adrover, C.; Affolder, A.; Ajaltouni, Z.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amhis, Y.; Anderlini, L.; Anderson, J.; Appleby, R. B.; Aquines Gutierrez, O.; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Bachmann, S.; Back, J. J.; Baesso, C.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Bates, A.; Bauer, Th; Bay, A.; Beddow, J.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Benayoun, M.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bettler, M. O.; Van Beuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Bizzeti, A.; Bjornstad, P. M.; Blake, T.; Blanc, F.; Blanks, C.; Blouw, J.; Blusk, S.; Bobrov, A.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Bowcock, T. J.V.; Bozzi, C.; Brambach, T.; Van Den Brand, J.; Bressieux, J.; Brett, D.; Britsch, M.; Britton, T.; Brook, N. H.; Brown, H.; Büchler-Germann, A.; Burducea, I.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Callot, O.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carranza-Mejia, H.; Carvalho Akiba, K.; Casse, G.; Cattaneo, M.; Cauet, Ch; Charles, M.; Charpentier, Ph; Chen, P.; Chiapolini, N.; Chrzaszcz, M.; Ciba, K.; Cid Vidal, X.; Ciezarek, G.; Clarke, P. E.L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coca, C.; Coco, V.; Cogan, J.; Cogneras, E.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Corti, G.; Couturier, B.; Cowan, G. A.; Craik, D.; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; David, P. N.Y.; De Bonis, I.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Simone, P.; Decamp, D.; Deckenhoff, M.; Degaudenzi, H.; Del Buono, L.; Deplano, C.; Derkach, D.; Deschamps, O.; Dettori, F.; Di Canto, A.; Dickens, J.; Diniz Batista, P.; Dogaru, M.; Domingo Bonal, F.; Donleavy, S.; Dordei, F.; Dosil Suárez, A.; Dossett, D.; Dovbnya, A.; Dupertuis, F.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Van Eijk, D.; Eisenhardt, S.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch; Elsby, D.; Falabella, A.; Färber, C.; Fardell, G.; Farinelli, C.; Farry, S.; Fave, V.; Fernandez Albor, V.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fitzpatrick, C.; Fontana, M.; Fontanelli, F.; Forty, R.; Francisco, O.; Frank, M.; Frei, C.; Frosini, M.; Furcas, S.; Gallas Torreira, A.; Galli, D.; Gandelman, M.; Gandini, P.; Gao, Y.; Garnier, J. C.; Garofoli, J.; Garosi, P.; Garra Tico, J.; Garrido, L.; Gaspar, C.; Gauld, R.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph; Gibson, V.; Gligorov, V. V.; Göbel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gordon, H.; Grabalosa Gándara, M.; Graciani Diaz, R.; Granado Cardoso, L. A.; Graugés, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Grünberg, O.; Gui, B.; Gushchin, E.; Guz, Yu; Gys, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hampson, T.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; Harrison, P. F.; Heijne, V.; Hennessy, K.; Henrard, P.; Hernando Morata, J. A.; Van Herwijnen, E.; Hicks, E.; Hill, D.; Hoballah, M.; Hopchev, P.; Hulsbergen, W.; Hunt, P.; Huse, T.; Hussain, N.; Hutchcroft, D.; Hynds, D.; Iakovenko, V.; Ilten, P.; Imong, J.; Jacobsson, R.; Jaeger, A.; Jahjah Hussein, M.; Jans, E.; Jaton, P.; Jean-Marie, B.; Jing, F.; John, M.; Jones, C. R.; Jost, B.; Kaballo, M.; Kandybei, S.; Karacson, M.; Karbach, T. M.; Kenyon, I. R.; Kerzel, U.; Ketel, T.; Keune, A.; Khanji, B.; Kochebina, O.; Komarov, V.; Koopman, R. F.; Koppenburg, P.; Korolev, M.; Kozlinskiy, A.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kucharczyk, M.; Kudryavtsev, V.; Kvaratskheliya, T.; La Thi, V. N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R. W.; Lanciotti, E.; Lanfranchi, G.; Langenbruch, C.; Latham, T.; Lazzeroni, C.; Le Gac, R.; Van Leerdam, J.; Lees, J. P.; Lefèvre, R.; Leflat, A.; Lefrançois, J.; Leroy, O.; Lesiak, T.; Li Gioi, L.; Liles, M.; Lindner, R.; Linn, C.; Von Loeben, J.; Lopes, J. H.; Lopez Asamar, E.; Lopez-March, N.; Lu, H.; Luisier, J.; Luo, H.; Mac Raighne, A.; MacHefert, F.; MacHikhiliyan, I. V.; MacIuc, F.; Maev, O.; Magnin, J.; Maino, M.; Malde, S.; Manca, G.; Mancinelli, G.; Mangiafave, N.; Marconi, U.; Märki, R.; Marks, J.; Martellotti, G.; Martin, L.; Martín Sánchez, A.; Martinelli, M.; Martinez Santos, D.; Martins Tostes, D.; Massafferri, A.; Matev, R.; Mathe, Z.; Matteuzzi, C.; Matveev, M.; Maurice, E.; Mazurov, A.; McCarthy, J.; McGregor, G.; McNulty, R.; Meissner, M.; Merk, M.; Merkel, J.; Milanes, D. A.; Minard, M. N.; Molina Rodriguez, J.; Monteil, S.; Moran, D.; Morawski, P.; Mountain, R.; Mous, I.; Muheim, F.; Müller, K.; Muresan, R.; Muryn, B.; Muster, B.; Mylroie-Smith, J.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Needham, M.; Neufeld, N.; Nguyen, A. D.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Nikitin, N.; Nikodem, T.; Nomerotski, A.; Novoselov, A.; Oblakowska-Mucha, A.; Obraztsov, V.; Oggero, S.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Orlandea, M.; Otalora Goicochea, J. M.; Owen, P.; Pal, B. K.; Palano, A.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Parkes, C.; Parkinson, C. J.; Passaleva, G.; Patel, G. D.; Patel, M.; Patrick, G. N.; Patrignani, C.; Pavel-Nicorescu, C.; Pazos Alvarez, A.; Pellegrino, A.; Penso, G.; Pepe Altarelli, M.; Perazzini, S.; Perego, D. L.; Perez Trigo, E.; Pérez-Calero Yzquierdo, A.; Perret, P.; Perrin-Terrin, M.; Pessina, G.; Petridis, K.; Petrolini, A.; Phan, A.; Picatoste Olloqui, E.; Pie Valls, B.; Pietrzyk, B.; Pilař, T.; Pinci, D.; Playfer, S.; Plo Casasus, M.; Polci, F.; Polok, G.; Poluektov, A.; Polycarpo, E.; Popov, D.; Popovici, B.; Potterat, C.; Powell, A.; Prisciandaro, J.; Pugatch, V.; Puig Navarro, A.; Qian, W.; Rademacker, J. H.; Rakotomiaramanana, B.; Rangel, M. S.; Raniuk, I.; Rauschmayr, N.; Raven, G.; Redford, S.; Reid, M. M.; Dos Reis, A. C.; Ricciardi, S.; Richards, A.; Rinnert, K.; Rives Molina, V.; Roa Romero, D. A.; Robbe, P.; Rodrigues, E.; Rodriguez Perez, P.; Rogers, G. J.; Roiser, S.; Romanovsky, V.; Romero Vidal, A.; Rouvinet, J.; Ruf, T.; Ruiz, H.; Sabatino, G.; Saborido Silva, J. J.; Sagidova, N.; Sail, P.; Saitta, B.; Salzmann, C.; Sanmartin Sedes, B.; Sannino, M.; Santacesaria, R.; Santamarina Rios, C.; Santinelli, R.; Santovetti, E.; Sapunov, M.; Satriano, C.; Satta, A.; Savrie, M.; Schaack, P.; Schiller, M.; Schindler, H.; Schleich, S.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M. H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Seco, M.; Semennikov, A.; Senderowska, K.; Sepp, I.; Serra, N.; Serrano, J.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shatalov, P.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, O.; Shevchenko, V.; Shires, A.; Silva Coutinho, R.; Skwarnicki, T.; Smith, N. A.; Smith, M.; Soler, F. J.P.; Soomro, F.; Souza, D.; Souza De Paula, B.; Spaan, B.; Sparkes, A.; Spradlin, P.; Stagni, F.; Stahl, S.; Steinkamp, O.; Stoica, S.; Stone, S.; Storaci, B.; Straticiuc, M.; Straumann, U.; Subbiah, V. K.; Swientek, S.; Szczekowski, M.; Szczypka, P.; Szumlak, T.; T'Jampens, S.; Teklishyn, M.; Teodorescu, E.; Teubert, F.; Thomas, C.; Van Tilburg, J.; Tisserand, V.; Tobin, M.; Tolk, S.; Tonelli, D.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tourneur, S.; Tran, M. T.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Ubeda Garcia, M.; Ukleja, A.; Urner, D.; Uwer, U.; Vagnoni, V.; Valenti, G.; Vazquez Gomez, R.; Vazquez Regueiro, P.; Vecchi, S.; Velthuis, J. J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Viaud, B.; Videau, I.; Vieira, D.; Vilasis-Cardona, X.; Visniakov, J.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voß, C.; Waldi, R.; Wallace, R.; Wandernoth, S.; Ward, D. R.; Watson, N. K.; Webber, A. D.; Websdale, D.; Whitehead, M.; Wicht, J.; Wiedner, D.; Wilkinson, G.; Williams, M. P.; Williams, M.; Wilson, F. F.; Wishahi, J.; Witek, M.; Witzeling, W.; Wotton, S. A.; Wright, S.; Wyllie, K.; Xie, Y.; Xing, F.; Xing, Z.; Yang, Z.; Young, R.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhang, F.; Zhang, W. C.; Zhelezov, A.; Zhong, L.; Zvyagin, A.
2012-01-01
The first observation of the decays B̄s0→Ds+K -π+π- and B̄0→ Ds+K-π+π- are reported using an integrated luminosity of 1.0 fb-1 recorded by the LHCb experiment. The branching fractions, normalized with respect to B̄s0→Ds+π -π+π- and B̄s0→Ds+K -π+π-, respectively, are measured to be B(B̄s0→Ds+K-π+π-)
Review of Optimization Strategies for System-Level Design in Hybrid Electric Vehicles
Silvas, E.; Hofman, T.; Murgovski, N.; Etman, L.F.P.; Steinbuch, M.
2017-01-01
The optimal design of a hybrid electric vehicle (HEV) can be formulated as a multiobjective optimization problem that spreads over multiple levels (technology, topology, size, and control). In the last decade, studies have shown that by integrating these optimization levels, fuel benefits are
Tumor and Endothelial Cell Hybrids Participate in Glioblastoma Vasculature
Directory of Open Access Journals (Sweden)
Soufiane El Hallani
2014-01-01
Full Text Available Background. Recently antiangiogenic therapy with bevacizumab has shown a high but transient efficacy in glioblastoma (GBM. Indeed, GBM is one of the most angiogenic human tumors and endothelial proliferation is a hallmark of the disease. We therefore hypothesized that tumor cells may participate in endothelial proliferation of GBM. Materials and Methods. We used EGFR FISH Probe to detect EGFR amplification and anti-CD31, CD105, VE-cadherin, and vWF to identify endothelial cells. Endothelial and GBM cells were grown separately, labeled with GFP and DsRed lentiviruses, and then cocultured with or without contact. Results. In a subset of GBM tissues, we found that several tumor endothelial cells carry EGFR amplification, characteristic of GBM tumor cells. This observation was reproduced in vitro: when tumor stem cells derived from GBM were grown in the presence of human endothelial cells, a fraction of them acquired endothelial markers (CD31, CD105, VE-cadherin, and vWF. By transduction with GFP and DsRed expressing lentiviral vectors, we demonstrate that this phenomenon is due to cell fusion and not transdifferentiation. Conclusion. A fraction of GBM stem cells thus has the capacity to fuse with endothelial cells and the resulting hybrids may participate in tumor microvascular proliferation and in treatment resistance.
Roles of the spreading scope and effectiveness in spreading dynamics on multiplex networks
Li, Ming; Liu, Run-Ran; Peng, Dan; Jia, Chun-Xiao; Wang, Bing-Hong
2018-02-01
Comparing with single networks, the multiplex networks bring two main effects on the spreading process among individuals. First, the pathogen or information can be transmitted to more individuals through different layers at one time, which enlarges the spreading scope. Second, through different layers, an individual can also transmit the pathogen or information to the same individuals more than once at one time, which makes the spreading more effective. To understand the different roles of the spreading scope and effectiveness, we propose an epidemic model on multiplex networks with link overlapping, where the spreading effectiveness of each interaction as well as the variety of channels (spreading scope) can be controlled by the number of overlapping links. We find that for Poisson degree distribution, increasing the epidemic scope (the first effect) is more efficient than enhancing epidemic probability (the second effect) to facilitate the spreading process. However, for power-law degree distribution, the effects of the two factors on the spreading dynamics become complicated. Enhancing epidemic probability makes pathogen or rumor easier to outbreak in a finite system. But after that increasing epidemic scopes is still more effective for a wide spreading. Theoretical results along with reasonable explanation for these phenomena are all given in this paper, which indicates that the epidemic scope could play an important role in the spreading dynamics.
Energy Technology Data Exchange (ETDEWEB)
Wood, Byard; Kim, Kwang
2006-03-30
This RD&D project is a multi-institutional effort to develop a hybrid solar lighting (HSL) system that transports daylight from a paraboloidal dish concentrator to a luminaire via a bundle of polymer fiber optics. The luminaire can be a device to distribute sunlight into a space for the production of algae for CO{sub 2} sequestration or it can be a device that is a combination of daylighting and electric lighting for space/task lighting. In this project, the sunlight is collected using a one-meter paraboloidal concentrator dish with two-axis tracking. For the third generation (beta) system, the secondary mirror is an ellipsoidal mirror that directs the visible light into a bundle of 3 mm diameter fibers. The IR spectrum is filtered out to minimize unnecessary heating at the fiber entrance region. This report describes the major achievements from this research that began in August 2001.
International Nuclear Information System (INIS)
Zhao, Dongxing; Wu, Jiarui; Gu, Ying; Gong, Qihuang
2014-01-01
We propose tailoring of the double Fano profiles via plasmon-assisted quantum interference in a hybrid exciton-plasmon system. Tailoring is performed by the interference between two exciton channels interacting with a common localized surface plasmon. Using an applied field of low intensity, the absorption spectrum of the hybrid system reveals a double Fano lineshape with four peaks. For relatively large field intensity, a broad flat window in the absorption spectrum appears which results from the destructive interference between excitons. Because of strong constructive interference, this window vanishes as intensity is further increased. We have designed a nanometer bandpass optical filter for visible light based on tailoring of the optical spectrum. This study provides a platform for quantum interference that may have potential applications in ultracompact tunable quantum devices.
Directory of Open Access Journals (Sweden)
Santiago Urrestarazu Vincent
2017-10-01
Full Text Available Although Sustainable Drainage Systems (SuDS are used in cities across the world as effective flood adaptation responses, their economic viability has frequently been questioned. Inclusion of the monetary value of ecosystem services (ES provided by SuDS can increase the rate of return on investments made. Hence, this paper aims at reviewing the enhancement of the economic value of large-scale investments in SuDS through inclusion of ecosystem services. This study focuses on the flood reduction capacity and the ES benefits of green roofs and rain barrels in the combined sewerage network of Montevideo Municipality in Uruguay. The methodology comprises a cost–benefit analysis—with and without monetised ES provided by SuDS—of two drainage network configurations comprising: (i SuDS; and (ii SuDS and detention storage. The optimal drainage design for both these drainage configurations have been determined using SWMM-EA, a tool which uses multi-objective optimisation based evolutionary algorithm (EA and the storm water management model (SWMM. In both design configurations, total benefits comprising both flood reduction and ES benefits are always higher than their costs. The use of storage along with SuDS provides greater benefits with a larger reduction in flooding, and thus is more cost-effective than using SuDS alone. The results show that, for both of the drainage configurations, the larger investments are not beneficial unless ES benefits are taken into account. Hence, it can be concluded that the inclusion of ES benefits is necessary to justify large-scale investments in SuDS.
Hybrid device based on GaN nanoneedles and MEH-PPV/PEDOT:PSS polymer
International Nuclear Information System (INIS)
Shin, Min Jeong; Gwon, Dong-Oh; Lee, Chan-Mi; Lee, Gang Seok; Jeon, In-Jun; Ahn, Hyung Soo; Yi, Sam Nyung; Ha, Dong Han
2015-01-01
Highlights: • A hybrid device was demonstrated by using MEH-PPV, PEDOT:PSS, and GaN nanoneedles. • I–V curve of the hybrid device showed its rectification behaviour, similar to a diode. • EL peak originated by the different potential barriers at MEH-PPV and GaN interface. - Abstract: A hybrid device that combines the properties of organic and inorganic semiconductors was fabricated and studied. It incorporated poly[2-methoxy-5-(2-ethylhexyloxy)- 1,4-phenylenevinylene] (MEH-PPV) and poly(3,4-ethylenedioxythiophene):poly(styrenesulfonate) (PEDOT:PSS) as organic polymers and GaN nanoneedles as an inorganic semiconductor. Layers of the two polymers were spin coated on to the GaN nanoneedles. The one peak in the electroluminescence spectrum originated from the MEH-PPV layer owing to the different potential barriers of electrons and holes at its interface with the GaN nanoneedles. However, the photoluminescence spectrum showed peaks due to both GaN nanoneedles and MEH-PPV. Such hybrid structures, suitably developed, might be able to improve the efficiency of optoelectronic devices
Hybrid device based on GaN nanoneedles and MEH-PPV/PEDOT:PSS polymer
Energy Technology Data Exchange (ETDEWEB)
Shin, Min Jeong; Gwon, Dong-Oh; Lee, Chan-Mi; Lee, Gang Seok [Department of Applied Science, Korea Maritime and Ocean University, Busan 606-791 (Korea, Republic of); Jeon, In-Jun [Department of Nano-semiconductor Engineering, Korea Maritime and Ocean University, Busan 606-791 (Korea, Republic of); Ahn, Hyung Soo [Department of Applied Science, Korea Maritime and Ocean University, Busan 606-791 (Korea, Republic of); Department of Nano-semiconductor Engineering, Korea Maritime and Ocean University, Busan 606-791 (Korea, Republic of); Yi, Sam Nyung, E-mail: snyi@kmou.ac.kr [Department of Applied Science, Korea Maritime and Ocean University, Busan 606-791 (Korea, Republic of); Department of Nano-semiconductor Engineering, Korea Maritime and Ocean University, Busan 606-791 (Korea, Republic of); Ha, Dong Han [Division of Convergence Technology, Korea Research Institute of Standards and Science, Daejeon 305-340 (Korea, Republic of)
2015-08-15
Highlights: • A hybrid device was demonstrated by using MEH-PPV, PEDOT:PSS, and GaN nanoneedles. • I–V curve of the hybrid device showed its rectification behaviour, similar to a diode. • EL peak originated by the different potential barriers at MEH-PPV and GaN interface. - Abstract: A hybrid device that combines the properties of organic and inorganic semiconductors was fabricated and studied. It incorporated poly[2-methoxy-5-(2-ethylhexyloxy)- 1,4-phenylenevinylene] (MEH-PPV) and poly(3,4-ethylenedioxythiophene):poly(styrenesulfonate) (PEDOT:PSS) as organic polymers and GaN nanoneedles as an inorganic semiconductor. Layers of the two polymers were spin coated on to the GaN nanoneedles. The one peak in the electroluminescence spectrum originated from the MEH-PPV layer owing to the different potential barriers of electrons and holes at its interface with the GaN nanoneedles. However, the photoluminescence spectrum showed peaks due to both GaN nanoneedles and MEH-PPV. Such hybrid structures, suitably developed, might be able to improve the efficiency of optoelectronic devices.
Noncytotoxic orange and red/green derivatives of DsRed-Express2 for whole-cell labeling
Directory of Open Access Journals (Sweden)
Glick Benjamin S
2009-04-01
Full Text Available Abstract Background Whole-cell labeling is a common application of fluorescent proteins (FPs, but many red and orange FPs exhibit cytotoxicity that limits their use as whole-cell labels. Recently, a tetrameric red FP called DsRed-Express2 was engineered for enhanced solubility and was shown to be noncytotoxic in bacterial and mammalian cells. Our goal was to create derivatives of this protein with different spectral properties. Results Building on previous studies of DsRed mutants, we created two DsRed-Express2 derivatives: E2-Orange, an orange FP, and E2-Red/Green, a dual-color FP with both red and green emission. We show that these new FPs retain the low cytotoxicity of DsRed-Express2. In addition, we show that these new FPs are useful as second or third colors for flow cytometry and fluorescence microscopy. Conclusion E2-Orange and E2-Red/Green will facilitate the production of healthy, stably fluorescent cell lines and transgenic organisms for multi-color labeling studies.
Measuring dental fear using the CFSS-DS. Do children and parents agree?
Krikken, Janneke B; van Wijk, Arjen J; ten Cate, Jacob M; Veerkamp, Jaap S J
2013-03-01
In most studies, the parental version of the CFSS-DS is used; however, no information is available concerning the extent to which parents are able to report dental fear on behalf of their children. This study aims to assess whether parents are accurate reporters of their child's dental fear. The CFSS-DS was filled out by 326 children in a classroom setting and by 167 parents (mostly mothers) at home on behalf of their child. Intraclass correlation coefficients were used as a measure of agreement between both CFSS-DS versions, and reasons for nonagreement were assessed. Mean CFSS-DS for children was 21.15 (SD = 6.4) and for parents 23.26 (SD = 6.7). The intraclass correlation coefficient was 0.57. After selection of the 73.1% most accurate reporting parents, the ICC was 0.90. In general, parents estimate the dental fear of their children higher than their children do (P ≤ 0.001), whereas parents of high anxious children (HAC) estimate this fear lower, and parents of low anxious children (LAC) estimate this fear higher. Anxious parents (AP) estimate the dental fear of their children significantly higher than nonanxious parents (NAP) (P ≤ 0.001), but the children of AP do not estimate their own dental fear higher than children of NAP. In general, parents tend to estimate the dental fear of their children slightly higher than their children. © 2012 The Authors. International Journal of Paediatric Dentistry © 2012 BSPD, IAPD and Blackwell Publishing Ltd.
SuDS for managing surface water in Diepsloot informal settlement ...
African Journals Online (AJOL)
2017-04-02
Apr 2, 2017 ... ... of intervention. Keywords: SuDS, action research, water quality, informal settlements, Diepsloot ..... principles, solutions were explored that were a fusion of these ... was thought that the leachates from the landfill and surface.
Review of optimization strategies for system-level design in hybrid electric vehicles
Silvas, E.; Hofman, T.; Murgovski, N.; Etman, P.; Steinbuch, M.
2017-01-01
The optimal design of a hybrid electric vehicle can be formulated as a multi-objective optimization problem that spreads over multiple levels (technology, topology, size and control). In the last decade, studies have shown that, by integrating these optimization levels fuel benefits are obtained,
Mechanochemical synthesis of dodecyl sulfate anion (DS-) intercalated Cu-Al layered double hydroxide
Qu, Jun; He, Xiaoman; Lei, Zhiwu; Zhang, Qiwu; Liu, Xinzhong
2017-12-01
Dodecyl sulfate anion (DS-) was successfully intercalated into the gallery space of Cu-Al layered double hydroxides (LDH) by a non-heating mechanochemical route, in which basic cupric carbonate (Cu2(OH)2CO3) and aluminum hydroxide (Al(OH)3) were first dry ground and then agitated in SDS solution under ambient environment. The organics modified Cu-Al LDH showed good adsorption ability toward 2,4-dichlorophenoxyacetic acid (2, 4-D). The prepared samples were characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), CHS elemental analysis and Scanning electron microscopy (SEM). The LDH precursor prepared by ball-milling could directly react with SDS molecules forming a pure phase of DS- pillared Cu-Al LDH, which was not observed with the LDH product through the ion-exchange of DS- at room temperature. The process introduced here may be applied to manufacture other types of organic modified composites for pollutants removal and other applications.
International Nuclear Information System (INIS)
2004-01-01
Diffusion of technology, environmental effects and rebound effects are the principal effects from the funding of renewable energy and energy economising. It is difficult to estimate the impact of the spread effects both prior to the measures are implemented and after the measures are carried out. Statistical methods can be used to estimate the spread effects, but they are insecure and always need to be complemented with qualitative and subjective evaluations. It is more adequate to evaluate potential spread effects from market and market data surveillance for a selection of technologies and parties. Based on this information qualitative indicators for spread effects can be constructed and used both ex ante and ex post (ml)
Spectrum-to-Spectrum Searching Using a Proteome-wide Spectral Library*
Yen, Chia-Yu; Houel, Stephane; Ahn, Natalie G.; Old, William M.
2011-01-01
The unambiguous assignment of tandem mass spectra (MS/MS) to peptide sequences remains a key unsolved problem in proteomics. Spectral library search strategies have emerged as a promising alternative for peptide identification, in which MS/MS spectra are directly compared against a reference library of confidently assigned spectra. Two problems relate to library size. First, reference spectral libraries are limited to rediscovery of previously identified peptides and are not applicable to new peptides, because of their incomplete coverage of the human proteome. Second, problems arise when searching a spectral library the size of the entire human proteome. We observed that traditional dot product scoring methods do not scale well with spectral library size, showing reduction in sensitivity when library size is increased. We show that this problem can be addressed by optimizing scoring metrics for spectrum-to-spectrum searches with large spectral libraries. MS/MS spectra for the 1.3 million predicted tryptic peptides in the human proteome are simulated using a kinetic fragmentation model (MassAnalyzer version2.1) to create a proteome-wide simulated spectral library. Searches of the simulated library increase MS/MS assignments by 24% compared with Mascot, when using probabilistic and rank based scoring methods. The proteome-wide coverage of the simulated library leads to 11% increase in unique peptide assignments, compared with parallel searches of a reference spectral library. Further improvement is attained when reference spectra and simulated spectra are combined into a hybrid spectral library, yielding 52% increased MS/MS assignments compared with Mascot searches. Our study demonstrates the advantages of using probabilistic and rank based scores to improve performance of spectrum-to-spectrum search strategies. PMID:21532008
LED Current Balance Using a Variable Voltage Regulator with Low Dropout vDS Control
Directory of Open Access Journals (Sweden)
Hung-I Hsieh
2017-02-01
Full Text Available A cost-effective light-emitting diode (LED current balance strategy using a variable voltage regulator (VVR with low dropout vDS control is proposed. This can regulate the multiple metal-oxide-semiconductor field-effect transistors (MOSFETs of the linear current regulators (LCR, maintaining low dropout vDS on the flat vGS-characteristic curves and making all drain currents almost the same. Simple group LCRs respectively loaded with a string LED are employed to implement the theme. The voltage VVdc from a VVR is synthesized by a string LED voltage NvD, source voltage vR, and a specified low dropout vDS = VQ. The VVdc updates instantly, through the control loop of the master LCR, which means that all slave MOSFETs have almost the same biases on their flat vGS-characteristic curves. This leads to all of the string LED currents being equal to each other, producing an almost even luminance. An experimental setup with microchip control is built to verify the estimations. Experimental results show that the luminance of all of the string LEDs are almost equal to one another, with a maximum deviation below 1% during a wide dimming range, while keeping all vDS of the MOSFETs at a low dropout voltage, as expected.
Multilevel Hybrid Chernoff Tau-Leap
Moraes, Alvaro
2016-01-06
Markovian pure jump processes can model many phenomena, e.g. chemical reactions at molecular level, protein transcription and translation, spread of epidemics diseases in small populations and in wireless communication networks, among many others. In this work [6] we present a novel multilevel algorithm for the Chernoff-based hybrid tauleap algorithm. This variance reduction technique allows us to: (a) control the global exit probability of any simulated trajectory, (b) obtain accurate and computable estimates for the expected value of any smooth observable of the process with minimal computational work.
Multilevel Hybrid Chernoff Tau-Leap
Moraes, Alvaro
2015-01-07
Markovian pure jump processes can model many phenomena, e.g. chemical reactions at molecular level, protein transcription and translation, spread of epidemics diseases in small populations and in wireless communication networks, among many others. In this work [6] we present a novel multilevel algorithm for the Chernoff-based hybrid tauleap algorithm. This variance reduction technique allows us to: (a) control the global exit probability of any simulated trajectory, (b) obtain accurate and computable estimates for the expected value of any smooth observable of the process with minimal computational work.
Multilevel Hybrid Chernoff Tau-Leap
Moraes, Alvaro
2014-01-06
Markovian pure jump processes can model many phenomena, e.g. chemical reactions at molecular level, protein transcription and translation, spread of epidemics diseases in small populations and in wireless communication networks, among many others. In this work [6] we present a novel multilevel algorithm for the Chernoff-based hybrid tauleap algorithm. This variance reduction technique allows us to: (a) control the global exit probability of any simulated trajectory, (b) obtain accurate and computable estimates for the expected value of any smooth observable of the process with minimal computational work.
EURISOL-DS Multi-MW Target: A safe way to run the CGS converter
Cyril Kharoua, Yacine Kadi, Karel Samec (CERN)
This technical note summarizes the design calculations performed within Task#2 of the European Isotope Separation On-Line Radioactive Ion Beam Facility Design Study (EURISOL-DS) on the safety hull of the CGS design of the mercury converter. A study was carried out in order to propose a configuration for the safety hull and the connection between the target and the accelerator. The results of these calculations show a layout and a design proposal for the safety barrier of the EURISOL DS target design.
ON THE ESTIMATION OF RANDOM UNCERTAINTIES OF STAR FORMATION HISTORIES
Energy Technology Data Exchange (ETDEWEB)
Dolphin, Andrew E., E-mail: adolphin@raytheon.com [Raytheon Company, Tucson, AZ, 85734 (United States)
2013-09-20
The standard technique for measurement of random uncertainties of star formation histories (SFHs) is the bootstrap Monte Carlo, in which the color-magnitude diagram (CMD) is repeatedly resampled. The variation in SFHs measured from the resampled CMDs is assumed to represent the random uncertainty in the SFH measured from the original data. However, this technique systematically and significantly underestimates the uncertainties for times in which the measured star formation rate is low or zero, leading to overly (and incorrectly) high confidence in that measurement. This study proposes an alternative technique, the Markov Chain Monte Carlo (MCMC), which samples the probability distribution of the parameters used in the original solution to directly estimate confidence intervals. While the most commonly used MCMC algorithms are incapable of adequately sampling a probability distribution that can involve thousands of highly correlated dimensions, the Hybrid Monte Carlo algorithm is shown to be extremely effective and efficient for this particular task. Several implementation details, such as the handling of implicit priors created by parameterization of the SFH, are discussed in detail.
ON THE ESTIMATION OF RANDOM UNCERTAINTIES OF STAR FORMATION HISTORIES
International Nuclear Information System (INIS)
Dolphin, Andrew E.
2013-01-01
The standard technique for measurement of random uncertainties of star formation histories (SFHs) is the bootstrap Monte Carlo, in which the color-magnitude diagram (CMD) is repeatedly resampled. The variation in SFHs measured from the resampled CMDs is assumed to represent the random uncertainty in the SFH measured from the original data. However, this technique systematically and significantly underestimates the uncertainties for times in which the measured star formation rate is low or zero, leading to overly (and incorrectly) high confidence in that measurement. This study proposes an alternative technique, the Markov Chain Monte Carlo (MCMC), which samples the probability distribution of the parameters used in the original solution to directly estimate confidence intervals. While the most commonly used MCMC algorithms are incapable of adequately sampling a probability distribution that can involve thousands of highly correlated dimensions, the Hybrid Monte Carlo algorithm is shown to be extremely effective and efficient for this particular task. Several implementation details, such as the handling of implicit priors created by parameterization of the SFH, are discussed in detail
Neutronics study on hybrid reactor cooled by helium, water and molten salt
International Nuclear Information System (INIS)
Li Zaixin; Feng Kaiming; Zhang Guoshu; Zheng Guoyao; Zhao Fengchao
2009-01-01
There is no serious magnetohydrodynamics (MHD) problem when helium,water or molten salt of Flibe flows in high magnetic field. Thus helium, water and Flibe were proposed as candidate of coolant for fusion-fission hybrid reactor based on magnetic confinement. The effect on neutronics of hybrid reactor due to coolant was investigated. The analyses of neutron spectra and fuel breeding of blanket with different coolants were performed. Variations of tritium breeding ratio (TBR), blanket energy multiplication (M) and keff with operating time were also studied. MCNP code was used for neutron transport simulation. It is shown that spectra change greatly with different coolants. The blanket with helium exhibits very hard spectrum and good tritium breeding ability. And fission reactions are mainly from fast neutron. The blanket with water has soft spectrum and high energy multiplication factor. However, it needs to improve TBR. The blanket with Flibe has hard spectrum and less energy release. (authors)
Genomic and environmental selection patterns in two distinct lettuce crop-wild hybrid crosses
Hartman, Y.; Uwimana, B; Hooftman, D.A.P.; Schranz, M.E.; van de Wiel, C.C.M.; Smulders, M.J.M.; Visser, R.G.F.; van Tienderen, P.H.
2013-01-01
Genomic selection patterns and hybrid performance influence the chance that crop (trans)genes can spread to wild relatives. We measured fitness(-related) traits in two different field environments employing two different crop-wild crosses of lettuce. We performed quantitative trait loci (QTL)
Genomic and environmental selection patterns in two distinct lettuce crop-wild hybrid crosses
Hartman, Y.; Uwimana, B.; Hooftman, D.A.P.; Schranz, M.E.; Wiel, van de C.C.M.; Smulders, M.J.M.; Visser, R.G.F.; Tienderen, van P.H.
2013-01-01
Genomic selection patterns and hybrid performance influence the chance that crop (trans)genes can spread to wild relatives. We measured fitness(-related) traits in two different field environments employing two different crop–wild crosses of lettuce. We performed quantitative trait loci (QTL)
Production and application of long dsRNA in mammalian cells
Czech Academy of Sciences Publication Activity Database
Chalupníková, Kateřina; Nejepínská, Jana; Svoboda, Petr
2013-01-01
Roč. 942, 20.2.2013 (2013), s. 291-314 ISSN 1940-6029 Institutional support: RVO:68378050 Keywords : dsRNA * RNAi * IFN response * transgenic RNAi * OAS (2′5′-oligoadenylate synthetase) Subject RIV: EB - Genetics ; Molecular Biology
Structural properties of maize hybrids established by infrared spectra
Directory of Open Access Journals (Sweden)
Radenović Čedomir N.
2015-01-01
Full Text Available This paper discusses the application of the infrared (IR spectroscopy method for determination of structural properties of maize hybrid grains. The IR spectrum of maize grain has been registered in the following hybrids: ZP 341, ZP 434 and ZP 505. The existence of spectral bands varying in both number and intensity, as well as their shape, frequency and kinetics have been determined. They have been determined by valence oscillations and deformation oscillations of the following organic compounds: alkanes, alkenes, alkynes, amides, alcohols, ethers, carboxylic acids, esters and aldehydes and ketones, characteristic for biogenic compounds such as carbohydrates, proteins and lipids. In this way, possible changes in the grain structure of observed maize hybrids could be detected.
Alugo, T; Malone, H; Sheehan, A; Coyne, I; Lawlor, A; McNicholas, F
2017-07-01
22q11.2 deletion syndrome (22q11DS) is a multisystem genetic condition with a broad phenotype. It is associated with a high prevalence of depression and anxiety during childhood and increased risk of schizophrenia in adulthood. Despite this, studies report that families may receive inadequate information of mental health (MH) risks at diagnosis. Therefore, this study investigated parents' experiences of caring for a child with 22q11DS, investigated their knowledge regarding the risk of MH problems and assessed the need for a psycho-educational programme. A qualitative design and purposeful sampling was utilized. Parents registered with the '22q11 Ireland' support group, and parents listed on the cleft palate database in a children's hospital in Ireland were invited to participate. Focus groups were held with 22 parents. Data were thematically analysed using Burnard's method of analysis. Most parents had some knowledge of the relationship between 22q11DS and an increased risk of MH issues. Parents reported that MH information relating to 22q11DS was mainly obtained from 22q11DS conferences, the '22q11 Ireland' support group and the Internet. Parents expressed a need for information to prevent or cope with their child's MH issues. Parents suggested that the following topics would be quite useful in a psycho-educational programme. These included information on the early warning signs of MH issues and guidance on when and how to tell the child about the condition and how to manage the child or young person's anxiety, obsessive behaviour or hearing voices. The findings indicated parental support for a psycho-educational programme that would provide relevant, accurate and timely information on how to effectively care for a child with 22q11DS MH needs. © 2017 John Wiley & Sons Ltd.
AUTHOR|(CDS)2092407
In this thesis, the measurement of $\\mathcal{B}(B^0 \\rightarrow \\pi^- D_s^+)$ at LHCb is discussed. $B^0 \\rightarrow \\pi^- D_s^+$ is a non-leptonic tree decay, which only occurs via the $b \\rightarrow u$ quark transition. As a result, it probes the CKM matrix element $|V_{ub}|$. As $B^0 \\rightarrow \\pi^- D_s^+$ is purely non-leptonic, non-factorisable contributions $|a_{NF}|$ from the strong interaction have to be taken into account. They are estimated using $B^0 \\rightarrow D \\bar{D}$ decays while taking non-tree (penguin, exchange and penguin annihilation) contributions into account. It is found that $\\mathcal{B}(B^0 \\rightarrow \\pi^- D_s^+) = (26.7\\pm 2.0(stat.)\\pm 1.5(syst.)\\pm1.6(\\mathcal{B}))\\times 10^{-6}$, which results in $|V_{ub}||a_{NF}| = (3.40\\pm 0.14(\\mathcal{B})\\pm 0.29(ext.))10^{-3}$, where the first uncertainty comes from the measurement of $\\mathcal{B}(B^0 \\rightarrow \\pi^- D_s^+)$ and the second uncertainty from external inputs.
Energy Technology Data Exchange (ETDEWEB)
Byard D. Wood; David L. Beshears
2006-02-01
This RD&D project is a three year team effort to develop a hybrid solar lighting (HSL) system that transports daylight from a paraboloidal dish concentrator to a luminaire via a bundle of polymer fiber optics. The luminaire can be a device to distribute sunlight into a space for the production of algae or it can be a device that is a combination of daylighting and electric lighting for space/task lighting. In this project, the sunlight is collected using a one-meter paraboloidal concentrator dish with two-axis tracking. For the third generation (beta) system, the secondary mirror is an ellipsoidal mirror that directs the visible light into a bundle of 3 mm diameter fibers. The IR spectrum is filtered out to minimize unnecessary heating at the fiber entrance region. This report describes the following investigations: Niche applications for HSL technology, Luminaire design characteristics for linear and point lighting fixtures, and Daylight affects on productivity.
Damage spreading on the 3-12 lattice with competing Glauber and ...
Indian Academy of Sciences (India)
In recent years, much attention has been paid to the DS study on complex .... A reasonable explanation may be that the memory of the original ... less cells will be affected, and so the DS is difficult when compared with the 12-gon. (f = 12).
Hybridization rapidly reduces fitness of a native trout in the wild
Muhlfeld, C.C.; Kalinowski, S.T.; McMahon, T.E.; Taper, M.L.; Painter, S.; Leary, R.F.; Allendorf, F.W.
2009-01-01
Human-mediated hybridization is a leading cause of biodiversity loss worldwide. How hybridization affects fitness and what level of hybridization is permissible pose difficult conservation questions with little empirical information to guide policy and management decisions. This is particularly true for salmonids, where widespread introgression among non-native and native taxa has often created hybrid swarms over extensive geographical areas resulting in genomic extinction. Here, we used parentage analysis with multilocus microsatellite markers to measure how varying levels of genetic introgression with non-native rainbow trout (Oncorhynchus mykiss) affect reproductive success (number of offspring per adult) of native westslope cutthroat trout (Oncorhynchus clarkii lewisi) in the wild. Small amounts of hybridization markedly reduced fitness of male and female trout, with reproductive success sharply declining by approximately 50 per cent, with only 20 per cent admixture. Despite apparent fitness costs, our data suggest that hybridization may spread due to relatively high reproductive success of first-generation hybrids and high reproductive success of a few males with high levels of admixture. This outbreeding depression suggests that even low levels of admixture may have negative effects on fitness in the wild and that policies protecting hybridized populations may need reconsideration. ?? 2009 The Royal Society.
Combinatorics of spreads and parallelisms
Johnson, Norman
2010-01-01
Partitions of Vector Spaces Quasi-Subgeometry Partitions Finite Focal-SpreadsGeneralizing André SpreadsThe Going Up Construction for Focal-SpreadsSubgeometry Partitions Subgeometry and Quasi-Subgeometry Partitions Subgeometries from Focal-SpreadsExtended André SubgeometriesKantor's Flag-Transitive DesignsMaximal Additive Partial SpreadsSubplane Covered Nets and Baer Groups Partial Desarguesian t-Parallelisms Direct Products of Affine PlanesJha-Johnson SL(2,
Smart-DS: Synthetic Models for Advanced, Realistic Testing: Distribution Systems and Scenarios
Energy Technology Data Exchange (ETDEWEB)
Krishnan, Venkat K [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Palmintier, Bryan S [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Hodge, Brian S [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Hale, Elaine T [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Elgindy, Tarek [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Bugbee, Bruce [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Rossol, Michael N [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Lopez, Anthony J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Krishnamurthy, Dheepak [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Vergara, Claudio [MIT; Domingo, Carlos Mateo [IIT Comillas; Postigo, Fernando [IIT Comillas; de Cuadra, Fernando [IIT Comillas; Gomez, Tomas [IIT Comillas; Duenas, Pablo [MIT; Luke, Max [MIT; Li, Vivian [MIT; Vinoth, Mohan [GE Grid Solutions; Kadankodu, Sree [GE Grid Solutions
2017-08-09
The National Renewable Energy Laboratory (NREL) in collaboration with Massachusetts Institute of Technology (MIT), Universidad Pontificia Comillas (Comillas-IIT, Spain) and GE Grid Solutions, is working on an ARPA-E GRID DATA project, titled Smart-DS, to create: 1) High-quality, realistic, synthetic distribution network models, and 2) Advanced tools for automated scenario generation based on high-resolution weather data and generation growth projections. Through these advancements, the Smart-DS project is envisioned to accelerate the development, testing, and adoption of advanced algorithms, approaches, and technologies for sustainable and resilient electric power systems, especially in the realm of U.S. distribution systems. This talk will present the goals and overall approach of the Smart-DS project, including the process of creating the synthetic distribution datasets using reference network model (RNM) and the comprehensive validation process to ensure network realism, feasibility, and applicability to advanced use cases. The talk will provide demonstrations of early versions of synthetic models, along with the lessons learnt from expert engagements to enhance future iterations. Finally, the scenario generation framework, its development plans, and co-ordination with GRID DATA repository teams to house these datasets for public access will also be discussed.
Simulations of Micro Gas Flows by the DS-BGK Method
Li, Jun
2011-01-01
For gas flows in micro devices, the molecular mean free path is of the same order as the characteristic scale making the Navier-Stokes equation invalid. Recently, some micro gas flows are simulated by the DS-BGK method, which is convergent
Lifescience Database Archive (English)
Full Text Available arditis [DS:H00334] ... semisynthetic penicillin: narrow spectrum penicillin beta-Lac...1531] Pinta [DS:H01530] Diphtheria [DS:H00343] Anthrax [DS:H00328] Rat-bite fever [DS:H01314] Erysipeloid [DS:H01315] Bacterial endoc
On capacity tradeoffs in secure DS-CDMA packet communications with QOS constraints
International Nuclear Information System (INIS)
Sattar, F.; Mufti, M.
2012-01-01
This paper presents a mathematical framework for analysis of effect of counter mode (CTR) encryption on the traffic capacity of packet communication systems based on direct-sequence, code-division, multiple-access (DS-CDMA). We specify QoS constraints in terms of minimum acceptable mean opinion score (MOS) of voice payload, maximum permissible resource utilization for CTR-mode re-keying and DS-CDMA processing gain. We quantify the trade-offs in system capacity as a function of these constraints. Results show that application of CTR encryption causes error expansion and respecting the QoS constraints while satisfying the desired encryption parameters results in reduction of traffic capacity. (author)
Uplink Packet-Data Scheduling in DS-CDMA Systems
Choi, Young Woo; Kim, Seong-Lyun
In this letter, we consider the uplink packet scheduling for non-real-time data users in a DS-CDMA system. As an effort to jointly optimize throughput and fairness, we formulate a time-span minimization problem incorporating the time-multiplexing of different simultaneous transmission schemes. Based on simple rules, we propose efficient scheduling algorithms and compare them with the optimal solution obtained by linear programming.
2010-09-23
... Information Collection: DS-156E Nonimmigrant Treaty Trader/Investor Application ACTION: Notice of request for... Collection: Nonimmigrant Treaty Trader/Investor Application. OMB Control Number: 1405-0101. Type of Request... State (CA/VO). Form Number: DS-156E. Respondents: Nonimmigrant treaty trader/investor visa applicants...
Hybrid and hierarchical composite materials
Kim, Chang-Soo; Sano, Tomoko
2015-01-01
This book addresses a broad spectrum of areas in both hybrid materials and hierarchical composites, including recent development of processing technologies, structural designs, modern computer simulation techniques, and the relationships between the processing-structure-property-performance. Each topic is introduced at length with numerous and detailed examples and over 150 illustrations. In addition, the authors present a method of categorizing these materials, so that representative examples of all material classes are discussed.
Age, spreading rates, and spreading asymmetry of the world's ocean crust
National Oceanic and Atmospheric Administration, Department of Commerce — The authors present four companion digital models of the age, age uncertainty, spreading rates and spreading asymmetries of the world's ocean basins as geographic...
Energy Technology Data Exchange (ETDEWEB)
Krause, Sabine [Bayer Schering Pharma AG, Global Drug Discovery, D-13342 Berlin (Germany); Rennen, Huub J.; Boerman, Otto C. [Radboud University, Nijmegen Medical Centre, 6500 HB Nijmegen (Netherlands); Baumann, Sabine; Cyr, John E.; Manchanda, Rajesh; Lister-James, John [Bayer Schering Pharma AG, Global Drug Discovery, D-13342 Berlin (Germany); Corstens, Frans C. [Radboud University, Nijmegen Medical Centre, 6500 HB Nijmegen (Netherlands); Dinkelborg, Ludger M. [Bayer Schering Pharma AG, Global Drug Discovery, D-13342 Berlin (Germany)], E-mail: sabine.krause@bayerhealthcare.com
2007-11-15
Background: The technetium 99 m ({sup 99m}Tc)-radiolabeled, leukocyte-avid peptide-glycoseaminoglycan complex, [{sup 99m}Tc]P1827DS, has been synthesized as an improved infection/inflammation imaging agent to [{sup 99m}Tc]P483H (LeukoTect, Diatide). In a phase I/II clinical trail, [{sup 99m}Tc]P483H images were equivalent to those obtained with {sup 111}In ex vivo labeled leukocytes. However, there was physiologic accumulation of radioactivity in the body that could hamper interpretation of the images. In this study, the potential of [{sup 99m}Tc]P1827DS for infection imaging was assessed in comparison with [{sup 99m}Tc]P483H and the well-described imaging agent [{sup 99m}Tc] hydrazinonicotinamide (HYNIC)-interleukin 8 (IL-8). Methods: The binding of [{sup 99m}Tc]P1827DS to human blood cell was studied in vitro. A rabbit Escherichia coli infection model was used to perform the biodistribution and imaging studies with [{sup 99m}Tc]P1827DS, [{sup 99m}Tc]P483H and [{sup 99m}Tc]HYNIC-IL-8. Results: [{sup 99m}Tc]P1827DS binds to leukocytes but not to erythrocytes. The leukocyte binding was not saturable up to an investigated concentration of 10 {mu}M. The accumulation of [{sup 99m}Tc]P1827/DS at the infection site strongly depends on the P1827/DS ratio and was optimal at a molar ratio of 10:1. [{sup 99m}Tc]P1827DS shows improved biodistribution over [{sup 99m}Tc]P483H with similar uptake at the infection site. Abscess uptake of [{sup 99m}Tc]HYNIC-IL-8 was approximately three times higher than that of [{sup 99m}Tc]P1827DS. [{sup 99m}Tc]HYNIC-IL-8 showed high accumulation in the kidneys, whereas [{sup 99m}Tc]P1827DS showed high lung uptake and slightly higher accumulation in the liver and spleen. Conclusion: [{sup 99m}Tc]P1827DS is a potential new inflammation imaging agent, which clearly visualized the abscess in the rabbit E. coli infection model and showed improved biodistribution compared to [{sup 99m}Tc]P483H. However, the infection uptake and biodistribution of
International Nuclear Information System (INIS)
Krause, Sabine; Rennen, Huub J.; Boerman, Otto C.; Baumann, Sabine; Cyr, John E.; Manchanda, Rajesh; Lister-James, John; Corstens, Frans C.; Dinkelborg, Ludger M.
2007-01-01
Background: The technetium 99 m ( 99m Tc)-radiolabeled, leukocyte-avid peptide-glycoseaminoglycan complex, [ 99m Tc]P1827DS, has been synthesized as an improved infection/inflammation imaging agent to [ 99m Tc]P483H (LeukoTect, Diatide). In a phase I/II clinical trail, [ 99m Tc]P483H images were equivalent to those obtained with 111 In ex vivo labeled leukocytes. However, there was physiologic accumulation of radioactivity in the body that could hamper interpretation of the images. In this study, the potential of [ 99m Tc]P1827DS for infection imaging was assessed in comparison with [ 99m Tc]P483H and the well-described imaging agent [ 99m Tc] hydrazinonicotinamide (HYNIC)-interleukin 8 (IL-8). Methods: The binding of [ 99m Tc]P1827DS to human blood cell was studied in vitro. A rabbit Escherichia coli infection model was used to perform the biodistribution and imaging studies with [ 99m Tc]P1827DS, [ 99m Tc]P483H and [ 99m Tc]HYNIC-IL-8. Results: [ 99m Tc]P1827DS binds to leukocytes but not to erythrocytes. The leukocyte binding was not saturable up to an investigated concentration of 10 μM. The accumulation of [ 99m Tc]P1827/DS at the infection site strongly depends on the P1827/DS ratio and was optimal at a molar ratio of 10:1. [ 99m Tc]P1827DS shows improved biodistribution over [ 99m Tc]P483H with similar uptake at the infection site. Abscess uptake of [ 99m Tc]HYNIC-IL-8 was approximately three times higher than that of [ 99m Tc]P1827DS. [ 99m Tc]HYNIC-IL-8 showed high accumulation in the kidneys, whereas [ 99m Tc]P1827DS showed high lung uptake and slightly higher accumulation in the liver and spleen. Conclusion: [ 99m Tc]P1827DS is a potential new inflammation imaging agent, which clearly visualized the abscess in the rabbit E. coli infection model and showed improved biodistribution compared to [ 99m Tc]P483H. However, the infection uptake and biodistribution of [ 99m Tc]P1827DS is not superior to that of [ 99m Tc]HYNIC-IL-8 in this animal model
Supersymmetric hybrid inflation with non-minimal Kahler potential
International Nuclear Information System (INIS)
Bastero-Gil, M.; King, S.F.; Shafi, Q.
2007-01-01
Minimal supersymmetric hybrid inflation based on a minimal Kahler potential predicts a spectral index n s ∼>0.98. On the other hand, WMAP three year data prefers a central value n s ∼0.95. We propose a class of supersymmetric hybrid inflation models based on the same minimal superpotential but with a non-minimal Kahler potential. Including radiative corrections using the one-loop effective potential, we show that the prediction for the spectral index is sensitive to the small non-minimal corrections, and can lead to a significantly red-tilted spectrum, in agreement with WMAP
Discovery of a dsRNA virus infecting the marine photosynthetic protist Micromonas pusilla
International Nuclear Information System (INIS)
Brussaard, C.P.D.; Noordeloos, A.A.M.; Sandaa, R.-A.; Heldal, M.; Bratbak, G.
2004-01-01
We report the isolation of the first double-stranded (ds) RNA virus in the family Reoviridae that infects a protist (microalga Micromonas pusilla, Prasinophyceae). The dsRNA genome was composed of 11 segments ranging between 0.8 and 5.8 kb, with a total size of approximately 25.5 kb. The virus (MpRNAV-01B) could not be assigned to the genus level because host type, genome size, and number of segments smaller than 2 kb did not correspond to either of the two existing 11-segmented dsRNA genera Rotavirus and Aquareovirus. MpRNAV-01B has a particle size of 65-80 nm, a narrow host range, a latent period of 36 h, and contains five major proteins (120, 95, 67, 53, and 32 kDa). MpRNAV-01B was stable to freeze-thawing, resistant to chloroform, ether, nonionic detergents, chelating and reducing agents. The virus was inactivated at temperatures above 35 deg. C and by ionic detergent, ethanol, acetone, and acidic conditions (pH 2-5)
Chang, Zhenyi; Chen, Zhufeng; Wang, Na; Xie, Gang; Lu, Jiawei; Yan, Wei; Zhou, Junli; Tang, Xiaoyan; Deng, Xing Wang
2016-12-06
The breeding and large-scale adoption of hybrid seeds is an important achievement in agriculture. Rice hybrid seed production uses cytoplasmic male sterile lines or photoperiod/thermo-sensitive genic male sterile lines (PTGMS) as female parent. Cytoplasmic male sterile lines are propagated via cross-pollination by corresponding maintainer lines, whereas PTGMS lines are propagated via self-pollination under environmental conditions restoring male fertility. Despite huge successes, both systems have their intrinsic drawbacks. Here, we constructed a rice male sterility system using a nuclear gene named Oryza sativa No Pollen 1 (OsNP1). OsNP1 encodes a putative glucose-methanol-choline oxidoreductase regulating tapetum degeneration and pollen exine formation; it is specifically expressed in the tapetum and miscrospores. The osnp1 mutant plant displays normal vegetative growth but complete male sterility insensitive to environmental conditions. OsNP1 was coupled with an α-amylase gene to devitalize transgenic pollen and the red fluorescence protein (DsRed) gene to mark transgenic seed and transformed into the osnp1 mutant. Self-pollination of the transgenic plant carrying a single hemizygous transgene produced nontransgenic male sterile and transgenic fertile seeds in 1:1 ratio that can be sorted out based on the red fluorescence coded by DsRed Cross-pollination of the fertile transgenic plants to the nontransgenic male sterile plants propagated the male sterile seeds of high purity. The male sterile line was crossed with ∼1,200 individual rice germplasms available. Approximately 85% of the F1s outperformed their parents in per plant yield, and 10% out-yielded the best local cultivars, indicating that the technology is promising in hybrid rice breeding and production.
Hybrid Lanczos-type product methods
Energy Technology Data Exchange (ETDEWEB)
Ressel, K.J. [Swiss Center for Scientific Computing, Zuerich (Switzerland)
1996-12-31
A general framework is proposed to construct hybrid iterative methods for the solution of large nonsymmetric systems of linear equations. This framework is based on Lanczos-type product methods, whose iteration polynomial consists of the Lanczos polynomial multiplied by some other arbitrary, {open_quotes}shadow{close_quotes} polynomial. By using for the shadow polynomial Chebyshev (more general Faber) polynomials or L{sup 2}-optimal polynomials, hybrid (Chebyshev-like) methods are incorporated into Lanczos-type product methods. In addition, to acquire spectral information on the system matrix, which is required for such a choice of shadow polynomials, the Lanczos-process can be employed either directly or in an QMR-like approach. The QMR like approach allows the cheap computation of the roots of the B-orthogonal polynomials and the residual polynomials associated with the QMR iteration. These roots can be used as a good approximation for the spectrum of the system matrix. Different choices for the shadow polynomials and their construction are analyzed. The resulting hybrid methods are compared with standard Lanczos-type product methods, like BiOStab, BiOStab({ell}) and BiOS.
Nanoscale Organic−Inorganic Hybrid Lubricants
Kim, Daniel
2011-03-15
Silica (SiO2) nanoparticles densely grafted with amphiphilic organic chains are used to create a family of organic-inorganic hybrid lubricants. Short sulfonate-functionalized alkylaryl chains covalently tethered to the particles form a dense corona brush that stabilizes them against aggregation. When these hybrid particles are dispersed in poly-α-olefin (PAO) oligomers, they form homogeneous nanocomposite fluids at both low and high particle loadings. By varying the volume fraction of the SiO2 nanostructures in the PAO nanocomposites, we show that exceptionally stable hybrid lubricants can be created and that their mechanical properties can be tuned to span the spectrum from simple liquids to complex gels. We further show that these hybrid lubricants simultaneously exhibit lower interfacial friction coefficients, enhanced wear and mechanical properties, and superior thermal stability in comparison with either PAO or its nanocomposites created at low nanoparticle loadings. Profilometry and energy dispersive X-ray spectroscopic analysis of the wear track show that the enhanced wear characteristics in PAO-SiO2 composite lubricants originate from two sources: localization of the SiO2 particles into the wear track and extension of the elastohydrodynamic lubrication regime to Sommerfeld numbers more than an order of magnitude larger than for PAO. © 2011 American Chemical Society.
Directory of Open Access Journals (Sweden)
Corrado Sandini
2018-05-01
Full Text Available Background: Schizophrenia is currently considered a neurodevelopmental disorder of connectivity. Still few studies have investigated how brain networks develop in children and adolescents who are at risk for developing psychosis. 22q11.2 Deletion Syndrome (22q11DS offers a unique opportunity to investigate the pathogenesis of schizophrenia from a neurodevelopmental perspective. Structural covariance (SC is a powerful approach to explore morphometric relations between brain regions that can furthermore detect biomarkers of psychosis, both in 22q11DS and in the general population.Methods: Here we implement a state-of-the-art sliding-window approach to characterize maturation of SC network architecture in a large longitudinal cohort of patients with 22q11DS (110 with 221 visits and healthy controls (117 with 211 visits. We furthermore propose a new clustering-based approach to group regions according to trajectories of structural connectivity maturation. We correlate measures of SC with development of working memory, a core executive function that is highly affected in both idiopathic psychosis and 22q11DS. Finally, in 22q11DS we explore correlations between SC dysconnectivity and severity of internalizing psychopathology.Results: In HCs network architecture underwent a quadratic developmental trajectory maturing up to mid-adolescence. Late-childhood maturation was particularly evident for fronto-parietal cortices, while Default-Mode-Network-related regions showed a more protracted linear development. Working memory performance was positively correlated with network segregation and fronto-parietal connectivity. In 22q11DS, we demonstrate aberrant maturation of SC with disturbed architecture selectively emerging during adolescence and correlating more severe internalizing psychopathology. Patients also presented a lack of typical network development during late-childhood, that was particularly prominent for frontal connectivity.Conclusions: Our
Performance measurements of hybrid PIN diode arrays
International Nuclear Information System (INIS)
Jernigan, J.G.; Arens, J.F.; Collins, T.; Herring, J.; Shapiro, S.L.; Wilburn, C.D.
1990-05-01
We report on the successful effort to develop hybrid PIN diode arrays and to demonstrate their potential as components of vertex detectors. Hybrid pixel arrays have been fabricated by the Hughes Aircraft Co. by bump bonding readout chips developed by Hughes to an array of PIN diodes manufactured by Micron Semiconductor Inc. These hybrid pixel arrays were constructed in two configurations. One array format having 10 x 64 pixels, each 120 μm square, and the other format having 256 x 256 pixels, each 30 μm square. In both cases, the thickness of the PIN diode layer is 300 μm. Measurements of detector performance show that excellent position resolution can be achieved by interpolation. By determining the centroid of the charge cloud which spreads charge into a number of neighboring pixels, a spatial resolution of a few microns has been attained. The noise has been measured to be about 300 electrons (rms) at room temperature, as expected from KTC and dark current considerations, yielding a signal-to-noise ratio of about 100 for minimum ionizing particles. 4 refs., 13 figs
Uzun, Lokman; Yavuz, Handan; Osman, Bilgen; Celik, Hamdi; Denizli, Adil
2010-07-01
The preparation of polymeric membrane using affinity technology for application in blood filtration devices is described here. DNA attached poly(hydroxyethyl methacrylate) (PHEMA) based microporous affinity membrane was prepared for selective removal of anti-dsDNA antibodies from systemic lupus erythematosus (SLE) patient plasma in in vitro. In order to further increase blood-compatibility of affinity membrane, aminoacid based comonomer N-methacryloyl-L-alanine (MAAL) was included in the polymerization recipe. PHEMAAL membrane was produced by a photopolymerization technique and then characterized by swelling tests and scanning electron microscope (SEM) studies. Blood-compatibility tests were also performed. The water swelling ratio of PHEMAAL membrane increased significantly (133.2%) compared with PHEMA (58%). PHEMAAL membrane has large pores around in the range of 5-10 microm. All the clotting times increased when compared with PHEMA membrane. Loss of platelets and leukocytes was very low. DNA loading was 7.8 mg/g. There was a very low anti-dsDNA-antibody adsorption onto the plain PHEMAAL membrane, about 78 IU/g. The PHEMAAL-DNA membrane adsorbed anti-dsDNA-antibody in the range of 10-68 x 10(3)IU/g from SLE plasma. Anti-dsDNA-antibody concentration decreased significantly from 875 to 144 IU/ml with the time. Anti-dsDNA-antibodies could be repeatedly adsorbed and eluted without noticeable loss in the anti-dsDNA-antibody adsorption amount. (c) 2010 Elsevier B.V. All rights reserved.
Cape Saint Paul Wilt Disease of coconut in Ghana: surveillance and management of disease spread
Directory of Open Access Journals (Sweden)
Nkansah-Poku Joe
2009-03-01
Full Text Available The Cape Saint Paul Wilt Disease (CSPWD, a lethal-yellowing type disease of coconut has been in Ghana since 1932. Aerial and/or ground surveys were undertaken to assess the current status of the disease spread. The survey showed that the spread of the disease for the past 5 years has mainly been the expansion of existing foci. However, new outbreaks were identified at Glidzi in the Volta, Bawjiase and Efutu Breman in Central regions. After the resurgence in the Volta region in 1995, the Woe-Tegbi-Dzelukope corridor has remained endemic, but less aggressive. Pockets of healthy groves remain along all the coastline and inland of known disease zones. Eradication of diseased palms at Ampain focus lying just about 60 km to the Ivorian border, and disease situations on new replanting with MYD × VTT hybrid are discussed.
Non-Invasive Delivery of dsRNA into De-Waxed Tick Eggs by Electroporation
Ruiz, Newton; de Abreu, Leonardo Araujo; Parizi, Luís Fernando; Kim, Tae Kwon; Mulenga, Albert; Braz, Gloria Regina Cardoso; Vaz, Itabajara da Silva; Logullo, Carlos
2015-01-01
RNA interference-mediated gene silencing was shown to be an efficient tool for validation of targets that may become anti-tick vaccine components. Here, we demonstrate the application of this approach in the validation of components of molecular signaling cascades, such as the Protein Kinase B (AKT) / Glycogen Synthase Kinase (GSK) axis during tick embryogenesis. It was shown that heptane and hypochlorite treatment of tick eggs can remove wax, affecting corium integrity and but not embryo development. Evidence of AKT and GSK dsRNA delivery into de-waxed eggs of via electroporation is provided. Primers designed to amplify part of the dsRNA delivered into the electroporated eggs dsRNA confirmed its entry in eggs. In addition, it was shown that electroporation is able to deliver the fluorescent stain, 4',6-diamidino-2-phenylindole (DAPI). To confirm gene silencing, a second set of primers was designed outside the dsRNA sequence of target gene. In this assay, the suppression of AKT and GSK transcripts (approximately 50% reduction in both genes) was demonstrated in 7-day-old eggs. Interestingly, silencing of GSK in 7-day-old eggs caused 25% reduction in hatching. Additionally, the effect of silencing AKT and GSK on embryo energy metabolism was evaluated. As expected, knockdown of AKT, which down regulates GSK, the suppressor of glycogen synthesis, decreased glycogen content in electroporated eggs. These data demonstrate that electroporation of de-waxed R. microplus eggs could be used for gene silencing in tick embryos, and improve the knowledge about arthropod embryogenesis. PMID:26091260
DEFF Research Database (Denmark)
Philipsen, Kirsten Riber; Bootsma, M. C. J.; Leverstein-van Hall, M.A.
In this study a mathematical model for the spread of ESBL resistant E.coli among patients in a hospital and the surrounding catchment population has been introduced and used to described prevalence data from the Netherlands. Several statistical methods have been applied to estimate the model...
Theory of the Quantum Dot Hybrid Qubit
Friesen, Mark
2015-03-01
The quantum dot hybrid qubit, formed from three electrons in two quantum dots, combines the desirable features of charge qubits (fast manipulation) and spin qubits (long coherence times). The hybridized spin and charge states yield a unique energy spectrum with several useful properties, including two different operating regimes that are relatively immune to charge noise due to the presence of optimal working points or ``sweet spots.'' In this talk, I will describe dc and ac-driven gate operations of the quantum dot hybrid qubit. I will analyze improvements in the dephasing that are enabled by the sweet spots, and I will discuss the outlook for quantum hybrid qubits in terms of scalability. This work was supported in part by ARO (W911NF-12-0607), NSF (PHY-1104660), the USDOD, and the Intelligence Community Postdoctoral Research Fellowship Program. The views and conclusions contained in this presentation are those of the authors and should not be interpreted as representing the official policies or endorsements, either expressed or implied, of the US government.
Hybrid Model For Reverberant Indoor Radio Channels Using Rays and Graphs
DEFF Research Database (Denmark)
Steinböck, Gerhard; Gan, Mingming; Meissner, Paul
2016-01-01
efficient calculation of the channel transfer function considering infinitely many components. We use ray-tracing and the theory of room electromagnetics to obtain the parameter settings for the propagation graph. Thus the proposed hybrid model does not require new or additional parameters in comparison...... to ray-tracing. Simulation results show good agreement with measurements with respect to the inclusion of the diffuse tail in both the delay power spectrum and the azimuth delay power spectrum....
The Effects of Spatial Diversity and Imperfect Channel Estimation on Wideband MC-DS-CDMA and MC-CDMA
2009-10-01
In our previous work, we compared the theoretical bit error rates of multi-carrier direct sequence code division multiple access (MC- DS - CDMA ) and...consider only those cases where MC- CDMA has higher frequency diversity than MC- DS - CDMA . Since increases in diversity yield diminishing gains, we conclude
The SFR-M∗ main sequence archetypal star-formation history and analytical models
Ciesla, L.; Elbaz, D.; Fensch, J.
2017-12-01
The star-formation history (SFH) of galaxies is a key assumption to derive their physical properties and can lead to strong biases. In this work, we derive the SFH of main sequence (MS) galaxies and show how the peak SFH of a galaxy depends on its seed mass at, for example, z = 5. This seed mass reflects the galaxy's underlying dark matter (DM) halo environment. We show that, following the MS, galaxies undergo a drastic slow down of their stellar mass growth after reaching the peak of their SFH. According to abundance matching, these masses correspond to hot and massive DM halos which state could result in less efficient gas inflows on the galaxies and thus could be the origin of limited stellar mass growth. As a result, we show that galaxies, still on the MS, can enter the passive region of the UVJ diagram while still forming stars. The best fit to the MS SFH is provided by a right skew peak function for which we provide parameters depending on the seed mass of the galaxy. The ability of the classical analytical SFHs to retrieve the star-formation rate (SFR) of galaxies from spectral energy distribution (SED) fitting is studied. Due to mathematical limitations, the exponentially declining and delayed SFH struggle to model high SFR, which starts to be problematic at z > 2. The exponentially rising and log-normal SFHs exhibit the opposite behavior with the ability to reach very high SFR, and thus model starburst galaxies, but they are not able to model low values such as those expected at low redshift for massive galaxies. By simulating galaxies SED from the MS SFH, we show that these four analytical forms recover the SFR of MS galaxies with an error dependent on the model and the redshift. They are, however, sensitive enough to probe small variations of SFR within the MS, with an error ranging from 5 to 40% depending on the SFH assumption and redshift; but all the four fail to recover the SFR of rapidly quenched galaxies. However, these SFHs lead to an artificial
DsRed gene expression by doxycycline in porcine fibroblasts and ...
African Journals Online (AJOL)
DsRed gene expression by doxycycline in porcine fibroblasts and cloned embryos using transposon. SuJin Kim, JoonHo Moon, BegoRoibas da Torre, Islam M Saadeldin, JungTaek Kang, JiYei Choi, SolJi Park, Byeong-Chun Lee, Goo Jang Goo Jang ...
Transactivation of Ds by Ac-transposase gene fusions in tobacco
Rommens, Caius M.T.; Haaren, Mark J.J. van; Buchel, Annemarie S.; Mol, Joseph N.M.; Tunen, Arjen J. van; Nijkamp, H. John J.; Hille, Jacques
1992-01-01
To study regulation of the (Ds) transposition process in heterologous plant species, the transposase gene of Ac was fused to several promoters that are active late during plant development. These promoters are the flower-specific chalcone synthase A promoter (CHS A), the anther-specific chalcone
Application of D-S Evidence Fusion Method in the Fault Detection of Temperature Sensor
Directory of Open Access Journals (Sweden)
Zheng Dou
2014-01-01
Full Text Available Due to the complexity and dangerousness of drying process, the fault detection of temperature sensor is very difficult and dangerous in actual working practice and the detection effectiveness is not satisfying. For this problem, in this paper, based on the idea of information fusion and the requirements of D-S evidence method, a D-S evidence fusion structure with two layers was introduced to detect the temperature sensor fault in drying process. The first layer was data layer to establish the basic belief assignment function of evidence which could be realized by BP Neural Network. The second layer was decision layer to detect and locate the sensor fault which could be realized by D-S evidence fusion method. According to the numerical simulation results, the working conditions of sensors could be described effectively and accurately by this method, so that it could be used to detect and locate the sensor fault.
Non-Specific dsRNA-Mediated Antiviral Response in the Honey Bee
Flenniken, Michelle L.; Andino, Raul
2013-01-01
Honey bees are essential pollinators of numerous agricultural crops. Since 2006, honey bee populations have suffered considerable annual losses that are partially attributed to Colony Collapse Disorder (CCD). CCD is an unexplained phenomenon that correlates with elevated incidence of pathogens, including RNA viruses. Honey bees are eusocial insects that live in colonies of genetically related individuals that work in concert to gather and store nutrients. Their social organization provides numerous benefits, but also facilitates pathogen transmission between individuals. To investigate honey bee antiviral defense mechanisms, we developed an RNA virus infection model and discovered that administration of dsRNA, regardless of sequence, reduced virus infection. Our results suggest that dsRNA, a viral pathogen associated molecular pattern (PAMP), triggers an antiviral response that controls virus infection in honey bees. PMID:24130869
Adaptive Multiuser Detectors for DS-CDMA Systems
Directory of Open Access Journals (Sweden)
Paul Jean Etienne Jeszensky
2006-02-01
Full Text Available This work makes a review of the main Adaptives Multi-user Detectors (MuD-Adpt for Direct Sequence - Code Division Multiple Access (DS-CDMA systems. The MuD-Adpt based on Minimum Mean Square Error (MMSE and Decorrelator (MuD-Dec are focused. Multi-user detectors show great resistance to the near-far effect and combat effectively the Multiple Access Interference (MAI. Comparative numeric results characterize the substantial performance improvement of those detectors in relation to the matched filter conventional receiver (Conv.
Directory of Open Access Journals (Sweden)
Petré Frederik
2004-01-01
Full Text Available In the downlink of DS-CDMA, frequency-selectivity destroys the orthogonality of the user signals and introduces multiuser interference (MUI. Space-time chip equalization is an efficient tool to restore the orthogonality of the user signals and suppress the MUI. Furthermore, multiple-input multiple-output (MIMO communication techniques can result in a significant increase in capacity. This paper focuses on space-time block coding (STBC techniques, and aims at combining STBC techniques with the original single-antenna DS-CDMA downlink scheme. This results into the so-called space-time block coded DS-CDMA downlink schemes, many of which have been presented in the past. We focus on a new scheme that enables both the maximum multiantenna diversity and the maximum multipath diversity. Although this maximum diversity can only be collected by maximum likelihood (ML detection, we pursue suboptimal detection by means of space-time chip equalization, which lowers the computational complexity significantly. To design the space-time chip equalizers, we also propose efficient pilot-based methods. Simulation results show improved performance over the space-time RAKE receiver for the space-time block coded DS-CDMA downlink schemes that have been proposed for the UMTS and IS-2000 W-CDMA standards.
A Synthetic Fusion Rule for Salient Region Detection under the Framework of DS-Evidence Theory
Directory of Open Access Journals (Sweden)
Naeem Ayoub
2018-05-01
Full Text Available Saliency detection is one of the most valuable research topics in computer vision. It focuses on the detection of the most significant objects/regions in images and reduces the computational time cost of getting the desired information from salient regions. Local saliency detection or common pattern discovery schemes were actively used by the researchers to overcome the saliency detection problems. In this paper, we propose a bottom-up saliency fusion method by taking into consideration the importance of the DS-Evidence (Dempster–Shafer (DS theory. Firstly, we calculate saliency maps from different algorithms based on the pixels-level, patches-level and region-level methods. Secondly, we fuse the pixels based on the foreground and background information under the framework of DS-Evidence theory (evidence theory allows one to combine evidence from different sources and arrive at a degree of belief that takes into account all the available evidence. The development inclination of image saliency detection through DS-Evidence theory gives us better results for saliency prediction. Experiments are conducted on the publicly available four different datasets (MSRA, ECSSD, DUT-OMRON and PASCAL-S. Our saliency detection method performs well and shows prominent results as compared to the state-of-the-art algorithms.
Directory of Open Access Journals (Sweden)
Lili eGao
2015-04-01
Full Text Available The prevalence of extended-spectrum beta-lactamase (ESBL-producing Escherichia coli (E. coli is increasing rapidly in both hospital environments and animal farms. A lot of animal manure has been directly applied into arable fields in the developing countries. But the impact of ESBL-positive bacteria from animal manure on the agricultural fields is sparse, especially in the rural regions of Tai’an, China. Here, we collected 29, 3, and 10 ESBL-producing E. coli from pig manure, compost, and soil samples, respectively. To track ESBL-harboring E. coli from agricultural soil, these isolates of different sources were analyzed with regard to antibiotic resistance profiles, ESBL genes, plasmid replicons, and enterobacterial repetitive intergenic consensus (ERIC-polymerase chain reaction (PCR typing. The results showed that all the isolates exhibited multi-drug resistance. CTX-M gene was the predominant ESBL gene in the isolates from pig farm samples (30/32, 93.8% and soil samples (7/10, 70.0%, but no SHV gene was detected. 25 isolates contained the IncF-type replicon of plasmid, including 18 strains (18/32, 56.3% from the pig farm and 7 (7/10, 70.0% from the soil samples. ERIC-PCR demonstrated that 3 isolates from the soil had above 90% genetic similarity with strains from pig farm samples. In conclusion, application of animal manure carrying drug-resistant bacteria on agricultural fields is a likely contributor to antibiotic resistance gene spread.
Directory of Open Access Journals (Sweden)
Qiang Shang
Full Text Available Short-term traffic flow prediction is one of the most important issues in the field of intelligent transport system (ITS. Because of the uncertainty and nonlinearity, short-term traffic flow prediction is a challenging task. In order to improve the accuracy of short-time traffic flow prediction, a hybrid model (SSA-KELM is proposed based on singular spectrum analysis (SSA and kernel extreme learning machine (KELM. SSA is used to filter out the noise of traffic flow time series. Then, the filtered traffic flow data is used to train KELM model, the optimal input form of the proposed model is determined by phase space reconstruction, and parameters of the model are optimized by gravitational search algorithm (GSA. Finally, case validation is carried out using the measured data of an expressway in Xiamen, China. And the SSA-KELM model is compared with several well-known prediction models, including support vector machine, extreme learning machine, and single KLEM model. The experimental results demonstrate that performance of the proposed model is superior to that of the comparison models. Apart from accuracy improvement, the proposed model is more robust.
Optoelectronic Properties of Van Der Waals Hybrid Structures: Fullerenes on Graphene Nanoribbons.
Correa, Julián David; Orellana, Pedro Alejandro; Pacheco, Mónica
2017-03-20
The search for new optical materials capable of absorbing light in the frequency range from visible to near infrared is of great importance for applications in optoelectronic devices. In this paper, we report a theoretical study of the electronic and optical properties of hybrid structures composed of fullerenes adsorbed on graphene and on graphene nanoribbons. The calculations are performed in the framework of the density functional theory including the van der Waals dispersive interactions. We found that the adsorption of the C 60 fullerenes on a graphene layer does not modify its low energy states, but it has strong consequences for its optical spectrum, introducing new absorption peaks in the visible energy region. The optical absorption of fullerenes and graphene nanoribbon composites shows a strong dependence on photon polarization and geometrical characteristics of the hybrid systems, covering a broad range of energies. We show that an external electric field across the nanoribbon edges can be used to tune different optical transitions coming from nanoribbon-fullerene hybridized states, which yields a very rich electro-absorption spectrum for longitudinally polarized photons. We have carried out a qualitative analysis on the potential of these hybrids as possible donor-acceptor systems in photovoltaic cells.
Optoelectronic Properties of Van Der Waals Hybrid Structures: Fullerenes on Graphene Nanoribbons
Directory of Open Access Journals (Sweden)
Julián David Correa
2017-03-01
Full Text Available The search for new optical materials capable of absorbing light in the frequency range from visible to near infrared is of great importance for applications in optoelectronic devices. In this paper, we report a theoretical study of the electronic and optical properties of hybrid structures composed of fullerenes adsorbed on graphene and on graphene nanoribbons. The calculations are performed in the framework of the density functional theory including the van der Waals dispersive interactions. We found that the adsorption of the C 60 fullerenes on a graphene layer does not modify its low energy states, but it has strong consequences for its optical spectrum, introducing new absorption peaks in the visible energy region. The optical absorption of fullerenes and graphene nanoribbon composites shows a strong dependence on photon polarization and geometrical characteristics of the hybrid systems, covering a broad range of energies. We show that an external electric field across the nanoribbon edges can be used to tune different optical transitions coming from nanoribbon–fullerene hybridized states, which yields a very rich electro-absorption spectrum for longitudinally polarized photons. We have carried out a qualitative analysis on the potential of these hybrids as possible donor-acceptor systems in photovoltaic cells.
California Natural Resource Agency — These data define the current range of Barred and hybrid Barred/Spotted Owls in California. The current range includes the coastal mountains of northern California...
The VULCANO spreading programme
Energy Technology Data Exchange (ETDEWEB)
Cognet, G.; Laffont, G.; Jegou, C.; Journeau, C.; Sudreau, F.; Pierre, J.; Ramacciotti, M. [CEA (Atomic Energy Commission), DRN/DER - Bat. 212, CEA Cadarache, 13108 St. Paul Lez Durance (France)
1999-07-01
Among the currently studied core-catcher projects, some of them suppose corium spreading before cooling, in particular the EPR (European Pressurized Reactor) core-catcher concept is based on mixing the corium with a special concrete, spreading the molten mixture on a large multi-layer surface cooled from the bottom and subsequently cooling by flooding with water. Therefore, melt spreading deserves intensive investigation in order to determine and quantify key phenomena which govern the stopping of spreading. In France, for some years, the Nuclear Reactor Division of the Atomic Energy Commission (CEA/DRN) has undertaken a large program to improve knowledge on corium behaviour and coolability. This program is based on experimental and theoretical investigations which are finally gathered in scenario and mechanistic computer codes. In this framework, the real material experimental programme, VULCANO, conducted within an European frame, is currently devoted to the study of corium spreading. In 1997 and 1998, several tests have been performed on dry corium spreading with various composition of melts. Although all the observed phenomena, in particular the differences between simulant and real material melts have not been yet totally explained, these tests have already provided a lot of information about: The behaviour of complex mixtures including refractory oxides, silica, iron oxides and in one case iron metal; Spreading progression, which was never stopped in any of these tests by a crust formation at the front; The structure of spread melts (porosity, crusts,...); Physico-chemical interaction between melt and the refractory substratum which was composed of zirconia bricks. (authors)
The VULCANO spreading programme
International Nuclear Information System (INIS)
Cognet, G.; Laffont, G.; Jegou, C.; Journeau, C.; Sudreau, F.; Pierre, J.; Ramacciotti, M.
1999-01-01
Among the currently studied core-catcher projects, some of them suppose corium spreading before cooling, in particular the EPR (European Pressurized Reactor) core-catcher concept is based on mixing the corium with a special concrete, spreading the molten mixture on a large multi-layer surface cooled from the bottom and subsequently cooling by flooding with water. Therefore, melt spreading deserves intensive investigation in order to determine and quantify key phenomena which govern the stopping of spreading. In France, for some years, the Nuclear Reactor Division of the Atomic Energy Commission (CEA/DRN) has undertaken a large program to improve knowledge on corium behaviour and coolability. This program is based on experimental and theoretical investigations which are finally gathered in scenario and mechanistic computer codes. In this framework, the real material experimental programme, VULCANO, conducted within an European frame, is currently devoted to the study of corium spreading. In 1997 and 1998, several tests have been performed on dry corium spreading with various composition of melts. Although all the observed phenomena, in particular the differences between simulant and real material melts have not been yet totally explained, these tests have already provided a lot of information about: The behaviour of complex mixtures including refractory oxides, silica, iron oxides and in one case iron metal; Spreading progression, which was never stopped in any of these tests by a crust formation at the front; The structure of spread melts (porosity, crusts,...); Physico-chemical interaction between melt and the refractory substratum which was composed of zirconia bricks. (authors)
Surface-enhanced Raman effect in hybrid metal–semiconductor nanoparticle assemblies
International Nuclear Information System (INIS)
Lughi, Vanni; Bonifacio, Alois; Barbone, Matteo; Marsich, Lucia; Sergo, Valter
2013-01-01
Hybrid metal–semiconductor nanoparticles consisting of silver nanoparticle cores (AgNPs) coated with a layer of CdSe quantum dots (QDs) have been studied by Raman spectroscopy. The hybrid nanoparticles were prepared via electrostatic interaction by mixing aqueous suspensions of QDs and AgNPs, where opposite charges on the AgNPs and QDs surfaces were induced by opportunely selected capping agents. Assemblies of such hybrid nanoparticles show an increased intensity of the Raman spectrum of up to 500 times, when compared to that of the sole QDs. This enhancement is attributed to the SERS effect (Surface-enhanced Raman scattering). Such enhancement of the Raman modes suggests several opportunities for further research, both in imaging and sensing applications.
SuDS for managing surface water in Diepsloot informal settlement ...
African Journals Online (AJOL)
Sustainable drainage systems (SuDS) imitate natural water management processes in catchments that have been degraded due to urbanisation. The aim is to reduce the quantity of stormwater runoff and improve water quality. Management of rainwater in the informal settlement of Diepsloot in Johannesburg is ...
Mechanically-competent and cytocompatible polycaprolactone-borophosphosilicate hybrid biomaterials.
Mondal, Dibakar; Dixon, S Jeffrey; Mequanint, Kibret; Rizkalla, Amin S
2017-11-01
Organic-inorganic class II hybrid materials have domain sizes at the molecular level and chemical bonding between the organic and inorganic phases. We have previously reported the synthesis of class II hybrid biomaterials from alkoxysilane-functionalized polycaprolactone (PCL) and borophosphosilicate (B 2 O 3 -P 2 O 5 -SiO 2 ) glass (BPSG) through a non-aqueous sol-gel process. In the present study, the mechanical properties and degradability of these PCL/BPSG hybrid biomaterials were studied and compared to those of their conventional composite counterparts. The compressive strength, modulus and toughness of the hybrid biomaterials were significantly greater compared to the conventional composites, likely due to the covalent bonding between the organic and inorganic phases. A hybrid biomaterial (50wt% PCL and 50wt% BPSG) exhibited compressive strength, modulus and toughness values of 32.2 ± 3.5MPa, 573 ± 85MPa and 1.54 ± 0.03MPa, respectively; whereas the values for composite of similar composition were 18.8 ± 1.6MPa, 275 ± 28MPa and 0.76 ± 0.03MPa, respectively. Degradation in phosphate-buffered saline was slower for hybrid biomaterials compared to their composite counterparts. Thus, these hybrid materials possess superior mechanical properties and more controlled degradation characteristics compared to their corresponding conventional composites. To assess in vitro cytocompatibility, MC3T3-E1 pre-osteoblastic cells were seeded onto the surfaces of hybrid biomaterials and polycaprolactone (control). Compared to polycaprolactone, cells on the hybrid material displayed enhanced spreading, focal adhesion formation, and cell number, consistent with excellent cytocompatibility. Thus, based on their mechanical properties, degradability and cytocompatibility, these novel biomaterials have potential for use as scaffolds in bone tissue engineering and related applications. Copyright © 2017. Published by Elsevier Ltd.
Damage spreading on networks: Clustering effects
Indian Academy of Sciences (India)
sensitive to statistical fluctuations compared to conventional Monte Carlo ... Theory. We deal with the DS problem on networks based on Ising model with Glauber ... s = {si(t)} evolve in time, we use Glauber dynamics, the transition probability of.
Okudaira, H; Terada, E; Ogita, T; Aotsuka, S; Yokohari, R
1981-01-01
A solid-phase radioimmunoassay method was devised to detect mouse anti-double strand (ds) DNA antibody. This method could easily detect the anti-dsDNA antibody in 1 : 10,000 dilutions (1 unit) of pooled 9-10-month-old female NZB/W F1 sera. The sensitivity was about 10(3)- and 10(2)-fold higher than that of the modified Farr method and of the double antibody technique respectively. NZB/W mice developed high titer anti-dsDNA antibody as they grew older. Spleen cells brought to a microculture system using flat-bottomed polystyrene plates produced anti-dsDNA antibody clearly detectable by solid-phase radioimmunoassay. Anti-dsDNA antibody produced in vitro (y units) was in close correlation with the anti-dsDNA antibody titer of the spleen donor (x units) (y = 4.8 X 10(-2) x -65, gamma = 0.94, P less than 0.001). A combination of the microculture system and solid-phase radioimmunoassay was recommended for the characterization of anti-dsDNA antibody-forming cells.
International Nuclear Information System (INIS)
Okudaira, H.; Terada, E.; Ogita, T.; Aotsuka, S.; Yokohari, R.
1981-01-01
A solid-phase radioimmunoassay method was devised to detect mouse anti-double strand (ds) DNA antibody. This method could easily detect the anti-ds DNA antibody in 1 : 10,000 dilutions (1 unit) of pooled 9-10 month-old female NZB/W F1 sera. The sensitivity was about 10 3 and 10 2 -fold higher than that of the modified Farr method and of the double antibody technique respectively. NZB/W mice developed high titer anti-dsDNA antibody as they grew older. Spleen cells brought to a microculture system using flat-bottomed polystyrene plates produced anti-dsDNA antibody clearly detectable by solid-phase radioimmunoassay. Anti-dsDNA antibody produced in vitro (y units) was in close correlation with the anti-dsDNA antibody titer of the spleen donor (x units) (y = 4.8 X 10 -2 x-65, γ = 0.94, P < 0.001). A combination of the microculture system and solid-phase radioimmunoassay was recommended for the characterization of anti-dsDNA antibody-forming cells. (Auth.)
Directory of Open Access Journals (Sweden)
Kee-Chaing Chua
2005-02-01
Full Text Available An approximate analytical formulation of the resource allocation problem for handling variable bit rate multiclass services in a cellular round-robin carrier-hopping multirate multicarrier direct-sequence code-division multiple-access (MC-DS-CDMA system is presented. In this paper, all grade-of-service (GoS or quality-of-service (QoS requirements at the connection level, packet level, and link layer are satisfied simultaneously in the system, instead of being satisfied at the connection level or at the link layer only. The analytical formulation shows how the GoS/QoS in the different layers are intertwined across the layers. A novelty of this paper is that the outages in the subcarriers are minimized by spreading the subcarriers' signal-to-interference ratio evenly among all the subcarriers by using a dynamic round-robin carrier-hopping allocation scheme. A complete sharing (CS scheme with guard capacity is used for the resource sharing policy at the connection level based on the mean rates of the connections. Numerical results illustrate that significant gain in the system utilization is achieved through the joint coupling of connection/packet levels and link layer.
Directory of Open Access Journals (Sweden)
Meher Krishna Patel
2017-01-01
Full Text Available This paper presents an adaptive multiuser transceiver scheme for DS-CDMA systems in which pilot symbols are added to users’ data to estimate complex channel fading coefficients. The performance of receiver antenna diversity with maximal ratio combining (MRC technique is analyzed for imperfect channel estimation in flat fading environments. The complex fading coefficients are estimated using least mean square (LMS algorithm and these coefficients are utilized by the maximal ratio combiner for generating the decision variable. Probability of error in closed form is derived. Further, the effect of pilot signal power on bit error rate (BER and BER performance of multiplexed pilot and data signal transmission scenario are investigated. We have compared the performance of added and multiplexed pilot-data systems and concluded the advantages of both systems. The proposed CDMA technique uses the chaotic sequence as spreading sequence. Assuming proper synchronization, the computer simulation results demonstrate the better bit error rate performance in the presence of channel estimator in the chaotic based CDMA system and the receiver antenna diversity technique further improves the performance of the proposed system. Also, no channel estimator is required if there is no phase distortion to the transmitted signal.
Development and material properties of new hybrid plywood from oil palm biomass
International Nuclear Information System (INIS)
Abdul Khalil, H.P.S.; Nurul Fazita, M.R.; Bhat, A.H.; Jawaid, M.; Nik Fuad, N.A.
2010-01-01
Shortage of wood as a raw material has forced wood-based industries to find alternative local raw materials. Currently, oil palm biomass is undergoing research and development (R and D) and appears to be the most viable alternative. This work examines the conversion of oil palm trunk (OPT) and oil palm empty fruit bunches (OPEFB) into new plywood and analyses its properties. We prepared five-ply veneer hybrid plywood (alternating layers of oil palm trunk veneer and empty fruit bunch mat) with different spread levels (300 g/m 2 and 500 g/m 2 ) of resins (phenol formaldehyde and urea formaldehyde). We then studied the mechanical and physical properties of the plywood. The results show that hybridisation of EFB with OPT improves some properties of plywood, such as bending strength, screw withdrawal and shear strength. The thermal properties of the plywood panels were studied by thermogravimetric analysis (TGA). The panels glued with phenol formaldehyde with a spread level of 500 g/m 2 showed better thermal stability than the other panels. Scanning electron microscope (SEM) was used to study the fibre matrix bonding and surface morphology of the plywood at different glue spread levels of the resins. The fibre-matrix bonding showed good improvement for the hybrid panel glued with 500 g/m 2 phenol formaldehyde.
Measurement of the CP asymmetry in B- -> (Ds-D0) and B- -> (D-D0) decays
Aaij, R.; Adeva, B.; Adinolfi, M.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Dufour, L.; Mulder, M; Onderwater, C. J. G.; Pellegrino, A.; Tolk, S.; van Veghel, M.
2018-01-01
The CP asymmetry in B- -> (Ds-D0) and B- -> (D-D0) decays is measured using LHCb data corresponding to an integrated luminosity of 3.0 fb(-1), collected in pp collisions at centre-of-mass energies of 7 and 8TeV. The results are A(CP) (B- -> (Ds-D0)) = (-0.4 +/- 0.5 +/- 0.5)% and A(CP) (B- -> (D-D0))
Carter, Jared D; Pereira, Andy; Dickerman, Allan W; Veilleux, Richard E
2013-05-01
Tomato (Solanum lycopersicum) is a model organism for Solanaceae in both molecular and agronomic research. This project utilized Agrobacterium tumefaciens transformation and the transposon-tagging construct Activator (Ac)/Dissociator (Ds)-ATag-Bar_gosGFP to produce activation-tagged and knockout mutants in the processing tomato cultivar M82. The construct carried hygromycin resistance (hyg), green fluorescent protein (GFP), and the transposase (TPase) of maize (Zea mays) Activator major transcript X054214.1 on the stable Ac element, along with a 35S enhancer tetramer and glufosinate herbicide resistance (BAR) on the mobile Ds-ATag element. An in vitro propagation strategy was used to produce a population of 25 T0 plants from a single transformed plant regenerated in tissue culture. A T1 population of 11,000 selfed and cv M82 backcrossed progeny was produced from the functional T0 line. This population was screened using glufosinate herbicide, hygromycin leaf painting, and multiplex polymerase chain reaction (PCR). Insertion sites of transposed Ds-ATag elements were identified through thermal asymmetric interlaced PCR, and resulting product sequences were aligned to the recently published tomato genome. A population of 509 independent, Ds-only transposant lines spanning all 12 tomato chromosomes has been developed. Insertion site analysis demonstrated that more than 80% of these lines harbored Ds insertions conducive to activation tagging. The capacity of the Ds-ATag element to alter transcription was verified by quantitative real-time reverse transcription-PCR in two mutant lines. The transposon-tagged lines have been immortalized in seed stocks and can be accessed through an online database, providing a unique resource for tomato breeding and analysis of gene function in the background of a commercial tomato cultivar.
APC/C-mediated degradation of dsRNA-binding protein 4 (DRB4 involved in RNA silencing.
Directory of Open Access Journals (Sweden)
Katia Marrocco
Full Text Available Selective protein degradation via the ubiquitin-26S proteasome is a major mechanism underlying DNA replication and cell division in all Eukaryotes. In particular, the APC/C (Anaphase Promoting Complex or Cyclosome is a master ubiquitin protein ligase (E3 that targets regulatory proteins for degradation allowing sister chromatid separation and exit from mitosis. Interestingly, recent work also indicates that the APC/C remains active in differentiated animal and plant cells. However, its role in post-mitotic cells remains elusive and only a few substrates have been characterized.In order to identify novel APC/C substrates, we performed a yeast two-hybrid screen using as the bait Arabidopsis APC10/DOC1, one core subunit of the APC/C, which is required for substrate recruitment. This screen identified DRB4, a double-stranded RNA binding protein involved in the biogenesis of different classes of small RNA (sRNA. This protein interaction was further confirmed in vitro and in plant cells. Moreover, APC10 interacts with DRB4 through the second dsRNA binding motif (dsRBD2 of DRB4, which is also required for its homodimerization and binding to its Dicer partner DCL4. We further showed that DRB4 protein accumulates when the proteasome is inactivated and, most importantly, we found that DRB4 stability depends on APC/C activity. Hence, depletion of Arabidopsis APC/C activity by RNAi leads to a strong accumulation of endogenous DRB4, far beyond its normal level of accumulation. However, we could not detect any defects in sRNA production in lines where DRB4 was overexpressed.Our work identified a first plant substrate of the APC/C, which is not a regulator of the cell cycle. Though we cannot exclude that APC/C-dependent degradation of DRB4 has some regulatory roles under specific growth conditions, our work rather points to a housekeeping function of APC/C in maintaining precise cellular-protein concentrations and homeostasis of DRB4.
An Efficient Code-Timing Estimator for DS-CDMA Systems over Resolvable Multipath Channels
Directory of Open Access Journals (Sweden)
Jian Li
2005-04-01
Full Text Available We consider the problem of training-based code-timing estimation for the asynchronous direct-sequence code-division multiple-access (DS-CDMA system. We propose a modified large-sample maximum-likelihood (MLSML estimator that can be used for the code-timing estimation for the DS-CDMA systems over the resolvable multipath channels in closed form. Simulation results show that MLSML can be used to provide a high correct acquisition probability and a high estimation accuracy. Simulation results also show that MLSML can have very good near-far resistant capability due to employing a data model similar to that for adaptive array processing where strong interferences can be suppressed.
Hybrid Warfare: the 21st Century Russian Way of Warfare
2017-05-25
to wage information operations— from television, to the Internet, to unconventional forces on the ground spreading the message word -of- mouth ...adversarial vulnerabilities. Many of the peculiarities of hybrid warfare described herein are inextricably linked to Russia’s social , political, and...the US election. Then they utilized various means of media to distribute that information with the goal to discredit the US political process and
Kandouci, Chahinaz; Djebbari, Ali
2018-04-01
A new family of two-dimensional optical hybrid code which employs zero cross-correlation (ZCC) codes, constructed by the balanced incomplete block design BIBD, as both time-spreading and wavelength hopping patterns are used in this paper. The obtained codes have both off-peak autocorrelation and cross-correlation values respectively equal to zero and unity. The work in this paper is a computer experiment performed using Optisystem 9.0 software program as a simulator to determine the wavelength hopping/time spreading (WH/TS) OCDMA system performances limitations. Five system parameters were considered in this work: the optical fiber length (transmission distance), the bitrate, the chip spacing and the transmitted power. This paper shows for what sufficient system performance parameters (BER≤10-9, Q≥6) the system can stand for.
Houba-Hérin, N; Domin, M; Pédron, J
1994-07-01
Nicotiana plumbaginifolia haploid protoplasts were co-transformed with two plasmids, one with a NPT-II/Ds element and one with a gene encoding an amino-terminal truncated Ac transposase. It is shown that Ds can efficiently transpose from extrachromosomal DNA to N. plumbaginifolia chromosomes when the Ac transposase gene is present in trans. Ds has been shown to have transposed into the plant genome in a limited number of copies (1.9 copies per genome), for 21/32 transgenic lines tested. The flanking sequences present in the original plasmid are missing in these 21 plants. In only two of 21 plants was part of the transposase construct integrated. By segregation analysis of transgenic progeny, Ds was shown to be present in the heterozygous state in 10 lines even though haploid protoplasts had been originally transformed. This observation could indicate that integration occurred after or during DNA replication that leads to protoplast diploidization.
International Nuclear Information System (INIS)
Wu, Yuqian; Zhang, Yixin; Wang, Qiu; Hu, Zhengda
2016-01-01
For Gaussian beams with three different partially coherent models, including Gaussian-Schell model (GSM), Laguerre-Gaussian Schell-model (LGSM) and Bessel-Gaussian Schell-model (BGSM) beams propagating through a biological turbulent tissue, the expression of the spatial coherence radius of a spherical wave propagating in a turbulent biological tissue, and the average intensity and beam spreading for GSM, LGSM and BGSM beams are derived based on the fractal model of power spectrum of refractive-index variations in biological tissue. Effects of partially coherent model and parameters of biological turbulence on such beams are studied in numerical simulations. Our results reveal that the spreading of GSM beams is smaller than LGSM and BGSM beams on the same conditions, and the beam with larger source coherence width has smaller beam spreading than that with smaller coherence width. The results are useful for any applications involved light beam propagation through tissues, especially the cases where the average intensity and spreading properties of the light should be taken into account to evaluate the system performance and investigations in the structures of biological tissue. - Highlights: • Spatial coherence radius of a spherical wave propagating in a turbulent biological tissue is developed. • Expressions of average intensity and beam spreading for GSM, LGSM and BGSM beams in a turbulent biological tissue are derived. • The contrast for the three partially coherent model beams is shown in numerical simulations. • The results are useful for any applications involved light beam propagation through tissues.
Supersymmetric Hybrid Inflation with Non-Minimal Kähler potential
Bastero-Gil, M; Shafi, Q
2007-01-01
Minimal supersymmetric hybrid inflation based on a minimal Kahler potential predicts a spectral index n_s\\gsim 0.98. On the other hand, WMAP three year data prefers a central value n_s \\approx 0.95. We propose a class of supersymmetric hybrid inflation models based on the same minimal superpotential but with a non-minimal Kahler potential. Including radiative corrections using the one-loop effective potential, we show that the prediction for the spectral index is sensitive to the small non-minimal corrections, and can lead to a significantly red-tilted spectrum, in agreement with WMAP.
International Nuclear Information System (INIS)
Meneghello, Marta; Papadopoulou, Evanthia; Ugo, Paolo; Bartlett, Philip N.
2016-01-01
Interaction with DNA plays an important role in the biological activity of some anticancer drug molecules. In this paper we show that electrochemical surface enhanced Raman spectroscopy at sphere segment void gold electrodes can be used as a highly sensitive technique to measure the redox potential of the anticancer drug mitoxantrone bound to dsDNA. For this system we show that we can follow the redox reaction of the bound molecule and can extract the redox potential for the molecule bound to dsDNA by deconvolution of the SER spectra recorded as a function of electrode potential. We find that mitoxantrone bound to dsDNA undergoes a 2 electron, 1 proton reduction and that the redox potential (-0.87 V vs. Ag/AgCl at pH 7.2) is shifted approximately 0.12 V cathodic of the corresponding value at a glassy carbon electrode. Our results also show that the reduced form of mitoxantrone remains bound to dsDNA and we are able to use the deconvoluted SER spectra of the reduced mitoxantrone as a function of electrode potential to follow the electrochemically driven melting of the dsDNA at more negative potentials.
Marpaung, B.; Patrick, J.
2018-03-01
Systemic Lupus Erythematosus (SLE) is an autoimmune rheumatic disease characterized by widespread inflammation and affects any organism the body. Many autoimmune diseases result in autoantibody production, but Anti-dsDNA antibodies are highly specific to SLE. Previous study found that Anti-dsDNA antibodies are associated with severe clinical manifestations of lupus. The aim of this study was to examine the relationship between anti-dsDNA level with clinical features and laboratory findings in SLE patients. This cross-sectional study was conducted in Hospital Haji Adam Malik Medan in May-October 2016.We examine anti-dsDNA, clinical features and kidney laboratory profile in all patient. Data were statistically analyzed.81 SLE patients with median level of anti-dsDNA 294 (6.1-1317). There was no significant relationship between increased level of Anti-dsDNA with clinical manifestations (p>0.05). There were significant relationships between increased level of Anti-dsDNA with renal impairment (p=0.049), urea level (p=0.016), urine protein (p=0.042) and hematology disorder (p=0.005). Arthritis is the most frequent clinical manifestation (96.3%) followed by malar rash (77.8%). Elevated anti-dsDNA level was not related with clinical manifestations but there was significant relationship with hematology disorder, urea, creatinine, and proteinuria in SLE patents.
Sensitive Fluorescent Sensor for Recognition of HIV-1 dsDNA by Using Glucose Oxidase and Triplex DNA
Directory of Open Access Journals (Sweden)
Yubin Li
2018-01-01
Full Text Available A sensitive fluorescent sensor for sequence-specific recognition of double-stranded DNA (dsDNA was developed on the surface of silver-coated glass slide (SCGS. Oligonucleotide-1 (Oligo-1 was designed to assemble on the surface of SCGS and act as capture DNA, and oligonucleotide-2 (Oligo-2 was designed as signal DNA. Upon addition of target HIV-1 dsDNA (Oligo-3•Oligo-4, signal DNA could bind on the surface of silver-coated glass because of the formation of C•GoC in parallel triplex DNA structure. Biotin-labeled glucose oxidase (biotin-GOx could bind to signal DNA through the specific interaction of biotin-streptavidin, thereby GOx was attached to the surface of SCGS, which was dependent on the concentration of target HIV-1 dsDNA. GOx could catalyze the oxidation of glucose and yield H2O2, and the HPPA can be oxidized into a fluorescent product in the presence of HRP. Therefore, the concentration of target HIV-1 dsDNA could be estimated with fluorescence intensity. Under the optimum conditions, the fluorescence intensity was proportional to the concentration of target HIV-1 dsDNA over the range of 10 pM to 1000 pM, the detection limit was 3 pM. Moreover, the sensor had good sequence selectivity and practicability and might be applied for the diagnosis of HIV disease in the future.
2011-02-23
... UNESCO (IO/UNESCO). Form Number: DS-7646. Respondents: U.S. college and university students applying for... students at U.S. colleges and universities, will submit descriptions of self-designed proposals for brief... Collection: DS-7652, U.S. National Commission for UNESCO Laura W. Bush Traveling Fellowship ACTION: Notice of...
Information spreading dynamics in hypernetworks
Suo, Qi; Guo, Jin-Li; Shen, Ai-Zhong
2018-04-01
Contact pattern and spreading strategy fundamentally influence the spread of information. Current mathematical methods largely assume that contacts between individuals are fixed by networks. In fact, individuals are affected by all his/her neighbors in different social relationships. Here, we develop a mathematical approach to depict the information spreading process in hypernetworks. Each individual is viewed as a node, and each social relationship containing the individual is viewed as a hyperedge. Based on SIS epidemic model, we construct two spreading models. One model is based on global transmission, corresponding to RP strategy. The other is based on local transmission, corresponding to CP strategy. These models can degenerate into complex network models with a special parameter. Thus hypernetwork models extend the traditional models and are more realistic. Further, we discuss the impact of parameters including structure parameters of hypernetwork, spreading rate, recovering rate as well as information seed on the models. Propagation time and density of informed nodes can reveal the overall trend of information dissemination. Comparing these two models, we find out that there is no spreading threshold in RP, while there exists a spreading threshold in CP. The RP strategy induces a broader and faster information spreading process under the same parameters.
Uniform Circular Antenna Array Applications in Coded DS-CDMA Mobile Communication Systems
National Research Council Canada - National Science Library
Seow, Tian
2003-01-01
...) has greatly increased. This thesis examines the use of an equally spaced circular adaptive antenna array at the mobile station for a typical coded direct sequence code division multiple access (DS-CDMA...
Matrix polyelectrolyte capsules based on polysaccharide/MnCO₃ hybrid microparticle templates.
Wei, Qingrong; Ai, Hua; Gu, Zhongwei
2011-06-15
An efficient strategy for biomacromolecule encapsulation based on spontaneous deposition into polysaccharide matrix-containing capsules is introduced in this study. First, hybrid microparticles composed of manganese carbonate and ionic polysaccharides including sodium hyaluronate (HA), sodium alginate (SA) and dextran sulfate sodium (DS) with narrow size distribution were synthesized to provide monodisperse templates. Incorporation of polysaccharide into the hybrid templates was successful as verified by thermogravimetric analysis (TGA) and confocal laser scanning microscopy (CLSM). Matrix polyelectrolyte microcapsules were fabricated through layer-by-layer (LbL) self-assembly of oppositely charged polyelectrolytes (PEs) onto the hybrid particles, followed by removal of the inorganic part of the cores, leaving polysaccharide matrix inside the capsules. The loading and release properties of the matrix microcapsules were investigated using myoglobin as a model biomacromolecule. Compared to matrix-free capsules, the matrix capsules had a much higher loading capacity up to four times; the driving force is mostly due to electrostatic interactions between myoglobin and the polysaccharide matrix. From our observations, for the same kind of polysaccharide, a higher amount of polysaccharide inside the capsules usually led to better loading capacity. The release behavior of the loaded myoglobin could be readily controlled by altering the environmental pH. These matrix microcapsules may be used as efficient delivery systems for various charged water-soluble macromolecules with applications in biomedical fields. Copyright © 2010 Elsevier B.V. All rights reserved.
Senthilkumar, R P; Bhuvaneshwari, V; Ranjithkumar, R; Sathiyavimal, S; Malayaman, V; Chandarshekar, B
2017-11-01
The hybrid chitosan cerium oxide nanoparticles were prepared for the first time by green chemistry approach using plant leaf extract. The intense peak observed around 292nm in the UV-vis spectrum indicate the formation of cerium oxide nanoparticles. The XRD pattern revealed that the hybrid chitosan-cerium oxide nanoparticles have a polycrystalline structure with cubic fluorite phase. The FTIR spectrum of prepared samples showed the formation of Ce-O bonds and chitosan main chains COC and CO. The FESEM image of hybrid chitosan cerium oxide nanoparticles revealed that the particles are spherical in shape with grains size varying from 23.12nm to 89.91nm. EDAX analysis confirmed the presence of Ce, O, C and N elements in the prepared sample. TEM images showed that the prepared hybrid chitosan-cerium oxide nanoparticles are predominantly uniform in size and most of the particles are spherical in shape with less agglomeration and the particles size varies from 3.61nm to 24.40nm. The prepared chitosan cerium oxide nanoparticles of 50μL concentration showed good antibacterial properties against test pathogens, which was confirmed by the FESEM analysis. The prepared small particle size facilitate that these hybrid ChiCO 2 NPs could effectively be used in biomedical applications. Copyright © 2017 Elsevier B.V. All rights reserved.