WorldWideScience

Sample records for huskey amy bowen

  1. Bowen-York tensors

    International Nuclear Information System (INIS)

    Beig, Robert; Krammer, Werner

    2004-01-01

    For a conformally flat 3-space, we derive a family of linear second-order partial differential operators which sends vectors into trace-free, symmetric 2-tensors. These maps, which are parametrized by conformal Killing vectors on the 3-space, are such that the divergence of the resulting tensor field depends only on the divergence of the original vector field. In particular, these maps send source-free electric fields into TT tensors. Moreover, if the original vector field is the Coulomb field on R 3 {0}, the resulting tensor fields on R 3 {0} are nothing but the family of TT tensors originally written by Bowen and York

  2. Bowen Journal of Agriculture: Submissions

    African Journals Online (AJOL)

    Author Guidelines. The following guidelines should be followed by Authors submitting papers to Bowen Journal of Agriculture. Titles: Should be specific, capitalized, bold, centralized and brief. All other headings e.g ABSTRACT, INTRODUCTION, MATERIALS AND METHODS and REFERENCES are also to be capitalized ...

  3. Amie Sluiter | NREL

    Science.gov (United States)

    dollar, cross-laboratory U.S. Department of Energy research projects. Excellent technical writing skills managing personnel and technical oversight. She is highly organized, with a technical background that lends itself to project participation and technical monitoring. Biofuels Sample Characterization Amie began

  4. [The AMY experiment

    International Nuclear Information System (INIS)

    1989-01-01

    The AMY experiment is one of three major experiments at TRISTAN which is studying the states the matter produced in electron positron annihilations in the center of mass energy range of 50--65GeV. It provides information between the lower energy facilities such as PEP and PETRA and the new facilities SLC and LEP which are designed to operate in the region of the Z 0 mass near 90GeV. In the region of the AMY experiment, interaction cross sections are near their minimum of about 100pb, making it difficult to acquire large data samples during typical running cycles. This last year has seen an accumulation of about 10---12pb -1 of integrated luminosity in the energy range from 58 to 61.7GeV. Despite this limited data sample, the AMY experiment has been extremely active in attempting to extract the minimum amount of information from the data. Some of the most significant results are discussed in this paper. 9 refs

  5. Ami - The chemist's amanuensis.

    Science.gov (United States)

    Brooks, Brian J; Thorn, Adam L; Smith, Matthew; Matthews, Peter; Chen, Shaoming; O'Steen, Ben; Adams, Sam E; Townsend, Joe A; Murray-Rust, Peter

    2011-10-14

    The Ami project was a six month Rapid Innovation project sponsored by JISC to explore the Virtual Research Environment space. The project brainstormed with chemists and decided to investigate ways to facilitate monitoring and collection of experimental data.A frequently encountered use-case was identified of how the chemist reaches the end of an experiment, but finds an unexpected result. The ability to replay events can significantly help make sense of how things progressed. The project therefore concentrated on collecting a variety of dimensions of ancillary data - data that would not normally be collected due to practicality constraints. There were three main areas of investigation: 1) Development of a monitoring tool using infrared and ultrasonic sensors; 2) Time-lapse motion video capture (for example, videoing 5 seconds in every 60); and 3) Activity-driven video monitoring of the fume cupboard environs.The Ami client application was developed to control these separate logging functions. The application builds up a timeline of the events in the experiment and around the fume cupboard. The videos and data logs can then be reviewed after the experiment in order to help the chemist determine the exact timings and conditions used.The project experimented with ways in which a Microsoft Kinect could be used in a laboratory setting. Investigations suggest that it would not be an ideal device for controlling a mouse, but it shows promise for usages such as manipulating virtual molecules.

  6. AMI: Augmented Michelson Interferometer

    Science.gov (United States)

    Furió, David; Hachet, Martin; Guillet, Jean-Paul; Bousquet, Bruno; Fleck, Stéphanie; Reuter, Patrick; Canioni, Lionel

    2015-10-01

    Experiments in optics are essential for learning and understanding physical phenomena. The problem with these experiments is that they are generally time consuming for both their construction and their maintenance, potentially dangerous through the use of laser sources, and often expensive due to high technology optical components. We propose to simulate such experiments by way of hybrid systems that exploit both spatial augmented reality and tangible interaction. In particular, we focus on one of the most popular optical experiments: the Michelson interferometer. In our approach, we target a highly interactive system where students are able to interact in real time with the Augmented Michelson Interferometer (AMI) to observe, test hypotheses and then to enhance their comprehension. Compared to a fully digital simulation, we are investigating an approach that benefits from both physical and virtual elements, and where the students experiment by manipulating 3D-printed physical replicas of optical components (e.g. lenses and mirrors). Our objective is twofold. First, we want to ensure that the students will learn with our simulator the same concepts and skills that they learn with traditional methods. Second, we hypothesis that such a system opens new opportunities to teach optics in a way that was not possible before, by manipulating concepts beyond the limits of observable physical phenomena. To reach this goal, we have built a complementary team composed of experts in the field of optics, human-computer interaction, computer graphics, sensors and actuators, and education science.

  7. Bowen ratio over the Norway spruce stand

    Czech Academy of Sciences Publication Activity Database

    Taufarová, Klára; Dvořáková, Marcela; Czerný, Radek; Pokorný, Radek; Janouš, Dalibor

    2007-01-01

    Roč. 20, č. 1 (2007), s. 131-136 ISSN 1803-1013 R&D Projects: GA ČR GD526/03/H036; GA MŽP SM/640/18/03 Institutional research plan: CEZ:AV0Z60870520 Keywords : Bowen ratio * evapotranspiration * transpiration * eddy covariance technique Subject RIV: DG - Athmosphere Sciences, Meteorology

  8. Energy Balance Bowen Ratio (EBBR) Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Cook, D. R. [Argonne National Lab. (ANL), Argonne, IL (United States)

    2016-01-01

    The Energy Balance Bowen Ratio (EBBR) system produces 30-minute estimates of the vertical fluxes of sensible and latent heat at the local surface. Flux estimates are calculated from observations of net radiation, soil surface heat flux, and the vertical gradients of temperature and relative humidity (RH). Meteorological data collected by the EBBR are used to calculate bulk aerodynamic fluxes, which are used in the Bulk Aerodynamic Technique (BA) EBBR value-added product (VAP) to replace sunrise and sunset spikes in the flux data. A unique aspect of the system is the automatic exchange mechanism (AEM), which helps to reduce errors from instrument offset drift.

  9. Distribution of Bowen ratio over the north Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, G.R.L.; Rao, M.V.; Prasad, P.H.; Reddy, K.G.

    The monthly averages of Bowen ratio over the north Indian Ocean have been computed Three typical situations in the months of January May and September are taken for the present study Month to month differences in the Bowen ratio over the study...

  10. The Female Voice: Applications to Bowen's Family Systems Theory.

    Science.gov (United States)

    Knudson-Martin, Carmen

    1994-01-01

    Responds to calls from feminist scholars to address potential biases against women in theories of family therapy. Summarizes findings from studies of female development and integrates findings into expanded model of Bowen's family systems theory. Includes case example comparing expanded model with traditional application of Bowen's theory.…

  11. Bowen's Disease Associated With Two Human Papilloma Virus Types.

    Science.gov (United States)

    Eftekhari, Hojat; Gharaei Nejad, Kaveh; Azimi, Seyyede Zeinab; Rafiei, Rana; Mesbah, Alireza

    2017-09-01

    Bowen's disease (BD) is an epidermal in-situ squamous cell carcinoma (SCC). Most Human Papilloma Viruses (HPV)-positive lesions in Bowen's disease are localized to the genital region or distal extremities (periungual sites) in which HPV type-16 is frequently detected. Patient was a 64-year-old construction worker for whom we detected 2 erythematous psoriasiform reticular scaly plaques on peri-umbilical and medial knee. Biopsy established the diagnosis of Bowen's disease and polymerase chain reaction assay showed HPV-6, -18 co-infection. Patient was referred for surgical excision.

  12. Elizabeth Bowen, Modernism, and the Spectre of Anglo-Ireland

    Directory of Open Access Journals (Sweden)

    James F. Wurtz

    2010-03-01

    Full Text Available The recent scholarly focus on Elizabeth Bowen’s modernism tends to reinforce a false dichotomy between Bowen as an Ascendancy Big House novelist and Bowen as a literary modernist. In keeping with Jameson’s argument that the colonial experience is at the root of Western modernism, I propose that her representations of Anglo-Irish Big House culture, in The Last September in particular, are in fact focal points for understanding Bowen as a modernist, and I argue that the Gothic, with its unavoidable political and colonial resonances, is fundamental to Bowen’s Irish modernism.

  13. Reference material for trace analysis by radioanalytical methods: Bowen's Kale

    International Nuclear Information System (INIS)

    Wainerdi, R.E.

    1979-01-01

    A fairly large volume of published data on 'Bowen's Kale' has been examined critically in order to develop recommendations for the use of this preparation as a 'reference material' in the standardisation and evaluation of the reliability of analytical procedures. Values are now recommended for the contents of twelve elements present in major to trace concentrations in 'Bowen's Kale'. 'Indicated values' for another 16 elements are provided. Values for 15 more elements are listed with no recommendation. The criteria adopted in categorising elements into these groups are discussed. (author)

  14. A case of Bowen's disease on chronic radiodermatitis

    International Nuclear Information System (INIS)

    Ohmori, Masaki; Suenaga, Yoshinori; Fuchi, Kougi.

    1992-01-01

    A 62-year-old female radiologist with chronic radiodermatitis on the dorsal side of her left fingers is reported. She had an occupational history of practicing fluoroscopy for about thirty years. Histopathologically Bowen's disease on the 2nd, 3rd and 4th fingers and squamous cell carcinoma on the 5th finger were found in the radiodermatitis lesion. All the lesions were surgically removed and repaired with a full thickness skin graft. The literature on Bowen's disease caused by radiotherapy and occupational irradiation was also reviewed. (author)

  15. A case of squamous cell carchinoma, basal cell epithelioma and Bowen`s disease arising from chronic radiodermatitis

    Energy Technology Data Exchange (ETDEWEB)

    Matsushima, Hironori; Yamasaki, Kenshi; Hatamochi, Atsushi; Shinkai, Hiroshi [Chiba Univ. (Japan). School of Medicine

    1997-10-01

    We report a case of multiple cancers developing in chronic radiodermatitis. A 43-year-old Japanese male presented with chronic radiodermatitis on both dorsal surfaces of his fingers, following a long-term irradiation by Grenz rays for the treatment of psoriasis vulgaris. At the same site, he developed squamous cell carcinoma and Bowen`s disease 7 years after the last irradiation. Three years later, he noticed a black papule on the dorsal surface of his right middle finger. After a histological examination, this papule diagnosed to be basal cell epithelioma. (author)

  16. Eccrine porocarcinoma arising within an area of Bowen disease.

    LENUS (Irish Health Repository)

    Lowney, A C

    2012-03-01

    Summary Very little is known about the aetiology of eccrine porocarcinoma (EP), a rare malignant sweat-gland tumour. Most reported cases have arisen de novo, or from a benign eccrine poroma. We report an unusual case, in which eccrine porocarcinoma arose at the exact site of pre-existing Bowen disease (BD).

  17. Obituary: George Hamilton Bowen Jr. (1925-2009)

    Science.gov (United States)

    Willson, Lee Anne; Struck, Curtis

    2011-12-01

    Our colleague and collaborator George Hamilton Bowen, Jr., passed away November 1, 2009 in Ames, Iowa. George was born June 20, 1925 in Tulsa, Oklahoma to George and Dorothy (Huntington) Bowen. He married Marjorie Brown June 19, 1948 in Redondo Beach, California; they had five children, with eight grandchildren and five great-grandchildren at the time of his death. George H. Bowen's third or perhaps his fourth career was in astronomy. He was drafted into the navy in 1944, at the end of his first year as a student at Caltech, and ended his war-time service as an electronic technician on the aircraft carrier Shangri-La. He later said "In just nine months, starting from scratch (Ohm's law!), we learned an amazing amount - not by memorization, of course, but by study and real understanding of the basic function of the most advanced AC circuits then being used for instrumentation, measurements, communications, control systems, and much more." He gained a confidence that he could quickly and accurately diagnose and solve technical problems that stood him well in future work. One accomplishment he took particular pride in was figuring out how the radar control used cams and gears to solve the trigonometry for accurate pointing. He also described how the captain was alarmed when weather conditions changed so that refraction no longer showed them distant, small boats around the curvature of Earth. After the war, George Bowen returned to undergraduate and eventually graduate study at Caltech, where he was recruited to the biophysics research group headed by future Nobel Laureate Max Delbrück. George often described his joy in working with these first-rate scientists and finding himself accepted as a part of the effort. He finished his BS with honors in 1949 and his PhD in 1953 with a thesis on "Kinetic Studies on the Mechanism of Photoreactivation of Bacteriophase T2 Inactivated by Ultraviolet Light" involving work with E Coli. This work was supported by grants from the U

  18. All in the family: a belated response to Knudson-Martin's feminist revision of Bowen theory.

    Science.gov (United States)

    Horne, K Blake; Hicks, Mary W

    2002-01-01

    The first formal attempt at revising Bowen theory within the marriage and family therapy literature is represented in the work of Knudson-Martin (1994). Claiming that several of the theory's concepts are defined at odds with female development, Knudson-Martin (1994) reconceptualizes and expands Bowen theory to rectify these perceived shortcomings. In turn, we address several fundamental concerns with Knudson-Martin's critique and revision of Bowen theory. An alternative representation of Bowen Theory, as well as its relationship to feminist thought, is put forth. Suggestions for the field's future relationship to Bowen theory are also discussed.

  19. Spectrophotometry of Bowen resonance fluorescence lines in three planetary nebulae

    Science.gov (United States)

    O'Dell, C. R.; Miller, Christopher O.

    1992-01-01

    The results are presented of a uniquely complete, carefully reduced set of observations of the O III Bowen fluorescence lines in the planetary nebulae NGC 6210, NGC 7027, and NGC 7662. A detailed comparison with the predictions of radiative excitation verify that some secondary lines are enhanced by selective population by the charge exchange mechanism involving O IV. Charge exchange is most important in NGC 6210, which is of significantly lower ionization than the other nebulae. In addition to the principal Bowen lines arising from Ly-alpha pumping of the O III O1 line, lines arising from pumping of the O3 line are also observed. Comparison of lines produced by O1 and O3 with the theoretical predictions of Neufeld indicate poor agreement; comparison with the theoretical predictions of Harrington show agreement with NGC 7027 and NGC 7662.

  20. AMIE Camera System on board SMART-1

    Science.gov (United States)

    Josset, J. L.; Beauvivre, S.; Amie Team

    The Advanced Moon micro-Imager Experiment AMIE on board ESA SMART-1 the first European mission to the Moon launched on 27th September 2003 is an imaging system with scientific technical and public outreach oriented objectives The science objectives are to image the Lunar Poles permanent shadow areas ice deposit eternal light crater rims ancient Lunar Non-mare volcanism local spectro-photometry and physical state of the lunar sur-face and to map high latitudes regions south mainly at far side South Pole Aitken basin The technical objectives are to perform a laserlink experiment detec-tion of laser beam emitted by ESA Tenerife ground station flight demonstration of new technologies and on-board autonomy navigation The public outreach and educational objectives are to promote planetary exploration We present the AMIE instrument and perfomances with respect to the first results

  1. The Reverend Thomas Jefferson Bowen: An Introductory Background to His Linguistic Works, 1850-1856

    Science.gov (United States)

    Awoniyi, Timothy A.

    1974-01-01

    A historical narrative background for the linguistic works of Thomas Jefferson Bowen, an American missionary who was the first non-Nigerian to publish a grammar of Yoruba (1858). The author points up a need for further scholarly review of Bowen's pioneering work and contribution to Yoruba studies. (JT)

  2. All in the Family: A Belated Response to Knudson-Martin's Feminist Revision of Bowen Theory

    Science.gov (United States)

    Horne, K. Blake; Hicks, Mary W.

    2002-01-01

    The first formal attempt at revising Bowen theory within the marriage and family therapy literature is represented in the work of Knudson-Martin (1994). Claiming that several of the theory's concepts are defined at odds with female development, Knudson-Martin (1994) reconceptualizes and expands Bowen theory to rectify these perceived shortcomings.…

  3. Automated material interface (AMI) for mini-environment technology

    International Nuclear Information System (INIS)

    Wolf, M.; Fleming, J.; Mueller, R.; Pulaski, L.

    1993-01-01

    The Automated Material Inter-face or AMI presented here is a new method of automating the input/output of materials or products into mini-environments. The AMI concept and hardware, and preliminary data are presented to show that neither the automation hardware nor the product isolation carrier contribute any significant contamination to the product during the I/O process. Budgetary estimates are presented which support the AMI concept for cost effective manufacturing of advanced semiconductors and disk media

  4. The effects of the Bowen technique on hamstring flexibility over time: a randomised controlled trial.

    Science.gov (United States)

    Marr, Michelle; Baker, Julian; Lambon, Nicky; Perry, Jo

    2011-07-01

    The hamstring muscles are regularly implicated in recurrent injuries, movement dysfunction and low back pain. Links between limited flexibility and development of neuromusculoskeletal symptoms are frequently reported. The Bowen Technique is used to treat many conditions including lack of flexibility. The study set out to investigate the effect of the Bowen Technique on hamstring flexibility over time. An assessor-blind, prospective, randomised controlled trial was performed on 120 asymptomatic volunteers. Participants were randomly allocated into a control group or Bowen group. Three flexibility measurements occurred over one week, using an active knee extension test. The intervention group received a single Bowen treatment. A repeated measures univariate analysis of variance, across both groups for the three time periods, revealed significant within-subject and between-subject differences for the Bowen group. Continuing increases in flexibility levels were observed over one week. No significant change over time was noted for the control group. Copyright © 2010 Elsevier Ltd. All rights reserved.

  5. Thermodynamic and multifractal formalism and the Bowen-series map

    International Nuclear Information System (INIS)

    Rudolph, O.

    1994-07-01

    In the theory of quantum chaos one studies the semiclassical behaviour of quantum mechanical systems whose corresponding classical counterparts exhibit chaos. These systems are sometimes considered as model systems in the theory of quantum chaos since they are well understood from a mathematical point of view. In this work we study the multifractal formalism for the geodesic flow on surfaces with constant negative curvature. The multifractal analysis of measures has been developed in order to characterize the scaling behaviour of measures on attractors of classical chaotic dynamical systems globally. In order to relate the multifractal formalism with quantities usually considered in the study of the geodesic flow on Riemann surfaces with constant negative curvature, it is necessary to establish the assertions of the multifractal formalism in a mathematically rigorous way. This is achieved with the help of the thermodynamic formalism for hyperbolic dynamical systems developed by Ruelle, Bowen and others. (orig.)

  6. Evolution of the ATLAS Metadata Interface (AMI)

    CERN Document Server

    Odier, Jerome; The ATLAS collaboration; Fulachier, Jerome; Lambert, Fabian

    2015-01-01

    The ATLAS Metadata Interface (AMI) can be considered to be a mature application because it has existed for at least 10 years. Over the years, the number of users and the number of functions provided for these users has increased. It has been necessary to adapt the hardware infrastructure in a seamless way so that the Quality of Service remains high. We will describe the evolution of the application from the initial one, using single server with a MySQL backend database, to the current state, where we use a cluster of Virtual Machines on the French Tier 1 Cloud at Lyon, an ORACLE database backend also at Lyon, with replication to CERN using ORACLE streams behind a back-up server.

  7. ATLAS Metadata Interface (AMI), a generic metadata framework

    CERN Document Server

    Fulachier, Jerome; The ATLAS collaboration

    2016-01-01

    The ATLAS Metadata Interface (AMI) is a mature application of more than 15 years of existence. Mainly used by the ATLAS experiment at CERN, it consists of a very generic tool ecosystem for metadata aggregation and cataloguing. We briefly describe the architecture, the main services and the benefits of using AMI in big collaborations, especially for high energy physics. We focus on the recent improvements, for instance: the lightweight clients (Python, Javascript, C++), the new smart task server system and the Web 2.0 AMI framework for simplifying the development of metadata-oriented web interfaces.

  8. ATLAS Metadata Interface (AMI), a generic metadata framework

    Science.gov (United States)

    Fulachier, J.; Odier, J.; Lambert, F.; ATLAS Collaboration

    2017-10-01

    The ATLAS Metadata Interface (AMI) is a mature application of more than 15 years of existence. Mainly used by the ATLAS experiment at CERN, it consists of a very generic tool ecosystem for metadata aggregation and cataloguing. We briefly describe the architecture, the main services and the benefits of using AMI in big collaborations, especially for high energy physics. We focus on the recent improvements, for instance: the lightweight clients (Python, JavaScript, C++), the new smart task server system and the Web 2.0 AMI framework for simplifying the development of metadata-oriented web interfaces.

  9. ATLAS Metadata Interface (AMI), a generic metadata framework

    CERN Document Server

    AUTHOR|(SzGeCERN)573735; The ATLAS collaboration; Odier, Jerome; Lambert, Fabian

    2017-01-01

    The ATLAS Metadata Interface (AMI) is a mature application of more than 15 years of existence. Mainly used by the ATLAS experiment at CERN, it consists of a very generic tool ecosystem for metadata aggregation and cataloguing. We briefly describe the architecture, the main services and the benefits of using AMI in big collaborations, especially for high energy physics. We focus on the recent improvements, for instance: the lightweight clients (Python, JavaScript, C++), the new smart task server system and the Web 2.0 AMI framework for simplifying the development of metadata-oriented web interfaces.

  10. Evolution of the architecture of the ATLAS Metadata Interface (AMI)

    Science.gov (United States)

    Odier, J.; Aidel, O.; Albrand, S.; Fulachier, J.; Lambert, F.

    2015-12-01

    The ATLAS Metadata Interface (AMI) is now a mature application. Over the years, the number of users and the number of provided functions has dramatically increased. It is necessary to adapt the hardware infrastructure in a seamless way so that the quality of service re - mains high. We describe the AMI evolution since its beginning being served by a single MySQL backend database server to the current state having a cluster of virtual machines at French Tier1, an Oracle database at Lyon with complementary replication to the Oracle DB at CERN and AMI back-up server.

  11. Thermodynamic and multifractal formalism and the Bowen-series map

    International Nuclear Information System (INIS)

    Rudolph, O.

    1995-01-01

    In the theory of quantum chaos one studies the semiclassical behaviour of quantum mechanical systems whose corresponding classical counterparts exhibit chaos. The geodesic motion of a free classical particle on closed Riemann surfaces with constant negative curvature is strongly chaotic. Selberg's theory relates the classical and the quantum mechanical systems. These systems are sometimes considered as model systems in the theory of quantum chaos since they are well understood from a mathematical point of view. In this work we study the multifractal formalism for the geodesic flow on surfaces with constant negative curvature. The multifractal analysis of measures has been developed in order to characterize the scaling behaviour of measures on attractors of classical chaotic dynamical systems globally. In order to relate the multifractal formalism with quantities usually considered in the study of the geodesic flow on Riemann surfaces with constant negative curvature, it is necessary to establish the assertions of the multifractal formalism in a mathematically rigorous way. This is achieved with the help of the thermodynamic formalism for hyperbolic dynamical systems developed by Ruelle, Bowen and others. (orig.)

  12. Monitoring with MonAMI: a case study

    Energy Technology Data Exchange (ETDEWEB)

    Millar, A P; Stewart, G A [Department of Physics and Astronomy, University of Glasgow, University Avenue, Glasgow, G12 8QQ (United Kingdom); Cowan, G A [Department of Physics, University of Edinburgh, Edinburgh (United Kingdom)], E-mail: p.millar@physics.gla.ac.uk

    2008-07-15

    Computing resources in HEP are increasingly delivered utilising grid technologies, which presents new challenges in terms of monitoring. Monitoring involves the flow of information between different communities: the various resource-providers and the different user communities. The challenge is providing information so everyone can find what they need: from the local site administrators, regional operational centres through to end-users. To meet this challenge, MonAMI was developed. MonAMI aims to be a universal sensor framework with a plugin architecture. This plugin structure allows flexibility in what is monitored and how the gathered information is reported. MonAMI supports gathering statistics from many standard daemons, such as MySQL and Apache, and system data, such as network sockets and memory consumption. The gathered data can be sent to many monitoring systems, including Ganglia, Nagios, MonALISA and R-GMA. This flexibility allows MonAMI to be integrated into whatever monitoring system is being used. This avoids the current duplication of sensors and allows the gathered statistics to be presented within a greater diversity of monitoring systems. Using the MonAMI framework, sensors have been developed for the DPM and dCache storage systems, both common at HEP grid centres. The development of these tools specifically to tackle the challenges of high availability storage is described. We illustrate how MonAMI's architecture allows a single sensor to both deliver long term trend information and to trigger alarms in abnormal conditions. The use of MonAMI within the ScotGrid distributed Tier-2 is examined as a case study, illustrating both the ease with which MonAMI integrates into existing systems and helps provide a framework for extending monitoring where necessary.

  13. Monitoring with MonAMI: a case study

    International Nuclear Information System (INIS)

    Millar, A P; Stewart, G A; Cowan, G A

    2008-01-01

    Computing resources in HEP are increasingly delivered utilising grid technologies, which presents new challenges in terms of monitoring. Monitoring involves the flow of information between different communities: the various resource-providers and the different user communities. The challenge is providing information so everyone can find what they need: from the local site administrators, regional operational centres through to end-users. To meet this challenge, MonAMI was developed. MonAMI aims to be a universal sensor framework with a plugin architecture. This plugin structure allows flexibility in what is monitored and how the gathered information is reported. MonAMI supports gathering statistics from many standard daemons, such as MySQL and Apache, and system data, such as network sockets and memory consumption. The gathered data can be sent to many monitoring systems, including Ganglia, Nagios, MonALISA and R-GMA. This flexibility allows MonAMI to be integrated into whatever monitoring system is being used. This avoids the current duplication of sensors and allows the gathered statistics to be presented within a greater diversity of monitoring systems. Using the MonAMI framework, sensors have been developed for the DPM and dCache storage systems, both common at HEP grid centres. The development of these tools specifically to tackle the challenges of high availability storage is described. We illustrate how MonAMI's architecture allows a single sensor to both deliver long term trend information and to trigger alarms in abnormal conditions. The use of MonAMI within the ScotGrid distributed Tier-2 is examined as a case study, illustrating both the ease with which MonAMI integrates into existing systems and helps provide a framework for extending monitoring where necessary

  14. Broadband PLC for Clustered Advanced Metering Infrastructure (AMI Architecture

    Directory of Open Access Journals (Sweden)

    Augustine Ikpehai

    2016-07-01

    Full Text Available Advanced metering infrastructure (AMI subsystems monitor and control energy distribution through exchange of information between smart meters and utility networks. A key challenge is how to select a cost-effective communication system without compromising the performance of the applications. Current communication technologies were developed for conventional data networks with different requirements. It is therefore necessary to investigate how much of existing communication technologies can be retrofitted into the new energy infrastructure to cost-effectively deliver acceptable level of service. This paper investigates broadband power line communications (BPLC as a backhaul solution in AMI. By applying the disparate traffic characteristics of selected AMI applications, the network performance is evaluated. This study also examines the communication network response to changes in application configurations in terms of packet sizes. In each case, the network is stress-tested and performance is assessed against acceptable thresholds documented in the literature. Results show that, like every other communication technology, BPLC has certain limitations; however, with some modifications in the network topology, it indeed can fulfill most AMI traffic requirements for flexible and time-bounded applications. These opportunities, if tapped, can significantly improve fiscal and operational efficiencies in AMI services. Simulation results also reveal that BPLC as a backhaul can support flat and clustered AMI structures with cluster size ranging from 1 to 150 smart meters.

  15. Obesity as an Early Symptom of the AMIS Syndrome

    Directory of Open Access Journals (Sweden)

    W. Wayne Lautt

    2014-10-01

    Full Text Available We review evidence that the AMIS (Absence of Meal-induced Insulin Sensitization syndrome describes a paradigm fundamental to development of obesity. The hypoglycemic response to a pulse of insulin is doubled after a meal as a result of Hepatic Insulin Sensitizing Substance (HISS, released from the liver to act selectively on muscle, heart and kidney. In the absence of HISS action, the hypoglycemic response to insulin is the same as in the fasted state, and only half of what it should be. Postprandial hyperglycemia ensues, with compensatory hyperinsulinemia, resultant hyperlipidemia and elevated free radical stress. Storage of nutrient energy shifts from glycogen in muscle to fat. Chronic AMIS results in adiposity, occurs with age, is accelerated with sucrose supplement, and prevented by a synergistic antioxidant. Exercise reverses AMIS, as do pharmaceuticals that mimic the “feeding signals”. The AMIS syndrome develops as a sequence of pathologies based on the consequences of absence of HISS action, including adiposity as the earliest symptom. Cardiac dysfunction, hypertension, hypercholesterolemia, and fatty liver are related to lack of HISS action. The AMIS syndrome hypothesis is mechanistic-based and accounts for the major pathologies associated with prediabetes, obesity, diabetes and metabolic syndrome. AMIS can be diagnosed, prevented and treated.

  16. N III Bowen Lines and Fluorescence Mechanism in the Symbiotic Star AG Peg

    Science.gov (United States)

    Hyung, Siek; Lee, Seong-Jae; Lee, Kang Hwan

    2018-03-01

    We have investigated the intensities and full width at half maximum (FWHM) of the high dispersion spectroscopic N III emission lines of AG Peg, observed with the Hamilton Echelle Spectrograph (HES) in three different epochs at Mt. Hamilton's Lick Observatory. The earlier theoretical Bowen line study assumed the continuum fluorescence effect, presenting a large discrepancy with the present data. Hence, we analyzed the observed N III lines assuming line fluorescence as the only suitable source: (1) The O III and N III resonance line profiles near λ 374 were decomposed, using the Gaussian function, and the contributions from various O III line components were determined. (2) Based on the theoretical resonant N III intensities, the expected N III Bowen intensities were obtained to fit the observed values. Our study shows that the incoming line photon number ratio must be considered to balance at each N III Bowen line level in the ultraviolet radiation according to the observed lines in the optical zone. We also found that the average FWHM of the N III Bowen lines was about 5 km·s-1 greater than that of the O III Bowen lines, perhaps due to the inherently different kinematic characteristics of their emission zones.

  17. Obesity, starch digestion and amylase: association between copy number variants at human salivary (AMY1) and pancreatic (AMY2) amylase genes.

    Science.gov (United States)

    Carpenter, Danielle; Dhar, Sugandha; Mitchell, Laura M; Fu, Beiyuan; Tyson, Jess; Shwan, Nzar A A; Yang, Fengtang; Thomas, Mark G; Armour, John A L

    2015-06-15

    The human salivary amylase genes display extensive copy number variation (CNV), and recent work has implicated this variation in adaptation to starch-rich diets, and in association with body mass index. In this work, we use paralogue ratio tests, microsatellite analysis, read depth and fibre-FISH to demonstrate that human amylase CNV is not a smooth continuum, but is instead partitioned into distinct haplotype classes. There is a fundamental structural distinction between haplotypes containing odd or even numbers of AMY1 gene units, in turn coupled to CNV in pancreatic amylase genes AMY2A and AMY2B. Most haplotypes have one copy each of AMY2A and AMY2B and contain an odd number of copies of AMY1; consequently, most individuals have an even total number of AMY1. In contrast, haplotypes carrying an even number of AMY1 genes have rearrangements leading to CNVs of AMY2A/AMY2B. Read-depth and experimental data show that different populations harbour different proportions of these basic haplotype classes. In Europeans, the copy numbers of AMY1 and AMY2A are correlated, so that phenotypic associations caused by variation in pancreatic amylase copy number could be detected indirectly as weak association with AMY1 copy number. We show that the quantitative polymerase chain reaction (qPCR) assay previously applied to the high-throughput measurement of AMY1 copy number is less accurate than the measures we use and that qPCR data in other studies have been further compromised by systematic miscalibration. Our results uncover new patterns in human amylase variation and imply a potential role for AMY2 CNV in functional associations. © The Author 2015. Published by Oxford University Press.

  18. Obesity, starch digestion and amylase: association between copy number variants at human salivary (AMY1) and pancreatic (AMY2) amylase genes

    Science.gov (United States)

    Carpenter, Danielle; Dhar, Sugandha; Mitchell, Laura M.; Fu, Beiyuan; Tyson, Jess; Shwan, Nzar A.A.; Yang, Fengtang; Thomas, Mark G.; Armour, John A.L.

    2015-01-01

    The human salivary amylase genes display extensive copy number variation (CNV), and recent work has implicated this variation in adaptation to starch-rich diets, and in association with body mass index. In this work, we use paralogue ratio tests, microsatellite analysis, read depth and fibre-FISH to demonstrate that human amylase CNV is not a smooth continuum, but is instead partitioned into distinct haplotype classes. There is a fundamental structural distinction between haplotypes containing odd or even numbers of AMY1 gene units, in turn coupled to CNV in pancreatic amylase genes AMY2A and AMY2B. Most haplotypes have one copy each of AMY2A and AMY2B and contain an odd number of copies of AMY1; consequently, most individuals have an even total number of AMY1. In contrast, haplotypes carrying an even number of AMY1 genes have rearrangements leading to CNVs of AMY2A/AMY2B. Read-depth and experimental data show that different populations harbour different proportions of these basic haplotype classes. In Europeans, the copy numbers of AMY1 and AMY2A are correlated, so that phenotypic associations caused by variation in pancreatic amylase copy number could be detected indirectly as weak association with AMY1 copy number. We show that the quantitative polymerase chain reaction (qPCR) assay previously applied to the high-throughput measurement of AMY1 copy number is less accurate than the measures we use and that qPCR data in other studies have been further compromised by systematic miscalibration. Our results uncover new patterns in human amylase variation and imply a potential role for AMY2 CNV in functional associations. PMID:25788522

  19. A case of Bowen's disease on chronic radiodermatitis

    Energy Technology Data Exchange (ETDEWEB)

    Ohmori, Masaki; Suenaga, Yoshinori (University of Occupational and Environmental Health, Kitakyushu, Fukuoka (Japan)); Fuchi, Kougi

    1992-04-01

    A 62-year-old female radiologist with chronic radiodermatitis on the dorsal side of her left fingers is reported. She had an occupational history of practicing fluoroscopy for about thirty years. Histopathologically Bowen's disease on the 2nd, 3rd and 4th fingers and squamous cell carcinoma on the 5th finger were found in the radiodermatitis lesion. All the lesions were surgically removed and repaired with a full thickness skin graft. The literature on Bowen's disease caused by radiotherapy and occupational irradiation was also reviewed. (author).

  20. Missed Opportunities To Impact Fast Response to AMI Symptoms.

    Science.gov (United States)

    Zapka, Jane G.; Oakes, J. Michael; Simons-Morton, Denise G.; Mann, N. Clay; Goldberg, Robert; Sellers, Deborah E.; Estabrook, Barbara; Gilliland, Janice; Linares, Adriana C.; Benjamin-Garner, Ruby; McGovern, Paul

    2000-01-01

    Examines factors that influence the prompt seeking of care for symptoms of acute myocardial infarction (AMI). Survey of adults in 20 communities in 10 states confirmed the importance of attrition and perceived self-confidence in symptom recognition in care seeking. Concludes that the lack of a significant role of health history and clinician…

  1. Bowen's disease: report of a case in a Nigerian man | Yahya | West ...

    African Journals Online (AJOL)

    Bowen's disease (cutaneous squamous cell carcinoma in situ), like other cancers of the skin, is rare in black people – to our knowledge, only about 43 cases have been published in the medical literature. We report a 59-year old Nigerian man who presented with a five-year history of a mildly pruritic, slowly enlarging ...

  2. The quantitative analysis of Bowen's kale by PIXE using the internal standard

    International Nuclear Information System (INIS)

    Navarrete, V.R.; Izawa, G.; Shiokawa, T.; Kamiya, M.; Morita, S.

    1978-01-01

    The internal standard method was used for non-destructive quantitative determination of trace elements by PIXE. The uniform distribution of the internal standard element in the Bowen's kale powder sample was obtained by using homogenization technique. Eleven elements are determined quantitatively for the sample prepared into self-supporting targets having lower relative standard deviations than non-self-supporting targets. (author)

  3. Technical note: using Distributed Temperature Sensing for Bowen ratio evaporation measurements

    NARCIS (Netherlands)

    Schilperoort, B.; Coenders, Miriam; Luxemburg, W.M.J.; Jimenez Rodriguez, C.D.; Cisneros Vaca2, C.; Savenije, Hubert

    2017-01-01

    Rapid improvements in the precision and spatial resolution of Distributed Temperature Sensing (DTS) technology now allows its use in hydrological and atmospheric sciences. Introduced by Euser [Hydrol. Earth Syst. Sci., 18, 2021–2032 (2014)] is the use of DTS for measuring the Bowen ratio (BR-DTS),

  4. A case of Bowen’s disease responding well to radiotherapy

    Directory of Open Access Journals (Sweden)

    Goknur Kalkan

    2013-08-01

    Full Text Available Bowen’s disease is a form of intraepidermal squamous cell carcinoma which is known as carsinoma in situ. The head, neck, and extremities are the most commonly affected anatomic locations. Treatment options for Bowen’s disease include observation, surgery, cryotherapy, electrodesiccation and curettage, topical application of 5-fluorouracil or imiquimod, Moh’s micrographic surgery, photodynamic therapy, and radiotherapy. Radiation therapy is advantageous in patients who refuse surgery, for large or multiple lesions, for lesions in cosmetically sensitive areas, and in patients who are predisposed to formation of keloids, with a high cure rate cited in the literature. Here we report a 70-year-old man who was diagnosed as Bowen’s disease and completely healed with the treatment of radiotherapy. By means of this case report, we will review the current literature and empasize that radiotherapy is an effective treatment alternative for Bowen's disease in the suitable lesions. [Cukurova Med J 2013; 38(4.000: 813-817

  5. Combustion behaviour of Sydney and Bowen Basin coals determined by thermogravimetry

    Energy Technology Data Exchange (ETDEWEB)

    Benfell, K.E.; Beamish, B.B.; Rodgers, K.A.; Crosdale, P.J. [University of Auckland, Auckland (New Zealand). Department of Geology

    1996-08-01

    Assesses the suitability of thermogravimetric (TG) and derivative thermogravimetric (DTG) analysis techniques to characterise the combustion behaviour of Sydney and Bowen basin coals. Results indicate that the thermogravimetric technique is suitable for characterising the effects of rank, maceral, sub-maceral and seam variations on the combustion behaviour of these coals. 6 refs., 6 figs., 2 tabs.

  6. Interannual variation of the Bowen ratio in a subtropical coniferous plantation in southeast China, 2003-2012.

    Directory of Open Access Journals (Sweden)

    Yakun Tang

    Full Text Available The interannual variation of the Bowen ratio, through its effect on the warming extent of available energy to the ecosystem land surface air, heavily influences the ecosystem microclimate and affects the hydrological cycle at both regional and global scales. Although the precipitation amount in southeast China is not expected to change greatly as a result of climate change, the precipitation frequency may be altered in the future. We explored the interannual variation of the Bowen ratio and its affecting mechanisms based on eddy covariance measurements in a subtropical plantation in southeast China during 2003-2012. The results indicated that the annual mean Bowen ratio was 0.35 ± 0.06, with a range of 0.29-0.45. The Bowen ratio during the dry season (July-October positively correlated with the annual Bowen ratio (R(2 = 0.85, p<0.001. The effective precipitation frequency during the dry season, through its positive effect on shallow soil water content, indirectly and negatively affected the annual Bowen ratio. Between 2003 and 2012, the annual Bowen ratio exhibited a marginally significant decreasing trend (p = 0.061, meanwhile the effective precipitation frequency and shallow soil water content during the dry season increased significantly (p<0.001. The annual Bowen ratio may decrease further if the effective precipitation frequency and shallow soil water content during the dry season follow similar trends in the future. The warming effect of available energy to the surface air of our studied plantation may decline with the decreasing annual Bowen ratio.

  7. [Urs Fischer: faux amis : documentation d'exposition

    OpenAIRE

    2016-01-01

    Tiré du site internet des Musées d'art et d'histoire (www.ville-geneve.ch/mah): "Urs Fischer - Faux Amis propose une sélection inédite d'œuvres de la collection Dakis Joannou, présentée pour la première fois au Musée d'art et d'histoire de Genève. Conçue par le commissaire Massimiliano Gioni comme une synthèse inhabituelle entre une présentation monographique et une exposition de groupe, Faux Amis réunit un ensemble d'œuvres signées Urs Fischer (né en 1973), l'un des artistes suisses les plus...

  8. Coastal wave measurements during passage of tropical storm Amy

    Science.gov (United States)

    Morris, W. D.

    1977-01-01

    Aerial photographic and laser profilometer data of waves generated by tropical storm Amy are presented. The data mission consisted primarily of two legs, one in the direction of the wind waves, and the second along the direction of swell propagation, using Jennette's Pier at Nags Head, North Carolina, as a focal point. At flight time, Amy's center was 512 nmi from shore and had maximum winds of 60 knots. The storm's history is presented, along with a satellite photograph, showing the extent of the storm on the day of the flight. Flight ground tracks are presented along with sample aerial photographs of the wave conditions showing approximate wavelength and direction. Sample wave energy spectra are presented both from the laser profilometer onboard the aircraft, and from the Corps of Engineers Research Center (CERC) shore gauge at Nags Head, North Carolina.

  9. AMiBA: BROADBAND HETERODYNE COSMIC MICROWAVE BACKGROUND INTERFEROMETRY

    International Nuclear Information System (INIS)

    Chen, M.-T.; Li, C.-T.; Hwang, Y.-J.; Jiang Homin; Altamirano, Pablo; Chang, C.-H.; Chang, S.-H.; Chang, S.-W.; Han, C.-C.; Huang, Y.-D.; Kubo, Derek; Martin-Cocher, Pierre; Oshiro, Peter; Raffin, Philippe; Wei Tashun; Chiueh, T.-D.; Chu, T.-H.; Wang Huei; Kesteven, Michael; Wilson, Warwick

    2009-01-01

    The Y. T. Lee Array for Microwave Background (AMiBA) has reported the first results on the detection of galaxy clusters via the Sunyaev-Zel'dovich effect. The objectives required small reflectors in order to sample large-scale structures (20'), while interferometry provided modest resolutions (2'). With these constraints, we designed for the best sensitivity by utilizing the maximum possible continuum bandwidth matched to the atmospheric window at 86-102 GHz, with dual polarizations. A novel wide-band analog correlator was designed that is easily expandable for more interferometer elements. Monolithic millimeter-wave integrated circuit technology was used throughout as much as possible in order to miniaturize the components and to enhance mass production. These designs will find application in other upcoming astronomy projects. AMiBA is now in operation since 2006, and we are in the process to expand the array from seven to 13 elements.

  10. The AMY experiment: Microwave emission from air shower plasmas

    Directory of Open Access Journals (Sweden)

    Alvarez-Muñiz J.

    2016-01-01

    Full Text Available You The Air Microwave Yield (AMY experiment investigate the molecular bremsstrahlung radiation emitted in the GHz frequency range from an electron beam induced air-shower. The measurements have been performed at the Beam Test Facility (BTF of Frascati INFN National Laboratories with a 510 MeV electron beam in a wide frequency range between 1 and 20 GHz. We present the apparatus and the results of the tests performed.

  11. AmI and deployment considerations in AAL services provision for elderly independent living: the MonAMI project.

    Science.gov (United States)

    Falcó, Jorge L; Vaquerizo, Esteban; Lain, Luis; Artigas, Jose Ignacio; Ibarz, Alejandro

    2013-07-12

    The MonAMI project aims to investigate the feasibility of the deployment of open platforms for Ambient Assisted Living (AAL) services provision based on Ambient Intelligence (AmI) and to test user acceptance and the usability of the services. Services were designed to provide support in the areas of environmental control, security, well-being and leisure. These services were installed and evaluated in a Spanish geriatric residence. The participants included elderly persons with disabilities, nursing home care givers and informal carers. The concept of the open platform proved to be satisfactory for the provision of the services in a context aware framework. Furthermore, the usability of the technology was viewed positively and the overall results indicate that this system has the potential to prolong independent living at home for elderly people with disabilities. Deployment was proven successful and awareness of open-platform AAL service delivery was raised in local communities throughout Europe.

  12. AmI and Deployment Considerations in AAL Services Provision for Elderly Independent Living: The MonAMI Project

    Directory of Open Access Journals (Sweden)

    Alejandro Ibarz

    2013-07-01

    Full Text Available The MonAMI project aims to investigate the feasibility of the deployment of open platforms for Ambient Assisted Living (AAL services provision based on Ambient Intelligence (AmI and to test user acceptance and the usability of the services. Services were designed to provide support in the areas of environmental control, security, well-being and leisure. These services were installed and evaluated in a Spanish geriatric residence. The participants included elderly persons with disabilities, nursing home care givers and informal carers. The concept of the open platform proved to be satisfactory for the provision of the services in a context aware framework. Furthermore, the usability of the technology was viewed positively and the overall results indicate that this system has the potential to prolong independent living at home for elderly people with disabilities. Deployment was proven successful and awareness of open-platform AAL service delivery was raised in local communities throughout Europe.

  13. On the possibility of multiple utilization of Bowen's Kale for neutron activation analysis of biological materials

    International Nuclear Information System (INIS)

    Marinov, V.M.; Lazarova, M.S.; Mihajlov, M.I.; Apostolov, D.

    1977-01-01

    The results of investigations related to the multiple utilization of Bowen's Kale in developing neutron-activation methods for determining microelements in biological materials carried out in recent years are presented. Bowen's Kale might be used as: (1) experimental material in the development of a method and its verification, i.e. as a test for biological materials; (2) a material where experimental conditions might be optimized; (3) a material for investigating the accuracy, reproducibility and the limit of proof at experimental conditions already defined; (4) a monitor; (5) a multielement volume reference standard for a number of microelements during their simultaneous determination and (6) a standard for verifying the authenticity of the results obtained. In this manner, a reliable criterion for comparison of the potentialities, the accuracy, reproducibility, the limits of proof and the authenticity of the neutron-activation methods of determining microelements in biological materials is introduced. (author)

  14. Are AMI patients with comorbid mental illness more likely to be admitted to hospitals with lower quality of AMI care?

    Directory of Open Access Journals (Sweden)

    Xueya Cai

    Full Text Available Older patients with comorbid mental illness are shown to receive less appropriate care for their medical conditions. This study analyzed Medicare patients hospitalized for acute myocardial infarction (AMI and determined whether those with comorbid mental illness were more likely to present to hospitals with lower quality of AMI care.Retrospective analyses of Medicare claims in 2008. Hospital quality was measured using the five "Hospital Compare" process indicators (aspirin at admission/discharge, beta-blocker at admission/discharge, and angiotension-converting enzyme inhibitor or angiotension receptor blocker for left ventricular dysfunction. Multinomial logit model determined the association of mental illness with admission to low-quality hospitals (rank of the composite process score 90(th percentile, compared to admissions to other hospitals with medium quality. Multivariate analyses further determined the effects of hospital type and mental diagnosis on outcomes.Among all AMI admissions to 2,845 hospitals, 41,044 out of 287,881 patients were diagnosed with mental illness. Mental illness predicted a higher likelihood of admission to low-quality hospitals (unadjusted rate 2.9% vs. 2.0%; adjusted odds ratio [OR]1.25, 95% confidence interval [CI] 1.17-1.34, p<0.01, and an equal likelihood to high-quality hospitals (unadjusted rate 9.8% vs. 10.3%; adjusted OR 0.97, 95% CI 0.93-1.01, p = 0.11. Both lower hospital quality and mental diagnosis predicted higher rates of 30-day readmission, 30-day mortality, and 1-year mortality.Among Medicare myocardial infarction patients, comorbid mental illness was associated with an increased risk for admission to lower-quality hospitals. Both lower hospital quality and mental illness predicted worse post-AMI outcomes.

  15. Observation of Bowen fluorescence and other phenomena in five symbiotic stars

    International Nuclear Information System (INIS)

    Wallerstein, G.; Garnavich, P.M.; Schachter, J.; Oke, J.B.

    1991-01-01

    Wavelength measurements and line identifications in the 3200-3600 A regions are presented for the symbiotic stars AG Dra, HM Sge, V1016 Cyg, V1329 Cyg, Z And, and R Aqr. The O III lines excited via Bowen's mechanism are analyzed in detail, and a shell model yielding reasonable shell thicknesses and electron densities is described. The Ne/Fe ratio is derived for five of the systems, and spectra in the blue region are briefly described. 42 refs

  16. Genital Bowenʼs Disease in a Bulgarian Patient: Complete Remission after Surgical Approach

    Directory of Open Access Journals (Sweden)

    Georgi Tchernev

    2017-07-01

    Full Text Available A 60-year-old male patient presented with complaints of persistent red to a brown-colored plaque on his scrotum, with duration of approximately three years. The patient had been treated with oral and topical antifungals for inguinal tinea for several months and after that with topical corticosteroids for eczema for several more months. None of the regimens achieved any therapeutic effect. The histopathological evaluation revealed the presence of atypical keratinocytes in all layers of the epidermis with the altered epidermal pattern, spread parabasal mitotic activity, without secondary satellites, multiple dyskeratotic cells and multinucleated cells. The diagnosis of an intraepithelial non-invasive squamous cell carcinoma, associated with koilocytic dysplasia and hyperplasia was made, meeting the criteria for Bowen disease. An elliptic surgical excision of the lesion was made, while the defect was closed with single stitches, with excellent therapeutic and aesthetic result. First described by John T. Bowen in 1912, Bowen disease (BD represents a squamous cell carcinoma (SCC in situ with the potential for significant lateral spread. Treatment options include the application of topical 5-flurorouracil cream – useful in non-hairy areas, imiquimod cream or destructive methods such as radiation, curettage, cryotherapy, laser ablation and photodynamic therapy, especially useful in nail bed involvement. Despite the early lesions, surgical excision is the preferred treatment option, regarding the potential malignant transformation risk.

  17. Evolution of the Architecture of the ATLAS Metadata Interface (AMI)

    CERN Document Server

    Odier, Jerome; The ATLAS collaboration; Fulachier, Jerome; Lambert, Fabian

    2015-01-01

    The ATLAS Metadata Interface (AMI) is now a mature application. Over the years, the number of users and the number of provided functions has dramatically increased. It is necessary to adapt the hardware infrastructure in a seamless way so that the quality of service remains high. We describe the evolution from the beginning of the application life, using one server with a MySQL backend database, to the current state in which a cluster of virtual machines on the French Tier 1 cloud at Lyon, an Oracle database also at Lyon, with replication to Oracle at CERN and a back-up server are used.

  18. Arabidopsis thaliana AMY3 Is a Unique Redox-regulated Chloroplastic α-Amylase

    DEFF Research Database (Denmark)

    Seung, David; Thalmann, Matthias; Sparla, Francesca

    2013-01-01

    α-Amylases are glucan hydrolases that cleave α-1,4-glucosidic bonds in starch. In vascular plants, α-amylases can be classified into three subfamilies. Arabidopsis has one member of each subfamily. Among them, only AtAMY3 is localized in the chloroplast. We expressed and purified AtAMY3 from...... to be dependent on a conserved aspartic acid residue (Asp666), identified as the catalytic nucleophile in other plant α-amylases such as the barley AMY1. AtAMY3 released small linear and branched glucans from Arabidopsis starch granules, and the proportion of branched glucans increased after the predigestion...

  19. Clinical significance of changes of plasma ET and NPY levels after treatment in patients with AMI

    International Nuclear Information System (INIS)

    Zhou Jinbao

    2005-01-01

    Objective: To investigate the changes of plasma ET and NPY levels in patients with AMI. Methods: Plasma ET and NPY levels were dynamically determined in 36 patients with AMI right after establishment of diagnosis and 8h, 24h, 4ph, 72h, 7d, 14d later. Levels in 35 healthy individuals were taken as control. Results: Before treatment was initiated, the levels of Et and Np in patients with AMI were significantly higher than those in controls (P <0.01). After one week of treatment, the levels dropped toward normal. Conclusion: Dynamic measurement of plasma ET and NPY levels in patients with AMI is of clinical importance. (authors)

  20. A case of squamous cell carchinoma, basal cell epithelioma and Bowen's disease arising from chronic radiodermatitis

    International Nuclear Information System (INIS)

    Matsushima, Hironori; Yamasaki, Kenshi; Hatamochi, Atsushi; Shinkai, Hiroshi

    1997-01-01

    We report a case of multiple cancers developing in chronic radiodermatitis. A 43-year-old Japanese male presented with chronic radiodermatitis on both dorsal surfaces of his fingers, following a long-term irradiation by Grenz rays for the treatment of psoriasis vulgaris. At the same site, he developed squamous cell carcinoma and Bowen's disease 7 years after the last irradiation. Three years later, he noticed a black papule on the dorsal surface of his right middle finger. After a histological examination, this papule diagnosed to be basal cell epithelioma. (author)

  1. A Bowen Family Systems Model of Generalized Anxiety Disorder and Romantic Relationship Distress.

    Science.gov (United States)

    Priest, Jacob B

    2015-07-01

    Many individuals with generalized anxiety disorder (GAD) do not respond well to currently available treatments. Moreover, treatments are less effective when GAD is accompanied by romantic relationship distress. In order to develop effective treatments for GAD and relationship distress, it is necessary to conduct theory-based research to identify links common to both GAD and romantic relationship distress. Drawing on Bowen's family systems theory, the roles of family abuse/violence and differentiation in GAD and romantic relationship distress were examined using existing data from the National Comorbidity Survey Replication (n = 2,312; 2005). As predicted, family abuse/violence was directly linked to both GAD and romantic relationship distress. Differentiation mediated the relationship between family abuse/violence and GAD, and partially mediated the relationship between family abuse/violence and romantic relationship distress. Findings suggest that current and past relationship processes may help maintain chronic anxiety and that Bowen's theory may be a useful framework for developing couple therapy treatment of GAD and romantic relationship distress. © 2013 American Association for Marriage and Family Therapy.

  2. Comparison of AMI-25 enhanced MRI and helical dynamic CT in the detection of hepatic lesions

    International Nuclear Information System (INIS)

    Saitou, Kazuhiro; Matsuda, Hiromichi; Fukushima, Hiroaki; Kanzaki, Hiroshi; Hirose, Takashi; Karizaki, Dai; Abe, Kimihiko; Amino, Saburou

    1994-01-01

    We performed AMI-25 enhanced MRI and helical dynamic CT in 12 cases of hepatic lesions. Nine of these were hepatocellular carcinomas. Two cases were metastatic liver tumors (the primary lesion was gastric in one and the other was gallbladder cancer). One case was suspected to be adenomatous hyperplasia. Thirty-two lesions were detected in T2-weighted SE images before AMI-25 administration, while 46 lesions were detected in AMI-25 enhanced MRI images. In particular, AMI-25 enhanced MRI was superior to plain MRI in lesions less than 10 mm in size. A total of 48 lesions were detected in helical dynamic CT. Although AMI-25 enhanced MRI almost equaled helical dynamic CT in the detection of liver tumors, helical dynamic CT was slightly superior to AMI-25 enhanced MRI in the detection of subphrenic lesions. It was possible to know the hemodynamics in each hepatic lesion by helical dynamic CT. AMI-25 enhanced MRI was useful to know the inclusion of reticuloendothelial system, and that yielded different diagnoses in adenomatous hyperplasia and well differentiated hepatocellular carcinoma. Helical dynamic CT was useful for qualitative diagnosis. Both AMI-25 enhanced MRI and helical dynamic CT contributed to the detection of liver tumor and qualitative diagnosis. (author)

  3. Expression, purification and functional characterization of AmiA of acetamidase operon of Mycobacterium smegmatis.

    Science.gov (United States)

    Sundararaman, Balaji; Palaniyandi, Kannan; Venkatesan, Arunkumar; Narayanan, Sujatha

    2014-11-01

    Regulation of gene expression is one of the mechanisms of virulence in pathogenic organisms. In this context, we would like to understand the gene regulation of acetamidase enzyme of Mycobacterium smegmatis, which is the first reported inducible enzyme in mycobacteria. The acetamidase is highly inducible and the expression of this enzyme is increased 100-fold when the substrate acetamide is added. The acetamidase structural gene (amiE) is found immediately downstream of three predicted open reading frames (ORFs). Three of these genes along with a divergently expressed ORF are predicted to form an operon and involved in the regulation of acetamidase enzyme. Here we report expression, purification and functional characterization of AmiA which is one of these predicted ORFs. Electrophoretic mobility shift assays showed that AmiA binds to the region between the amiA and amiD near the predicted promoter (P2). Over-expression of AmiA significantly lowered the expression of acetamidase compared to the wild type as demonstrated by qRT-PCR and SDS-PAGE. We conclude that AmiA binds near P2 promoter and acts as a repressor in the regulation of acetamidase operon. The described work is a further step forward toward broadening the knowledge on understanding of the complex gene regulatory mechanism of Mycobacterium sp. Copyright © 2014 Elsevier GmbH. All rights reserved.

  4. Report for fiscal 1993 on feasibility study for development of overseas coal. Bowen coal field, Australia; 1993 nendo kaigaitan kaihatsu kanosei chosa hokokusho. Australia koku Bowen tanden

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1993-09-01

    Discussions were given on the possibility of development as a coal supply source for Japan on the area centering around the Bowen coal field, whose coal exploration right was made open by the state government of Queensland, Australia in March 1993. Surveys were performed on information about the release of restrictions and the bid on the coal exploration right area RA55, the current status of the coal industry in Queensland, infrastructures, and the coal related government organizations. The following conclusions were arrived as a result of the surveys: the RA55 area to which the coal exploration right was made open has mining areas remaining, which are possible of supplying coals for an extended period of time from both of quantity and quality aspects; particularly in the 12 mining areas under the open bid, high-quality ordinary coal and raw material coal are in existence, whose potential is high; the state government and the related organizations are enthusiastic in promoting the development because the coal industry is the largest industry in the state; for new coal development, such assistance is expected as improvement in the infrastructures, deregulation, and favorable taxation system; and implementations are desired on acquisition of the exploration right, and exploration activities for new coal development. (NEDO)

  5. Health and aging in elderly farmers: the AMI cohort

    Directory of Open Access Journals (Sweden)

    Pérès Karine

    2012-07-01

    Full Text Available Abstract Background The health of the agricultural population has been previously explored, particularly in relation to the farming exposures and among professionally active individuals. However, few studies specifically focused on health and aging among elders retired from agriculture. Yet, this population faces the long-term effects of occupational exposures and multiple difficulties related to living and aging in rural area (limited access to shops, services, and practitioners. However, these difficulties may be counter-balanced by advantages related to healthier lifestyle, richer social support and better living environment. The general aim of the AMI cohort was to study health and aging in elderly farmers living in rural area through a multidisciplinary approach, with a main focus on dementia. Methods/design The study initially included 1 002 participants, randomly selected from the Farmer Health Insurance rolls. Selection criteria were: being 65 years and older; living in rural area in Gironde (South-Western France; being retired from agriculture after at least 20 years of activity and being affiliated to the Health Insurance under own name. The study started in 2007, with two follow-up visits over 5 years. Baseline visits were conducted at home by a neuropsychologist then by a geriatrician for all cases suspected of dementia, Parkinson’s disease and depression (to confirm the diagnosis, and by a nurse for others. A large panel of data were collected through standardised questionnaires: complete neuropsychological assessment, material and social living environment, psychological transition to retirement, lifestyle (smoking, alcohol and diet, medications, disability in daily living, sensory impairments and some clinical measures (blood pressure, depression symptomatology, anxiety, visual test, anthropometry…. A blood sampling was performed with biological measurements and constitution of a biological bank, including DNA. Brain MRI

  6. In vivo microvascular imaging of cutaneous actinic keratosis, Bowen's disease and squamous cell carcinoma using dynamic optical coherence tomography

    DEFF Research Database (Denmark)

    Themstrup, L; Pellacani, G; Welzel, J

    2017-01-01

    BACKGROUND: A clear distinction between actinic keratosis (AK), Bowen's disease (BD) and squamous cell carcinoma (SCC) cannot reliably be made by clinical and dermoscopic evaluation alone. Dynamic optical coherence tomography (D-OCT) is a novel angiographic variant of OCT that allows for non...

  7. SCC, Bowen's disease and BCC arising on chronic radiation dermatitis due to radiation therapy for tinea pedis

    International Nuclear Information System (INIS)

    Aoki, Eri; Aoki, Mikako; Ikemura, Akiko; Igarashi, Tsukasa; Suzuki, Kayano; Kawana, Seiji

    2000-01-01

    We reported a case who developed three different types of skin cancers: SCC, BCC, and Bowen's disease, on the chronic radiation dermatitis. He had been treated for his tinea pedis et palmaris with radiotherapy in 1940's. It is very ratre that three different types of skin cancers arise in the same patient. This is a second case reported in Japan. (author)

  8. Technical note: Using distributed temperature sensing for Bowen ratio evaporation measurements

    Science.gov (United States)

    Schilperoort, Bart; Coenders-Gerrits, Miriam; Luxemburg, Willem; Jiménez Rodríguez, César; Cisneros Vaca, César; Savenije, Hubert

    2018-01-01

    Rapid improvements in the precision and spatial resolution of distributed temperature sensing (DTS) technology now allow its use in hydrological and atmospheric sciences. Introduced by ) is the use of DTS for measuring the Bowen ratio (BR-DTS), to estimate the sensible and latent heat flux. The Bowen ratio is derived from DTS-measured vertical profiles of the air temperature and wet-bulb temperature. However, in previous research the measured temperatures were not validated, and the cables were not shielded from solar radiation. Additionally, the BR-DTS method has not been tested above a forest before, where temperature gradients are small and energy storage in the air column becomes important. In this paper the accuracy of the wet-bulb and air temperature measurements of the DTS are verified, and the resulting Bowen ratio and heat fluxes are compared to eddy covariance data. The performance of BR-DTS was tested on a 46 m high tower in a mixed forest in the centre of the Netherlands in August 2016. The average tree height is 26 to 30 m, and the temperatures are measured below, in, and above the canopy. Using the vertical temperature profiles the storage of latent and sensible heat in the air column was calculated. We found a significant effect of solar radiation on the temperature measurements, leading to a deviation of up to 3 K. By installing screens, the error caused by sunlight is reduced to under 1 K. Wind speed seems to have a minimal effect on the measured wet-bulb temperature, both below and above the canopy. After a simple quality control, the Bowen ratio measured by DTS correlates well with eddy covariance (EC) estimates (r2 = 0.59). The average energy balance closure between BR-DTS and EC is good, with a mean underestimation of 3.4 W m-2 by the BR-DTS method. However, during daytime the BR-DTS method overestimates the available energy, and during night-time the BR-DTS method estimates the available energy to be more negative. This difference could be

  9. Testing a model of codependency for college students in Taiwan based on Bowen's concept of differentiation.

    Science.gov (United States)

    Chang, Shih-Hua

    2018-04-01

    The purpose of this study was to test a model of codependency based on Bowen's concept of differentiation for college students in Taiwan. The relations between family-of-origin dysfunction, differentiation of self, codependency traits and related symptoms including low self-esteem, relationship distress and psychological adjustment problems were examined. Data were collected from 567 college students from 2 large, urban universities in northern Taiwan. Results indicated a significantly negative relationship between levels of codependency and self-differentiation and that self-differentiation partially mediated the relationship between family-of-origin dysfunction and codependency. The implications of these findings for counselling Taiwanese college students who experience codependency traits and related symptoms as well as suggestions for future research are discussed. © 2016 International Union of Psychological Science.

  10. Divided Spirits. Tequila, Mezcal, and The Politics of Production, de Sarah Bowen

    Directory of Open Access Journals (Sweden)

    Olga I. Mancha Caceres

    2017-05-01

    Full Text Available Sarah Bowen, profesora asociada del Departamento de Sociologia y Antropologia de la Universidad Estatal de Carolina del Norte, presenta en Divided Spirits. Tequila, Mezcal, and The Politics of Production, el resultado de algo mas de una década de trabajo sobre las denominaciones de origen (DO en México, Francia y Estados Unidos, en el que nos presenta un profundo analisis del complejo mundo de la producción y comercialización del tequila y el mezcal ¿dos productos identitarios de México?, las dinamicas sociales, económicas y politicas que promueven y el papel de sus multiples y desiguales actores involucrados.

  11. Anomalously high intercombination line ratios in symbiotic stars; extreme Bowen pumping?

    International Nuclear Information System (INIS)

    Kastner, S.O.; Bhatia, A.K.; Feibelman, W.A.

    1989-01-01

    We assemble International Ultraviolet Explorer observations of the ratio of the O III intercombination lines near 1660 A, showing that the observed ratios in symbiotic stars are significantly higher than the theoretically predicted optically thin limit of 2.5. The presence of an enhancing physical process is thereby indicated. It is suggested that Bowen pumping of the lower level of the 1666.2 A line in an 'external saturation' limit, coupled with appreciable optical depth, could logically explain the high ratios. Some tentative evidence for this is presented and the relevance of far-infrared observations of the O III 51.8 and 88.3 μm lines in symbiotic sources is emphasized. (author)

  12. [Acute myocardial infarction in Morocco: FES-AMI registry data].

    Science.gov (United States)

    Akoudad, H; El Khorb, N; Sekkali, N; Mechrafi, A; Zakari, N; Ouaha, L; Lahlou, I

    2015-12-01

    Acute myocardial infarction is the most dangerous complication of coronary atherothrombosis. There are several disparities in regard to its management around the world. The aim of this study is to analyze the specificities of management of acute myocardial infarction in Morocco. FES-AMI (Fès Acute Myocardial Infarction) is a prospective monocentric registry conducted in cardiology department of Hassan II university hospital in Fès. In this registry, we enrolled patients with acute myocardial infarction who presented within 5 days after symptom onset. From January 2005 to August 2015, we enrolled 1835 patients. Seventy-five percent of patients were males and mean age was 60 years old. Fifty-one percent of patients were smokers, 27% were hypertensives and 14% were diabetics. Sixty-six percent of patients had more than 2 risk factors. Time from symptom onset to hospital admission was less than six hours for 40% of the patients. Thirty-six percent of patients were admitted more than twelve hours after the onset of chest pain. Only 37% of patients received reperfusion therapy, 31% with in-hospital thrombolysis and 6% with primary angioplasty. In-hospital mortality was 7.6%. The patients enrolled in our registry have late presentation of acute myocardial infarction and less rate of reperfusion therapy. Furthermore, the majority of our patients have multiple risk factors and this result underlines the failure of preventive interventions. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  13. Layered AMI Architecture for Various Grid Topologies and Communication Technologies

    Directory of Open Access Journals (Sweden)

    I. Petruševski

    2016-06-01

    Full Text Available Advanced metering infrastructure (AMI system, proposed in this paper, is capable of fulfilling all smart metering functionalities in real-time. The novel Local Metering Concentrator (LMC layer is introduced as the set of independent embedded system components, allowing distributed architecture implementation. Two main data flows can be defined as command request processing and meter data acquisition. A command request, initiated by some of the top layer applications, is processed and forwarded through the system to the LMC layer, where the request is executed and the status is sent as a reply. The data and event acquisition is performed as an automatic function of the LMC layer. The collected data is forwarded to the system as soon as it is downloaded from the meters. The results of more than one-year exploitation of the installed pilot system are presented, emphasizing the real-time load profile data acquisition, allowing the distribution system operators (DSO and the end consumer to be actively involved in energy saving. The introduced architecture enables load profiling, energy diagnostic and easy integration with any meter data management system.

  14. Lunar photometric modelling with SMART-1/AMIE imaging data

    International Nuclear Information System (INIS)

    Wilkman, O.; Muinonen, K.; Videen, G.; Josset, J.-L.; Souchon, A.

    2014-01-01

    We investigate the light-scattering properties of the lunar mare areas. A large photometric dataset was extracted from images taken by the AMIE camera on board the SMART-1 spacecraft. Inter-particle shadowing effects in the regolith are modelled using ray-tracing simulations, and then a phase function is fit to the data using Bayesian techniques and Markov chain Monte Carlo. Additionally, the data are fit with phase functions computed from radiative-transfer coherent-backscatter (RT-CB) simulations. The results indicate that the lunar photometry, including both the opposition effect and azimuthal effects, can be explained well with a combination of inter-particle shadowing and coherent backscattering. Our results produce loose constraints on the mare physical properties. The RT-CB results indicate that the scattering volume element is optically thick. In both the Bayesian analysis and the RT-CB fit, models with lower packing density and/or higher surface roughness always produce better fits to the data than densely packed, smoother ones

  15. ARM MJO Investigation Experiment on Gan Island (AMIE-Gan) Science Plan

    Energy Technology Data Exchange (ETDEWEB)

    Long, CL; Del Genio, A; Deng, M; Fu, X; Gustafson, W; Houze, R; Jakob, C; Jensen, M; Johnson, R; Liu, X; Luke, E; May, P; McFarlane, S; Minnis, P; Schumacher, C; Vogelmann, A; Wang, Y; Webster, P; Xie, S; Zhang, C

    2011-04-11

    The overarching campaign, which includes the ARM Mobile Facility 2 (AMF2) deployment in conjunction with the Dynamics of the Madden-Julian Oscillation (DYNAMO) and the Cooperative Indian Ocean experiment on intraseasonal variability in the Year 2011 (CINDY2011) campaigns, is designed to test several current hypotheses regarding the mechanisms responsible for Madden-Julian Oscillation (MJO) initiation and propagation in the Indian Ocean area. The synergy between the proposed AMF2 deployment with DYNAMO/CINDY2011, and the corresponding funded experiment on Manus, combine for an overarching ARM MJO Investigation Experiment (AMIE) with two components: AMF2 on Gan Island in the Indian Ocean (AMIE-Gan), where the MJO initiates and starts its eastward propagation; and the ARM Manus site (AMIE-Manus), which is in the general area where the MJO usually starts to weaken in climate models. AMIE-Gan will provide measurements of particular interest to Atmospheric System Research (ASR) researchers relevant to improving the representation of MJO initiation in climate models. The framework of DYNAMO/CINDY2011 includes two proposed island-based sites and two ship-based locations forming a square pattern with sonde profiles and scanning precipitation and cloud radars at both island and ship sites. These data will be used to produce a Variational Analysis data set coinciding with the one produced for AMIE-Manus. The synergy between AMIE-Manus and AMIE-Gan will allow studies of the initiation, propagation, and evolution of the convective cloud population within the framework of the MJO. As with AMIE-Manus, AMIE-Gan/DYNAMO also includes a significant modeling component geared toward improving the representation of MJO initiation and propagation in climate and forecast models. This campaign involves the deployment of the second, marine-capable, AMF; all of the included measurement systems; and especially the scanning and vertically pointing radars. The campaign will include sonde

  16. Low AMY1 Gene Copy Number Is Associated with Increased Body Mass Index in Prepubertal Boys.

    Directory of Open Access Journals (Sweden)

    M Loredana Marcovecchio

    Full Text Available Genome-wide association studies have identified more than 60 single nucleotide polymorphisms associated with Body Mass Index (BMI. Additional genetic variants, such as copy number variations (CNV, have also been investigated in relation to BMI. Recently, the highly polymorphic CNV in the salivary amylase (AMY1 gene, encoding an enzyme implicated in the first step of starch digestion, has been associated with obesity in adults and children. We assessed the potential association between AMY1 copy number and a wide range of BMI in a population of Italian school-children.744 children (354 boys, 390 girls, mean age (±SD: 8.4±1.4years underwent anthropometric assessments (height, weight and collection of saliva samples for DNA extraction. AMY1 copies were evaluated by quantitative PCR.A significant increase of BMI z-score by decreasing AMY1 copy number was observed in boys (β: -0.117, p = 0.033, but not in girls. Similarly, waist circumference (β: -0.155, p = 0.003, adjusted for age was negatively influenced by AMY1 copy number in boys. Boys with 8 or more AMY1 copy numbers presented a significant lower BMI z-score (p = 0.04 and waist circumference (p = 0.01 when compared to boys with less than 8 copy numbers.In this pediatric-only, population-based study, a lower AMY1 copy number emerged to be associated with increased BMI in boys. These data confirm previous findings from adult studies and support a potential role of a higher copy number of the salivary AMY1 gene in protecting from excess weight gain.

  17. Migration of the ATLAS Metadata Interface (AMI) to Web 2.0 and cloud

    Science.gov (United States)

    Odier, J.; Albrand, S.; Fulachier, J.; Lambert, F.

    2015-12-01

    The ATLAS Metadata Interface (AMI), a mature application of more than 10 years of existence, is currently under adaptation to some recently available technologies. The web interfaces, which previously manipulated XML documents using XSL transformations, are being migrated to Asynchronous JavaScript (AJAX). Web development is considerably simplified by the introduction of a framework based on JQuery and Twitter Bootstrap. Finally, the AMI services are being migrated to an OpenStack cloud infrastructure.

  18. Deploying the ATLAS Metadata Interface (AMI) on the cloud with Jenkins

    Science.gov (United States)

    Lambert, F.; Odier, J.; Fulachier, J.; ATLAS Collaboration

    2017-10-01

    The ATLAS Metadata Interface (AMI) is a mature application of more than 15 years of existence. Mainly used by the ATLAS experiment at CERN, it consists of a very generic tool ecosystem for metadata aggregation and cataloguing. AMI is used by the ATLAS production system, therefore the service must guarantee a high level of availability. We describe our monitoring and administration systems, and the Jenkins-based strategy used to dynamically test and deploy cloud OpenStack nodes on demand.

  19. Deploying the ATLAS Metadata Interface (AMI) on the cloud with Jenkins.

    CERN Document Server

    AUTHOR|(SzGeCERN)637120; The ATLAS collaboration; Odier, Jerome; Fulachier, Jerome

    2017-01-01

    The ATLAS Metadata Interface (AMI) is a mature application of more than 15 years of existence. Mainly used by the ATLAS experiment at CERN, it consists of a very generic tool ecosystem for metadata aggregation and cataloguing. AMI is used by the ATLAS production system, therefore the service must guarantee a high level of availability. We describe our monitoring and administration systems, and the Jenkins-based strategy used to dynamically test and deploy cloud OpenStack nodes on demand.

  20. Characteristics of myocardial perfusion imaging and coronary artery angiography in patients of NIDDM complicated with AMI

    International Nuclear Information System (INIS)

    Zhao Peiqin; Zhao Jinhua; Qin Mingzhao; Dai HaoJie; Zhang Runwu; Xiao Fen

    2001-01-01

    Objective: To investigate the characteristic changes of myocardial perfusion imaging and coronary artery angiography in patients of acute myocardial infarction (AMI) with underlined type 2 diabetes mellitus. Methods: 25 type 2 diabetes mellitus patients were enrolled for having clinical manifestation of AMI. Ten inpatients with AMI of simple coronary heart disease origin were served as controls. All subjects underwent both myocardial perfusion imagings (resting and nitroglycerine invention) and coronary artery angiography. Results: Compared to controls (40%), type 2 diabetes mellitus + AMI group had higher rate of multivessel disease (60%). For type 2 diabetes mellitus + AMI patients, 129/400 segments (32.25%) showed fixed defect, 25/160 segments (15.62%) in controls. Conclusions: For type 2 diabetes mellitus + AMI group, myocardial perfusion defects are widely distributed and multivessel or severe stenosis is more often presented. Good correlation exists between abnormal segments and angiographic lesions in both the number of segments involved and the severity of the lesions. Radionuclide myocardial perfusion is therefore considered a useful screening test not inferior to angiography, especially for those who are not tolerant enough to undergoing angiography

  1. Profile of acute myocardial infarction (ami) in pakistan

    International Nuclear Information System (INIS)

    Jafary, M.H.; Samad, A.; Ishaq, M.; Jawaid, S.A.; Vohra, E.A.

    2007-01-01

    While doing the study on Aspirin Awareness and Usage (AAUS) in cases of Acute Coronary Syndrome (ACS), AAUS study Group designed the protocol to include the profile of patients presenting with symptoms of ACS and in the light of that also reviewed the available data in South Asian population. A prospective study was carried out in 17 coronary care units (CCUs) in all 4 provinces of Pakistan. Patients included were males and females of all age groups presenting with chest pain, diagnosed to have Coronary Artery Disease (CAD) and categorized into Unstable Angina (USA), STEMI or NSTEMI, based on clinical, ECG and enzymatic criteria. The risk factors, family history, dietary history, time to reach ER after the onset of symptoms, management of ACS in CCU and outcome of treatment were recorded. A total of 1,527 patients presented to the Emergency Room (ER) with chest pain but around 1400 patients were evaluable. The majority (68%) were males. The mean age of all patients was 52.2+-10.7 years. 28.3% patients were <45 years. Average time to presentation at ER was 13.2+-6.2 hours. 92.7% patients presented with chest pain. More than half the patients had hypertension (55.2%) and or smoking (52%) as the risk factors while 37.2 % had diabetes and 18.2% had hyperlipidemia. Hypertension (52.7%), IHD (44%) and Diabetes (36.2%) figured prominently in the family history. USA and STEMI were the major types of ACS (43.0% and 40.5% respectively). At discharge 67.8% of patients were stable without symptoms, 13.3% were stable but with symptoms, 16.4% were referred for further investigations and 2.5% had died. The review of the available data in Pakistan, supported by the present study in a cohort of 1400 patients from 17 CCUs in the country, the emerging profile of patients with AMI is that the majority are male, relatively younger as compared to Western population, have smoking and hypertension followed by diabetes as the major risk factors. USA and STEMI are the dominant types of ACS

  2. Spectrophotometry near the atmospheric cutoff of the strongest Bowen resonance fluorescence lines of O III in two planetary nebulae

    Science.gov (United States)

    O'Dell, C. R.; Opal, Chet B.

    1989-01-01

    Spectrophotometric results are presented for the stronger, well-resolved Bowen O III resonance fluorescence emission lines in the planetary nebulae 7027 and NGC 7662 down to and including the intrinsically strong line at 3133 A. These data are combined with results from the IUE atlas of spectra and similar results for the longer wavelength lines by Likkel and Aller (1986) to give the first full coverage of the Bowen lines. Good agreement is found with fluorescence theory for the primary cascade lines, except for the Likkel and Aller results. The efficiency of conversion of the exciting He II Ly-alpha into O III lines is determined, and values comparable to other planetary nebulae are found.

  3. Information from geology: Implications for soil formation and rehabilitation in the post coal mining environment, Bowen Basin, Australia

    International Nuclear Information System (INIS)

    Spain, A.V.; Esterle, J.; McLennan, T.P.T.

    1995-01-01

    The coal mining industry is likely to disturb as much as 60,000 ha of the Bowen Basin up to the year 2000. While comprising only a small proportion of the approximately 32,000 km 2 of the Bowen Basin, this considerable area will eventually need to be rehabilitated by creating appropriate land forms with a stabilizing and self-sustaining cover of vegetation. The job of restoring the disturbed area will fall to the practitioners of rehabilitation science. This paper briefly outlines the actual and potential significance of geological information to rehabilitation practice in the open-cut coal mining industry of the Bowen Basin. It focuses particularly on the problems of soil formation and the consequent limitations to ecosystem development due to the nature of the overburden materials and the environment. Lastly, it describes some of the distinctive features of the mine-soils of the area. Geological information can assist in the identification, classification, description and behaviour of post-mining materials. Potential inputs are not restricted to these and there is scope for wider inputs to management of the mining environment although the interface with biology requires further development. (author). 4 figs., 31 refs

  4. Bowen emission from Aquila X-1: evidence for multiple components and constraint on the accretion disc vertical structure

    Science.gov (United States)

    Jiménez-Ibarra, F.; Muñoz-Darias, T.; Wang, L.; Casares, J.; Mata Sánchez, D.; Steeghs, D.; Armas Padilla, M.; Charles, P. A.

    2018-03-01

    We present a detailed spectroscopic study of the optical counterpart of the neutron star X-ray transient Aquila X-1 during its 2011, 2013 and 2016 outbursts. We use 65 intermediate resolution GTC-10.4 m spectra with the aim of detecting irradiation-induced Bowen blend emission from the donor star. While Gaussian fitting does not yield conclusive results, our full phase coverage allows us to exploit Doppler mapping techniques to independently constrain the donor star radial velocity. By using the component N III 4640.64/4641.84 Å, we measure Kem = 102 ± 6 km s-1. This highly significant detection (≳13σ) is fully compatible with the true companion star radial velocity obtained from near-infrared spectroscopy during quiescence. Combining these two velocities we determine, for the first time, the accretion disc opening angle and its associated error from direct spectroscopic measurements and detailed modelling, obtaining α = 15.5 ^{+ 2.5}_{-5} deg. This value is consistent with theoretical work if significant X-ray irradiation is taken into account and is important in the light of recent observations of GX339-4, where discrepant results were obtained between the donor's intrinsic radial velocity and the Bowen-inferred value. We also discuss the limitations of the Bowen technique when complete phase coverage is not available.

  5. Health Information Management Leaders and the Practice of Leadership through the Lens of Bowen Theory

    Science.gov (United States)

    Sheridan, Patty Thierry; Watzlaf, Valerie; Fox, Leslie Ann

    2016-01-01

    Even though leadership is one of the most examined topics in the organizational literature, its application in the field of health information management (HIM) has not been studied extensively. This descriptive, mixed-methodology study examined HIM leadership through the lens of Bowen theory. The researchers conducted surveys of HIM directors and managers, administrators and colleagues of HIM leaders, and HIM staff using focus groups, observations of meetings, and face-to-face interviews. Results showed that HIM leaders are valued for HIM expertise in electronic health records, privacy, security, and coding; for being the center or heart of the organization; and for commonly valued leadership behaviors and skills including dependability, strategic planning, project management, listening ability, and fairness. Leadership was seen as a reciprocal process, and a team approach was preferred. Good communication, education, and training on HIM topics were also valued. However, HIM leaders believed that they spend more time on management activities than on leadership activities, although they would prefer the reverse. Future research is needed to examine how HIM leadership can be practiced more consistently in the workplace across different HIM functions. PMID:27134609

  6. Health Information Management Leaders and the Practice of Leadership through the Lens of Bowen Theory.

    Science.gov (United States)

    Sheridan, Patty Thierry; Watzlaf, Valerie; Fox, Leslie Ann

    2016-01-01

    Even though leadership is one of the most examined topics in the organizational literature, its application in the field of health information management (HIM) has not been studied extensively. This descriptive, mixed-methodology study examined HIM leadership through the lens of Bowen theory. The researchers conducted surveys of HIM directors and managers, administrators and colleagues of HIM leaders, and HIM staff using focus groups, observations of meetings, and face-to-face interviews. Results showed that HIM leaders are valued for HIM expertise in electronic health records, privacy, security, and coding; for being the center or heart of the organization; and for commonly valued leadership behaviors and skills including dependability, strategic planning, project management, listening ability, and fairness. Leadership was seen as a reciprocal process, and a team approach was preferred. Good communication, education, and training on HIM topics were also valued. However, HIM leaders believed that they spend more time on management activities than on leadership activities, although they would prefer the reverse. Future research is needed to examine how HIM leadership can be practiced more consistently in the workplace across different HIM functions.

  7. Copy number variation of human AMY1 is a minor contributor to variation in salivary amylase expression and activity.

    Science.gov (United States)

    Carpenter, Danielle; Mitchell, Laura M; Armour, John A L

    2017-02-20

    Salivary amylase in humans is encoded by the copy variable gene AMY1 in the amylase gene cluster on chromosome 1. Although the role of salivary amylase is well established, the consequences of the copy number variation (CNV) at AMY1 on salivary amylase protein production are less well understood. The amylase gene cluster is highly structured with a fundamental difference between odd and even AMY1 copy number haplotypes. In this study, we aimed to explore, in samples from 119 unrelated individuals, not only the effects of AMY1 CNV on salivary amylase protein expression and amylase enzyme activity but also whether there is any evidence for underlying difference between the common haplotypes containing odd numbers of AMY1 and even copy number haplotypes. AMY1 copy number was significantly correlated with the variation observed in salivary amylase production (11.7% of variance, P structure may affect expression, but this was not significant in our data.

  8. Complex Copy Number Variation of AMY1 does not Associate with Obesity in two East Asian Cohorts.

    Science.gov (United States)

    Yong, Rita Y Y; Mustaffa, Su'Aidah B; Wasan, Pavandip S; Sheng, Liang; Marshall, Christian R; Scherer, Stephen W; Teo, Yik-Ying; Yap, Eric P H

    2016-07-01

    The human amylase gene locus at chromosome 1p21.1 is structurally complex. This region contains two pancreatic amylase genes, AMY2B, AMY2A, and a salivary gene AMY1. The AMY1 gene harbors extensive copy number variation (CNV), and recent studies have implicated this variation in adaptation to starch-rich diets and in association to obesity for European and Asian populations. In this study, we showed that by combining quantitative PCR and digital PCR, coupled with careful experimental design and calibration, we can improve the resolution of genotyping CNV with high copy numbers (CNs). In two East Asian populations of Chinese and Malay ethnicity studied, we observed a unique non-normal distribution of AMY1 diploid CN genotypes with even:odd CNs ratio of 4.5 (3.3-4.7), and an association between the common AMY2A CN = 2 genotype and odd CNs of AMY1, that could be explained by the underlying haplotypic structure. In two further case-control cohorts (n = 932 and 145, for Chinese and Malays, respectively), we did not observe the previously reported association between AMY1 and obesity or body mass index. Improved methods for accurately genotyping multiallelic CNV loci and understanding the haplotype complexity at the AMY1 locus are necessary for population genetics and association studies. © 2016 WILEY PERIODICALS, INC.

  9. A Power Planning Algorithm Based on RPL for AMI Wireless Sensor Networks.

    Science.gov (United States)

    Miguel, Marcio L F; Jamhour, Edgard; Pellenz, Marcelo E; Penna, Manoel C

    2017-03-25

    The advanced metering infrastructure (AMI) is an architecture for two-way communication between electric, gas and water meters and city utilities. The AMI network is a wireless sensor network that provides communication for metering devices in the neighborhood area of the smart grid. Recently, the applicability of a routing protocol for low-power and lossy networks (RPL) has been considered in AMI networks. Some studies in the literature have pointed out problems with RPL, including sub-optimal path selection and instability. In this paper, we defend the viewpoint that careful planning of the transmission power in wireless RPL networks can significantly reduce the pointed problems. This paper presents a method for planning the transmission power in order to assure that, after convergence, the size of the parent set of the RPL nodes is as close as possible to a predefined size. Another important feature is that all nodes in the parent set offer connectivity through links of similar quality.

  10. amiA is a negative regulator of acetamidase expression in Mycobacterium smegmatis

    Directory of Open Access Journals (Sweden)

    Turner Jane

    2001-08-01

    Full Text Available Abstract Background The acetamidase of Mycobacterium smegmatis is a highly inducible enzyme. Expression of this enzyme is increased 100-fold when the substrate acetamide is present. The acetamidase gene is found immediately downstream of three open reading frames. Two of these are proposed to be involved in regulation. Results We constructed a deletion mutant in one of the upstream ORFs (amiA. This mutant (Mad1 showed a constitutively high level of acetamidase expression. We identified four promoters in the upstream region using a β-galactosidase reporter gene. One of these (P2 was inducible in the wild-type, but was constitutively active in Mad1. Conclusions These results demonstrate that amiA encodes a negative regulatory protein which interacts with P2. Since amiA has homology to DNA-binding proteins, it is likely that it exerts the regulatory effect by binding to the promoter to prevent transcription.

  11. Low Rate of Detection of Mucosal High-Risk-Type Human Papillomavirus in Korean Patients with Extragenital Bowen's Disease and Squamous Cell Carcinoma, Especially in Digital Cases

    Directory of Open Access Journals (Sweden)

    Hye-Rim Park

    2013-01-01

    Full Text Available Human papillomavirus (HPV infection has been demonstrated in some of the nonmelanoma skin cancers as well as in precancerous lesions. Multiple infections of mucosal high-risk HPV may contribute to the onset of digital Bowen's disease through, if any, digital-genital transmission. We screened for the presence of the mucosal HPV DNA in patients with extragenital Bowen's disease (, squamous cell carcinoma (, bowenoid papulosis (, verrucous carcinoma (, actinic keratosis (, and basal cell carcinoma (. We used a PANArray HPV Genotyping Chip for high-risk and low-risk mucosal types. Genotyping data was confirmed using a conventional direct DNA sequencing method. Two cases of extragenital Bowen's disease were positive for types 16 and 33 of mucosal HPV, respectively. None of the squamous cell carcinoma cases were positive. Neither patients with digital Bowen's disease ( nor those with squamous cell carcinoma ( showed any mucosal high-risk HPV. Mucosal high-risk HPV DNA was confirmed in 5 (55.6% of the 9 patients with bowenoid papulosis. HPV 16 was most prevalent (, while the DNA of HPVs 35 and 67 was detected in one sample for each of the two types. Our study demonstrated that two (6.7% of the patients with 30 extragenital Bowen's disease were positive for types 16 and 33 of mucosal HPV, respectively. HPVs belonging to the mucosal high-risk group may participate in the development of extragenital Bowen's disease. However, we could not find any relationship between the mucosal high-risk HPV and Bowen's disease or squamous cell carcinoma in the fingers.

  12. Rethinking the starch digestion hypothesis for AMY1 copy number variation in humans.

    Science.gov (United States)

    Fernández, Catalina I; Wiley, Andrea S

    2017-08-01

    Alpha-amylase exists across taxonomic kingdoms with a deep evolutionary history of gene duplications that resulted in several α-amylase paralogs. Copy number variation (CNV) in the salivary α-amylase gene (AMY1) exists in many taxa, but among primates, humans appear to have higher average AMY1 copies than nonhuman primates. Additionally, AMY1 CNV in humans has been associated with starch content of diets, and one known function of α-amylase is its involvement in starch digestion. Thus high AMY1 CNV is considered to result from selection favoring more efficient starch digestion in the Homo lineage. Here, we present several lines of evidence that challenge the hypothesis that increased AMY1 CNV is an adaptation to starch consumption. We observe that α- amylase plays a very limited role in starch digestion, with additional steps required for starch digestion and glucose metabolism. Specifically, we note that α-amylase hydrolysis only produces a minute amount of free glucose with further enzymatic digestion and glucose absorption being rate-limiting steps for glucose availability. Indeed α-amylase is nonessential for starch digestion since sucrase-isomaltase and maltase-glucoamylase can hydrolyze whole starch granules while releasing glucose. While higher AMY1 CN and CNV among human populations may result from natural selection, existing evidence does not support starch digestion as the major selective force. We report that in humans α-amylase is expressed in several other tissues where it may have potential roles of evolutionary significance. © 2017 Wiley Periodicals, Inc.

  13. Voltage Harmonics Monitoring in a Microgrid Based on Advanced Metering Infrastructure (AMI)

    DEFF Research Database (Denmark)

    Firoozabadi, Mehdi Savaghebi; Guan, Yajuan; Quintero, Juan Carlos Vasquez

    2015-01-01

    Smart meters are the main part of Advanced Metering Infrastructure (AMI) and are usually able to provide detailed information on customers’ energy consumptions, voltage variations and interruptions. In addition, these meters are potentially able to provide more information about power quality (PQ......) disturbances. This paper will address the monitoring of voltage harmonics utilizing the features of smart meters and AMI system. To do this, the first step is to select proper indices to quantify the distortion. An important point which should be considered in this regard is the limited processing power...

  14. Migration of the ATLAS Metadata Interface (AMI) to Web 2.0 and cloud

    CERN Document Server

    Odier, Jerome; The ATLAS collaboration; Fulachier, Jerome; Lambert, Fabian

    2015-01-01

    The ATLAS Metadata Interface (AMI) can be considered to be a mature application because it has existed for at least 10 years. Over the last year, we have been adapting the application to some recently available technologies. The web interface, which previously manipulated XML documents using XSL transformations, has been migrated to Asynchronous Java Script (AJAX). Web development has been considerably simplified by the development of a framework for AMI based on JQuery and Twitter Bootstrap. Finally there has been a major upgrade of the python web service client.

  15. Deploying the ATLAS Metadata Interface (AMI) on the cloud with Jenkins

    CERN Document Server

    Lambert, Fabian; The ATLAS collaboration

    2016-01-01

    The ATLAS Metadata Interface (AMI) is a mature application of more than 15 years of existence. Mainly used by the ATLAS experiment at CERN, it consists of a very generic tool ecosystem for metadata aggregation and cataloguing. AMI is used by the ATLAS production system, therefore the service must guarantee a high level of availability. We describe our monitoring system and the Jenkins-based strategy used to dynamically test and deploy cloud OpenStack nodes on demand. Moreover, we describe how to switch to a distant replica in case of downtime.

  16. Science goals and expected results from the smart-1 amie multi-coulour micro-camera

    Science.gov (United States)

    Josset, J.-L.; AMIE Team

    2003-04-01

    The Advanced Moon micro-Imager Experiment (AMIE), which will be on board ESA SMART-1, the first European mission to the Moon (launch foreseen in 2003), is an imaging system with scientific, technical and public outreach oriented objectives. The science objectives are to image the Lunar South Pole (Aitken basin), permanent shadow areas (ice deposit), eternal light (crater rims), ancient Lunar Nonmare volcanism, local spectro-photometry and physical state of the lunar surface, and to map high latitudes regions (south) mainly at far side. The main science goals and the expected results from the AMIE multi-colour micro-camera are presented.

  17. Determination of chromium in Bowen's kale, NBS bovine liver, and brewers yeast, before and after dry ashing

    International Nuclear Information System (INIS)

    Versieck, J.; Hoste, J.; De Rudder, J.; Barbier, F.; Vanballenberghe, L.

    1979-01-01

    In view of the persistent controversy about the volatility of chromium in biologic materials, the element was determined by neutron activation analysis in three reference materials before and after dry ashing up to 450 0 C. The following mean values were obtained: 0.364 μg/g and 0.362 μg/g (Bowen's kale), 0.0806 μg/g and 0.0789 μg/g (NBS bovine liver), 2.043 μg/g and 2.094 μg/g (NBS brewers yeast). It was concluded that chromium does not volatilize significantly in experimental conditions of drying and ashing

  18. Audio-Visual Processing in Meetings: Seven Questions and Current AMI Answers

    NARCIS (Netherlands)

    Al-Hamas, Marc; Hain, Thomas; Cernocky, Jan; Schreiber, Sascha; Poel, Mannes; Rienks, R.J.

    2007-01-01

    The project Augmented Multi-party Interaction (AMI) is concerned with the development of meeting browsers and remote meeting assistants for instrumented meeting rooms – and the required component technologies R&D themes: group dynamics, audio, visual, and multimodal processing, content abstraction,

  19. Test Review: An Interview with Amy Gabel--About the WISC-V

    Science.gov (United States)

    Greathouse, Dan; Shaughnessy, Michael F.

    2016-01-01

    Whenever a major intelligence or achievement test is revised, there is always renewed interest in the underlying structure of the test as well as a renewed interest in the scoring, administration, and interpretation changes. In this interview, Amy Gabel discusses the most recent revision of the "Wechsler Intelligence Scale for Children-Fifth…

  20. Amy Tan, Author of "The Joy Luck Club." (People to Know).

    Science.gov (United States)

    Kramer, Barbara

    This book, aimed at the young reader, explores the life and career of the Chinese-American author, Amy Tan. It follows her childhood in Oakland, California, through her struggle to accept her Chinese heritage, through her education and marriage to a non-Chinese man, to her early work as a business writer, and finally to her great success as a…

  1. Now that California has AMI, what can the state do with it?

    International Nuclear Information System (INIS)

    Woo, C.K.; Kollman, E.; Orans, R.; Price, S.; Horii, B.

    2008-01-01

    Recognizing the lack of retail-demand response, a state regulator, such as the California Public Utilities Commission (CPUC), seeks tariff proposals that transmit wholesale price signals to a local distribution company's (LDC) retail customers. To enable these proposals, the CPUC has authorized funding for advanced metering infrastructure (AMI) for two investor-owned LDCs. Assuming regulatory approval of the third LDC's application, the state's US$4.28 billion AMI investment will aid new rate designs for 11.3 million electricity customers. Now that California has AMI, what can the state do with it? With AMI in hand, an LDC can implement service options that can further the state's energy initiatives, ranging from resource adequacy requirement (RAR) to greenhouse gas (GHG) emissions reduction. These options can efficiently allocate limited capacity based on each customer's willingness to pay, without the unnecessary distinction between price rationing and reliability differentiation. They can be Pareto superior, welfare dominating the default tariffs that apply to these customers. A case in point is the generalized demand subscription service (GDSS) option proposed in this paper. However, it is unclear whether the option will find wide customer acceptance, without an LDC's intensive customer education and marketing efforts

  2. Beneficial effect of a high number of copies of salivary amylase AMY1 gene on obesity risk in Mexican children.

    Science.gov (United States)

    Mejía-Benítez, María A; Bonnefond, Amélie; Yengo, Loïc; Huyvaert, Marlène; Dechaume, Aurélie; Peralta-Romero, Jesús; Klünder-Klünder, Miguel; García Mena, Jaime; El-Sayed Moustafa, Julia S; Falchi, Mario; Cruz, Miguel; Froguel, Philippe

    2015-02-01

    Childhood obesity is a major public health problem in Mexico, affecting one in every three children. Genome-wide association studies identified genetic variants associated with childhood obesity, but a large missing heritability remains to be elucidated. We have recently shown a strong association between a highly polymorphic copy number variant encompassing the salivary amylase gene (AMY1 also known as AMY1A) and obesity in European and Asian adults. In the present study, we aimed to evaluate the association between AMY1 copy number and obesity in Mexican children. We evaluated the number of AMY1 copies in 597 Mexican children (293 obese children and 304 normal weight controls) through highly sensitive digital PCR. The effect of AMY1 copy number on obesity status was assessed using a logistic regression model adjusted for age and sex. We identified a marked effect of AMY1 copy number on reduced risk of obesity (OR per estimated copy 0.84, with the number of copies ranging from one to 16 in this population; p = 4.25 × 10(-6)). The global association between AMY1 copy number and reduced risk of obesity seemed to be mostly driven by the contribution of the highest AMY1 copy number. Strikingly, all children with >10 AMY1 copies were normal weight controls. Salivary amylase initiates the digestion of dietary starch, which is highly consumed in Mexico. Our current study suggests putative benefits of high number of AMY1 copies (and related production of salivary amylase) on energy metabolism in Mexican children.

  3. Medium dependent dual turn on/turn off fluorescence sensing for Cu2 + ions using AMI/SDS assemblies

    Science.gov (United States)

    Gujar, Varsha B.; Ottoor, Divya

    2017-02-01

    Behavior of Amiloride (AMI) as a metal ion sensor in anionic surfactant assemblies of varying concentrations at different pH is depicted in this work. From a non-sensor fluorophore, AMI has been transformed in to a tunable fluorosensor for Cu2 + ions in various SDS concentrations. At premicellar concentration of SDS, ion-pair complex is expected to be formed between AMI and SDS due to electrostatic interactions between them. However at CMC concentrations of SDS, fluorescence intensity of AMI is greatly enhanced with red shift in emission, due to the incorporation of AMI molecule in the hydrophobic micellar interface. The behavior of metal sensing by AMI-SDS assemblies gives rise to several interesting observations. Micellation of SDS has been greatly enhanced by increasing copper ion concentrations, as these counter ions screens the charge on monomers of SDS which lead to the aggregation at premicellar concentrations only. Concentrations and pH dependent discrete trends of interactions between SDS-AMI and SDS-Cu2 + ions, have given tunable fluorescence responses (fluorescence turn on/turn off) of AMI for added Cu2 + ions. The electrostatic interaction between the metal cations and the anionic surfactants is the driving force for bringing the metal ions near to the vicinity of micelle where AMI resides. Thus, a comprehensive understanding of the mechanism related to the 'turn on-turn off' fluorescence response of AMI with respect to pH and SDS concentration for effective Cu2 + ion sensing is illustrated in this work.

  4. The thermal history of the Bowen Basin: a comparison of apatite fission track analysis and vitrinite reflectance

    International Nuclear Information System (INIS)

    Marshallsea, S.J.

    1987-01-01

    Vitrinite reflectance and apatite fission-track analysis (AFTA) are two techiques widely used to assess paleotemperatures of the order of 20-120 deg.C. in sedimentary basins. Whereas vitrinite reflectance is essentially a qualitative technique that gives an integrated measure of the entire thermal history, AFTA can reveal information on the variation of paleotemperatures through time because fission-tracks in apatite are continually produced throughout geological time. An apatite fission track study of the Upper Permian units of the Bowen Basin has offered the opportunity to compare the two paleotemperature indicators and place constraints on the timing of maximum paleotemperatures. The regional pattern of apatite fission-track ages closely coincides with the vitrinite reflectance indicating that maximum paleotemperatures have varied across the Basin with the central region of the Bowen Basin experiencing highest paleotemperatures. The reduction in apatite reflectance fission-track age with increasing reflectance represents the progressive annealing at temperatures around 60-120 deg. C. of those fission-tracks formed prior to the time of maximum temperatures. In those samples giving the youngest apatite fission-track ages all tacks were totally annealed at this time, and the fission-track age in these samples, in the range 90-120 Myr, indicate the time of cooling from the thermal maximum in the Early Cretaceous. 1 ref

  5. Enhanced ID-Based Authentication Scheme Using OTP in Smart Grid AMI Environment

    Directory of Open Access Journals (Sweden)

    Sang-Soo Yeo

    2014-01-01

    Full Text Available This paper presents the vulnerabilities analyses of KL scheme which is an ID-based authentication scheme for AMI network attached SCADA in smart grid and proposes a security-enhanced authentication scheme which satisfies forward secrecy as well as security requirements introduced in KL scheme and also other existing schemes. The proposed scheme uses MDMS which is the supervising system located in an electrical company as a time-synchronizing server in order to synchronize smart devices at home and conducts authentication between smart meter and smart devices using a new secret value generated by an OTP generator every session. The proposed scheme has forward secrecy, so it increases overall security, but its communication and computation overhead reduce its performance slightly, comparing the existing schemes. Nonetheless, hardware specification and communication bandwidth of smart devices will have better conditions continuously, so the proposed scheme would be a good choice for secure AMI environment.

  6. Using AMIE data to study cloud processes within the Madden-Julian Oscillation

    Energy Technology Data Exchange (ETDEWEB)

    Houze, Robert A. [Univ. of Washington, Seattle, WA (United States). Dept. of Atmospheric Sciences

    2015-12-17

    This study uses AMIE data to show how the small clouds in the Madden-Julian Oscillation first organize into lines and other patterns, how they develop the first rainshowers, how those showers deposit cool air over the ocean surface, how this cool air spreads and triggers deeper convection, how the deep convection develops into mesoscale systems, how the mesoscale systems modify the heating profile through the depth of the troposphere, and how the development of the clouds responds to and interacts with large-scale waves circumnavigating the globe at upper levels, and how equatorial trapped waves at lower levels modulates the development of the cloud population. The techniques used to analyze the radar and sounding data collected in AMIE to achieve the above results are innovative, and to obtain more general results we have used regional modeling with a variety of cloud microphysical schemes in combination with the data analyses.

  7. VerSAMI: Versatile and Scalable key management for Smart Grid AMI systems

    OpenAIRE

    Benmalek , Mourad; Challal , Yacine; Derhab , Abdelouahid; Bouabdallah , Abdelmadjid

    2018-01-01

    International audience; In this paper, we propose four new key management schemes for Advanced Metering Infrastructure (AMI) to secure data communications in the Smart Grid (SG). The schemes are based on individual and batch rekeying operations using a novel multi-group key graph structure, are also versatile in the sense that they can support broadcast, unicast, as well as multicast communications. Security analysis shows that our schemes satisfy key management security properties. Furthermo...

  8. Towards Efficient Energy Management: Defining HEMS, AMI and Smart Grid Objectives

    DEFF Research Database (Denmark)

    Rossello Busquet, Ana; Kardaras, Georgios; Soler, José

    2011-01-01

    electricity in the grid will also help to reduce the increase of energy consumption in the future. In order to reduce energy consumption in home environments, researches have been designing Home Energy Management Systems (HEMS). In addition, Advanced Metering Infrastructure (AMI) and smart grids are also...... being developed to distribute and produce electricity efficiently. This paper presents the high level goals and requirements of HEMS. Additionally, it gives an overview of Advanced Metering Infrastructure benefits and smart grids objectives....

  9. PLATFORM DEFORMATION PHASE CORRECTION FOR THE AMiBA-13 COPLANAR INTERFEROMETER

    Energy Technology Data Exchange (ETDEWEB)

    Liao, Yu-Wei; Lin, Kai-Yang; Huang, Yau-De; Ho, Paul T. P.; Chen, Ming-Tang; Locutus Huang, Chih-Wei; Koch, Patrick M.; Nishioka, Hiroaki; Umetsu, Keiichi; Han, Chih-Chiang; Li, Chao-Te; Martin-Cocher, Pierre; Oshiro, Peter [Institute of Astronomy and Astrophysics, Academia Sinica, P.O. Box 23-141, Taipei 10617, Taiwan (China); Proty Wu, Jiun-Huei; Cheng, Tai-An; Fu, Szu-Yuan; Wang, Fu-Cheng [Department of Physics, Institute of Astrophysics, and Center for Theoretical Sciences, National Taiwan University, Taipei 10617, Taiwan (China); Liu, Guo-Chin [Department of Physics, Tamkang University, 251-37 Tamsui, New Taipei City, Taiwan (China); Molnar, Sandor M. [Leung Center for Cosmology and Particle Astrophysics, National Taiwan University, Taipei 10617, Taiwan (China); Chang, Yu-Yen, E-mail: ywliao@asiaa.sinica.edu.tw, E-mail: jhpw@phys.ntu.edu.tw [Max-Planck-Institut fuer Astronomie, Koenigstuhl 17, D-69117 Heidelberg (Germany)

    2013-05-20

    We present a new way to solve the platform deformation problem of coplanar interferometers. The platform of a coplanar interferometer can be deformed due to driving forces and gravity. A deformed platform will induce extra components into the geometric delay of each baseline and change the phases of observed visibilities. The reconstructed images will also be diluted due to the errors of the phases. The platform deformations of The Yuan-Tseh Lee Array for Microwave Background Anisotropy (AMiBA) were modeled based on photogrammetry data with about 20 mount pointing positions. We then used the differential optical pointing error between two optical telescopes to fit the model parameters in the entire horizontal coordinate space. With the platform deformation model, we can predict the errors of the geometric phase delays due to platform deformation with a given azimuth and elevation of the targets and calibrators. After correcting the phases of the radio point sources in the AMiBA interferometric data, we recover 50%-70% flux loss due to phase errors. This allows us to restore more than 90% of a source flux. The method outlined in this work is not only applicable to the correction of deformation for other coplanar telescopes but also to single-dish telescopes with deformation problems. This work also forms the basis of the upcoming science results of AMiBA-13.

  10. eAMI: A Qualitative Quantification of Periodic Breathing Based on Amplitude of Oscillations

    Science.gov (United States)

    Fernandez Tellez, Helio; Pattyn, Nathalie; Mairesse, Olivier; Dolenc-Groselj, Leja; Eiken, Ola; Mekjavic, Igor B.; Migeotte, P. F.; Macdonald-Nethercott, Eoin; Meeusen, Romain; Neyt, Xavier

    2015-01-01

    Study Objectives: Periodic breathing is sleep disordered breathing characterized by instability in the respiratory pattern that exhibits an oscillatory behavior. Periodic breathing is associated with increased mortality, and it is observed in a variety of situations, such as acute hypoxia, chronic heart failure, and damage to respiratory centers. The standard quantification for the diagnosis of sleep related breathing disorders is the apnea-hypopnea index (AHI), which measures the proportion of apneic/hypopneic events during polysomnography. Determining the AHI is labor-intensive and requires the simultaneous recording of airflow and oxygen saturation. In this paper, we propose an automated, simple, and novel methodology for the detection and qualification of periodic breathing: the estimated amplitude modulation index (eAMI). Patients or Participants: Antarctic cohort (3,800 meters): 13 normal individuals. Clinical cohort: 39 different patients suffering from diverse sleep-related pathologies. Measurements and Results: When tested in a population with high levels of periodic breathing (Antarctic cohort), eAMI was closely correlated with AHI (r = 0.95, P Dolenc-Groselj L, Eiken O, Mekjavic IB, Migeotte PF, Macdonald-Nethercott E, Meeusen R, Neyt X. eAMI: a qualitative quantification of periodic breathing based on amplitude of oscillations. SLEEP 2015;38(3):381–389. PMID:25581914

  11. AmiD Is a Novel Peptidoglycan Amidase in Wolbachia Endosymbionts of Drosophila melanogaster

    Directory of Open Access Journals (Sweden)

    Miriam Wilmes

    2017-08-01

    Full Text Available Wolbachia endobacteria are obligate intracellular bacteria with a highly reduced genome infecting many arthropod and filarial species, in which they manipulate arthropod reproduction to increase their transmission and are essential for nematode development and survival. The Wolbachia genome encodes all enzymes required for the synthesis of the cell wall building block lipid II, although a peptidoglycan-like structure has not been detected. Despite the ability to synthesize lipid II, Wolbachia from arthropods and nematodes have only a subset of genes encoding enzymes involved in the periplasmic processing of lipid II and peptidoglycan recycling, with arthropods having two more than nematodes. We functionally analyzed the activity of the putative cell wall hydrolase AmiD from the Wolbachia endosymbiont of Drosophila melanogaster, an enzyme not encoded by the nematode endobacteria. Wolbachia AmiD has Zn2+-dependent amidase activity and cleaves intact peptidoglycan, monomeric lipid II and anhydromuropeptides, substrates that are generated during bacterial growth. AmiD may have been maintained in arthropod Wolbachia to avoid host immune recognition by degrading cell wall fragments in the periplasm. This is the first description of a wolbachial lipid II processing enzyme putatively expressed in the periplasm.

  12. AToMS: A Ubiquitous Teleconsultation System for Supporting AMI Patients with Prehospital Thrombolysis

    Directory of Open Access Journals (Sweden)

    Bruno S. P. M. Correa

    2011-01-01

    Full Text Available The latest population-based studies in the medical literature worldwide indicate that acute myocardial infarction (AMI patients still experience prolonged delay to be rescued, which often results in morbidity and mortality. This paper reports from a technological standpoint a teleconsultation and monitoring system named AToMS. This system addresses the problem of prehospital delivery of thrombolysis to AMI patients by enabling the remote interaction of the paramedics and a cardiologist available at a Coronary Care Unit (CCU. Such interaction allows the diagnosis of the patient eligibility to the immediate application of thrombolysis, which is meant to reduce the delay between the onset of symptoms and the eventual application of proper treatment. Such delay reduction is meant to increase the AMI patient's chances of survival and decrease the risks of postinfarction sequels. The teleconsultation is held with the support of wireless and mobile technologies, which also allows the cardiologist to monitor the patient while he/she is being taken to the nearest CCU. All exchanged messages among paramedics and cardiologists are recorded to render an auditable system. AToMS has been deployed in a first stage in the city of Rio de Janeiro, where the medical team involved in the project has conducted commissioned tests.

  13. No gender differences in prognosis and preventive treatment in patients with AMI without significant stenoses

    DEFF Research Database (Denmark)

    Hansen, Kim; Hvelplund, Anders; Abildstrøm, Steen Zabell

    2011-01-01

    : By compiling data from Danish registries, we identified 20,800 patients hospitalized with AMI during 2005-2007. We included the 834 women and 761 men without significant stenoses on CAG who were discharged and alive after 60 days. Main outcome measures: All-cause mortality, recurrent AMI, and redeeming...... a prescription for a lipid-lowering drug, beta-blocker, clopidogrel, or aspirin within 60 days of discharge. Results: During follow-up, 97 women and 60 men died, resulting in a crude female/male hazard ratio (HR) of 1.51 (95% CI 1.09-2.08). After adjustment for age, time-period, and comorbidity, the gender...... difference was attenuated (HR 1.22, 95% CI 0.86-1.72). AMI recurrence was experienced by 28 women and 29 men with a female/male HR 0.88 (95% CI 0.52-1.48). After multivariable adjustment results were similar (HR 0.84, 95% CI 0.50-1.43). More women than men redeemed a prescription for lipid-lowering drugs...

  14. PLATFORM DEFORMATION PHASE CORRECTION FOR THE AMiBA-13 COPLANAR INTERFEROMETER

    International Nuclear Information System (INIS)

    Liao, Yu-Wei; Lin, Kai-Yang; Huang, Yau-De; Ho, Paul T. P.; Chen, Ming-Tang; Locutus Huang, Chih-Wei; Koch, Patrick M.; Nishioka, Hiroaki; Umetsu, Keiichi; Han, Chih-Chiang; Li, Chao-Te; Martin-Cocher, Pierre; Oshiro, Peter; Proty Wu, Jiun-Huei; Cheng, Tai-An; Fu, Szu-Yuan; Wang, Fu-Cheng; Liu, Guo-Chin; Molnar, Sandor M.; Chang, Yu-Yen

    2013-01-01

    We present a new way to solve the platform deformation problem of coplanar interferometers. The platform of a coplanar interferometer can be deformed due to driving forces and gravity. A deformed platform will induce extra components into the geometric delay of each baseline and change the phases of observed visibilities. The reconstructed images will also be diluted due to the errors of the phases. The platform deformations of The Yuan-Tseh Lee Array for Microwave Background Anisotropy (AMiBA) were modeled based on photogrammetry data with about 20 mount pointing positions. We then used the differential optical pointing error between two optical telescopes to fit the model parameters in the entire horizontal coordinate space. With the platform deformation model, we can predict the errors of the geometric phase delays due to platform deformation with a given azimuth and elevation of the targets and calibrators. After correcting the phases of the radio point sources in the AMiBA interferometric data, we recover 50%-70% flux loss due to phase errors. This allows us to restore more than 90% of a source flux. The method outlined in this work is not only applicable to the correction of deformation for other coplanar telescopes but also to single-dish telescopes with deformation problems. This work also forms the basis of the upcoming science results of AMiBA-13.

  15. Platform Deformation Phase Correction for the AMiBA-13 Coplanar Interferometer

    Science.gov (United States)

    Liao, Yu-Wei; Lin, Kai-Yang; Huang, Yau-De; Proty Wu, Jiun-Huei; Ho, Paul T. P.; Chen, Ming-Tang; Locutus Huang, Chih-Wei; Koch, Patrick M.; Nishioka, Hiroaki; Cheng, Tai-An; Fu, Szu-Yuan; Liu, Guo-Chin; Molnar, Sandor M.; Umetsu, Keiichi; Wang, Fu-Cheng; Chang, Yu-Yen; Han, Chih-Chiang; Li, Chao-Te; Martin-Cocher, Pierre; Oshiro, Peter

    2013-05-01

    We present a new way to solve the platform deformation problem of coplanar interferometers. The platform of a coplanar interferometer can be deformed due to driving forces and gravity. A deformed platform will induce extra components into the geometric delay of each baseline and change the phases of observed visibilities. The reconstructed images will also be diluted due to the errors of the phases. The platform deformations of The Yuan-Tseh Lee Array for Microwave Background Anisotropy (AMiBA) were modeled based on photogrammetry data with about 20 mount pointing positions. We then used the differential optical pointing error between two optical telescopes to fit the model parameters in the entire horizontal coordinate space. With the platform deformation model, we can predict the errors of the geometric phase delays due to platform deformation with a given azimuth and elevation of the targets and calibrators. After correcting the phases of the radio point sources in the AMiBA interferometric data, we recover 50%-70% flux loss due to phase errors. This allows us to restore more than 90% of a source flux. The method outlined in this work is not only applicable to the correction of deformation for other coplanar telescopes but also to single-dish telescopes with deformation problems. This work also forms the basis of the upcoming science results of AMiBA-13.

  16. Squamous Cell Carcinoma and Multiple Bowen's Disease in a Patient with a History of Consumption of Traditional Chinese Herbal Balls

    Directory of Open Access Journals (Sweden)

    Joon Seok

    2015-07-01

    Full Text Available Arsenic has been classified as a class I human carcinogen, meaning that there is sufficient evidence of carcinogenicity to humans. Arsenic, however, remains a common contaminant in a number of traditional Chinese herbal balls. A 64-year-old man presented with an erythematous erosive patch on the left palm, multiple yellowish scaly patches on the right palm and an erythematous hyperkeratotic patch with bleeding on the left foot dorsum. He also had similar skin lesions on the back and buttock. He had a past medical history of chronic exposure to arsenic through consumption of traditional Chinese herbal balls. Skin biopsy revealed Bowen's disease on the left palm and squamous cell carcinoma on left foot dorsum. We report this case to emphasize that we should investigate patient's history thoroughly, including the use of Chinese herbal balls to find out arsenicism.

  17. Effect of urokinase thrombolysis on the cardiac function, coagulation, and fibrinolytic system in patients with AMI

    Directory of Open Access Journals (Sweden)

    Zhi-Bin Kuang

    2017-06-01

    Full Text Available Objective: To observe the effect of urokinase thrombolysis on the cardiac function, coagulation, and fibrinolytic system in patients with acute myocardial infarction (AMI. Methods: A total of 39 patients with AMI who were admitted in our hospital from March, 2016 to November, 2016 were included in the study and served as the observation group. The peripheral venous blood before and after thrombolysis was collected. The plasma NTproBNP level, related coagulation factors, and fibrinolysis indicators were detected. The cardiac function before treatment was evaluated. A total of 30 healthy individuals who came for physical examinations were served as the control group for contrastive analysis. Results: The plasma NT-proBNP, Fg, and D-D levels before thrombolysis in the observation group were significantly higher than those in the control group, while PT, APTT, and TT in the observation group were significantly shortened. The plasma NT-proBNP and D-D levels 2-48 h after thrombolysis in the observation group were significantly elevated first and reduced later and reached the peak 4 h after treatment, while PT, APTT, and TT were significantly extended first and shortened later. The plasma Fg level was significantly reduced first and elevated later and reached the minimum 4 h after treatment. During the treatment process, in the observation group, 2 had mucocutaneous hemorrhage, 3 had nasal hemorrhage, and 1 had gingival bleeding, but no gastrointestinal bleeding or cerebral hemorrhage occurred. Conclusions: The thrombolytic therapy can effectively reduce the coagulation activity in patients with AMI, strengthen the fibrinolysis activity, and improve the cardiac function.

  18. CFRP platform and hexapod mount for the Array of MIcrowave Background Anisotropy (AMiBA)

    Science.gov (United States)

    Raffin, Philippe A.; Martin, Robert N.; Huang, Yau-De; Patt, Ferdinand; Romeo, Robert C.; Chen, Ming-Tang; Kingsley, Jeffrey S.

    2004-09-01

    AMiBA consists of a 90 GHz interferometric array telescope with dishes ranging in size from 0.3 to 2.4 meter in diameter, mounted on a 6-meter fully steerable platform. The dishes are attached to the receivers, which are mounted on a platform controlled by a six degree of freedom hexapod mount. The hexapod mount is a parallel connection manipulator also called Stewart Platform. The basic reference for this mechanism is a paper by Stewart. The Stewart Platform is a unique kinematically constrained work platform. It can be manipulated through the six degrees of freedom. The hexapod also provides better accuracy, rigidity, load to weight ratio and load distribution than a serial manipulator or traditional manipulator. The advantages of the hexapod shows that it is a great choice for the AMiBA project. Vertex Antennentechnik GmbH fabricates the hexapod. Testing has started in Germany. The telescope will be delivered in the summer of 2004. The 6m in diameter hexagonal platform is made of carbon fiber reinforced plastics (CFRP) and consists of seven pieces of three different unique types. The platform can be disassembled and fits in a container for transportation. The mounting plane flatness is an important issue for the platform assembly. The deflection angle of the mounting plane relative to any other mounting position must be less than 20 arcsec. Meanwhile, the platform must endure a loading of 3 tons. The platform has been built by Composite Mirror Applications, Inc. (CMA) in Tucson, and mounted on the Hexapod in Germany. This report describes the design and testing of platform and mount for the AMiBA telescope.

  19. A novel approach for UI charge reduction using AMI based load prioritization in smart grid

    Directory of Open Access Journals (Sweden)

    Avani Pujara

    2017-09-01

    Full Text Available System frequency is vital part for power system balance. As per India Electricity Grid code frequency should be in the range of 49.5 Hz–50.5 Hz. Deviation from above mentioned range is charged as Unscheduled Interchange (UI charge. This paper proposes a new method for load and frequency control based on control of third parameter of three-part Availability Based Tariff (ABT i.e. Unscheduled Interchange charges. New circuit is designed considering prioritization of load and using Advanced Metering Infrastructure (AMI under Smart Grid environment.

  20. Advances in Autonomous Mini Robots : Proceedings of the 6-th AMiRE Symposium

    CERN Document Server

    Joaquin, Sitte; Felix, Werner

    2012-01-01

    Autonomous robots must carry out useful tasks all by themselves relying entirely on their own perceptions of their environment. The cognitive abilities required for autonomous action are largely independent of robot size, which makes mini robots attractive as artefacts for research, education and entertainment. Autonomous mini robots must be small enough for experimentation on a desktop or a small laboratory.  They must be easy to carry and safe for interaction with humans. They must not be expensive. Mini robot designers have to work at the leading edge of technology so that their creations can carry out purposeful autonomic action under these constraints. Since 2001 researchers have met every two years for an international symposium to report on the advances achieved in Autonomous Mini  Robots for Research and Edutainment (AMiRE). The AMiRE Symposium is a single track conference that offers ample opportunities for discussion and exchange of ideas. This volume contains the contributed papers of the 2011 AM...

  1. Ontological Representation of Light Wave Camera Data to Support Vision-Based AmI

    Directory of Open Access Journals (Sweden)

    José Manuel Molina

    2012-09-01

    Full Text Available Recent advances in technologies for capturing video data have opened a vast amount of new application areas in visual sensor networks. Among them, the incorporation of light wave cameras on Ambient Intelligence (AmI environments provides more accurate tracking capabilities for activity recognition. Although the performance of tracking algorithms has quickly improved, symbolic models used to represent the resulting knowledge have not yet been adapted to smart environments. This lack of representation does not allow to take advantage of the semantic quality of the information provided by new sensors. This paper advocates for the introduction of a part-based representational level in cognitive-based systems in order to accurately represent the novel sensors’ knowledge. The paper also reviews the theoretical and practical issues in part-whole relationships proposing a specific taxonomy for computer vision approaches. General part-based patterns for human body and transitive part-based representation and inference are incorporated to an ontology-based previous framework to enhance scene interpretation in the area of video-based AmI. The advantages and new features of the model are demonstrated in a Social Signal Processing (SSP application for the elaboration of live market researches.

  2. Post-MI depression and levels of serum IL-6 and CRP in AMI patients

    International Nuclear Information System (INIS)

    Huang Tiejun

    2004-01-01

    Objective: To explore the relationship between the presence and severity of post-MI depression and the increased inflammatory activity, as marked by the serum levels of interleukin-6 (IL-6) and C-reactive protein (CRP) after myocardial infarction. Methods: Serum IL-6 and CRP levels were measured in 58 AMI patients within 36 hours after onset of event. Depression was evaluated by self-reporting standardized questionnaire, using a validated Chinese version of Hospiatla Anxiety and Depression Scale (HADS)-Depression Subscale (7 items) within 7 days. Demographic and medical data including LVEF, NYHA cardiac function grading, atherosclerosis severity shown from angiography as well as cardiac risk factors were recorded. Results: Serum levels of IL-6 and CRP were higher in depressive AMI patients than those in non-depressive ones (0.93 ± 0.64 vs 0.48 ± 0.37 ng/L, P<0.05 and 0.96 ± 0.41 vs 0.47 ± 0.26 mg/dL, P<0.05). Neither levels of IL-6 nor HADS-D scores were found to be correlated to the severity of atherosclerosis shown in angiography. Conclusion: Presence and severity of post-MI depression is associated with increased activity of inflammation in patients after myocardial infarction. (authors)

  3. Multiple Bowen's disease and epithelioid malignant peripheral nerve sheath tumor in a patient who experienced chronic arsenic poisoning

    Directory of Open Access Journals (Sweden)

    Ching-En Chen

    2017-01-01

    Full Text Available The Southwest coastal plain of Taiwan is an endemic area of arsenic contamination. Residents who lived there before the 1970s and who used raw groundwater for drinking have a higher risk of arsenic poisoning. In 1968, Tseng et al. described Blackfoot disease as a peripheral vascular disease caused by chronic exposure to arsenic, thereby introducing the concept of arsenic-induced systemic illness in Taiwan. Multiple Bowen's disease (BD is one of the characteristic consequences of chronic arsenic poisoning and it usually presents as cutaneous carcinoma in situ. Multiple BD can also be associated with squamous cell carcinoma and basal cell carcinoma of the skin, as well as lung, liver, gastrointestinal, and bladder cancers. We encountered a 79-year-old male from Yun-Lin, a county in Southwest Taiwan, who presented with a progressing tumor in his right anterior chest wall. In addition, numerous keratoses and scaly skin lesions were noted on his trunk and extremities, some of which were combined with erosions. The patient was diagnosed with chronic arsenic poisoning with multiple BD and the huge tumor was confirmed as an epithelioid malignant peripheral nerve sheath tumor.

  4. Rehabilitation with pasture after open-cut coal mining at three sites in the Bowen Coal Basin of Queensland

    Energy Technology Data Exchange (ETDEWEB)

    Coaldrake, J E

    1978-03-01

    Open-cut coal mining in the Bowen Coal Basin leaves piled heaps of overburden, chiefly of a clayey nature, that have high pH, high salinity, and low contents of phosphorus and nitrogen. It is likely that pastures of introduced sub- tropical species can be used as a first stage in rehabilitating these areas, and possibly to convert them into permanent grazing lands. In field experiments the grasses Cenchrus ciliaris cv. Biloela (Buffel grass), Chloris gayana cv. Pioneer (Rhodes grass) and Panicum maximum var. trichoglume cv. Petrie (green panic) all showed satisfactory establishment and growth at two sites out of three tested. There was a clear response to superphosphate, with 400 kg/ha proving better over a two-year period than 100 kg/ha. Responses to nitrogen (as ammonium sulphate and as ammonium nitrate) were variable, and there was no response to gypsum and manganese at the one site tested for them. Of three tropical legumes subjected to limited testing only leucaena leucocephala gave encouraging results.

  5. LES AMIS D'ESCOFFIER AND THE POST-DEPRESSION LABOR MARKET FOR CHEFS DE CUISINE IN AMERICA

    Directory of Open Access Journals (Sweden)

    Martin T. Ollif

    2001-01-01

    Full Text Available This essay uses a cultural studies approach to analyze the effort of the gourmet society Les Amis d'Escoffier to re-create the niche market for chefs’ services in the waning years of the Great Depression. It examines the depressed labor market for chefs after 1912 as well as aspects of the chefs’ culture that informed the unusual rules and rituals Les Amis used to educate wealthy men in gourmandaise. It concludes that, regardless of how successful the society was in its original goal, culture as well as functional response shaped the chefs’ remedy to their labor market problems.

  6. The 3-D Tropical Convective Cloud Spectrum in AMIE Radar Observations and Global Climate Simulations

    Energy Technology Data Exchange (ETDEWEB)

    Schumacher, Courtney [Texas A & M Univ., College Station, TX (United States). Dept. of Atmospheric Sciences

    2015-08-31

    During the three years of this grant performance, the PI and her research group have made a number of significant contributions towards determining properties of tropical deep convective clouds and how models depict and respond to the heating associated with tropical convective systems. The PI has also been an active ARM/ASR science team member, including playing a significant role in AMIE and GoAmazon2014/5. She served on the DOE ASR radar science steering committee and was a joint chair of the Mesoscale Convective Organization group under the Cloud Life Cycle working group. This grant has funded a number of graduate students, many of them women, and the PI and her group have presented their DOE-supported work at various universities and national meetings. The PI and her group participated in the AMIE (2011-12) and GoAmazon2014/5 (2014-15) DOE field deployments that occurred in the tropical Indian Ocean and Brazilian Amazon, respectively. AMIE observational results (DePasquale et al. 2014, Feng et al. 2014, Ahmed and Schumacher 2015) focus on the variation and possible importance of Kelvin waves in various phases of the Madden-Julian Oscillation (MJO), on the synergy of the different wavelength radars deployed on Addu Atoll, and on the importance of humidity thresholds in the tropics on stratiform rain production. Much of the PIs GoAmazon2014/5 results to date relate to overviews of the observations made during the field campaign (Martin et al. 2015, 2016; Fuentes et al. 2016), but also include the introduction of the descending arm and its link to ozone transport from the mid-troposphere to the surface (Gerken et al. 2016). Vertical motion and mass flux profiles from GoAmazon (Giangrande et al. 2016) also show interesting patterns between seasons and provide targets for model simulations. Results from TWP-ICE (Schumacher et al. 2015), which took place in Darwin, Australia in 2006 show that vertical velocity retrievals from the profilers provide structure to

  7. Progress of the array of microwave background anisotropy (AMiBA)

    Science.gov (United States)

    Raffin, Philippe; Koch, Patrick; Huang, Yau-De; Chang, Chia-Hao; Chang, Joshua; Chen, Ming-Tang; Chen, Ke-Yung; Ho, Paul T. P.; Huang, Chih-Wie; Ibañez Roman, Fabiola; Jiang, Homin; Kesteven, Michael; Lin, Kai-Yang; Liu, Guo-Chin; Nishioka, Hiroaki; Umetsu, Keiichi

    2006-06-01

    The Academia Sinica, Institute for Astronomy and Astrophysics (ASIAA) is installing the AMiBA interferometric array telescope at the Mauna Loa Observatory, Hawaii. The 6-meter carbon fiber fully steerable platform is mounted on the Hexapod Mount. After integration and equipment with dummy weights, the platform has been measured by photogrammetry to verify its behavior predicted by Finite Element Analysis. The Hexapod servo control is now operational and equipment of the platform with the initial 7 60-cm dishes, the correlator and electronics is underway. Pointing has started with the aid of the optical telescope. We present the status of the telescope after the servo and initial pointing tests have been carried out. We also present the results of platform measurements by photogrammetry.

  8. First Results at the Moon from the SMART-1 / AMIE Experiment

    Science.gov (United States)

    Josset, J. L.; Beauvivre, S.; AMIE Team

    2005-08-01

    The Advanced Moon micro-Imager Experiment (AMIE), on board ESA SMART-1, the first European mission to the Moon (launched on 27th September 2003), is an imaging system with scientific, technical and public outreach oriented objectives. The science objectives are to image the Lunar South Pole, permanent shadow areas (ice deposit), eternal light (crater rims), ancient Lunar Non-mare volcanism, local spectro-photometry and physical state of the lunar surface, and to map high latitudes regions (south) mainly at far side (South Pole Aitken basin). The technical objectives are to perform a laserlink experiment (detection of laser beam emitted by ESA/Tenerife ground station), flight demonstration of new technologies and on-board autonomy navigation. The public outreach and educational objectives are to promote planetary exploration. We present here the first results obtained during the cruise phase and at the Moon.

  9. Science objectives and first results from the SMART-1/AMIE multicolour micro-camera

    Science.gov (United States)

    Josset, J.-L.; Beauvivre, S.; Cerroni, P.; de Sanctis, M. C.; Pinet, P.; Chevrel, S.; Langevin, Y.; Barucci, M. A.; Plancke, P.; Koschny, D.; Almeida, M.; Sodnik, Z.; Mancuso, S.; Hofmann, B. A.; Muinonen, K.; Shevchenko, V.; Shkuratov, Yu.; Ehrenfreund, P.; Foing, B. H.

    The Advanced Moon micro-Imager Experiment (AMIE), on-board SMART-1, the first European mission to the Moon, is an imaging system with scientific, technical and public outreach objectives. The science objectives are to image the lunar South Pole, permanent shadow areas (ice deposit), eternal light (crater rims), ancient lunar non-mare volcanism, local spectrophotometry and physical state of the lunar surface, and to map high latitudes regions (south) mainly at far side (South Pole Aitken basin). The technical objectives are to perform a Laserlink experiment (detection of laser beam emitted by ESA/Tenerife ground station), flight demonstration of new technologies and on-board autonomy navigation. The public outreach and educational objectives are to promote planetary exploration and space. We present here the first results obtained during the cruise phase.

  10. Intra-seasonal and Inter-annual variability of Bowen Ratio over rain-shadow region of North peninsular India

    Science.gov (United States)

    Morwal, S. B.; Narkhedkar, S. G.; Padmakumari, B.; Maheskumar, R. S.; Deshpande, C. G.; Kulkarni, J. R.

    2017-05-01

    Intra-seasonal and inter-annual variability of Bowen Ratio (BR) have been studied over the rain-shadow region of north peninsular India during summer monsoon season. Daily grid point data of latent heat flux (LHF), sensible heat flux (SHF) from NCEP/NCAR Reanalysis for the period 1970-2014 have been used to compute daily area-mean BR. Daily grid point rainfall data at a resolution of 0.25° × 0.25° from APHRODITE's Water Resources for the available period 1970-2007 have been used to study the association between rainfall and BR. The study revealed that BR rapidly decreases from 4.1 to 0.29 in the month of June and then remains nearly constant at the same value (≤0.1) in the rest of the season. High values of BR in the first half of June are indicative of intense thermals and convective clouds with higher bases. Low values of BR from July to September period are indicative of weak thermals and convective clouds with lower bases. Intra-seasonal and inter-annual variability of BR is found to be inversely related to precipitation over the region. BR analysis indicates that the land surface characteristics of the study region during July-September are similar to that over oceanic regions as far as intensity of thermals and associated cloud microphysical properties are concerned. Similar variation of BR is found in El Nino and La Nina years. During June, an increasing trend is observed in SHF and BR and decreasing trend in LHF from 1976 to 2014. Increasing trend in the SHF is statistically significant.

  11. The NtAMI1 gene functions in cell division of tobacco BY-2 cells in the presence of indole-3-acetamide.

    Science.gov (United States)

    Nemoto, Keiichirou; Hara, Masamitsu; Suzuki, Masashi; Seki, Hikaru; Muranaka, Toshiya; Mano, Yoshihiro

    2009-01-22

    Tobacco (Nicotiana tabacum) Bright Yellow-2 (BY-2) cells can be grown in medium containing indole-3-acetamide (IAM). Based on this finding, the NtAMI1 gene, whose product is functionally equivalent to the AtAMI1 gene of Arabidopsis thaliana and the aux2 gene of Agrobacterium rhizogenes, was isolated from BY-2 cells. Overexpression of the NtAMI1 gene allowed BY-2 cells to proliferate at lower concentrations of IAM, whereas suppression of the NtAMI1 gene by RNA interference (RNAi) caused severe growth inhibition in the medium containing IAM. These results suggest that IAM is incorporated into plant cells and converted to the auxin, indole-3-acetic acid, by NtAMI1.

  12. Família e o processo de diferenciação na perspectiva de Murray Bowen: um estudo de caso

    Directory of Open Access Journals (Sweden)

    Elizabeth Medeiros de Almeida Martins

    2008-06-01

    Full Text Available Este estudo teve como objetivo investigar a aplicabilidade do conceito de diferenciação do self elaborado por Murray Bowen na terapia da família. Focalizou a história de uma família mostrando como as histórias de vida do casal, a partir das primeiras triangulações, tanto na família nuclear quanto na extensa, foram transmitidas entre gerações até gerar uma história renovada do casal e de sua própria família.

  13. Bowen ratio/energy balance technique for estimating crop net CO2 assimilation, and comparison with a canopy chamber

    Science.gov (United States)

    Held, A. A.; Steduto, P.; Orgaz, F.; Matista, A.; Hsiao, T. C.

    1990-12-01

    This paper describes a Bowen ratio/energy balance (BREB) system which, in conjunction with an infra-red gas analyzer (IRGA), is referred to as BREB+ and is used to estimate evapotranspiration ( ET) and net CO2 flux ( NCF) over crop canopies. The system is composed of a net radiometer, soil heat flux plates, two psychrometers based on platinum resistance thermometers (PRT), bridge circuits to measure resistances, an IRGA, air pumps and switching valves, and a data logger. The psychrometers are triple shielded and aspirated, and with aspiration also between the two inner shields. High resistance (1 000 ohm) PRT's are used for dry and wet bulbs to minimize errors due to wiring and connector resistances. A high (55 K ohm) fixed resistance serves as one arm of the resistance bridge to ensure linearity in output signals. To minimize gaps in data, to allow measurements at short (e.g., 5 min) intervals, and to simplify operation, the psychrometers were fixed at their upper and lower position over the crop and not alternated. Instead, the PRT's, connected to the bridge circuit and the data logger, were carefully calibrated together. Field tests using a common air source showed appartent effects of the local environment around each psychrometer on the temperatures measured. ET rates estimated with the BREB system were compared to those measured with large lysimeters. Daily totals agreed within 5%. There was a tendency, however, for the lysimeter measurements to lag behind the BREB measurements. Daily patterns of NCF estimated with the BREB+ system are consistent with expectations from theories and data in the literature. Side-by-side comparisons with a stirred Mylar canopy chamber showed similar NCF patterns. On the other hand, discrepancies between the results of the two methods were quite marked in the morning or afternoon on certain dates. Part of the discrepancies may be attributed to inaccuracies in the psychrometric temperature measurements. Other possible causes

  14. Diasporic Authenticity Assertions: Analysis of Amy Tan’s The Bonesetter’s Daughter

    Directory of Open Access Journals (Sweden)

    Naeimeh Tabatabaei Lotfi

    2015-07-01

    Full Text Available This essay is an attempt to examine the active interaction of history and memory, in formulation of a diasporic authentic picture of past, in Amy Tan’s The Bonesetter’s Daughter (2001. Amongst discursive disciplines, memory and history perform vitally, in picturing past; both attempt to reproduce events, by emblematic narrative acts. However, their erratic quality endorses the existence of counter- stories that endangers displaying a homogeneous past. Among miscellaneous categories of memories, autobiographical memory asserts to obtain an authentic presentation, but as any other forms of accounts, it exhibits an imprecise fictional image. This psychological alleviation ensures the future mental integrity of trauma victims. In memory narratives, the contingent temperament of power network and continual formulation of resisting frameworks might be explored. Tan’s diasporic assertion of authenticity, as a migrant writer, amalgamated with employment of fantasy is to obtain a shared diasporic identity, among her characters, although personal accounts of characters undergo an extensive amount of contingency. The newly forged identity is collective in nature and defies the geographical and temporal borders and grants a humane picture rather than a diasporic one; an identity that is established to venerate the cardinal role of personal memory, in endowing legitimate truth.

  15. Reduction of Driver Stress Using AmI Technology while Driving in Motorway Merging Sections

    Science.gov (United States)

    Zia, Kashif; Riener, Andreas; Ferscha, Alois

    High average intensity of traffic and problems like traffic congestions, road safety, etc. are challenging problems striking highway operators in these days. With the broad application of intelligent transport systems (ITS), particularly for the most dense street sections, some of these problems can be minimized or even solved; supplementary great potential is attributed to applications based on state-of-the art technology like car-to-x communication, for instance by extending an individuals "field of vision" by observations taken from all the vehicles in front. In this work we present a simulation based approach for improving driving experience and increasing road safety in merging sections by redirecting vehicles in advance according to a negotiation of requirements and desires of the flowing traffic on the main road and cars merging from the entrance lane. The simulation experiments performed in a cellular automaton based environment were data driven and on real scale, using traffic flow data on a minute-by-minute basis from a large urban motorway in a main city of the European Union. Our results have shown that the application of AmI technology has potential to influence driver's behavior (seamlessly invoking for a lane change well before an abrupt merging point) resulting in a reduction of panic, particularly for sections with limited range of view.

  16. The Animals Reader: The Essential Classic and Contemporary Writings (Linda Kalof y Amy Fitzgerald, Eds.

    Directory of Open Access Journals (Sweden)

    Beto Vianna

    2009-01-01

    Full Text Available Las propuestas explicativas de la sociobiología y, aún más recientemente, de la psicología evolucionista han suscitado la queja, entre los científicos humanos, de una “colonización de las ciencias sociales” (término de Rose, 2000 desde la biología. La queja es legítima, si no por otros motivos, por una lamentable tendencia a la simplificación de las intricadas redes conductuales humanas a través de “explicaciones evolutivas”. Pero no podemos olvidar que hay un movimiento de igual tamaño e impacto desde las ciencias sociales que, a ejemplo de Bruno Latour, Tim Ingold y tantos otros, “colonizan” los estudios y objetos naturales (ver, por ejemplo, Latour, 1996 e Ingold, 2008. En The Animals Reader, dos sociólogas - Linda Kalof, de la Universidad del Estado de Michigan, y Amy Fitzgerald, de la Universidade de Windsor, Canada - son las responsables de hacer una incursión en un territorio tradicionalmente natural y, por tanto, perteneciente a las ciencias de la naturaleza: las descripciones que hacemos y las relaciones que mantenemos con los animales. The Animals Reader es una compilación bien cuidada, pienso que la primera de su tipo, que da forma a una preocupación multidisciplinar: los “estudios animales”.

  17. Off-line tracking of series parameters in distribution systems using AMI data

    Energy Technology Data Exchange (ETDEWEB)

    Williams, Tess L.; Sun, Yannan; Schneider, Kevin

    2016-05-01

    Electric distribution systems have historically lacked measurement points, and equipment is often operated to its failure point, resulting in customer outages. The widespread deployment of sensors at the distribution level is enabling observability. This paper presents an off-line parameter value tracking procedure that takes advantage of the increasing number of measurement devices being deployed at the distribution level to estimate changes in series impedance parameter values over time. The tracking of parameter values enables non-diurnal and non-seasonal change to be flagged for investigation. The presented method uses an unbalanced Distribution System State Estimation (DSSE) and a measurement residual-based parameter estimation procedure. Measurement residuals from multiple measurement snapshots are combined in order to increase the effective local redundancy and improve the robustness of the calculations in the presence of measurement noise. Data from devices on the primary distribution system and from customer meters, via an AMI system, form the input data set. Results of simulations on the IEEE 13-Node Test Feeder are presented to illustrate the proposed approach applied to changes in series impedance parameters. A 5% change in series resistance elements can be detected in the presence of 2% measurement error when combining less than 1 day of measurement snapshots into a single estimate.

  18. Bowen Journal of Agriculture

    African Journals Online (AJOL)

    Physicochemical properties of maize–'OGI' enriched with watermelon (Citrullus lanatus) seed · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Omolara Bolanle Otegbayo, Deborah Owolabi, Oluyinka Oroniran, Olufemi Oludemi, 32-40 ...

  19. Enabling cell-cell communication via nanopore formation: structure, function and localization of the unique cell wall amidase AmiC2 of Nostoc punctiforme.

    Science.gov (United States)

    Büttner, Felix M; Faulhaber, Katharina; Forchhammer, Karl; Maldener, Iris; Stehle, Thilo

    2016-04-01

    To orchestrate a complex life style in changing environments, the filamentous cyanobacterium Nostoc punctiforme facilitates communication between neighboring cells through septal junction complexes. This is achieved by nanopores that perforate the peptidoglycan (PGN) layer and traverse the cell septa. The N-acetylmuramoyl-l-alanine amidase AmiC2 (Npun_F1846; EC 3.5.1.28) in N. punctiforme generates arrays of such nanopores in the septal PGN, in contrast to homologous amidases that mediate daughter cell separation after cell division in unicellular bacteria. Nanopore formation is therefore a novel property of AmiC homologs. Immunofluorescence shows that native AmiC2 localizes to the maturing septum. The high-resolution crystal structure (1.12 Å) of its catalytic domain (AmiC2-cat) differs significantly from known structures of cell splitting and PGN recycling amidases. A wide and shallow binding cavity allows easy access of the substrate to the active site, which harbors an essential zinc ion. AmiC2-cat exhibits strong hydrolytic activity in vitro. A single point mutation of a conserved glutamate near the zinc ion results in total loss of activity, whereas zinc removal leads to instability of AmiC2-cat. An inhibitory α-helix, as found in the Escherichia coli AmiC(E. coli) structure, is absent. Taken together, our data provide insight into the cell-biological, biochemical and structural properties of an unusual cell wall lytic enzyme that generates nanopores for cell-cell communication in multicellular cyanobacteria. The novel structural features of the catalytic domain and the unique biological function of AmiC2 hint at mechanisms of action and regulation that are distinct from other amidases. The AmiC2-cat structure has been deposited in the Protein Data Bank under accession number 5EMI. © 2016 Federation of European Biochemical Societies.

  20. Radionuclide therapy of skin cancers and Bowen's disease using specially designed skin patch: A pilot study in an animal model and clinical trial

    International Nuclear Information System (INIS)

    Lee, J. D.; Park, K. K.; Lee, M. G.; Lee, J. T.; Yoo, H. S.; Kim, E. H.; Rhim, K. J.; Kim, Y. M.; Park, K. B.; Kim, J. R.

    1997-01-01

    Skin cancer is the most common malignant tumors in human. Therapeutic modalities of the skin cancers are local destruction, radiotherapy and surgery. External radiation therapy leads to good results, however, overall 5-6 weeks of treatment period is needed to deliver optimal radiation dose to tumors. In this study, β-emitting radionuclide, Ho-166, impregnated in a specially designed patch was utilized to superficial skin cancers and Bowen's disease for local irradiation. Methods; Animal study was employed in 10 mice with chemically induced skin tumors. Five- mm size patches containing 22.2 -72.15 MBq(0.6 - 1.95 mCi) of Ho-166 were applied to the tumor surface for 1 -2 hr. In clinical trial, patients with squamous carcinoma(n=3), basal cell carcinoma(n=1), and Bowen's disease(n=1) were treated with patches containing 273.8 - 999 MBq (7.4 - 27 mCi) of Ho-166 for 30 minutes to 1 hour. Pathologic examination was performed 4 - 7 weeks after the treatment in animal model. Skin biopsy was performed 8 weeks post-treatment in four patients. Results; Tumor destruction was seen 1 week post the treatment, however, radiation dermatitis or ulceration developed at the site of radionuclide application. Those reactions healed gradually with fibrosis or epithelialization, which was confirmed pathologically. No significant adverse reaction to radiation except subcutaneous fibrosis was found. Conclusion; Superficial skin tumors could be successfully treated by topical application of β-emitting radionuclides. (author)

  1. A Study on Literary Criticism from the Perspective of Ethics——Taking Amy Tan's Works for Example

    Institute of Scientific and Technical Information of China (English)

    Yang Yali; Yang Fan

    2017-01-01

    Amy Tan is a rnaster of describing the ethical relationship between people,and her novels focus particularly on family ethics.After interpretation of the setting of the ethical knots,.the trend of the ethical lines,and the structure of ethics in her novels from the perspective of literary ethics,we find out that every novel has its own characteristics and angle,and they share some commonality too.The analysis of the formation and deconstruction of the ethical knots,the ethical lines and the ethical structure in her novels give us an insight into Amy Tan's ethical philosophy that she wants to convey to readers through her novels,that is,harrnonious relationship will ultimately be built as long as people communicate sincerely,regardless of barriers and contradictions.This is not only the ethical ideas the author wants to convey,but also the ethical orientation of her works.

  2. Amy Caiazza, Mothers and Soldiers. Gender, Citizenship and Civil Society in Contemporary Russia. Routledge. New York and London 2002.

    Directory of Open Access Journals (Sweden)

    Elena Zdravomyslova

    2005-04-01

    Full Text Available This book examines the importance of gender and citizenship ideologies and the opportunities available for interest groups and related civic initiatives in relation to the role of conscripts mother’s in contemporary Russia. Amy Ciazza asks: what is the role of gender culture in the development of the Russian civil society? The author argues that gender-typing of citizenship and popular beliefs about the different civic obligations of men and women can be efficiently mobilized by interest grou...

  3. Evolution in Cloud Population Statistics of the MJO: From AMIE Field Observations to Global Cloud-Permiting Models

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Chidong [Univ. of Miami, Coral Gables, FL (United States)

    2016-08-14

    Motivated by the success of the AMIE/DYNAMO field campaign, which collected unprecedented observations of cloud and precipitation from the tropical Indian Ocean in Octber 2011 – March 2012, this project explored how such observations can be applied to assist the development of global cloud-permitting models through evaluating and correcting model biases in cloud statistics. The main accomplishment of this project were made in four categories: generating observational products for model evaluation, using AMIE/DYNAMO observations to validate global model simulations, using AMIE/DYNAMO observations in numerical studies of cloud-permitting models, and providing leadership in the field. Results from this project provide valuable information for building a seamless bridge between DOE ASR program’s component on process level understanding of cloud processes in the tropics and RGCM focus on global variability and regional extremes. In particular, experience gained from this project would be directly applicable to evaluation and improvements of ACME, especially as it transitions to a non-hydrostatic variable resolution model.

  4. An extended TRANSCAR model including ionospheric convection: simulation of EISCAT observations using inputs from AMIE

    Directory of Open Access Journals (Sweden)

    P.-L. Blelly

    2005-02-01

    Full Text Available The TRANSCAR ionospheric model was extended to account for the convection of the magnetic field lines in the auroral and polar ionosphere. A mixed Eulerian-Lagrangian 13-moment approach was used to describe the dynamics of an ionospheric plasma tube. In the present study, one focuses on large scale transports in the polar ionosphere. The model was used to simulate a 35-h period of EISCAT-UHF observations on 16-17 February 1993. The first day was magnetically quiet, and characterized by elevated electron concentrations: the diurnal F2 layer reached as much as 1012m-3, which is unusual for a winter and moderate solar activity (F10.7=130 period. An intense geomagnetic event occurred on the second day, seen in the data as a strong intensification of the ionosphere convection velocities in the early afternoon (with the northward electric field reaching 150mVm-1 and corresponding frictional heating of the ions up to 2500K. The simulation used time-dependent AMIE outputs to infer flux-tube transports in the polar region, and to provide magnetospheric particle and energy inputs to the ionosphere. The overall very good agreement, obtained between the model and the observations, demonstrates the high ability of the extended TRANSCAR model for quantitative modelling of the high-latitude ionosphere; however, some differences are found which are attributed to the precipitation of electrons with very low energy. All these results are finally discussed in the frame of modelling the auroral ionosphere with space weather applications in mind.

  5. An extended TRANSCAR model including ionospheric convection: simulation of EISCAT observations using inputs from AMIE

    Directory of Open Access Journals (Sweden)

    P.-L. Blelly

    2005-02-01

    Full Text Available The TRANSCAR ionospheric model was extended to account for the convection of the magnetic field lines in the auroral and polar ionosphere. A mixed Eulerian-Lagrangian 13-moment approach was used to describe the dynamics of an ionospheric plasma tube. In the present study, one focuses on large scale transports in the polar ionosphere. The model was used to simulate a 35-h period of EISCAT-UHF observations on 16-17 February 1993. The first day was magnetically quiet, and characterized by elevated electron concentrations: the diurnal F2 layer reached as much as 1012m-3, which is unusual for a winter and moderate solar activity (F10.7=130 period. An intense geomagnetic event occurred on the second day, seen in the data as a strong intensification of the ionosphere convection velocities in the early afternoon (with the northward electric field reaching 150mVm-1 and corresponding frictional heating of the ions up to 2500K. The simulation used time-dependent AMIE outputs to infer flux-tube transports in the polar region, and to provide magnetospheric particle and energy inputs to the ionosphere. The overall very good agreement, obtained between the model and the observations, demonstrates the high ability of the extended TRANSCAR model for quantitative modelling of the high-latitude ionosphere; however, some differences are found which are attributed to the precipitation of electrons with very low energy. All these results are finally discussed in the frame of modelling the auroral ionosphere with space weather applications in mind.

  6. Bayesian binary regression model: an application to in-hospital death after AMI prediction

    Directory of Open Access Journals (Sweden)

    Aparecida D. P. Souza

    2004-08-01

    Full Text Available A Bayesian binary regression model is developed to predict death of patients after acute myocardial infarction (AMI. Markov Chain Monte Carlo (MCMC methods are used to make inference and to evaluate Bayesian binary regression models. A model building strategy based on Bayes factor is proposed and aspects of model validation are extensively discussed in the paper, including the posterior distribution for the c-index and the analysis of residuals. Risk assessment, based on variables easily available within minutes of the patients' arrival at the hospital, is very important to decide the course of the treatment. The identified model reveals itself strongly reliable and accurate, with a rate of correct classification of 88% and a concordance index of 83%.Um modelo bayesiano de regressão binária é desenvolvido para predizer óbito hospitalar em pacientes acometidos por infarto agudo do miocárdio. Métodos de Monte Carlo via Cadeias de Markov (MCMC são usados para fazer inferência e validação. Uma estratégia para construção de modelos, baseada no uso do fator de Bayes, é proposta e aspectos de validação são extensivamente discutidos neste artigo, incluindo a distribuição a posteriori para o índice de concordância e análise de resíduos. A determinação de fatores de risco, baseados em variáveis disponíveis na chegada do paciente ao hospital, é muito importante para a tomada de decisão sobre o curso do tratamento. O modelo identificado se revela fortemente confiável e acurado, com uma taxa de classificação correta de 88% e um índice de concordância de 83%.

  7. A broader role for AmyR in Aspergillus niger: regulation of the utilisation of D-glucose or D-galactose containing oligo- and polysaccharides.

    Science.gov (United States)

    vanKuyk, Patricia A; Benen, Jaques A E; Wösten, Han A B; Visser, Jaap; de Vries, Ronald P

    2012-01-01

    AmyR is commonly considered a regulator of starch degradation whose activity is induced by the presence of maltose, the disaccharide building block of starch. In this study, we demonstrate that the role of AmyR extends beyond starch degradation. Enzyme activity assays, genes expression analysis and growth profiling on D-glucose- and D-galactose-containing oligo- and polysaccharides showed that AmyR regulates the expression of some of the Aspergillus niger genes encoding α- and β-glucosidases, α- and β- galactosidases, as well as genes encoding α-amlyases and glucoamylases. In addition, we provide evidence that D-glucose or a metabolic product thereof may be the inducer of the AmyR system in A. niger and not maltose, as is commonly assumed.

  8. Robillard, Amy E. and Ron Fortune (eds. Authorship Contested. Cultural Challenges to the Authentic Autonomous Author (New York, and London: Routledge, 2015

    Directory of Open Access Journals (Sweden)

    Alex Ciorogar

    2016-12-01

    Full Text Available A review of Amy E. Robillard and Ron Fortune's (eds Authorship Contested: Cultural Challenges to the Authentic Autonomous Author. New York, and London: Routledge, 2015. 214 pp. £100.

  9. Selection, calibration and mosaicing of AMIE images to build a Moon Atlas as seen by SMART-1

    Science.gov (United States)

    Almeida, M.; Fonseca, J. M.; Grieger, B.; Costa, M.; Mora, A.

    2014-04-01

    In mid 2010 the European Space Agency opened the SMART-1 data to general public. The free access to these data opened new possibilities for its exploitation and use. In this dataset, there are data from the three instruments carried on-board: an ultracompact electronic camera to survey the lunar terrain in visible and near-infrared light (AMIE), an infrared spectrometer to analyze the Moon's minerals (SIR) and an X-ray spectrometer to identify key chemical elements in the lunar surface (D-CIXS). This work is focused on the AMIE captured images, that are used to produce a complete high-resolution atlas of the Moon. During the SMART-1 mission from 2004 to 2006, the onboard AMIE camera collected 31947 start-of-the-art (at the time) resolution and coverage images from lunar surface. However, a considerable number of images were contaminated with noise or suffered from transmission errors, being unusable for any purposes. Also, during the Earth escape phase the radiation damaged significantly the AMIE sensor invalidating the laboratorial flat field correction algorithm. This malfunction was compensated by a new calibration procedure based on in-flight images and theoretical models that will be presented on this paper. After flat field compensated, all images were also calibrated to compensate the sensor color filters at 750, 915 and 960 nm, designed for multi-spectral analysis, although now we use them as full-frame gray scale images. The resulting 1024x1024 images were geographically referenced using the in-board data and mosaiced considering illumination angle and image quality, in order to produce 88 lunar surface maps with lower resolution on the North Lunar pole (spacecraft apolune altitude of 3000Km) and higher resolution on the South Lunar pole (perilune altitude of 27Km). The final maps achieved a coverture of approximately 96% of the Lunar surface. For the latitudes higher than 60ºN and lower than 75ºS polar projection was used with a resolution of 300m

  10. Antimicrobial activity against Porphyromonas gingivalis and mechanism of action of the cationic octadecapeptide AmyI-1-18 and its amino acid-substituted analogs.

    Science.gov (United States)

    Taniguchi, Masayuki; Ochiai, Akihito; Takahashi, Kiyoshi; Nakamichi, Shun-Ichi; Nomoto, Takafumi; Saitoh, Eiichi; Kato, Tetsuo; Tanaka, Takaaki

    2016-12-01

    The antimicrobial peptide AmyI-1-18 is a cationic α-helical octadecapeptide derived from α-amylase in rice (Oryza sativa L. japonica) that contains four cationic amino acid residues (two arginines and two lysines). To enhance the antibacterial activity of AmyI-1-18 against Porphyromonas gingivalis (a bacterium associated with periodontal disease), we synthesized 12 analogs bearing substitutions with alanine, leucine, and/or arginine that were designed based on helical wheel projections and investigated their antibacterial properties. The antibacterial properties of four analogs bearing substitution of a single arginine or lysine with alanine were almost similar to those of AmyI-1-18, suggesting that the antibacterial properties depend on the presence of three cationic amino acid residues. Of three single arginine-substituted analogs, AmyI-1-18(G12R) exhibited an antibacterial activity 2.8-fold higher [50% growth-inhibitory concentration (IC 50 ): 4.6 μM] than that of AmyI-1-18 (IC 50 : 13 μM). Likewise, the antibacterial properties of two single leucine-substituted analogs were significantly enhanced; in particular, AmyI-1-18(N3L) exhibited an antibacterial activity (IC 50 : 2.5 μM) 5.2-fold higher than that of AmyI-1-18. The hemolytic activity of AmyI-1-18(N3L) against mammalian red blood cells was low (2% at 50 μM). A membrane-depolarization assay using a membrane potential-sensitive fluorescent dye revealed that, similar to AmyI-1-18, the antibacterial activity of AmyI-1-18(N3L) was not dependent on its membrane-disrupting activity. Our results demonstrate that the antibacterial properties of AmyI-1-18 against P. gingivalis are significantly improved, without a significant increase in hemolytic activity, by replacing asparagine with leucine at position 3. Copyright © 2016 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  11. Limnological Conditions and Occurrence of Taste-and-Odor Compounds in Lake William C. Bowen and Municipal Reservoir #1, Spartanburg County, South Carolina, 2006-2009

    Science.gov (United States)

    Journey, Celeste A.; Arrington, Jane M.; Beaulieu, Karen M.; Graham, Jennifer L.; Bradley, Paul M.

    2011-01-01

    Limnological conditions and the occurrence of taste-and-odor compounds were studied in two reservoirs in Spartanburg County, South Carolina, from May 2006 to June 2009. Lake William C. Bowen and Municipal Reservoir #1 are relatively shallow, meso-eutrophic, warm monomictic, cascading impoundments on the South Pacolet River. Overall, water-quality conditions and phytoplankton community assemblages were similar between the two reservoirs but differed seasonally. Median dissolved geosmin concentrations in the reservoirs ranged from 0.004 to 0.006 microgram per liter. Annual maximum dissolved geosmin concentrations tended to occur between March and May. In this study, peak dissolved geosmin production occurred in April and May 2008, ranging from 0.050 to 0.100 microgram per liter at the deeper reservoir sites. Peak dissolved geosmin production was not concurrent with maximum cyanobacterial biovolumes, which tended to occur in the summer (July to August), but was concurrent with a peak in the fraction of genera with known geosmin-producing strains in the cyanobacteria group. Nonetheless, annual maximum cyanobacterial biovolumes rarely resulted in cyanobacteria dominance of the phytoplankton community. In both reservoirs, elevated dissolved geosmin concentrations were correlated to environmental factors indicative of unstratified conditions and reduced algal productivity, but not to nutrient concentrations or ratios. With respect to potential geosmin sources, elevated geosmin concentrations were correlated to greater fractions of genera with known geosmin-producing strains in the cyanobacteria group and to biovolumes of a specific geosmin-producing cyanobacteria genus (Oscillatoria), but not to actinomycetes concentrations. Conversely, environmental factors that correlated with elevated cyanobacterial biovolumes were indicative of stable water columns (stratified conditions), warm water temperatures, reduced nitrogen concentrations, longer residence times, and high

  12. Papulose bowenóide: um aspecto clínico da infecção pelo HPV Bowenoid papulosis: a clinical feature of the HPV infection

    Directory of Open Access Journals (Sweden)

    Sidney Roberto Nadal

    2009-12-01

    Full Text Available Papulose bowenóide é uma doença que acomete a pele da região anogenital e que se caracteriza pelas múltiplas pequenas pápulas planas ou aveludadas e de coloração que varia do róseo ao castanho-escuro. É provocada pelo HPV e a transmissão sexual é a forma mais freqüente de contaminação. As queixas mais comuns são prurido e dor. O aspecto é característico e o exame histopatológico confirma o diagnóstico. Junto com a doença de Bowen e a eritroplasia de Queyrat, é considerada como carcinoma in situ, ou neoplasia intra-epitelial de alto grau (NIAA, a lesão precursora do carcinoma espinocelular (CEC anal. Sem tratamento, a maioria das lesões permanece benigna e estável. Várias modalidades terapêuticas estão disponíveis, incluindo as medicações tópicas para citodestruição e as técnicas ablativas. Os esquemas tópicos são efetivos. Cabe ao profissional médico escolher a terapia adequada, tendo em mente que a doença é benigna e raramente evolui para carcinoma. Como as recidivas são freqüentes e ainda persistem dúvidas quanto ao potencial de malignização, os doentes devem ser examinados periodicamente para diagnosticar as lesões iniciais.Bowenoid papulosis is an anogenital skin disease characterized by multiple little papules, flat or velvet, which color varies from pink to dark brown. It is provoked by HPV and its transmission is sexual. Most common symptoms are anal pain and itching. Its appearance is characteristic and hystopathological examination confirms diagnosis. Together with Bowen´s disease and Queyrat erythroplasia, is considered as an in situ carcinoma, or high grade intra-epithelial neoplasia (HAIN, a precursor of the squamous-cell carcinoma. Most of lesions remain benign and stable without treatment. There are several kinds of treatment including topical drugs for cytodestruction and ablative techniques. Topic schemes are effectives. The consultant doctor may choose the most adequate therapy

  13. Análise das necessidades hídricas da vegetação Tamarisk através da razão de Bowen e do modelo SEBAL Water demand analysis of the Tamarisk vegetation through of the Bowen ratio and SEBAL model

    Directory of Open Access Journals (Sweden)

    Carlos Antonio Costa dos Santos

    2011-03-01

    Full Text Available O objetivo desse estudo foi determinar a evapotranspiração real diária (ETr da vegetação tamarisk utilizando dados micrometeorológicos e o modelo SEBAL. Foram utilizados dados provenientes do método da razão de Bowen, além do modelo SEBAL aplicado a imagens do Landsat 5 - TM, na obtenção da ETr diária da vegetação tamarisk do Baixo Rio Colorado, CA/EUA. Na obtenção da evapotranspiração de referência (ET0 foi utilizado o método da FAO/Penman-Monteith. Os resultados mostram características de forte advecção de ar, e que a radiação solar é o componente de maior influência na obtenção da ET0. Verifica-se também, que a vegetação tamarisk tem alto consumo hídrico e a sua rápida expansão poderá trazer impactos negativos para os rios da região. As estimativas da ETr pelo modelo SEBAL são similares aos valores medidos na torre micrometeorológica pelo método da razão de Bowen, demonstrando a aplicabilidade do modelo SEBAL na obtenção da distribuição espacial da evapotranspiração real diária.The objective of this study was to determine the daily actual evapotranspiration (ETr of the tamarisk vegetation using micrometeorological data and SEBAL model. Data originating from the Bowen ratio method were used, besides the SEBAL model applied to TM Landsat 5 image for obtaining the daily ETr of the tamarisk vegetation of Lower Colorado River, CA/USA. For obtaining the reference evapotranspiration (ET0 the FAO/Penman-Monteith method was used. The results show characteristics of strong air advection and that the solar radiation has the largest influence in obtaining ET0, as well as, that the tamarisk vegetation has high water demand and its fast expansion can bring negative impacts for the rivers of the area. The estimates of ETr through the SEBAL model are similar to the measured values on the micrometeorological tower by the Bowen ratio method, demonstrating the applicability of the SEBAL model to obtain the spatial

  14. Betwixt and Between Past and Present: Cultural and Generic Hybridity in the Fiction of Amy Tan and Mary Yukari Waters

    OpenAIRE

    Rania Youssef

    2013-01-01

    Amy Tan and Mary Yukari Waters are both Asian-Americans who portray hybridity in their short stories which depict the shifting identities of the self. But do the internal categories of gender, race and ethnicity help in the coherence or do they add to the fragmentation of diverse identities? It is the dynamics of this critique of multiple identification and hybrid cultures that is being traced here in this study and how all this is reflected in narrative responses to such conditions of ...

  15. Proactive Approach for Safe Use of Antimicrobial Coatings in Healthcare Settings: Opinion of the COST Action Network AMiCI

    Directory of Open Access Journals (Sweden)

    Merja Ahonen

    2017-03-01

    Full Text Available Infections and infectious diseases are considered a major challenge to human health in healthcare units worldwide. This opinion paper was initiated by EU COST Action network AMiCI (AntiMicrobial Coating Innovations and focuses on scientific information essential for weighing the risks and benefits of antimicrobial surfaces in healthcare settings. Particular attention is drawn on nanomaterial-based antimicrobial surfaces in frequently-touched areas in healthcare settings and the potential of these nano-enabled coatings to induce (ecotoxicological hazard and antimicrobial resistance. Possibilities to minimize those risks e.g., at the level of safe-by-design are demonstrated.

  16. MR tomography of focal liver lesions using the superparamagnetic contrast agent AMI-25 at 1.5 tesla

    International Nuclear Information System (INIS)

    Duda, S.H.; Laniado, M.; Kopp, A.F.; Groenewaeller, E.; Aicher, K.P.; Pavone, P.; Jehle, E.; Claussen, C.D.

    1994-01-01

    Superparamagnetic iron oxide particles (AMI-25) were evaluated as a liver contrast agent in high-field MR imaging (1.5 T). 16 patients with up to 5 presumed focal liver lesions (liver metastases n=8, HCC n=5, Klatskin tumours n=2, FNH n=1) received 15 μmol Fe/kg BW intravenously and were examined via standard T 1 - and T 2 -weighted spin-echo sequences. Quantitative image analysis showed a post-contrast increase of the contrast-to-noise ratio (C/N) from 1.6 to 7.4 on SE 2,500/15 images (p [de

  17. The amyR-deletion strain of Aspergillus niger CICC2462 is a suitable host strain to express secreted protein with a low background.

    Science.gov (United States)

    Zhang, Hui; Wang, Shuang; Zhang, Xiang Xiang; Ji, Wei; Song, Fuping; Zhao, Yue; Li, Jie

    2016-04-28

    The filamentous fungus Aspergillus niger is widely exploited as an important expression host for industrial production. The glucoamylase high-producing strain A. niger CICC2462 has been used as a host strain for the establishment of a secretion expression system. It expresses recombinant xylanase, mannase and asparaginase at a high level, but some high secretory background proteins in these recombinant strains still remain, such as alpha-amylase and alpha-glucosidase; lead to a low-purity of fermentation products. The aim was to construct an A. niger host strain with a low background of protein secretion. The transcription factor amyR was deleted in A. niger CICC2462, and the results from enzyme activity assays and SDS-PAGE analysis showed that the glucoamylase and amylase activities of the ∆amyR strains were significantly lower than those of the wild-type strain. High-throughput RNA-sequencing and shotgun LC-MS/MS proteomic technology analysis demonstrated that the expression of amylolytic enzymes was decreased at both the transcriptional and translational levels in the ∆amyR strain. Interestingly, the ∆amyR strain growth rate better than the wild-type strain. Our findings clearly indicated that the ∆amyR strain of A. niger CICC2462 can be used as a host strain with a low background of protein secretion.

  18. FTT-MA: A Flexible Time-Triggered Middleware Architecture for Time Sensitive, Resource-Aware AmI Systems

    Directory of Open Access Journals (Sweden)

    Federico Pérez

    2013-05-01

    Full Text Available There is an increasing number of Ambient Intelligence (AmI systems that are time-sensitive and resource-aware. From healthcare to building and even home/office automation, it is now common to find systems combining interactive and sensing multimedia traffic with relatively simple sensors and actuators (door locks, presence detectors, RFIDs, HVAC, information panels, etc.. Many of these are today known as Cyber-Physical Systems (CPS. Quite frequently, these systems must be capable of (1 prioritizing different traffic flows (process data, alarms, non-critical data, etc., (2 synchronizing actions in several distributed devices and, to certain degree, (3 easing resource management (e.g., detecting faulty nodes, managing battery levels, handling overloads, etc.. This work presents FTT-MA, a high-level middleware architecture aimed at easing the design, deployment and operation of such AmI systems. FTT-MA ensures that both functional and non-functional aspects of the applications are met even during reconfiguration stages. The paper also proposes a methodology, together with a design tool, to create this kind of systems. Finally, a sample case study is presented that illustrates the use of the middleware and the methodology proposed in the paper.

  19. FTT-MA: A Flexible Time-Triggered Middleware Architecture for Time Sensitive, Resource-Aware AmI Systems

    Science.gov (United States)

    Noguero, Adrián; Calvo, Isidro; Pérez, Federico; Almeida, Luis

    2013-01-01

    There is an increasing number of Ambient Intelligence (AmI) systems that are time-sensitive and resource-aware. From healthcare to building and even home/office automation, it is now common to find systems combining interactive and sensing multimedia traffic with relatively simple sensors and actuators (door locks, presence detectors, RFIDs, HVAC, information panels, etc.). Many of these are today known as Cyber-Physical Systems (CPS). Quite frequently, these systems must be capable of (1) prioritizing different traffic flows (process data, alarms, non-critical data, etc.), (2) synchronizing actions in several distributed devices and, to certain degree, (3) easing resource management (e.g., detecting faulty nodes, managing battery levels, handling overloads, etc.). This work presents FTT-MA, a high-level middleware architecture aimed at easing the design, deployment and operation of such AmI systems. FTT-MA ensures that both functional and non-functional aspects of the applications are met even during reconfiguration stages. The paper also proposes a methodology, together with a design tool, to create this kind of systems. Finally, a sample case study is presented that illustrates the use of the middleware and the methodology proposed in the paper. PMID:23669711

  20. On the Equality Assumption of Latent and Sensible Heat Energy Transfer Coefficients of the Bowen Ratio Theory for Evapotranspiration Estimations: Another Look at the Potential Causes of Inequalities

    Directory of Open Access Journals (Sweden)

    Suat Irmak

    2014-08-01

    Full Text Available Evapotranspiration (ET and sensible heat (H flux play a critical role in climate change; micrometeorology; atmospheric investigations; and related studies. They are two of the driving variables in climate impact(s and hydrologic balance dynamics. Therefore, their accurate estimate is important for more robust modeling of the aforementioned relationships. The Bowen ratio energy balance method of estimating ET and H diffusions depends on the assumption that the diffusivities of latent heat (KV and sensible heat (KH are always equal. This assumption is re-visited and analyzed for a subsurface drip-irrigated field in south central Nebraska. The inequality dynamics for subsurface drip-irrigated conditions have not been studied. Potential causes that lead KV to differ from KH and a rectification procedure for the errors introduced by the inequalities were investigated. Actual ET; H; and other surface energy flux parameters using an eddy covariance system and a Bowen Ratio Energy Balance System (located side by side on an hourly basis were measured continuously for two consecutive years for a non-stressed and subsurface drip-irrigated maize canopy. Most of the differences between KV and KH appeared towards the higher values of KV and KH. Although it was observed that KV was predominantly higher than KH; there were considerable data points showing the opposite. In general; daily KV ranges from about 0.1 m2∙s−1 to 1.6 m2∙s−1; and KH ranges from about 0.05 m2∙s−1 to 1.1 m2∙s−1. The higher values for KV and KH appear around March and April; and around September and October. The lower values appear around mid to late December and around late June to early July. Hourly estimates of KV range between approximately 0 m2∙s−1 to 1.8 m2∙s−1 and that of KH ranges approximately between 0 m2∙s−1 to 1.7 m2∙s−1. The inequalities between KV and KH varied diurnally as well as seasonally. The inequalities were greater during the non

  1. Cell wall amidase AmiC1 is required for cellular communication and heterocyst development in the cyanobacterium Anabaena PCC 7120 but not for filament integrity.

    Science.gov (United States)

    Berendt, Susanne; Lehner, Josef; Zhang, Yao Vincent; Rasse, Tobias M; Forchhammer, Karl; Maldener, Iris

    2012-10-01

    Filamentous cyanobacteria of the order Nostocales display typical properties of multicellular organisms. In response to nitrogen starvation, some vegetative cells differentiate into heterocysts, where fixation of N(2) takes place. Heterocysts provide a micro-oxic compartment to protect nitrogenase from the oxygen produced by the vegetative cells. Differentiation involves fundamental remodeling of the gram-negative cell wall by deposition of a thick envelope and by formation of a neck-like structure at the contact site to the vegetative cells. Cell wall-hydrolyzing enzymes, like cell wall amidases, are involved in peptidoglycan maturation and turnover in unicellular bacteria. Recently, we showed that mutation of the amidase homologue amiC2 gene in Nostoc punctiforme ATCC 29133 distorts filament morphology and function. Here, we present the functional characterization of two amiC paralogues from Anabaena sp. strain PCC 7120. The amiC1 (alr0092) mutant was not able to differentiate heterocysts or to grow diazotrophically, whereas the amiC2 (alr0093) mutant did not show an altered phenotype under standard growth conditions. In agreement, fluorescence recovery after photobleaching (FRAP) studies showed a lack of cell-cell communication only in the AmiC1 mutant. Green fluorescent protein (GFP)-tagged AmiC1 was able to complement the mutant phenotype to wild-type properties. The protein localized in the septal regions of newly dividing cells and at the neck region of differentiating heterocysts. Upon nitrogen step-down, no mature heterocysts were developed in spite of ongoing heterocyst-specific gene expression. These results show the dependence of heterocyst development on amidase function and highlight a pivotal but so far underestimated cellular process, the remodeling of peptidoglycan, for the biology of filamentous cyanobacteria.

  2. Temperature profiles from expendable bathythermograph (XBT) casts from the USS BOWEN and other Platforms from the Gulf of Alaska in support of the Integrated Global Ocean Services System (IGOSS) from 1983-09-06 to 1983-10-11 (NODC Accession 8300182)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — XBT data were collected from the USS BOWEN in support of the Integrated Global Ocean Services System (IGOSS). Data were collected by the US DOC; NOAA; National Ocean...

  3. Asteroid Moon Micro-imager Experiment (amie) For Smart-1 Mission, Science Objectives and Devel- Opment Status.

    Science.gov (United States)

    Josset, J.-L.; Heather, D.; Dunkin, S.; Roussel, F.; Beauvivre, S.; Kraenhenbuehl, D.; Plancke, P.; Lange-Vin, Y.; Pinet, P.; Chevrel, S.; Cerroni, P.; de Sanctis, M.-C.; Dillelis, A.; Sodnik, Z.; Koschny, D.; Barucci, A.; Hofmann, B.; Josset, M.; Muinonen, K.; Pironnen, J.; Ehrenfreud, P.; Shkuratov, Y.; Shevchenko, V.

    The Asteroid Moon micro-Imager Experiment (AMIE), which will be on board the first ESA SMART-1 mission to the Moon (launch foreseen late 2002), is an imaging sys- tem with scientific, technical and public outreach oriented objectives. The science objectives are to imagine the Lunar South Pole (Aitken basin), permanent shadow areas (ice deposit), eternal light (crater rims), ancient Lunar Non- mare volcanism, local spectro-photometry and physical state of the lunar surface, and to map high latitudes regions (south) mainly at far side (Fig. 1). The technical objectives are to perform a laser-link experiment (detection of laser beam emitted by ESA Tenerife ground station), flight demonstration of new technologies, navigation aid (feasi- bility study), and on-board autonomy investigations. Figure 3: AMIE camera (light source and a photodiode to verify the stability of the incident flux. The optical system is com- posed of a lens to insure good focusing on the samples (focus with the camera is at distance > 100m) and a mirror to image downwards. The samples used were anorthosite from northern Finland, basalt from Antarctis, meteorites and other lunar analog materials. A spectralon panel has also been used to have flat fields references. The samples were imaged with dif- Figure 1: SMART-1 camera imaging the Moon (simulated view) ferent phase angles. Figure 4 shows images obtained with In order to have spectral information of the surface of the basalt and olivine samples, with different integration times Moon, the camera is equipped with a set of filters (Fig. 2), in order to have information in all areas. introduced between the CCD and the teleobjective. Bandpass-filter No Filter, 750 nm (1) AR coating (3) Bandpass-filter 915 nm (2) Longpass-filter 960 nm (4) Band- Band- Figure 4: Basalt and Olivine sample ­ entire image (left) and passfilter passfilter 915 nm 750 nm visible part () (6) (7) Bandpass- More than 150 images were acquired during this validation filter 847

  4. Improving Learning Tasks for Mentally Handicapped People Using AmI Environments Based on Cyber-Physical Systems

    Directory of Open Access Journals (Sweden)

    Diego Martín

    2018-01-01

    Full Text Available A prototype to improve learning tasks for mentally handicapped people is shown in this research paper using ambient intelligence techniques and based on cyber-physical systems. The whole system is composed of a worktable, a cyber-glove (both with several RFID and NFC detection zones, and an AmI software application for modeling and workflow guidance. A case study was carried out by the authors where sixteen mentally handicapped people and 3 trainers were involved in the experiment. The experiment consisted in the execution of several memorization tasks of movements of objects using the approach presented in this paper. The results obtained were very interesting, indicating that this kind of solutions are feasible and allow the learning of complex tasks to some types of mentally handicapped people. In addition, at the end of the paper are presented some lessons learned after performing the experimentation.

  5. Balanço de energia e estimativa da evapotranspiração em culturas irrigadas de maracujazeiro pelo método da razão de Bowen Energy balance and estimative of the evapotranspiration of irrigated passionfruit crops by the Bowen ratio method

    Directory of Open Access Journals (Sweden)

    Tonny J. A. Silva

    2007-08-01

    Full Text Available A cultura do maracujazeiro-amarelo tem tido grande expansão da área cultivada no Estado de São Paulo e, apesar da importância da irrigação para a cultura, há poucos estudos sobre sua utilização. Este trabalho foi realizado na área experimental de irrigação, na Fazenda Areão, do Departamento de Engenharia Rural, da Escola Superior de Agricultura "Luiz de Queiroz" - ESALQ/USP (Piracicaba - SP. Foram coletados dados de saldo de radiação, fluxo de calor no solo, gradientes de temperatura e pressão de vapor do ar com o objetivo de avaliar a partição da energia disponível e a evapotranspiração em cultivo de maracujazeiros em dois sistemas de plantio (linhas de cultivo norte-sul e leste-oeste. O método da razão de Bowen foi utilizado na determinação dos fluxos de calor sensível e latente. O saldo de radiação não foi influenciado pelo sistema de plantio, sendo equivalente a 60% da radiação global. O componente de maior contribuição no balanço de energia foi o calor latente de evaporação ocorrendo imediatamente após a chuva ou irrigação. A utilização do modelo de análise e exclusão de intervalos em que o método da Razão de Bowen falha, melhora a estimativa da evapotranspiração.Passionfruit crop has been having great expansion in the cultivated area of São Paulo State and beside the irrigation importance for crop; there are few studies about its utilization. This work was carried out at the experimental irrigation farm of the Engineering Department - College of Agriculture "Luiz de Queiroz" - ESALQ/USP, in Piracicaba, São Paulo State, Brazil. Were collected micrometeorological data from net radiation, soil flux heat, temperature and vapor pressure gradient with the aim to evaluate the partition of available energy and evapotranspiration of passionfruit crop planted under two row directions (North-South and East-West. The Bowen ratio method was used to determine both sensible and latent fluxes. The net

  6. Comparison of eddy covariance and modified Bowen ratio methods for measuring gas fluxes and implications for measuring fluxes of persistent organic pollutants

    Directory of Open Access Journals (Sweden)

    D. J. Bolinius

    2016-04-01

    Full Text Available Semi-volatile persistent organic pollutants (POPs cycle between the atmosphere and terrestrial surfaces; however measuring fluxes of POPs between the atmosphere and other media is challenging. Sampling times of hours to days are required to accurately measure trace concentrations of POPs in the atmosphere, which rules out the use of eddy covariance techniques that are used to measure gas fluxes of major air pollutants. An alternative, the modified Bowen ratio (MBR method, has been used instead. In this study we used data from FLUXNET for CO2 and water vapor (H2O to compare fluxes measured by eddy covariance to fluxes measured with the MBR method using vertical concentration gradients in air derived from averaged data that simulate the long sampling times typically required to measure POPs. When concentration gradients are strong and fluxes are unidirectional, the MBR method and the eddy covariance method agree within a factor of 3 for CO2, and within a factor of 10 for H2O. To remain within the range of applicability of the MBR method, field studies should be carried out under conditions such that the direction of net flux does not change during the sampling period. If that condition is met, then the performance of the MBR method is neither strongly affected by the length of sample duration nor the use of a fixed value for the transfer coefficient.

  7. Participation in the ARGUS experiment at the DORIS Collider at Desy, Hamburg, Germany and participation in the AMY experiment at the TRISTAN Collider in Tsukuba, Japan: 1986 progress report

    International Nuclear Information System (INIS)

    Darden, C.

    1987-01-01

    Progress is reported on the AMY and ARGUS detectors, as well as plans for the next funding period. The AMY detector is reported as well on the way to completion, but not yet ready to take data. The ARGUS detector is reported to have completed its fourth year of operation. Some upsilon 1S decay data are discussed. 37 refs

  8. Rock and roll or rock and fall? Gendered framing of the rock and roll lifestyles of Amy Winehouse and Pete Doherty in British broadsheets

    NARCIS (Netherlands)

    P.P.L. Berkers (Pauwke); M. Eeckelaer (Merel)

    2014-01-01

    textabstractCombining insights from gender, popular music, and celebrity studies, this article addresses to what extent British broadsheets frame Amy Winehouse and Pete Doherty differently with regard to their rock and roll lifestyle. Our content analyses of The Guardian and The Independent indicate

  9. «Il nastro a rovescio». Possibili influenze di Storie Naturali ne La freccia del tempo di Martin Amis

    Directory of Open Access Journals (Sweden)

    Giuseppe Alvino

    2016-11-01

    Full Text Available Il presente contributo si propone di ripercorrere le tappe del rapporto letterario tra Martin Amis e Primo Levi, sottolineando l’attenzione dello scrittore inglese nei confronti dei testi di Levi. Come Amis stesso scrive più volte, Levi fu per lui una delle letture fondamentali nel suo percorso di ricerca letteraria; e nella Postfazione di una delle sue opere principali, Time’s arrow (La freccia del tempo, l’autore richiama per ben due volte l’attenzione su Levi, da un lato, ritenendo che senza le letture leviane non avrebbe potuto scrivere il suo romanzo, e dall’altro, avvertendo il lettore che il titolo pensato originariamente era un’espressione leviana, La natura dell’offesa (oggi secondo titolo de La freccia del tempo. Partendo da questi presupposti si nota come, nel racconto Trattamento di quiescenza della raccolta Storie Naturali, Levi parla tangenzialmente di uno scorrere del tempo al contrario e con una causalità inversa, nello stesso modo in cui Amis, in maniera più sistematica e precisa, costruisce per intero il suo romanzo. Dunque si potrebbe ipotizzare che Amis si sia ispirato non solo al Levi di Se questo è un uomo, La tregua e I sommersi e i salvati per il tema del suo romanzo (e cioè la barbarie nazista, ma anche al Levi dei racconti per il modo tutto particolare di narrare la sua storia. Del resto, la scelta di scrivere il romanzo ‘al contrario’ è funzionale al tema: solo in un mondo con un tempo e una causalità ‘al contrario’ la barbarie dei campi di concentramento sarebbe giustificabile. The purpose of this paper is to explore the literary relationship between Martin Amis and Primo Levi, highlighting how the English writer directed his attention to Levi’s works. As Amis himself often writes, Levi was one of his fundamental readings in his literary research; in the Afterword of one of his masterpieces, Time’s Arrow, the author mentions Levi twice: on the one hand, he claims that he could not

  10. Clinical trials update from the American Heart Association: REPAIR-AMI, ASTAMI, JELIS, MEGA, REVIVE-II, SURVIVE, and PROACTIVE.

    Science.gov (United States)

    Cleland, John G F; Freemantle, Nick; Coletta, Alison P; Clark, Andrew L

    2006-01-01

    This article provides information and a commentary on trials presented at the American Heart Association meeting held in November 2005, relevant to the pathophysiology, prevention and treatment of heart failure. All reports should be considered as preliminary data, as analyses may change in the final publication. In REPAIR-AMI an improvement in ejection fraction was observed in post-MI patients following infusion of bone marrow stem cells. However, the ASTAMI study showed no benefit of stem cell implantation in a similar patient cohort. The JELIS study reported a reduction in major coronary events in patients receiving statins plus fish oil compared to statins alone. MEGA showed that low dose statins in a low risk population reduce the incidence of major cardiovascular events. Two studies of levosimendan in acute heart failure gave conflicting results, in the REVIVE-II study levosimendan was reported to have a superior effect on the composite primary outcome compared to placebo, however, in SURVIVE despite a trend to early benefit with levosimendan, there was no difference in effect on long-term outcome versus dobutamine. The PROACTIVE study showed encouraging results for the use of pioglitazone in post-myocardial infarction patients with concomitant type 2 diabetes.

  11. Assessment of ionospheric Joule heating by GUMICS-4 MHD simulation, AMIE, and satellite-based statistics: towards a synthesis

    Directory of Open Access Journals (Sweden)

    M. Palmroth

    2005-09-01

    Full Text Available We investigate the Northern Hemisphere Joule heating from several observational and computational sources with the purpose of calibrating a previously identified functional dependence between solar wind parameters and ionospheric total energy consumption computed from a global magnetohydrodynamic (MHD simulation (Grand Unified Magnetosphere Ionosphere Coupling Simulation, GUMICS-4. In this paper, the calibration focuses on determining the amount and temporal characteristics of Northern Hemisphere Joule heating. Joule heating during a substorm is estimated from global observations, including electric fields provided by Super Dual Auroral Network (SuperDARN and Pedersen conductances given by the ultraviolet (UV and X-ray imagers on board the Polar satellite. Furthermore, Joule heating is assessed from several activity index proxies, large statistical surveys, assimilative data methods (AMIE, and the global MHD simulation GUMICS-4. We show that the temporal and spatial variation of the Joule heating computed from the GUMICS-4 simulation is consistent with observational and statistical methods. However, the different observational methods do not give a consistent estimate for the magnitude of the global Joule heating. We suggest that multiplying the GUMICS-4 total Joule heating by a factor of 10 approximates the observed Joule heating reasonably well. The lesser amount of Joule heating in GUMICS-4 is essentially caused by weaker Region 2 currents and polar cap potentials. We also show by theoretical arguments that multiplying independent measurements of averaged electric fields and Pedersen conductances yields an overestimation of Joule heating.

    Keywords. Ionosphere (Auroral ionosphere; Modeling and forecasting; Electric fields and currents

  12. Clinical significance of measurement of changes of plasma Hcy and ET levels after treatment in patients with acute myocardial infarction (AMI)

    International Nuclear Information System (INIS)

    Zhou Feng

    2008-01-01

    Objective: To explore the clinical significance of changes of plasma Hcy and ET levels in patients with AMI after treatment. Methods: Plasma Hcy and ET levels were measured with RIA in 33 patients with acute myocardial infarction both before and after treatment as well as in 30 controls. Results: Plasma Hcy and ET levels were significantly higher in the AMI patients than those in the controls before treatment and the levels were mutually positively correlated (P 0.05), but plasma ET levels, though dropped markedly remained significantly higher (P<0.05). Conclusion: Changes of plasma Hcy and ET levels after treatment might be of prognostic importance in patients with acute myocardial infarction. (authors)

  13. Report on information collection and analysis for fundamental survey on coal resource development in fiscal 1998. Survey on coal supply potentiality in Bowen Basin in Australia; 1998 nendo sekitan shigen kaihatsu kiso chosa joho shushu kaiseki hokokusho. Goshu Bowen bonchi sekitan kyokyu potentiality chosa

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    A survey was made on coal supply potentiality in Bowen Basin in Australia. The main coal beds exist in the order of four beds in the Permian period. The oldest bed is the Reids Dome bed in the Lower Permian period, deposited in the south-west part of the basin. The later wide-area transgression has caused the Back Creek bed groups to deposit, whereas three coal measures have deposited in a concave on the raised basic bed. Later, the ocean has invaded into the entire basin. After having turned into the Upper Permian period, regression had occurred from north to south, where major coal measures such as the Moranbah and German Creek beds had deposited over the entire basin. Further regression has taken place to south, causing three uppermost coal measures to have deposited over the entire basin. In major part of the areas identified currently with existence of coal measures, and even in areas without mines, the mining right or the exploration right has been established, limiting the areas having development potentiality. Five abandoned mining areas exist in the Rangal coal measure, two in the Moranbah coal measure, two in the Reids Dome coal measure, and one in the Baralaba coal measure. There is a possibility of discovering areas developable for a scale of several ten million tons. (NEDO)

  14. [The DMS 48: norms and diagnostic proprieties for Alzheimer's disease in elderly population from the AMI cohort study].

    Science.gov (United States)

    Rullier, Laetitia; Matharan, Fanny; Barbeau, Emmanuel J; Mokri, Hind; Dartigues, Jean-François; Pérès, Karine; Amieva, Hélène

    2014-09-01

    The DMS 48 is a visual recognition memory test designed to detect memory changes in early Alzheimer's disease (AD). The aim of this study was to produce normative scores for this test and to assess its psychometric properties in the detection of AD by comparison with a widely used test of verbal episodic memory: the story recall task of the Wechsler memory scale. Methods. Data were collected in a sample of 1002 agricultural retirees, aged 65 years and over, included in the AMI study, a population-based cohort conducted in Southwestern France. The sample used to establish normative data included 750 non-demented elderly while the sample used to study the properties of the test to detect AD included 751 participants whose 34 with AD. To assess AD detection accuracy, DMS 48 was compared to the Wechsler story recall task. Results. Age, sex, and education were significantly associated with DMS 48 performances. Therefore, normative scores were calculated according to sex, age, and educational level, and described by percentiles. Regarding the test properties for AD detection, DMS 48 presented a good balance between sensitivity (Se) and specificity (Sp) both for immediate (Se=70.6%; Sp=79.6%) and delayed recall (Se=79.4%; Sp=72.9%). It also showed high negative predictive values, around 98.5% for both recalls. Detection values were roughly similar to that of Wechsler story recall task. The DMS 48 seems to be as reliable as the Wechsler story recall task with similar detection properties. The DMS 48 is a test easy to administer in clinical situations and could be a helpful tool for AD screening.

  15. A starch-binding domain identified in α-amylase (AmyP) represents a new family of carbohydrate-binding modules that contribute to enzymatic hydrolysis of soluble starch.

    Science.gov (United States)

    Peng, Hui; Zheng, Yunyun; Chen, Maojiao; Wang, Ying; Xiao, Yazhong; Gao, Yi

    2014-04-02

    A novel starch-binding domain (SBD) that represents a new carbohydrate-binding module family (CBM69) was identified in the α-amylase (AmyP) of the recently established alpha-amylase subfamily GH13_37. The SBD and its homologues come mostly from marine bacteria, and phylogenetic analysis indicates that they are closely related to the CBM20 and CBM48 families. The SBD exhibited a binding preference toward raw rice starch, but the truncated mutant (AmyPΔSBD) still retained similar substrate preference. Kinetic analyses revealed that the SBD plays an important role in soluble starch hydrolysis because different catalytic efficiencies have been observed in AmyP and the AmyPΔSBD. Copyright © 2014 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

  16. Bower ratio-energy balance associated errors in vineyards under dripping irrigation Erros associados pela razão de bowen ao balanço de energia em parreirais sob irrigação por gotejamento

    Directory of Open Access Journals (Sweden)

    José Monteiro Soares

    2007-08-01

    Full Text Available This study was conducted at the Bebedouro Experimental Station in Petrolina-PE, Brazil, to evaluate the errors associated to the application of the Bowen ratio-energy balance in a 3-years old vineyard (Vitis vinifera, L, grown in a trellis system, irrigated by dripping. The field measurements were taken during fruiting cycle (July to November, 2001, which was divided into eigth phenological stages. A micrometeorological tower was mounted in a grape-plants row in which sensors of net radiation, global solar radiation and wind speed were installed at about 1.0 m above the canopy. Also in the tower, two psicometers were installed at two levels (0.5 and 1.8 m above the vineyard canopy. Two soil heat flux plates were buried at 0.02 m beneath the soil surface. All these sensors were connected to a Data logger 21 X of Campbell Scientific Inc., programmed for collecting data once every 5 seconds and storage averages for every 15 minutes. A comparative analysis were made among four Bowen ratio accepting/rejecting rules, according to the methodology proposed by Spano et al. (2000: betar1 - values of beta calculated by Bowen (1926 equation; betar2 - values of beta as proposed by Verma et al. (1978 equation; betar3 - exclusion of the beta values obtained as recommended by Unland et al. (1996 and betar4 - exclusion of the beta values calculated as proposed by Bowen (1926, out of the interval (-0.7 Este estudo foi conduzido na Estação Experimental de Bebedouro, Petrolina-PE, Brasil, para avaliar os erros associados com a aplicação do balanço de energia com base na razão de Bowen em um parreiral (Vitis vinifera, L com três anos de idade, conduzido em latada, sob irrigação por gotejamento. As medições foram feitas durante o ciclo produtivo de julho a novembro de 2001, que foi dividido em oito estádios fenológicos. Numa torre micrometeorológica localizada no centro do parreiral, foram instalados a 1,00 m acima do dossel da videira, os seguintes

  17. Amy Schwab | NREL

    Science.gov (United States)

    Strategic Energy Analysis Center. Areas of Expertise Bioenergy supply chain and market analysis Integrative strategic scenario planning and analysis Program portfolio analysis Program management, planning and strategic execution Change management and operational improvement Research Interests Bioenergy supply chains

  18. Luminosity measurement at AMY

    International Nuclear Information System (INIS)

    Kurihara, Y.

    1995-01-01

    A precise measurement of a luminosity is required by experiments with high statistics. The largest sources of a systematic error of a luminosity measurement are an alignment of the tube chambers which measure a polar angle of Bhabha events and a higher order correction for the Bhabha cross section calculation. We describe a resent study for these uncertainties and how to reduce the systematic errors from these sources. The total systematic error of the luminosity measurement of 1.8% can be reduced to 1.0% by this study. (author)

  19. Estimativa do balanço de energia em cambarazal e pastagem no norte do Pantanal pelo método da razão de Bowen Estimate of energy balance in cambarazaland pasture in the north of Pantanal by Bowen ratio method

    Directory of Open Access Journals (Sweden)

    Marcelo Sacardi Biudes

    2009-06-01

    Full Text Available O estudo do balanço de energia de uma superfície vegetada e a atmosfera é importante para caracterizar o microclima local, identificar interações entre variáveis ambientais e a vegetação, e identificar efeitos das atividades antropogênicas. O objetivo deste trabalho foi estimar a variação sazonal do balanço de energia pelo método da razão de Bowen em uma área de vegetação monodominante de Cambará na RPPN SESC-Pantanal e uma área de pastagem na Fazenda Experimental da UFMT. Os componentes do balanço de energia apresentaram sazonalidade, com maiores médias na estação chuvosa nas duas áreas de estudo. No cambarazal houve maior variação do fluxo de calor latente da estação seca para a chuvosa que na pastagem. Entretanto, a variação sazonal do fluxo de calor sensível foi menor no cambarazal que na pastagem, devido ao efeito termo-regulador do cambarazal, em função da maior biomassa. A energia disponível aos dois sítios foi destinada prioritariamente em fluxo de calor latente, 80,0% no cambarazal e 56,6% na pastagem, seguido pelo fluxo de calor sensível, 19,1 e 42,9%, e pelo fluxo de calor no solo, 0,3 e 7,2%.The energy balance study of a vegetated surface and atmosphere is important to characterize the local microclimate, identify interactions among environmental variables and the vegetation and to identify anthropogenic activities effects. The objective of this work was estimate the seasonality of energy balance by Bowen ratio method in a monodominant vegetation of Cambará area in the RPPN SESC-Pantanal and a pasture area in UFMT's Experimental Farm. The energy balance components presented seasonality, with larger averages at the rainy station in two areas of study. In the cambarazal was a higher variation of the latent heat flux of the dry season for the rainy season that in the pasture. However, the seasonal variation of the sensible heat flux in the cambarazal was lower than in the pasture, due to the thermo

  20. Measuring Evapotranspiration of five Alley Cropping systems in Germany using the Eddy-Covariance- and Bowen-Ratio Energy-Balance methods

    Science.gov (United States)

    Markwitz, Christian; Knohl, Alexander; Siebicke, Lukas

    2017-04-01

    The inclusion of trees into the agricultural landscape of Europe is gaining popularity as a source for energy production. Fast growing tree species such as poplar or willow are included as short rotation coppice or alley cropping systems, which consist of tree alleys interleaved by annual rotating crops or perennial grasslands. Estimating turbulent fluxes of those systems using the eddy-covariance- (ECEB) and bowen-ratio energy-balance (BREB) method is challenging due to the methods limitation to horizontally homogeneous terrain and steady state conditions. As the conditions are not fulfilled for those systems the energy-balance is commonly not fully closed, with the non-closure being site specific. An underestimation of measured heat fluxes leads to an overestimation of the latent heat fluxes inferred from the ECEB method. The aim of our study is to 1) quantify the site specific non-closure of the energy-balance and 2) characterize the performance of both methods, compared to direct eddy-covariance measurements using a high frequency infra-red gas analyzer (LI-7200, Licor Inc.). To assess continuous evapotranspiration (ET) rates on a 30-minute time scale we installed a combined ECEB and BREB system at five alley cropping and five agricultural reference sites across Germany. For time periods of four weeks we performed direct eddy covariance flux measurements for H2O and CO2 over one crop- and one grassland alley cropping- and their respective reference systems during the growing season of 2016. We found a non-closure between 21 and 26 % for all sites, considering all day- and night-time data. The residual energy was highest during the morning and lowest in the afternoon. Related to that the energy-balance ratio (EBR), i.e. the ratio between the turbulent heat fluxes and available energy, was below one in the morning hours and increased slightly during the day up to 1.8, until the EBR decreased sharply after sunset. The EBR correlated to the daily cycle of solar

  1. Influences of AMY1 gene copy number and protein expression on salivary alpha-amylase activity before and after citric acid stimulation in splenic asthenia children.

    Science.gov (United States)

    Yang, Zemin; Lin, Jing; Chen, Longhui; Zhang, Min; Yang, Xiaorong; Chen, Weiwen

    2015-06-01

    To compare the correlations between salivary alpha-amylase (sAA) activity and amylase, alpha 1 (salivary) gene (AMYl) copy number or its gene expression between splenic asthenia and healthy children, and investigate the reasons of attenuated sAA activity ratio before and after citric acid stimulation in splenic asthenia children. Saliva samples from 20 splenic asthenia children and 29 healthy children were collected before and after citric acid stimulation. AMYl copy number, sAA activity, and total sAA and glycosylated sAA contents were determined, and their correlations were analyzed. Although splenic asthenia and healthy children had no differences in AMY1 copy number, splenic asthenia children had positive correlations between AMY1 copy number and sAA activity before or after citric acid stimulation. Splenic asthenia children had a higher sAA glycosylated proportion ratio and glycosylated sAA content ratio, while their total sAA content ratio and sAA activity ratio were lower compared with healthy children. The glycosylated sAA content ratio was higher than the total sAA content ratio in both groups. Splenic asthenia and healthy children had positive correlations between total sAA or glycosylated sAA content and sAA activity. However, the role played by glycosylated sAA content in sAA activity in healthy children increased after citric acid stimulation, while it decreased in splenic asthenia children. Genetic factors like AMY1 copy number variations, and more importantly, sAA glycosylation abnormalities leading to attenuated sAA activity after citric acid stimulation, which were the main reasons of the attenuated sAA activity ratio in splenic asthenia children compared with healthy children.

  2. Oh and by the way, you get meter readings too : a look at distribution automation, intelligent grids, and demand side management : getting the real value from your AMI

    Energy Technology Data Exchange (ETDEWEB)

    Summerlin, T. [Gestalt, Camden, NJ (United States); Ferguson, P.D. [Newmarket Hydro Ltd., Newmarket, ON (Canada)

    2006-07-01

    The full value of smart metering programs will be realized when information and communication capabilities are used to enable distribution automation, intelligent grids, and sufficient data management that will transform interval meter data into useful information. By leveraging and managing meter data effectively, utilities can increase their operational efficiency, improve their understanding of customers' needs, and develop more effective demand side management programs. This presentation examined some of the changing priorities of advanced metering infrastructure (AMI) strategies, and provided details of meter data management (MDM) technologies developed to help utilities increase efficiency, cut costs and provide better service to their customers. An MDM system is the set of data bases and applications required to provide utilities with a solution for the data retention, analysis and storage repository gaps that will be created when monthly manual meter readings are replaced with AMI systems. In order to resolve storage, functionality and legacy integration gaps, MDM systems must be scalable systems that can support large and small quantities of meter data, and must also conform to industry standard data warehouse designs. Data structure in the systems must support both regulated and deregulated markets, and be capable of providing extensive graphical, tabular and Excel export of the metered and totalized data from the interval to system level. MDM systems can provide improved support for demand response decision-making processes; distribution planning and reliability; outage management; revenue assurance; forecasting; and curtailment. It was concluded that MDM systems can be used to improve processes and provide additional benefits well beyond the meter reading and billing process benefits originally identified by utilities as a primary goal of implementing AMI. refs., tabs., figs.

  3. Betwixt and Between Past and Present: Cultural and Generic Hybridity in the Fiction of Amy Tan and Mary Yukari Waters Rania Youssef

    OpenAIRE

    Rania Youssef

    2012-01-01

    Amy Tan and Mary Yukari Waters are both Asian-Americans who portray hybridity in their short stories which depict the shifting identities of the self. But do the internal categories of gender, race and ethnicity help in the coherence or do they add to the fragmentation of diverse identities? It is the dynamics of this critique of multiple identification and hybrid cultures that is being traced here in this study and how all this is reflected in narrative responses to such conditions of the ex...

  4. Clinical significance of measurement of changes in serum NO/NOS ratio and plasma ET content after treatment in patients with acute myocardial infarction (AMI)

    International Nuclear Information System (INIS)

    Dong Zhaoshu; Liu Xugui

    2005-01-01

    Objective: To study the clinical significance of changes of plasma ET and serum NO/NOS ratio in patients with AMI after treatment. Methods: Serum NO/NOS ratio (with EIA) and plasma ET (with RIA) contents were measured in 30 patients with acute myocardial infarction both before and after treatment as well as in 35 controls. Results: Serum levels of NO were significantly lower (P 0.05), but plasma ET levels remained significantly higher (P<0.05). Conclusion: Changes of serum NO/NOS ratio and plasma ET contents after treatment might be of prognostic importance in patients with acute myocardial infarction. (authors)

  5. Caracterización bioquímica de AmiJ33, una amilasa de Bacillus amyloliquefaciens aislada de suelos cultivados con caña de azúcar en la región del Papaloapan

    Directory of Open Access Journals (Sweden)

    J. J. Montor-Antonio

    2014-01-01

    Full Text Available La amilasa (E.C. 3.2.1.1 de Bacillus amyloliquefaciens JJC33M (AmiJ33 fue producida por fermentación sumergida. Se probó el efecto de peptona, extracto de levadura, Ca+2 y glicina en la producción de AmiJ33. El extracto de levadura y Ca+2 tuvieron un efecto positivo sobre la síntesis de AmiJ33. La enzima fue recuperada mediante precipitación a saturación al 60% con (NH42SO4. El peso molecular aproximado de la enzima purificada fue de 50 kDa. Así mismo, se evaluó el efecto del pH y la temperatura sobre la actividad enzimática, concluyendo que los valores más altos de actividad se observaron a pH 6.0 y 80°C, respectivamente. En condiciones ligeramente ácidas (pH 4.0 y 5.0, AmiJ33 mantuvo el 72% de su actividad. AmiJ33 fue estable por 3 h a 40°C, y por 30 min a 45 y 50°C, conservando el 88 y 82% de actividad residual. A 60°C, la actividad disminuyó 40%. La actividad de AmiJ33 se incrementó 50.27% con b- mercaptoetanol, no fue inhibida por EDTA y se inhibió totalmente con SDS.

  6. AmyI-1-18, a cationic α-helical antimicrobial octadecapeptide derived from α-amylase in rice, inhibits the translation and folding processes in a protein synthesis system.

    Science.gov (United States)

    Taniguchi, Masayuki; Ochiai, Akihito; Fukuda, Shun; Sato, Teppei; Saitoh, Eiichi; Kato, Tetsuo; Tanaka, Takaaki

    2016-10-01

    In our previous study, we used a cell-free rapid translation system (RTS), which is an in vitro protein synthesis system based on Escherichia coli lysate, for evaluating the inhibition of green fluorescent protein (GFP) synthesis by pyrrhocoricin. In this study, using an RTS, we evaluated the inhibition of GFP synthesis by AmyI-1-18, an antimicrobial octadecapeptide. We found that, similarly to pyrrhocoricin, AmyI-1-18 inhibited GFP synthesis in the RTS in a concentration-dependent manner. In addition, the blockage of transcription and translation steps in the RTS was individually estimated using RT-PCR after gene expression to determine the mRNA products and using sodium dodecyl sulfate-polyacrylamide gel electrophoresis to determine the amounts of GFP expressed from purified mRNA, respectively. The results demonstrated that the inhibition of GFP synthesis by AmyI-1-18 did not occur at the transcription step but rather at the translation step. Furthermore, we assessed the inhibition of DnaK-mediated refolding of chemically denatured luciferase by AmyI-1-18; AmyI-1-18 inhibited the protein folding activity of the ATP-dependent DnaK/DnaJ molecular chaperone system in a concentration-dependent manner. Surface plasmon resonance (SPR) analysis showed that AmyI-1-18 strongly bound to RNA with a KD value of 1.4 × 10(-8) M but not to DNA and that AmyI-1-18 specifically bound to DnaK with a KD value of 4.4 × 10(-6) M. These SPR analysis results supported the results obtained in both the RTS and the molecular chaperone system. These results demonstrated that both RNA and DnaK are most likely the target of AmyI-1-18 in the protein synthesis system. Copyright © 2016 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  7. Increased Y-chromosome resolution of haplogroup O suggests genetic ties between the Ami aborigines of Taiwan and the Polynesian Islands of Samoa and Tonga.

    Science.gov (United States)

    Mirabal, Sheyla; Herrera, Kristian J; Gayden, Tenzin; Regueiro, Maria; Underhill, Peter A; Garcia-Bertrand, Ralph L; Herrera, Rene J

    2012-01-25

    The Austronesian expansion has left its fingerprint throughout two thirds of the circumference of the globe reaching the island of Madagascar in East Africa to the west and Easter Island, off the coast of Chile, to the east. To date, several theories exist to explain the current genetic distribution of Austronesian populations, with the "slow boat" model being the most widely accepted, though other conjectures (i.e., the "express train" and "entangled bank" hypotheses) have also been widely discussed. In the current study, 158 Y chromosomes from the Polynesian archipelagos of Samoa and Tonga were typed using high resolution binary markers and compared to populations across Mainland East Asia, Taiwan, Island Southeast Asia, Melanesia and Polynesia in order to establish their patrilineal genetic relationships. Y-STR haplotypes on the C2 (M38), C2a (M208), O1a (M119), O3 (M122) and O3a2 (P201) backgrounds were utilized in an attempt to identify the differing sources of the current Y-chromosomal haplogroups present throughout Polynesia (of Melanesian and/or Asian descent). We find that, while haplogroups C2a, S and K3-P79 suggest a Melanesian component in 23%-42% of the Samoan and Tongan Y chromosomes, the majority of the paternal Polynesian gene pool exhibits ties to East Asia. In particular, the prominence of sub-haplogroup O3a2c* (P164), which has previously been observed at only minimal levels in Mainland East Asians (2.0-4.5%), in both Polynesians (ranging from 19% in Manua to 54% in Tonga) and Ami aborigines from Taiwan (37%) provides, for the first time, evidence for a genetic connection between the Polynesian populations and the Ami. Copyright © 2011 Elsevier B.V. All rights reserved.

  8. Development and validation of an instrument to assess patients' appraisal, emotions and action tendencies preceding care-seeking in acute myocardial infarction: The PA-AMI questionnaire.

    Science.gov (United States)

    Nymark, C; Saboonchi, F; Mattiasson, A-C; Henriksson, P; Kiessling, A

    2017-03-01

    Reducing patient delay for patients afflicted by an acute myocardial infarction is a task of great complexity, which might be alleviated if more factors that influence this delay could be identified. Although a number of self-reported instruments associated with patient delay exist, none of these taps the content of the appraisal process related to patients' subjective emotions. The aim of this study was to develop and validate a questionnaire aimed at assessing patients' appraisal, emotions and action tendencies when afflicted by an acute myocardial infarction. An item pool was generated based on themes conceptualized in a recent qualitative study of acute myocardial infarction patients' thoughts, feelings and actions preceding the decision to seek medical care. The 'Think-Aloud Protocol' and test-retest analysis at item level were performed. The modified item pool was administered to 96 patients when treated for acute myocardial infarction. Explorative factor analysis and principal component analysis with the non-linear iterative partial least squares algorithm were performed to examine the underlying factor structure of the items. The findings indicated three core dimensions corresponding to three subscales, namely, 'symptom appraisal'; 'perceived inability to act'; 'autonomy preservation'. The results demonstrated acceptable measures of reliability and validity Conclusions: The PA-AMI questionnaire demonstrated satisfactory psychometric properties. Assessment of the included core dimensions may contribute to greater understanding of the appraisal processes for patients afflicted by an acute myocardial infarction.

  9. Tendencias de la multialfabetización en los albores del siglo XXI: alfabetización mediática e informacional (AMI como propuesta integradora

    Directory of Open Access Journals (Sweden)

    Maylin Frías-Guzmán

    Full Text Available La evolución de alfabetismos se produjo como resultado de la transición de una cultura oral a una cultura letrada. El presente estudio examina las principales tendencias de la multialfabetización a principios del siglo XXI. Se combina el método de análisis documental y el método bibliométrico en el análisis de la evolución de los alfabetismos, a través de documentos que establecen pautas en su fundamentación y el comportamiento de la producción científica por año en la primera década del siglo XXI. Se revela el lugar destacado que ocupan la Alfabetización Mediática y la Alfabetización Informacional con respecto al resto de las expresiones que surgen. La Alfabetización Multimedia es un alfabetismo poco abordado en la literatura como proceso de formación de competencias vinculadas a la recepción y producción de mensajes a partir de la convergencia de lenguajes y medios. La noción de Alfabetización Mediática e Informacional (AMI constituye la principal tendencia que integra los diversos alfabetismos que promueven la participación activa en la construcción y transformación del individuo y la sociedad.

  10. Influência do conteúdo vaginal de gestantes sobre a recuperação do estreptococo do grupo B nos meios de transporte Stuart e Amies Influence of vaginal environment of pregnant women on the recovery of group B streptococcus in Stuart and Amies transport media

    Directory of Open Access Journals (Sweden)

    José Antonio Simões

    2005-11-01

    Full Text Available OBJETIVO: avaliar a influência do meio vaginal de gestantes na sobrevivência do estreptococo do grupo B (EGB mantido por 8, 24 e 48 horas nos meios de transporte Amies e Stuart. MÉTODOS: foram coletados três swabs vaginais de 30 gestantes atendidas no Ambulatório de Pré-Natal do Centro de Atenção Integral à Saúde da Mulher (CAISM, Universidade Estadual de Campinas (UNICAMP. O primeiro swab foi mergulhado diretamente no meio seletivo de Todd-Hewitt; o segundo foi utilizado para a realização da bacterioscopia corada pelo Gram e o terceiro foi mergulhado em 2 mL de solução salina à qual foram acrescentados 200 µL de uma suspensão contendo EGB na concentração de 1-2 x 10(8 unidades formadoras de colônia. Desta última suspensão de EGB, foram colhidos três swabs do meio Amies e três do meio Stuart, os quais foram mantidos em temperatura ambiente por 8, 24 e 48 horas, para posterior semeadura em ágar sangue. A leitura do crescimento das placas foi realizada após 24 horas de incubação e classificada semiquantitativamente (0-3 cruzes de acordo com o número de colônias observadas. A análise estatística foi efetuada com o teste exato de Fisher. RESULTADOS: a recuperação do EGB nos meios de transporte Amies e Stuart após 48 horas de estocagem foi de 97 e 87%, respectivamente. Em um dos quatro casos em que não houve a recuperação do EGB após 48 horas de armazenamento, o pH vaginal foi superior a 4,5 e em dois casos havia a presença de vaginose citolítica. CONCLUSÕES: ambos os meios de transporte mostraram-se adequados para a recuperação do EGB em gestantes até 48 horas após a coleta. As características do meio vaginal não influenciaram a recuperação do EGB no presente estudo.PURPOSE: to evaluate the influence of vaginal environment of pregnant women on group B streptococcus (GBS survival after 8, 24 e 48 h in Amies and Stuart transport media. METHODS: Three vaginal samples were collected from 30 pregnant

  11. The crystal structure of Erwinia amylovora AmyR, a member of the YbjN protein family, shows similarity to type III secretion chaperones but suggests different cellular functions.

    Science.gov (United States)

    Bartho, Joseph D; Bellini, Dom; Wuerges, Jochen; Demitri, Nicola; Toccafondi, Mirco; Schmitt, Armin O; Zhao, Youfu; Walsh, Martin A; Benini, Stefano

    2017-01-01

    AmyR is a stress and virulence associated protein from the plant pathogenic Enterobacteriaceae species Erwinia amylovora, and is a functionally conserved ortholog of YbjN from Escherichia coli. The crystal structure of E. amylovora AmyR reveals a class I type III secretion chaperone-like fold, despite the lack of sequence similarity between these two classes of protein and lacking any evidence of a secretion-associated role. The results indicate that AmyR, and YbjN proteins in general, function through protein-protein interactions without any enzymatic action. The YbjN proteins of Enterobacteriaceae show remarkably low sequence similarity with other members of the YbjN protein family in Eubacteria, yet a high level of structural conservation is observed. Across the YbjN protein family sequence conservation is limited to residues stabilising the protein core and dimerization interface, while interacting regions are only conserved between closely related species. This study presents the first structure of a YbjN protein from Enterobacteriaceae, the most highly divergent and well-studied subgroup of YbjN proteins, and an in-depth sequence and structural analysis of this important but poorly understood protein family.

  12. Amy Winehouse e a casa dos mortos: a noção de genialidade no Romantismo Alemão DOI - 10.5752/P.2358-3428.2012v16n31p97

    Directory of Open Access Journals (Sweden)

    Sérgio Murilo Rodrigues

    2012-12-01

    Full Text Available  Criar significa destruir também. A genialidade cobra um preço alto: a angústia, a vida dilacerada. A chama que ilumina mais, dura menos. Amy Winehouse não foi a primeira e provavelmente não será a última artista genial a entrar em um processo autodestrutivo. Um processo de total perda de esperança resultando na busca deliberada pela morte. No Romantismo Alemão vários escritores e filósofos falaram sobre o peso da genialidade. Schelling coloca que o gênio é capaz da mesma intuição criadora do Espírito Absoluto. Schopenhauer nos fala da dor de ser gênio. Nietzsche, como Schiller, defende a genialidade artística como o único objetivo digno da vida humana. A vida é arte e cabe a nós desenvolvermos essa arte. Os poetas malditos, as estrelas do rock e do jazz celebraram esta festa, a vida, mesmo que, ao final, não haja mais vida alguma. Diante de um fenômeno midiático como Amy Winehouse, como podemos compreender toda essa reflexão filosófica sobre arte, vida, genialidade e morte?  Palvras-chave: Filosofia. Amy Winehouse. Genialidade. Romantismo Alemão.

  13. Worsening atrioventricular conduction after hospital discharge in patients with ST-segment elevation myocardial infarction undergoing primary percutaneous coronary intervention: the HORIZONS-AMI trial.

    Science.gov (United States)

    Kosmidou, Ioanna; Redfors, Björn; McAndrew, Thomas; Embacher, Monica; Mehran, Roxana; Dizon, José M; Ben-Yehuda, Ori; Mintz, Gary S; Stone, Gregg W

    2017-11-01

    The chronic effects of ST-segment elevation myocardial infarction (STEMI) on the atrioventricular conduction (AVC) system have not been elucidated. This study aimed to evaluate the incidence, predictors, and outcomes of worsened AVC post-STEMI in patients treated with a primary percutaneous coronary intervention (PCI). The current analysis included patients from the HORIZONS-AMI trial who underwent primary PCI and had available ECGs. Patients with high-grade atrioventricular block or pacemaker implant at baseline were excluded. Analysis of ECGs excluding the acute hospitalization period indicated worsened AVC in 131 patients (worsened AVC group) and stable AVC in 2833 patients (stable AVC group). Patients with worsened AVC were older, had a higher frequency of hypertension, diabetes, renal insufficiency, previous coronary artery bypass grafting, and predominant left anterior descending culprit lesions. Predictors of worsened AVC included age, hypertension, and previous history of coronary artery disease. Worsened AVC was associated with an increased rate of all-cause death and major adverse cardiac events (death, myocardial infarction, ischemic target vessel revascularization, and stroke) as well as death or reinfarction at 3 years. On multivariable analysis, worsened AVC remained an independent predictor of all-cause death (hazard ratio: 2.005, confidence interval: 1.051-3.827, P=0.0348) and major adverse cardiac events (hazard ratio 1.542, confidence interval: 1.059-2.244, P=0.0238). Progression of AVC system disease in patients with STEMI treated with primary PCI is uncommon, occurs primarily in the setting of anterior myocardial infarction, and portends a high risk for death and major adverse cardiac events.

  14. Variations in the polar cap area during intervals of substorm activity on 20-21 March 1990 deduced from AMIE convection patterns

    Directory of Open Access Journals (Sweden)

    J. R. Taylor

    1996-09-01

    Full Text Available The dynamic behaviour of the northern polar cap area is studied employing Northern Hemisphere electric potential patterns derived by the Assimilative Mapping of Ionospheric Electrodynamics (AMIE procedure. The rate of change in area of the polar cap, which can be defined as the region of magnetospheric field lines open to the interplanetary magnetic field (IMF, has been calculated during two intervals when the IMF had an approximately constant southward component (1100–2200 UT, 20 March 1990 and 1300–2100 UT, 21 March 1990. The estimates of the polar cap area are based on the approximation of the polar cap boundary by the flow reversal boundary. The change in the polar cap area is then compared to the predicted expansion rate based on a simple application of Faraday\\'s Law. Furthermore, timings of magnetospheric substorms are also related to changes in the polar cap area. Once the convection electric field reconfigures following a southward turning of the IMF, the growth rate of the observed polar cap boundary is consistent with that predicted by Faraday\\'s Law. A delay of typically 20 min to 50 min is observed between a substorm expansion phase onset and a reduction in the polar cap area. Such a delay is consistent with a synthesis between the near Earth neutral line and current disruption models of magnetospheric substorms in which the dipolarisation in the magnetotail may act as a trigger for reconnection. These delays may represent a propagation time between near geosynchronous orbit dipolarisation and subsequent reconnection further down tail. We estimate, from these delays, that the neutral X line occurs between ~35RE and ~75RE downstream in the tail.

  15. AMiBA: SYSTEM PERFORMANCE

    International Nuclear Information System (INIS)

    Lin, K.-Y.; Li, C.-T.; Ho, Paul T.P.; Liu, G.-C.; Koch, Patrick M.; Molnar, Sandor M.; Nishioka, Hiroaki; Umetsu, Keiichi; Altamirano, Pablo; Chang, C.-H.; Chang, S.-H.; Chang, S.-W.; Chen, M.-T.; Martin-Cocher, Pierre; Huang, C.-W.L.; Liao, Y.-W.; Wang, F.-C.; Wu, J.-H.P.; Kestevan, Michael; Birkinshaw, Mark

    2009-01-01

    The Y.T. Lee Array for Microwave Background Anisotropy started scientific operation in early 2007. This work describes the optimization of the system performance for the measurements of the Sunyaev-Zel'dovich effect for six massive galaxy clusters at redshifts 0.09-0.32. We achieved a point-source sensitivity of 63 ± 7 mJy with the seven 0.6 m dishes in 1 hr of on-source integration in two-patch differencing observations. We measured and compensated for the delays between the antennas of our platform-mounted interferometer. Beam switching was used to cancel instrumental instabilities and ground pick up. Total power and phase stability were good on timescales of hours, and the system was shown to integrate down on equivalent timescales of 300 hr per baseline/correlation, or about 10 hr for the entire array. While the broadband correlator leads to good sensitivity, the small number of lags in the correlator resulted in poorly measured bandpass response. We corrected for this by using external calibrators (Jupiter and Saturn). Using Jupiter as the flux standard, we measured the disk brightness temperature of Saturn to be 149 +5 -12 K.

  16. AMiBA: System Performance

    Science.gov (United States)

    Lin, Kai-Yang; Li, Chao-Te; Ho, Paul T. P.; Huang, Chih-Wei Locutus; Liao, Yu-Wei; Liu, Guo-Chin; Koch, Patrick M.; Molnar, Sandor M.; Nishioka, Hiroaki; Umetsu, Keiichi; Wang, Fu-Cheng; Wu, Jiun-Huei Proty; Kestevan, Michael; Birkinshaw, Mark; Altamirano, Pablo; Chang, Chia-Hao; Chang, Shu-Hao; Chang, Su-Wei; Chen, Ming-Tang; Martin-Cocher, Pierre; Han, Chih-Chiang; Huang, Yau-De; Hwang, Yuh-Jing; Ibañez-Roman, Fabiola; Jiang, Homin; Kubo, Derek Y.; Oshiro, Peter; Raffin, Philippe; Wei, Tashun; Wilson, Warwick; Chen, Ke-Jung; Chiueh, Tzihong

    2009-04-01

    The Y.T. Lee Array for Microwave Background Anisotropy started scientific operation in early 2007. This work describes the optimization of the system performance for the measurements of the Sunyaev-Zel'dovich effect for six massive galaxy clusters at redshifts 0.09-0.32. We achieved a point-source sensitivity of 63 ± 7 mJy with the seven 0.6 m dishes in 1 hr of on-source integration in two-patch differencing observations. We measured and compensated for the delays between the antennas of our platform-mounted interferometer. Beam switching was used to cancel instrumental instabilities and ground pick up. Total power and phase stability were good on timescales of hours, and the system was shown to integrate down on equivalent timescales of 300 hr per baseline/correlation, or about 10 hr for the entire array. While the broadband correlator leads to good sensitivity, the small number of lags in the correlator resulted in poorly measured bandpass response. We corrected for this by using external calibrators (Jupiter and Saturn). Using Jupiter as the flux standard, we measured the disk brightness temperature of Saturn to be 149+5 -12 K.

  17. Foundation on Economic Trends v. Bowen.

    Science.gov (United States)

    1989-10-04

    The National Enviromental Policy Act requires that government agencies make a detailed enviromental impact statement (EIS) for all research significantly affecting the environment. These statements must be supplemented if the project substantially changes or if new information is obtained. The Foundation on Economic Trends argued that three developments in recombinant DNA research will significantly alter the enviromental impact, thereby mandating a new EIS by the National Institutes of Health (NIH). These developments are cloning oncogenic viruses, engineering the human immunodeficiency virus into cells not normally susceptible to it, and introducing AIDS genetic codes into mice. The U.S. District Court, District of Columbia, held that the first two projects do not pose a greater risk and that the enviromental assessment being prepared by NIH on the third satisfies the requirements of the National Enviromental Policy Act.

  18. Genetics Home Reference: Bowen-Conradi syndrome

    Science.gov (United States)

    ... are assembled in a cell compartment called the nucleolus . The particular EMG1 gene mutation known to cause ... of EMG1 protein that is available in the nucleolus. A shortage of this protein in the nucleolus ...

  19. Análise de sensibilidade dos métodos de estimativa da evapotranspiração de referência e razão de Bowen em cultura da cana-de-açúcar Sensitivity analysis of methods for estimating reference evapotranspiration and sugarcane evapotranspiration

    Directory of Open Access Journals (Sweden)

    Bruce K. N Silva

    2011-10-01

    Full Text Available A técnica de análise de sensibilidade de modelos foi aplicada nos dados obtidos em experimento de campo conduzido no ano de 2009, na Destilaria Miriri, localizada no município de Capim, PB, e aos dados de evapotranspiração de referência (ETo, obtidos pela equação de Penman-Monteith (FAO/56, e da evapotranspiração da cultura da cana-de-açúcar (ETc, obtidos pelo balanço de energia com base na razão de Bowen. As análises de sensibilidade e de erros foram aplicadas ao método da razão de Bowen para os intervalos de medição de 15, 30, 60 e 120 minutos enquanto o método de Penman-Monteith foi aplicado para a escala diária durante o ano de 2009. Os resultados evidenciam que o saldo de radiação é a variável mais sensitiva no cálculo do balanço de energia, enquanto o fluxo de calor no solo oferece a menor contribuição; já os erros relativos de todas as variáveis envolvidas do cálculo balanço de energia baseado na razão de Bowen aumentaram significativamente com o aumento do intervalo de amostragem. A variável mais sensível na determinação da ETo pelo método de Penman-Monteith é o saldo de radiação seguida da umidade relativa, velocidade do vento a 2m de altura e a temperatura média do ar.The sensitivity analysis technique of models was applied to the data obtained from field experiment carried out during 2009 at Distillery Miriri, Capim, PB. This technique was applied to the reference evapotranspiration (ETo by Penman-Monteith (FAO/56 and the sugarcane evapotranspiration (ETc by energy balance equation based on Bowen ratio. The sensitivity analysis and errors were applied to the Bowen ratio method in measurement intervals of 15, 30, 60 and 120 min; however Penman-Monteith approach was applied on daily basis throughout the 2009 year. Results showed that the net radiation is the most sensitive variable in the energy equation balance and soil heat flux offers the lowest contribution. On the other hand, the relative

  20. When less is more: Psychometric properties of Norwegian short-forms of the Ambivalent Sexism Scales (ASI and AMI) and the Illinois Rape Myth Acceptance (IRMA) Scale.

    Science.gov (United States)

    Bendixen, Mons; Kennair, Leif Edward Ottesen

    2017-12-01

    This paper reports on the development and the psychometric properties of short forms of Ambivalent Sexism Scales toward women (ASI; Glick & Fiske, 1996) and men (AMI; Glick & Fiske, 1999), and a scale measuring rape stereotypes (IRMA; McMahon & Farmer, 2011). The short form AMI/ASI were applied for examining gender and educational differences in university students (N = 512) and in high school students (N = 1381), and for predicting individual differences in rape stereotypes in the latter. The short forms demonstrated good to excellent psychometric properties across samples of emerging adults. Relative to female students, male students reported markedly more hostility toward women and more stereotypical beliefs about rape. Despite sampling from a highly gender egalitarian and secular culture, these gender differences are on a par with those reported internationally. Rape stereotypes were predicted by sexism in high school students. Additional predictors were educational program, relationship status, and acceptance of derogatory sexual slurs. The paper questions the validity of separate constructs for benevolent sexism toward women versus men. The short form versions of the scales may substitute the original versions in future research, and help prevent attrition while measuring the same constructs. © 2017 Scandinavian Psychological Associations and John Wiley & Sons Ltd.

  1. On Feminism in Amy Tan's Works --A Case Study of The Joy Luck Club%论谭恩美作品中的女性主义特征--以小说《喜福会》为例

    Institute of Scientific and Technical Information of China (English)

    王赟

    2012-01-01

    Amy Tan is a minority writer who is located in the verge of sex and race in American literature world. As a woman, she is a "the other" in the male-dominated literary circle; as a minority writer, she is a "the other" as well to the American dominant culture. However, the dual personality characterizes her works by feminism. This thesis analyzes one of Amy Tan's main works, The Joy Luck Club, to interpret the feminism reflected in it.%谭恩美作为美国文坛一名女性少数族裔作家,在性别和种族上都处于边缘性的境地。作为女性,在男权话语为主的文坛,她是一个“他者”;作为少数族裔作家,对美国主流文化而言,她也是一个“他者”。但是这种复杂的双重身份却赋予她的作品一种鲜明而独特的女性主义特征。文章重点以谭恩美的《喜福会》为文本,通过女性主义的视角,来解析其作品中所表现出的女性主义特征。

  2. Élaboration d’indicateurs pour l’évaluation des collectivités-amies des aînés au Canada : démarche et résultats

    Directory of Open Access Journals (Sweden)

    H. Orpana

    2016-01-01

    Full Text Available Introduction : En 2006, l’Organisation mondiale de la Santé (OMS a lancé le projet mondial « Villes-amies des aînés » afin de favoriser un vieillissement actif. Si un grand nombre d’initiatives « amies des aînés » ont été mises en oeuvre au Canada, on dispose de peu d’information sur l’efficacité et les résultats des initiatives des collectivités-amies des aînés (CAA. En outre, les intervenants affirment qu’ils n’ont pas la capacité et les outils nécessaires pour élaborer et réaliser des évaluations relatives à leurs initiatives de CAA. Afin de pallier ces lacunes, l’Agence de la santé publique du Canada a mis au point des indicateurs pour l’évaluation des initiatives de CAA dans de nombreuses collectivités canadiennes. Ces indicateurs, destinés à répondre aux différents besoins des collectivités, ne sont pas conçus pour faire l’évaluation de répercussions collectives ou pour rendre possible une comparaison entre collectivités. Méthodologie : Une démarche de consultation itérative fondée sur des données probantes a été employée pour l’élaboration d’indicateurs relatifs aux CAA. Elle a nécessité une revue de la littérature et une analyse du contexte. Deux rondes de consultation auprès d’experts et d’intervenants clés ont été menées, ce qui a permis de classer les indicateurs potentiels en fonction de leur importance, de leur capacité à être mis en pratique et de leur faisabilité. Une liste définitive d’indicateurs et de mesures potentielles a ensuite été mise au point, en fonction des résultats de ces consultations et de considérations clés relatives aux politiques. Résultats : Trente-neuf indicateurs répartis en huit domaines relevant des CAA et quatre indicateurs relevant des résultats liés à la santé et aux conditions sociales à long terme ont été sélectionnés. Tous sont conformes à l’objectif énoncé, à savoir l’évaluation des

  3. Outcomes of patients with coronary artery perforation complicating percutaneous coronary intervention and correlations with the type of adjunctive antithrombotic therapy: pooled analysis from REPLACE-2, ACUITY, and HORIZONS-AMI trials.

    Science.gov (United States)

    Doll, Jacob A; Nikolsky, Eugenia; Stone, Gregg W; Mehran, Roxana; Lincoff, A Michael; Caixeta, Adriano; McLaurin, Brent; Cristea, Ecaterina; Fahy, Martin; Kesanakurthy, Vijaya; Lansky, Alexandra J

    2009-10-01

    The lack of a specific counteragent to bivalirudin may complicate the management of patients with coronary artery (CA) perforation during percutaneous coronary intervention (PCI). Assess outcomes of patients with CA perforation from three PCI trials comparing intravenous bivalirudin with provisional glycoprotein (GP) IIb/IIIa inhibition versus unfractionated heparin (UFH) plus GP IIb/IIIa. A pooled analysis of patients treated with PCI in three randomized trials including REPLACE-2, ACUITY, and HORIZONS-AMI. Among a total of 12,921 patients, CA perforation occurred in 35 patients (0.27%). By multivariable analysis, baseline creatinine clearance was the only independent predictor of CA perforation (per 10 mL/min decrease, odds ratio [95% confidence interval]= 1.28 [1.11, 1.47], P = 0.0007). At 30 days, patients with versus without CA perforation had significantly (all P values therapy of bivalirudin monotherapy was not associated with worse outcomes compared to treatment with UFH plus GP IIb/IIIa inhibitors.

  4. Outcomes in elderly and young patients with ST-segment elevation myocardial infarction undergoing primary percutaneous coronary intervention with bivalirudin versus heparin: Pooled analysis from the EUROMAX and HORIZONS-AMI trials.

    Science.gov (United States)

    Qaderdan, Khalid; Vos, Gerrit-Jan A; McAndrew, Thomas; Steg, Philippe Gabriel; Hamm, Christian W; Van't Hof, Arnoud; Mehran, Roxana; Deliargyris, Efthymios N; Bernstein, Debra; Stone, Gregg W; Ten Berg, Jurriën M

    2017-12-01

    Since older age is a strong predictor of not only bleeding but also of ischemic events, understanding the risk:benefit profile of bivalirudin in the elderly undergoing primary percutaneous coronary intervention (pPCI) for ST-segment elevation (STEMI) is important. For this, we aim to compare elderly with young patients, who all underwent pPCI for STEMI and randomly received either bivalirudin or heparin. We performed a patient-level pooled analysis (n=5800) of two large randomized trials. A total of 2149 (37.1%) elderly patients (>65 years of age) with STEMI were enrolled and randomly assigned to either bivalirudin or heparin with or without a GPI (control group) before pPCI. Clinical outcomes at 30 days were analyzed. In elderly patients, bivalirudin significantly reduced non-CABG major bleeding (7.1% vs 10.4%; PST (0.4% vs 1.5%; PST, or all-cause death, when compared with heparin with or without GPI. In a large group of elderly patients enrolled in the EUROMAX and HORIZONS-AMI trials, bivalirudin was associated with lower 30-day rates of non-CABG major bleeding, subacute ST and NACE, with similar 30-day rates of acute ST and mortality. Copyright © 2017 Elsevier Inc. All rights reserved.

  5. The SXT conjugative element and linear prophage N15 encode toxin-antitoxin-stabilizing systems homologous to the tad-ata module of the Paracoccus aminophilus plasmid pAMI2.

    Science.gov (United States)

    Dziewit, Lukasz; Jazurek, Magdalena; Drewniak, Lukasz; Baj, Jadwiga; Bartosik, Dariusz

    2007-03-01

    A group of proteic toxin-antitoxin (TA) cassettes whose representatives are widely distributed among bacterial genomes has been identified. These cassettes occur in chromosomes, plasmids, bacteriophages, and noncomposite transposons, as well as in the SXT conjugative element of Vibrio cholerae. The following four homologous loci were subjected to detailed comparative studies: (i) tad-ata from plasmid pAMI2 of Paracoccus aminophilus (the prototype of this group), (ii) gp49-gp48 from the linear bacteriophage N15 of Escherichia coli, (iii) s045-s044 from SXT, and (iv) Z3230-Z3231 from the genomic island of enterohemorrhagic Escherichia coli O157:H7 strain EDL933. Functional analysis revealed that all but one of these loci (Z3230-Z3231) are able to stabilize heterologous replicons, although the host ranges varied. The TA cassettes analyzed have the following common features: (i) the toxins are encoded by the first gene of each operon; (ii) the antitoxins contain a predicted helix-turn-helix motif of the XRE family; and (iii) the cassettes have two promoters that are different strengths, one which is located upstream of the toxin gene and one which is located upstream of the antitoxin gene. All four toxins tested are functional in E. coli; overexpression of the toxins (in the absence of antitoxin) results in a bacteriostatic effect manifested by elongation of bacterial cells and growth arrest. The toxins have various effects on cell viability, which suggests that they may recognize different intracellular targets. Preliminary data suggest that different cellular proteases are involved in degradation of antitoxins encoded by the loci analyzed.

  6. 21st Century Skylines / Amy Bryzgel

    Index Scriptorium Estoniae

    Bryzgel, Amy

    2008-01-01

    Kumu Kunstimuuseumist Tallinnas (arh. Pekka Vapaavuori), Leedu rahvusliku kunstigalerii renoveerimisest (Vilnius, ehitatud 1968. aastal, arh. Gediminas Baravykas ja Vytautas Vielius), uuest ehitatavast Guggenheim-Ermitaazhi muuseumist Vilniuses (arh. Zaha Hadid), Riia uuest kunstimuuseumist, mis ehitatakse vanasse 1905. a. ehitatud tööstushoonesse. (arh. Rem Koolhaas)

  7. G.hnem for AMI and DR

    DEFF Research Database (Denmark)

    Rossello Busquet, Ana

    2012-01-01

    consumption and production. Power Line Communication (PLC) is a candidate technology for connecting the customers and utilities as it is easy to deploy and has extensive coverage. ITU-T G.hnem standard defines a narrowband PLC, which was specially designed for Smart Grid applications. This paper proposes...... a PLC network architecture following the G.hnem standard, which enables bi-directional communication among customers and utilities....

  8. Determination of Surface Fluxes Using a Bowen Ratio System

    African Journals Online (AJOL)

    USER

    Components of the surface fluxes of the energy balance equation were determined ... and vapour pressure in combination with point measurements of net .... approaches zero, then almost all the energy available is used in evapotranspiration.

  9. Correlation of Admission Heart Rate With Angiographic and Clinical Outcomes in Patients With Right Coronary Artery ST-Segment Elevation Myocardial Infarction Undergoing Primary Percutaneous Coronary Intervention: HORIZONS-AMI (The Harmonizing Outcomes With Revascularization and Stents in Acute Myocardial Infarction) Trial.

    Science.gov (United States)

    Kosmidou, Ioanna; McAndrew, Thomas; Redfors, Björn; Embacher, Monica; Dizon, José M; Mehran, Roxana; Ben-Yehuda, Ori; Mintz, Gary S; Stone, Gregg W

    2017-07-19

    Bradycardia on presentation is frequently observed in patients with right coronary artery ST-segment elevation myocardial infarction, but it is largely unknown whether it predicts poor angiographic or clinical outcomes in that patient population. We sought to determine the prognostic implications of admission heart rate (AHR) in patients with ST-segment elevation myocardial infarction and a right coronary artery culprit lesion. We analyzed 1460 patients with ST-segment elevation myocardial infarction and a right coronary artery culprit lesion enrolled in the randomized HORIZONS-AMI (Harmonizing Outcomes with Revascularization and Stents in Acute Myocardial Infarction) trial who underwent primary percutaneous coronary intervention. Patients presenting with high-grade atrioventricular block were excluded. Outcomes were examined according to AHR range (AHR 100 beats per minute). Angiographic analysis showed no significant association between AHR and lesion location or complexity. On multivariate analysis, admission bradycardia (AHR ST-segment elevation myocardial infarction and a right coronary artery culprit lesion undergoing primary percutaneous coronary intervention, admission bradycardia was not associated with increased mortality or major adverse cardiac events at 1 year. URL: https://www.clinicaltrials.gov. Unique identifier: NCT00433966. © 2017 The Authors. Published on behalf of the American Heart Association, Inc., by Wiley.

  10. Sense of "Self":A Sure Path to Real Happiness——A critical reading of The Joy Luck Club by Amy Tan%“自我意识”:通向幸福的必由之路——读谭恩美《喜福会》

    Institute of Scientific and Technical Information of China (English)

    江蕙

    2012-01-01

    长篇小说《喜福会》是美国华裔女作家谭恩美的代表作,于上世纪末出版后即获得很大成功并很快成为学术界研究的热点,评论者角度各异,观点不一。本文以女性主义和文化研究为依托,吸取心理学人格结构理论的研究成果,运用文本细读的批评方法,分析在不同时代与文化背景下,母女两代人在寻求幸福的道路上,自我意识由缺失到觉醒,迷失到重拾的过程,侧重探讨了自我意识与个人幸福之间的关系。%The Joy Luck Club,Chinese-American female writer Amy Tan's masterpiece,won great popularity immediately after its publication at the end of the twentieth century and has soon become a hot subject for academic studies home and abroad.Following the principles of Feminism and Cultural Studies,as well as psychological research results in "the structure of mind",this article analyzes the life stories of mothers and daughters in the novel with regards of their losing and regaining "self-consciousness" while pursuing happiness in different time and social backgrounds.It focuses on investigating the interrelationship between "sense of self" and personal happiness.

  11. HTS 63_4_ VANWYK.AMIE._gewysig

    African Journals Online (AJOL)

    p1243322

    “consequences” of doctrinal proposals or demonstrating their “relevance”. ..... husband and wife, elders and children, the far and the near (people). The theme of .... society; it will also stand resolutely against dictatorship in principle (sic!) of the.

  12. Optimization of AMI-MDM-RoFSO under atmospheric turbulence

    Directory of Open Access Journals (Sweden)

    Chaudhary Sushank

    2017-01-01

    Full Text Available Radio over Free Space (Ro-FSO is promising candidate for providing ubiquitous digital services especially in rural areas. This work investigates the performance of MDM of two 5Gbps-10GHz data channels over FSO link using LP 01 and LP 02 modes under the effect of atmospheric turbulences. The signal to noise ratio (SNR, total received power, modal decomposition at receiver at the receiver is also reported. The reported result shows the successful transmission of two channels with acceptable SNR over FSO link under atmospheric turbulences.

  13. Risk Stratification and Effects of Pharmacotherapy in Patients with Acute Myocardial Infarction (AMI) based on data from Pilot AMI Registry

    Czech Academy of Sciences Publication Activity Database

    Peleška, Jan; Grünfeldová, H.; Monhart, Z.; Faltus, Václav; Tomečková, Marie; Ryšavá, D.; Velimský, T.; Ballek, L.; Hubač, J.; Charalampidi, K.; Jánský, P.

    2007-01-01

    Roč. 30 (2007), s. 367-367 ISSN 1420-4096. [Central European Meeting on Hypertension and Cardiovascular Disease Prevention. 11.10.2007-13.10.2007, Kraków] R&D Projects: GA MŠk(CZ) 1M06014 Institutional research plan: CEZ:AV0Z10300504 Keywords : pilot registry of acute myocardial infarction * risk stratification in acute myocardial infarction * effects of pharmacotherapy in acute myocardial infarction Subject RIV: FA - Cardiovascular Disease s incl. Cardiotharic Surgery

  14. Impact of iso-osmolar versus low-osmolar contrast agents on contrast-induced nephropathy and tissue reperfusion in unselected patients with ST-segment elevation myocardial infarction undergoing primary percutaneous coronary intervention (from the Contrast Media and Nephrotoxicity Following Primary Angioplasty for Acute Myocardial Infarction [CONTRAST-AMI] Trial).

    Science.gov (United States)

    Bolognese, Leonardo; Falsini, Giovanni; Schwenke, Carsten; Grotti, Simone; Limbruno, Ugo; Liistro, Francesco; Carrera, Arcangelo; Angioli, Paolo; Picchi, Andrea; Ducci, Kenneth; Pierli, Carlo

    2012-01-01

    Conflicting data have been reported on the effects of low-osmolar and iso-osmolar contrast media on contrast-induced acute kidney injury (CI-AKI). In particular, no clinical trial has yet focused on the effect of contemporary contrast media on CI-AKI, epicardial flow, and microcirculatory function in patients with ST-segment elevation acute myocardial infarction who undergo primary percutaneous coronary intervention. The Contrast Media and Nephrotoxicity Following Coronary Revascularization by Angioplasty for Acute Myocardial Infarction (CONTRAST-AMI) trial is a prospective, randomized, single-blind, parallel-group, noninferiority study aiming to evaluate the effects of the low-osmolar contrast medium iopromide compared to the iso-osmolar agent iodixanol on CI-AKI and tissue-level perfusion in patients with ST-segment elevation acute myocardial infarction. Four hundred seventy-five consecutive, unselected patients who underwent primary percutaneous coronary intervention were randomized to iopromide (n = 239) or iodixanol (n = 236). All patients received high-dose N-acetylcysteine and hydration. The primary end point was the proportion of patients with serum creatinine (sCr) increases ≥25% from baseline to 72 hours. Secondary end points were Thrombolysis In Myocardial Infarction (TIMI) myocardial perfusion grade, increase in sCr ≥50%, increase in sCr ≥0.5 or ≥1 mg/dl, and 1-month major adverse cardiac events. The primary end point occurred in 10% of the iopromide group and in 13% of the iodixanol group (95% confidence interval -9% to 3%, p for noninferiority = 0.0002). A TIMI myocardial perfusion grade of 0 or 1 was present in 14% of patients in the 2 groups. No differences between the 2 groups were found in any of the secondary analyses of sCr increase. No significant difference in 1-month major adverse cardiac events was found (8% vs 6%, p = 0.37). In conclusion, in a population of unselected patients with ST-segment elevation acute myocardial infarction

  15. 78 FR 60900 - Kiewit Power Constructors Co. et al. (Avalotis Corp., Bowen Engineering Corporation, Commonwealth...

    Science.gov (United States)

    2013-10-02

    ... from falling. Kiewit would use a headache ball, located on the hoist rope directly above the load, to... prevent a slack-rope condition. The condition will limit stress on the rope caused by snaps, thereby...

  16. Maladie de Bowen à localisations multiples: présentation clinique et approche thérapeutique

    Directory of Open Access Journals (Sweden)

    Jean-Baptiste Andonaba

    2017-10-01

    Full Text Available The Bowen’s disease (MB, also known as squamous cell carcinoma in situ is a neoplastic skin disease that was clinically and histologically individualized by Darier in 1914. The isolated lesions in the majority of patients can be multiplied in 10 to 20% of cases. We report many locations which has posed problems of therapeutic choice. It is the case of a 35-year-old housewife, seen in consultation for red colored and squamous patches associated to pruritus and pain. On the skin, the examination found red colored and squamous patches, in projection, shaped rounded with a very slow evolution combining in a variable manner, rashes, scales, crusts and keratosis. Patches tended to grow progressively. The vulvar lesions were pigmented patches. In the mouth, we noted ulcers and a diffuse hypopigmentation with cheilitis, perlèche and odynophagia. The oncology checkup in search of another skin, mucosal and visceral cancer was done without any cancer found and the general condition was retained. The histopathology performed on two biopsies confirmed the diagnosis. Considering the spread of lesions and after a pretreatment evaluation, we put the patient under 5fluorouracil in cream on evening and under isotretinoin capsule with favorable evolution in the third week. The multiple sites of MB are rare but pose a management problem because of the evolutionary potential of each individual lesion in squamous cell carcinoma. The choice of treatment depends on the general condition of the patient, the expected efficacy of the treatment but also on its tolerance and cost.

  17. Shifted energy fluxes, increased Bowen ratios, and reduced thaw depths linked with drainage-induced changes in permafrost ecosystem structure

    Science.gov (United States)

    Göckede, Mathias; Kittler, Fanny; Kwon, Min Jung; Burjack, Ina; Heimann, Martin; Kolle, Olaf; Zimov, Nikita; Zimov, Sergey

    2017-12-01

    Hydrologic conditions are a key factor in Arctic ecosystems, with strong influences on ecosystem structure and related effects on biogeophysical and biogeochemical processes. With systematic changes in water availability expected for large parts of the northern high-latitude region in the coming centuries, knowledge on shifts in ecosystem functionality triggered by altered water levels is crucial for reducing uncertainties in climate change predictions. Here, we present findings from paired ecosystem observations in northeast Siberia comprising a drained and a control site. At the drainage site, the water table has been artificially lowered by up to 30 cm in summer for more than a decade. This sustained primary disturbance in hydrologic conditions has triggered a suite of secondary shifts in ecosystem properties, including vegetation community structure, snow cover dynamics, and radiation budget, all of which influence the net effects of drainage. Reduced thermal conductivity in dry organic soils was identified as the dominating drainage effect on energy budget and soil thermal regime. Through this effect, reduced heat transfer into deeper soil layers leads to shallower thaw depths, initially leading to a stabilization of organic permafrost soils, while the long-term effects on permafrost temperature trends still need to be assessed. At the same time, more energy is transferred back into the atmosphere as sensible heat in the drained area, which may trigger a warming of the lower atmospheric surface layer.

  18. Shifted energy fluxes, increased Bowen ratios, and reduced thaw depths linked with drainage-induced changes in permafrost ecosystem structure

    Directory of Open Access Journals (Sweden)

    M. Göckede

    2017-12-01

    Full Text Available Hydrologic conditions are a key factor in Arctic ecosystems, with strong influences on ecosystem structure and related effects on biogeophysical and biogeochemical processes. With systematic changes in water availability expected for large parts of the northern high-latitude region in the coming centuries, knowledge on shifts in ecosystem functionality triggered by altered water levels is crucial for reducing uncertainties in climate change predictions. Here, we present findings from paired ecosystem observations in northeast Siberia comprising a drained and a control site. At the drainage site, the water table has been artificially lowered by up to 30 cm in summer for more than a decade. This sustained primary disturbance in hydrologic conditions has triggered a suite of secondary shifts in ecosystem properties, including vegetation community structure, snow cover dynamics, and radiation budget, all of which influence the net effects of drainage. Reduced thermal conductivity in dry organic soils was identified as the dominating drainage effect on energy budget and soil thermal regime. Through this effect, reduced heat transfer into deeper soil layers leads to shallower thaw depths, initially leading to a stabilization of organic permafrost soils, while the long-term effects on permafrost temperature trends still need to be assessed. At the same time, more energy is transferred back into the atmosphere as sensible heat in the drained area, which may trigger a warming of the lower atmospheric surface layer.

  19. Phosphorylation of DegU is essential for activation of amyE ...

    Indian Academy of Sciences (India)

    Gel filtration chromatography of DegU on Sephacryl. S100 (Methods). The native molecular weight of DegU was determined on a pre-calibrated Sephacryl S-100 ... Transferrin (80kDa), Alcohol Dehydrogenase (150 kDa). All the above markers were loaded individually. Purified DegU. (~1 mg), in a total volume of 1 mL was ...

  20. A task-driven design model for collaborative AmI systems

    OpenAIRE

    Arroyo, Roberto F.; Gea, Miguel; Garrido, José Luis; Haya, Pablo A.

    2006-01-01

    Proceedings of the CAISE*06 Workshop on Ubiquitous Mobile Information and Collaboration Systems UMICS '06. Luxemburg, June 5-9, 2006. The proceedings of this workshop also appeared in printed version In T. Latour and M. Petit (eds), Proceedings of Workshops and Doctoral Consortium, The 18th International Conference on Advanced Information Systems Engineering - Trusted Information Systems (CAiSE'06), June 5-9, 2006, Presses Universitaires de Namur, 2006, ISBN 2-87037-525. Also publishe...

  1. AMI-LA 15 GHz Observation of the Type IIP Supernova SN 2017eaw

    Science.gov (United States)

    Bright, Joe; Mooley, Kunal; Fender, Rob; Horesh, Assaf

    2017-05-01

    SN 2017eaw was discovered by Patrick Wiggins on 2017 May 14.24 and confirmed as a transient object (located in NGC 6946, at a distance of around 5.5 Mpc) in follow up observations from the McDonald observatory (ATel #10372).

  2. Advanced sampling theory with applications how Michael ‘selected’ Amy

    CERN Document Server

    Singh, Sarjinder

    2003-01-01

    This book is a multi-purpose document. It can be used as a text by teachers, as a reference manual by researchers, and as a practical guide by statisticians. It covers 1165 references from different research journals through almost 1900 citations across 1194 pages, a large number of complete proofs of theorems, important results such as corollaries, and 324 unsolved exercises from several research papers. It includes 159 solved, data-based, real life numerical examples in disciplines such as Agriculture, Demography, Social Science, Applied Economics, Engineering, Medicine, and Survey Sampling. These solved examples are very useful for an understanding of the applications of advanced sampling theory in our daily life and in diverse fields of science. An additional 173 unsolved practical problems are given at the end of the chapters. University and college professors may find these useful when assigning exercises to students. Each exercise gives exposure to several complete research papers for researchers/stude...

  3. septembre 2017 Chers collègues et amis, Mon article dans le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Fabiola Dieudonne

    13 juil. 2017 ... Dans la foulée de lʼéclosion du virus Ebola en 2014, lʼattention a été portée aux systèmes de santé dysfonctionnels de lʼAfrique de lʼOuest et à la façon dont ceux-ci ont aggravé lʼurgence de la situation et compliqué lʼintervention menée face à cette crise. Un nouveau supplément publié le 13 juillet ...

  4. Bridging the gap between services, devices and humans in ami environments

    NARCIS (Netherlands)

    Acampora, G.; Loia, V.

    2005-01-01

    By 2015, according to Mark Pinto of Bell Labs, the microelectronics industry will be manufacturing 10 million silicon transistors per human being per day and the applications will exist to consume them. The evolution of electronic design will lead entire products to be implemented on single silicon

  5. AMI Go Home - Assessing the Realignment of U.S. Army Forces in Europe

    Science.gov (United States)

    2005-03-18

    a major U.S. investment.37 According to Stuart Drury of the Joint Chiefs of Staff, deploying would be much more difficult from Eastern Europe...35 Ibid, xvi. 36 Ibid,12. 37 Ibid, 29. 38 Stuart P. Drury , “The Argument Against Relocating U.S. Forces in Europe,” National Defense University...Europe in the 21st Century,” Parameters (Autumn 2004): 61. 53 Colin Powell, “A Strategy of Partnership,” Foreign Affairs (Jan/Feb 2004): 22. 54 Michael

  6. AMI OBSERVATIONS OF THE ANOMALOUS MICROWAVE EMISSION IN THE PERSEUS MOLECULAR CLOUD

    International Nuclear Information System (INIS)

    Tibbs, C. T.; Scaife, A. M. M.; Dickinson, C.; Davies, R. D.; Davis, R. J.; Watson, R. A.; Paladini, R.; Grainge, K. J. B.

    2013-01-01

    We present observations of the known anomalous microwave emission region, G159.6–18.5, in the Perseus molecular cloud at 16 GHz performed with the Arcminute Microkelvin Imager Small Array. These are the highest angular resolution observations of G159.6–18.5 at microwave wavelengths. By combining these microwave data with infrared observations between 5.8 and 160 μm from the Spitzer Space Telescope, we investigate the existence of a microwave-infrared correlation on angular scales of ∼2'. We find that the overall correlation appears to increase toward shorter infrared wavelengths, which is consistent with the microwave emission being produced by electric dipole radiation from small, spinning dust grains. We also find that the microwave-infrared correlation peaks at 24 μm (6.7σ), suggesting that the microwave emission is originating from a population of stochastically heated small interstellar dust grains rather than polycyclic aromatic hydrocarbons.

  7. Conservation voltage regulation (CVR) applied to energy savings by voltage-adjusting equipment through AMI

    Science.gov (United States)

    Lan, B.-R.; Chang, C.-A.; Huang, P.-Y.; Kuo, C.-H.; Ye, Z.-J.; Shen, B.-C.; Chen, B.-K.

    2017-11-01

    Conservation voltage reduction (CVR) includes peak demand reduction, energy conservation, carbon emission reduction, and electricity bill reduction. This paper analyzes the energy-reduction of Siwei Feeders with applying CVR, which are situated in Penghu region and equipped with smart meters. Furthermore, the applicable voltage reduction range for the feeders will be explored. This study will also investigate how the CVR effect and energy conservation are improved with the voltage control devices integrated. The results of this study can serve as a reference for the Taiwan Power Company to promote and implement voltage reduction and energy conservation techniques. This study is expected to enhance the energy-reduction performance of the Penghu Low Carbon Island Project.

  8. Amy and Drew: Two Children Who Helped Determine What Free Appropriate Public Education Means

    Science.gov (United States)

    Hammel, Alice M.

    2018-01-01

    Two Supreme Court cases have served to frame our legal rights and responsibilities regarding a Free Appropriate Public Education for students in our music classrooms and ensembles. This article serves as record of the two cases and their merits, according to the Supreme Court, as well as the actions recommended based on the court decisions.

  9. RECOVERY OF amiRNA3-PARP1 TRANSGENIC MAIZE PLANTS ...

    African Journals Online (AJOL)

    ACSS

    Positive plant selectable marker genes are commonly used in plant transformation because they not only enhance the frequency of generation transgenic tissues but are considered biosafe, unlike antibiotic or herbicide resistance genes. In this study, the binary vector pNOV2819-ubiamiRNA3PARP1, harbouring the ...

  10. The AMI speaker diarization system for NIST RT06s meeting data

    NARCIS (Netherlands)

    Leeuwen, D.A. van; Huijbregts, Marijn

    2006-01-01

    We describe the systems submitted to the NIST RT06s evaluation for the Speech Activity Detection (SAD) and Speaker Diarization (SPKR) tasks. For speech activity detection, a new analysis methodology is presented that generalizes the Detection Erorr Tradeoff analysis commonly used in speaker

  11. The AMI speaker diarization system for NIST RT06s meeting data

    NARCIS (Netherlands)

    van Leeuwen, David A.; Huijbregts, M.A.H.

    2007-01-01

    We describe the systems submitted to the NIST RT06s evaluation for the Speech Activity Detection (SAD) and Speaker Diarization (SPKR) tasks. For speech activity detection, a new analysis methodology is presented that generalizes the Detection Erorr Tradeoff analysis commonly used in speaker detection

  12. Maria Edgeworth's Angelina, or L'amie Inconnue: queer materiality and the woman writer's grotesque body.

    Science.gov (United States)

    Gonda, Caroline

    2013-01-01

    Despite its many similarities to her better-known novel Belinda, Maria Edgeworth's Angelina is not usually read as a work about lesbianism--even though it begins with the heroine eloping to live with another woman. This article explores same-sex relationships in Angelina and suggests reasons for the work's comparative neglect by lesbian criticism. It examines the process by which the heroine's "unknown friend," the novelist Araminta, moves from being "nobody," a textual construct, to a woman all too thoroughly and grotesquely embodied; and it discusses the role of queer objects, including literary texts, in that process of embodiment.

  13. Raymond Stora, le physicien, l'homme, l'ami ( Memorial meeting )

    CERN Multimedia

    CERN. Geneva

    2015-01-01

      Speakers:  Michel Bauer, Michel Dubois-Violette, Sergio Ferrara, Marc Henneaux, Camillo Imbimbo, Juan Luis Manes, Ivan Todorov Organizers:  Luis Alvarez-Gaumé, Luc Frappat, Paul Sorba, Frank Thuillier

  14. Invariance of the magnetic behavior and AMI in ferromagnetic biphase films with distinct non-magnetic metallic spacers

    Energy Technology Data Exchange (ETDEWEB)

    Silva, E.F. [Departamento de Física, Universidade Federal do Rio Grande do Norte, 59078-900 Natal, RN (Brazil); Departamento de Física, Universidade Federal de Pernambuco, 50670-901 Recife, PE (Brazil); Gamino, M. [Departamento de Física, Universidade Federal de Pernambuco, 50670-901 Recife, PE (Brazil); Instituto de Física, Universidade Federal do Rio Grande de Sul, 91501-970 Porto Alegre, RS (Brazil); Andrade, A.M.H. de [Instituto de Física, Universidade Federal do Rio Grande de Sul, 91501-970 Porto Alegre, RS (Brazil); Vázquez, M. [Instituto de Ciencia de Materiales de Madrid, CSIC, 28049 Madrid (Spain); Correa, M.A. [Departamento de Física, Universidade Federal do Rio Grande do Norte, 59078-900 Natal, RN (Brazil); Bohn, F., E-mail: felipebohn@fisica.ufrn.br [Departamento de Física, Universidade Federal do Rio Grande do Norte, 59078-900 Natal, RN (Brazil)

    2017-02-01

    We investigate the quasi-static magnetic, magnetotransport, and dynamic magnetic properties in ferromagnetic biphase films with distinct non-magnetic metallic spacer layers. We observe that the nature of the non-magnetic metallic spacer material does not have significant influence on the overall biphase magnetic behavior, and, consequently, on the magnetotransport and dynamic magnetic responses. We focus on the magnetoimpedance effect and verify that the films present asymmetric magnetoimpedance effect. Moreover, we explore the possibility of tuning the linear region of the magnetoimpedance curves around zero magnetic field by varying the probe current frequency in order to achieve higher sensitivity values. The invariance of the magnetic behavior and the asymmetric magnetoimpedance effect in ferromagnetic biphase films with distinct non-magnetic metallic spacers place them as promising candidates for probe element and open possibilities to the development of lower-cost high sensitivity linear magnetic field sensor devices.

  15. A cluster randomised trial to assess the impact of clinical pathways on AMI management in rural Australian emergency departments

    Directory of Open Access Journals (Sweden)

    Snow Pamela C

    2009-05-01

    Full Text Available Abstract Background People living in rural Australia are more likely to die in hospital following an acute myocardial infarction than those living in major cities. While several factors, including time taken to access hospital care, contribute to this risk, it is also partially attributable to the lower uptake of evidence-based guidelines for the administration of thrombolytic drugs in rural emergency departments where up to one-third of eligible patients do not receive this life-saving intervention. Clinical pathways have the potential to link evidence to practice by integrating guidelines into local systems, but their impact has been hampered by variable implementation strategies and sub-optimal research designs. The purpose of this study is to determine the impact of a five-step clinical pathways implementation process on the timely and efficient administration of thrombolytic drugs for acute myocardial infarctions managed in rural Australian emergency departments. Methods/Design The design is a two-arm, cluster-randomised trial with rural hospital emergency departments that treat and do not routinely transfer acute myocardial infarction patients. Six rural hospitals in the state of Victoria will participate, with three in the intervention group and three in the control group. Intervention hospitals will participate in a five-step clinical pathway implementation process: engagement of clinicians, pathway development according to local resources and systems, reminders, education, and audit and feedback. Hospitals in the control group will each receive a hard copy of Australian national guidelines for chest pain and acute myocardial infarction management. Each group will include 90 cases to give a power of 80% at 5% significance level for the two primary outcome measures: proportion of those eligible for thrombolysis receiving the drug and time to delivery of thrombolytic drug. Discussion Improved compliance with thrombolytic guidelines via clinical pathways will increase acute myocardial infarction survival rates in rural hospitals and thereby help to reduce rural-urban mortality inequalities. Such knowledge translation has the potential to be adapted for a range of clinical problems in a wide array of settings. Trial registration Australia New Zealand Clinical Trials Registry code ACTRN12608000209392.

  16. Usefulness of superparamagnetic iron oxide particle (AMI-25) enhanced MR imaging for the diagnosis of liver tumors

    International Nuclear Information System (INIS)

    Hirohashi, Shinji; Hirohashi, Rina; Uchida, Hideo; Kachi, Kenji; Ohtomo, Kuni; Uchiyama, Gyou; Niitsu, Mamoru; Itai, Yuji.

    1994-01-01

    The purpose of this study was to clarify the usefulness of SPIO-enhanced MRI in the diagnosis of liver tumors in comparison with contrast enhanced CT. The subjects were forty patients with 154 nodules in the liver. We compared SPIO-enhanced MRI with contrast-enhanced CT in terms of tumor-liver contrast and detectability of liver tumors. In terms of tumor liver contrast, SPIO-enhanced MRI was equal or superior to contrast-enhanced CT in 82% of cases. In the detectability of liver tumor, SPIO-enhanced MRI detected more tumors than contrast-enhanced CT, especially small tumors. Tumors undetected by SPIO-enhanced MRI that were detected by contrast-enhanced CT and/or plain MRI were adenomatous hyperplasia and inflammatory pseudotumor according to fine needle biopsy. There were no severe complications of SPIO-enhanced MRI. In conclusion, SPIO-enhanced MRI will be more useful than contrast-enhanced CT in the diagnosis of liver tumors. SPIO-enhanced MRI may be a promising diagnostic method for the detection of hepatic tumors, especially small ones. (author)

  17. Grace and Courtesy: A Human Responsibility. AMI/USA Conference (Oak Brook, Illinois, July 23-26, 1998).

    Science.gov (United States)

    American Montessori International of the United States, Inc., Rochester, NY.

    This conference proceedings compile presentations from a 1998 meeting of the American Montessori International of the United States, focusing on the importance of grace and courtesy in children's lives and in Montessori education. The papers presented are: (1) "Grace--The Felicity of Being" (Renilde Montessori); (2) "A Montessori…

  18. Efficient and Privacy-Aware Power Injection over AMI and Smart Grid Slice in Future 5G Networks

    Directory of Open Access Journals (Sweden)

    Yinghui Zhang

    2017-01-01

    Full Text Available Smart grid is critical to the success of next generation of power grid, which is expected to be characterized by efficiency, cleanliness, security, and privacy. In this paper, aiming to tackle the security and privacy issues of power injection, we propose an efficient and privacy-aware power injection (EPPI scheme suitable for advanced metering infrastructure and 5G smart grid network slice. In EPPI, each power storage unit first blinds its power injection bid and then gives the blinded bid together with a signature to the local gateway. The gateway removes a partial blind factor from each blinded bid and then sends to the utility company aggregated bid and signature by using a novel aggregation technique called hash-then-addition. The utility company can get the total amount of collected power at each time slot by removing a blind factor from the aggregated bid. Throughout the EPPI system, both the gateway and the utility company cannot know individual bids and hence user privacy is preserved. In particular, EPPI allows the utility company to check the integrity and authenticity of the collected data. Finally, extensive evaluations indicate that EPPI is secure and privacy-aware and it is efficient in terms of computation and communication cost.

  19. Ægtefællers oplevelser, når deres partner indlægges med AMI

    DEFF Research Database (Denmark)

    Hansen, Birgitte; Lomborg, Kirsten

    2006-01-01

    that – even though emotional support was advertised by the spouses – need might not be fully recognised by the health care professional. A discussion of findings is elaborated, drawing on Ida J. Orlando’s ideas on nurse-patient relationships. The conclusion is drawn that the recent change in treatment...... of myocardial infarction to invasive treatment seems to cause new difficulties in terms of establishing a trustful relationship between spouses and healthcare professionals at community hospitals. Consequently, health care professionals are challenged to put extra efforts into the establishment of good...

  20. CVIT expert consensus document on primary percutaneous coronary intervention (PCI) for acute myocardial infarction (AMI) in 2018.

    Science.gov (United States)

    Ozaki, Yukio; Katagiri, Yuki; Onuma, Yoshinobu; Amano, Tetsuya; Muramatsu, Takashi; Kozuma, Ken; Otsuji, Satoru; Ueno, Takafumi; Shiode, Nobuo; Kawai, Kazuya; Tanaka, Nobuhiro; Ueda, Kinzo; Akasaka, Takashi; Hanaoka, Keiichi Igarashi; Uemura, Shiro; Oda, Hirotaka; Katahira, Yoshiaki; Kadota, Kazushige; Kyo, Eisho; Sato, Katsuhiko; Sato, Tadaya; Shite, Junya; Nakao, Koichi; Nishino, Masami; Hikichi, Yutaka; Honye, Junko; Matsubara, Tetsuo; Mizuno, Sumio; Muramatsu, Toshiya; Inohara, Taku; Kohsaka, Shun; Michishita, Ichiro; Yokoi, Hiroyoshi; Serruys, Patrick W; Ikari, Yuji; Nakamura, Masato

    2018-04-01

    While primary percutaneous coronary intervention (PCI) has significantly contributed to improve the mortality in patients with ST segment elevation myocardial infarction even in cardiogenic shock, primary PCI is a standard of care in most of Japanese institutions. Whereas there are high numbers of available facilities providing primary PCI in Japan, there are no clear guidelines focusing on procedural aspect of the standardized care. Whilst updated guidelines for the management of acute myocardial infarction were recently published by European Society of Cardiology, the following major changes are indicated; (1) radial access and drug-eluting stent over bare metal stent were recommended as Class I indication, and (2) complete revascularization before hospital discharge (either immediate or staged) is now considered as Class IIa recommendation. Although the primary PCI is consistently recommended in recent and previous guidelines, the device lag from Europe, the frequent usage of coronary imaging modalities in Japan, and the difference in available medical therapy or mechanical support may prevent direct application of European guidelines to Japanese population. The Task Force on Primary Percutaneous Coronary Intervention of the Japanese Association of Cardiovascular Intervention and Therapeutics (CVIT) has now proposed the expert consensus document for the management of acute myocardial infarction focusing on procedural aspect of primary PCI.

  1. Miks ühel õnnestub ja teisel mitte? / Amy Edmonson, Richard Bohmer, Gary Pisano ; tõlk. Kadre Vaik

    Index Scriptorium Estoniae

    Edmonson, Amy

    2003-01-01

    16 meditsiinikeskuses läbi viidud uuringust eesmärgiga jälgida kirurgimeeskondade tööd ning kohanemist uute töömeetoditega. Kommenteerivad Toomas-Andres Sulling, Tiit Ojaveski ja Ela Velström. Vt. samas: Uus meetod murtud südame parandamiseks; Kahe haigla lugu. Lisa: Õppiv liider

  2. The Study of Two Psychotherapy Approaches (Rogers Self Theory and Ellis Rational Theory) in Improvement of Bowen Self-differentiation and Intimacy.

    Science.gov (United States)

    Yousefi, Naser; Kiani, Mohammad Ali

    2014-01-01

    To compare the effectiveness of rational, behavioral and emotive therapy (REBT) and person-centered therapy (PCT) on self-differentiation and intimacy among divorce clients. In quasi-experimental study, 42 divorce clients (both males and females) who presented to the Counsling Center of Sanandaj, Iran were sampled. They were categorized into three groups of PCT, REBT, and control group (each group contained 14 subjects). The recovery indices (dependent variables) employed were the subject of self-differentiation and intimacy, which were measured twice before and after intervention of Differentiation of Self Inventory-2 (DSI-2) and intimacy. The therapy involved 8 one-hour sessions. It was held twice a week and therapeutic effects were traced after 8 months. The results showed that REBT and PCT were effective on self-differentiation scale and intimacy. Also they were influential in recovery self-differentiation scale and intimacy follow up stage. REBT and PCT were effective on self-differentiation and its subscales (Emotional reactivity, "I" position, Emotional cut off and Fusion with other) and general intimacy. None.

  3. Comments on 'On the estimation of overwater bowen ratio from sea-air temperature difference. Reply to: Hsu, S.A. - A relationship between the Bowen ratio and sea-air temperature difference under unstable conditions at sea. J. Phys. Oceanogr. Vol. 28; p. 2222-2226'

    Digital Repository Service at National Institute of Oceanography (India)

    Sadhuram, Y.; Murty, T.V.R.; Sarma, Y.V.B.; Murty, V.S.N.

    stream_size 2 stream_content_type text/plain stream_name J_Phys_Oceanogr_31_1933.pdf.txt stream_source_info J_Phys_Oceanogr_31_1933.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  4. Archeological Testing Fort Hood: 1994-1995. Volume 2

    Science.gov (United States)

    1996-10-01

    ASSOCI TES, INC. (662-22) Archeological Testing at Fort Hood. 1994-199.5 569 -48-1941.1080-134 1935 -058 Figure 7.17 Selected Perforator Types: Awl and...Department of Anthropology, University of Arkansas. Huskey, V. 1935 An Archeological Survey of the Nueces Canyon of Texas, Bulletin of the Texas... epr 064lL.Tan I lms expected 08-FH1 Yellow 4 expected expedctd cd .9 15.Q W n• I less M 0 ~ *~Tax~on Total Total Inmr 53 nac na Vertebra.es 1. FcAuifnm

  5. L'Abbaye cistercienne de Morimond. Histoire et rayonnement", Ed. Georges Viard. Association des Amis de l'Abbaye de Morimond, 2005

    DEFF Research Database (Denmark)

    McGuire, Brian Patrick

    2007-01-01

    Et vigtigt bidrag til middelalderens klosterhistorie. Morimond var et af de første datterklostre af Cîteaux og dermed en vigtig bidragyder til cistercienserordenens vækst og udvidelse i 1100-tallet. Alligevel har Morimonds historie været meget lidt kendt og derfor er dette arbejde mere end velkom...

  6. Retrospective analysis of the role and performance of family medicine versus emergency medical services in the pre-hospital management of patients with AMI in Banja Luka.

    Science.gov (United States)

    Lakić, Biljana; Račić, Maja; Vulić, Duško

    2016-05-01

    The aim of this study was to investigate the differences in pre-hospital care of patients with acute myocardial infarction between emergency medical services and family medicine. This retrospective descriptive study included patients treated for acute myocardial infarction at the University Clinical Centre of Banja Luka, in the period from 1st January to 31st December 2011. The patients were divided into two groups: patients who received a hospital referral from the family medicine service and those who received one from the emergency medical service. The majority of patients (54.8%) received pre-hospital care from emergency medical services, while in 24.8% of cases the care was provided by family medicine physicians. The analysis showed that the time that passed from the onset of symptoms to the visit to the health institution of first medical contact was shorter in the emergency medical service (pfamily practice was 24 hours, and to the emergency service 2 hours. The patients who established their first medical contact with the emergency service reported more severe symptoms than the ones who visited a family practice over the same period of time. The severity of symptoms affected the patients' decisions to seek help in a timely manner and to choose the facility of first medical contact. Interventions to decrease delay must focus on improving public awareness of acute myocardial infarction symptoms and increasing their knowledge of the benefits of early medical contact and treatment. Continuing education of family practitioners in this field is required. Copyright © 2016 by Academy of Sciences and Arts of Bosnia and Herzegovina.

  7. « Petits meurtres entre amis », Approche psychosomatique et psychodynamique du harcèlement moral au travail

    Directory of Open Access Journals (Sweden)

    Marie Grenier-Pezé

    2005-11-01

    Full Text Available La présence médiatique du harcèlement moral interroge sa légitimité sociale et psychopathologique. Comprendre la redoutable toxicité de la situation de harcèlement impose de se pencher sur les enjeux identitaires liés à la situation de travail. Il s’agit de replacer ce nouveau syndrome dans le contexte plus large des effets positifs et négatifs de l’organisation du travail sur la santé psychique et physique. Les mécanismes de défense individuels et les stratégies collectives mobilisés par les sujets pour tenir au travail peuvent souder ou disloquer un collectif de travail entraînant la désignation d’un bouc émissaire. L’intériorisation des valeurs organisationnelles de l’entreprise autorisent la banalisation du mal exercé sur autrui, sa systématisation en techniques de disciplinarisation du corps. La rencontre avec le réseau de prise en charge, médecin du travail, médecin inspecteur, médecin généraliste, psychologue n’est pas qu’une stratégie médico-administrative. Ce travail du lien met un terme symbolique à l’isolement du harcelé et un point d’arrêt à la désintrication psychosomatique en cours.The presence of moral harassment in the media questions its own social and psychopathological legitimacy. To understand the formidable toxicity of the harassment situation, identity issues related to the work situation need to be investigated. This new syndrome must be re-situated within the broader framework of the positive and negative effects of work organization on mental and physical health. The individual defence mechanisms and collective strategies that subjects mobilize to cope at work can either strengthen or dismantle a work collective, thus resulting in the creation of a scapegoat. Internalizing the company’s organizational values allows banalization of the harm imposed on others, and its systematization through bodily discipline techniques. Meeting with the network (the company medical officer, the government medical inspector, the general practitioner, the workplace psychologist is not just a medical and administrative strategy. This networking also puts a symbolic end to the harassed person’s isolation and an end to the evolving psychosomatic symptoms.La presencia mediática del acoso moral interroga su legitimidad social y psicopatológica. Comprender la temible toxicidad de la situación de acoso impone examinar lo que está en juego desde el punto de vista de la identidad en realción con la situación de trabajo. Se trata de reposicionar este nuevo síndrome en el contexto más amplio de los efectos positivos y negativos de la organización del trabajo sobre la salud psíquica y física. Los mecanismos de defensa individuales y las estrategias colectivas mobilizadas por los sujetos para mantenerse en el trabajo pueden solidificar o desmembrar un colectivo de trabajo ocasionando la designación de un chivo expiatorio. La interiorización de valores organizacionales de la empresa autoriza la banalización del mal ejercido contra el otro, su sistematización en técnicas cuyo objetivo es disciplinar el cuerpo. El encuentro con la red de contención, médico del trabajo, médico inspector, médico generalista, psicólogo no es solo una estrategia médico-administrativa. El trabajo sobre el vínculo pone un término simbólico al aislamiento del acosado y un freno a la desintricación psicosomática en curso.

  8. Reduction in cardiac mortality with bivalirudin in patients with and without major bleeding: The HORIZONS-AMI trial (Harmonizing Outcomes with Revascularization and Stents in Acute Myocardial Infarction).

    Science.gov (United States)

    Stone, Gregg W; Clayton, Tim; Deliargyris, Efthymios N; Prats, Jayne; Mehran, Roxana; Pocock, Stuart J

    The purpose of this study was to determine whether, in patients with ST-segment elevation myocardial infarction (STEMI) undergoing primary percutaneous coronary intervention (PCI), the reduction in cardiac mortality in those taking bivalirudin compared with unfractionated heparin plus a glycoprotein IIb/IIIa inhibitor (UFH+GPI) can be fully attributed to reduced bleeding. The association between hemorrhagic complications and mortality may explain the survival benefit with bivalirudin. A total of 3,602 STEMI patients undergoing primary PCI were randomized to bivalirudin versus UFH+GPI. Three-year cardiac mortality was analyzed in patients with and without major bleeding. When compared with UFH+GPI, bivalirudin resulted in lower 3-year rates of major bleeding (6.9% vs. 10.5%, hazard ratio [HR]: 0.64 [95% confidence interval (CI): 0.51 to 0.80], p accounting for major bleeding and other adverse events, bivalirudin was still associated with a 43% reduction in 3-year cardiac mortality (adjusted HR: 0.57 [95% CI: 0.39 to 0.83], p = 0.003). Bivalirudin reduces cardiac mortality in patients with STEMI undergoing primary PCI, an effect that can only partly be attributed to prevention of bleeding. Further studies are required to identify the nonhematologic benefits of bivalirudin. (Harmonizing Outcomes With Revascularization and Stents in Acute Myocardial Infarction; NCT00433966). Copyright © 2014 American College of Cardiology Foundation. Published by Elsevier Inc. All rights reserved.

  9. Design and implementation of a Smart Measurement System for AMI in the microgrid of the University of Nariño

    Directory of Open Access Journals (Sweden)

    Andrés F. Arciniegas M.

    2017-02-01

    Full Text Available This project describes a proposed Measure Management System, from the design stage to the implementation of a prototype smart meter, adapted to operate in the microgrid at the University of Nariño. This device features a constant record of measures, with resolution of 24 bits, sufficient to perform power quality analysis. In addition, it is integrated into the SCADA system through the open protocols MODBUS, DNP3 and IEC 61850, with scheduled cybersecurity techniques. Likewise, several management platforms for the monitoring of electrical variables and control over the current flow to the loads is designed. Finally, two study cases show the application of the implemented measure management system in the microgrid.

  10. The Shift in Gender Roles in Amy Tan’s 'The Joy Luck Club' and Khaled Hosseini’s 'The Kite Runner'

    Directory of Open Access Journals (Sweden)

    Mujad Didien Afandi

    2018-03-01

    Full Text Available The unfair gender roles under patriarchal system are constructed to preserve gender inequality between men and women. Gender role practices extend gradually to maintain the male hegemony to make women powerless because female traditional gender roles (femininities create dependency to men. Men are assigned to masculinities equipped with power, whereas women are ascribed to femininities to set boundaries that limit their movement. Yet, the increase of female awareness of gender equality has changed this situation. Gender roles are gradually shifting from traditional to modern as the opportunities to receive education and job open widely to develop women's roles that enable them to give financial contribution to the family. This study was purposed to analyze the shift in gender roles in 'The Joy Luck Club' and 'The Kite Runner'. This study used qualitative design in which Chinese traditional gender roles were described using Confucian perspective, whereas Afghan traditional gender roles were exposed in Islamic perspective. Moreover, Karl Marx's conflict theory was used to analyze the shift in gender roles in both novels. The results of study found that the construction of traditional gender roles in both China and Afghanistan was influenced mostly by patriarchy which perceives men as more superior than women. However, the dynamic changes of gender roles, especially femininities, supported by the increase of female education and occupation provide women with more power to achieve development. Further studies are encouraged to analyze other gender roles which have not discussed in this study.

  11. The Shift in Gender Roles in Amy Tan’s 'The Joy Luck Club' and Khaled Hosseini’s 'The Kite Runner'

    OpenAIRE

    Mujad Didien Afandi

    2018-01-01

    The unfair gender roles under patriarchal system are constructed to preserve gender inequality between men and women. Gender role practices extend gradually to maintain the male hegemony to make women powerless because female traditional gender roles (femininities) create dependency to men. Men are assigned to masculinities equipped with power, whereas women are ascribed to femininities to set boundaries that limit their movement. Yet, the increase of female awareness of gender equality has c...

  12. Use of podcast technology to facilitate education, communication and dissemination in palliative care: the development of the AmiPal podcast.

    Science.gov (United States)

    Nwosu, Amara Callistus; Monnery, Daniel; Reid, Victoria Louise; Chapman, Laura

    2017-06-01

    Podcasts have the potential to facilitate communication about palliative care with researchers, policymakers and the public. Some podcasts about palliative care are available; however, this is not reflected in the academic literature. Further study is needed to evaluate the utility of podcasts to facilitate knowledge-transfer about subjects related to palliative care. The aims of this paper are to (1) describe the development of a palliative care podcast according to international recommendations for podcast quality and (2) conduct an analysis of podcast listenership over a 14-month period. The podcast was designed according to internationally agreed quality indicators for medical education podcasts. The podcast was published on SoundCloud and was promoted via social media. Data were analysed for frequency of plays and geographical location between January 2015 and February 2016. 20 podcasts were developed which were listened to 3036 times (an average of 217 monthly plays). The Rich Site Summary feed was the most popular way to access the podcast (n=1937; 64%). The mean duration of each podcast was 10 min (range 3-21 min). The podcast was listened to in 68 different countries and was most popular in English-speaking areas, of which the USA (n=1372, 45.2%), UK (n=661, 21.8%) and Canada (n=221, 7.3%) were most common. A palliative care podcast is a method to facilitate palliative care discussion with global audience. Podcasts offer the potential to develop educational content and promote research dissemination. Future work should focus on content development, quality metrics and impact analysis, as this form of digital communication is likely to increase and engage wider society. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  13. Katherine Biddle, Saint-John Perse intime. Journal inédit d’une amie américaine (1940-1970)

    OpenAIRE

    Arena, Sara

    2016-01-01

    Un’amicizia trentennale unisce il poeta e diplomatico Saint-John Perse, il cui vero nome era Alexis Leger, a Katherine Biddle, scrittrice e poetessa, moglie del ministro della Giustizia degli Stati Uniti di Roosevelt, Francis Biddle. È anzi una vera e propria amicizia a tre quella che lega i due ricchi coniugi e il poeta a partire dal 1940, data del suo arrivo negli Stati Uniti, e che li vede insieme per lunghi periodi, nelle dimore dei Biddle e in viaggio; un rapporto non esente da ambiguità...

  14. DANSIN İLK AKADEMİSYENİ: AGRİPPİNA VAGANOVA (YAŞAMI VE DANS EĞİTİM METODU)

    OpenAIRE

    KOÇKAR, M. Tekin

    2016-01-01

    Dünya Bale sanatının en teknik ve en güçlü eğitim sistemini yaratan Agrippina Vaganova’nın, öz yaşamı ve yaratmış olduğu teknik ile ilgili genel bilgiler bu çalışmanın konusunu oluşturmaktadır. Vaganova’nın dans eğitim metodu üç temel programa dayalıdır: Birincisi; Eğitimin her aşamasının en ayrıntılı biçimde planlanması, ikincisi; dansçının virtüözlük özelliklerini ortaya çıkaracak olan karmaşık egzersizlerin uygulanması, üçüncüsü ise; eğitim sürecinde ayrı ayrı her dansçının yapacağı hareke...

  15. Improved stage of infarction wall motion in AMI. Association between the presence or absence of mismatch in myocardial scintigrams of Tl and BMIPP and CK release pattern

    International Nuclear Information System (INIS)

    Kurihara, Masato; Abe, Masahiro; Abe, Toshihiro; Nagai, Yoshikazu; Ibukiyama, Chiharu

    1998-01-01

    Binuclear myocardial scintigraphy with BMIPP and 201 TlCl was conducted on 40 patients with myocardial infarction. In all of 40 patients, reperfusion therapy in the acute stage succeeded. The relationship between serum CK release pattern and timing of improvement of wall motion at infarct-related area in the chronic stage was investigated. The patients were divided into 3 groups according to the early or late appearance of peak CK, and the presence or absence of B type mismatch in dual myocardial scintigraphy with BMIPP and 201 TlCl obtained one month after acute onset of myocardial infarction. Infarct size obtained from 201 TlCl scintigraphy and wall motion related to infarction were also investigated immediately after reperfusion and one month thereafter, respectively. No differences were recognized between Group I, in which the infarct area had B type mismatch with early appearance of CK peak, and Group II, in which the infarct area also had B type mismatch with the late appearance of CK peak. Although the wall motion did not change at all in Group I, it improved in Group II one month after reperfusion. Group III did not demonstrate B type mismatch with late appearance of CK peak and smaller infarct size compared to those in Group I and Group II. The wall motion in Group III had a tendency to improve immediately after reperfusion and maintain that level one month later. The timing of improvement of wall motion after successful reperfusion in the area with B type mismatch was not uniform. This suggests that the nonuniformity of the timing of improvement of wall motion in the area with B type mismatch is partly attributable to some kinds of injury to myocardium caused by reperfusion. (author)

  16. Specialised cleaning associated with antimicrobial coatings for reduction of hospital acquired infection. Opinion of the COST Action Network AMiCI (CA15114).

    Science.gov (United States)

    Dunne, Suzanne S; Ahonen, Merja; Modic, Martina; Crijns, Francy Rl; Keinänen-Toivola, Minna M; Meinke, Ruth; Keevil, C William; Gray, Jim; O'Connell, Nuala H; Dunne, Colum P

    2018-03-14

    Recognized issues with poor hand hygiene compliance among healthcare workers, and reports of re-contamination of previously chemically disinfected surfaces through hand contact, emphasize need for novel hygiene methods in addition to those currently available. One such approach involves antimicrobial (nano)-coatings (AMC), whereby integrated active ingredients are responsible for elimination of microorganisms that come into contact with treated surfaces. While widely studied under laboratory conditions with promising results, studies under real life healthcare conditions are scarce. The views of 75 contributors from 30 European countries were collated regarding specialised cleaning associated with antimicrobial coatings for reduction of hospital acquired infection. There was unanimous agreement that generation of scientific guidelines for cleaning of antimicrobial coatings, using traditional or new processes, are needed. Specific topics included: understanding mechanisms of action of cleaning materials and their physical interactions with conventional and antimicrobial coatings; that assessments mimic the life-cycle of coatings to determine the impact of repetitive cleaning and other aspects of ageing (e.g., exposure to sunlight); determining concentrations of AMC-derived biocides in effluents, and development of effective de-activation and sterilisation treatments for cleaning effluents. Further, the consensus opinion was that prior to widespread implementation of AMCs, the varying responsibilities of involved clinical, healthcare management, cleaning services, and environmental safety stakeholders need clarification. Copyright © 2018 The Author(s). Published by Elsevier Ltd.. All rights reserved.

  17. Optimal Throughput and Self-adaptability of Robust Real-Time IEEE 802.15.4 MAC for AMI Mesh Network

    International Nuclear Information System (INIS)

    Shabani, Hikma; Ahmed, Musse Mohamud; Khan, Sheroz; Hameed, Shahab Ahmed; Habaebi, Mohamed Hadi

    2013-01-01

    A smart grid refers to a modernization of the electricity system that brings intelligence, reliability, efficiency and optimality to the power grid. To provide an automated and widely distributed energy delivery, the smart grid will be branded by a two-way flow of electricity and information system between energy suppliers and their customers. Thus, the smart grid is a power grid that integrates data communication networks which provide the collected and analysed data at all levels in real time. Therefore, the performance of communication systems is so vital for the success of smart grid. Merit to the ZigBee/IEEE802.15.4std low cost, low power, low data rate, short range, simplicity and free licensed spectrum that makes wireless sensor networks (WSNs) the most suitable wireless technology for smart grid applications. Unfortunately, almost all ZigBee channels overlap with wireless local area network (WLAN) channels, resulting in severe performance degradation due to interference. In order to improve the performance of communication systems, this paper proposes an optimal throughput and self-adaptability of ZigBee/IEEE802.15.4std for smart grid

  18. On setting NRC alarm thresholds for inventory differences and process unit loss estimators: Clarifying their statistical basis with hypothesis testing methods and error propagation models from Jaech, Bowen and Bennett and IAEA

    International Nuclear Information System (INIS)

    Ong, L.

    1995-01-01

    Major fuel cycle facilities in the US private sector are required to respond-at predetermined alarm levels-to various special nuclear material loss estimators in the material control and accounting (MC and A) area. This paper presents US Nuclear Regulatory Commission (NRC) policy, along with the underlying statistical rationale, for establishing and inspecting the application of thresholds to detect excessive inventory differences (ID). Accordingly, escalating responsive action must be taken to satisfy NRC's MC and A regulations for low-enriched uranium (LEU) fuel conversion/fabrication plants and LEU enrichment facilities. The establishment of appropriate ID detection thresholds depends on a site-specific goal quantity, a specified probability of detection and the standard error of the ID. Regulatory guidelines for ID significance tests and process control tests conducted by licensees with highly enriched uranium are similarly rationalized in definitive hypothesis testing including null and alternative hypotheses; statistical efforts of the first, second, third, and fourth kinds; and suitable test statistics, uncertainty estimates, prevailing assumptions, and critical values for comparisons. Conceptual approaches are described in the context of significance test considerations and measurement error models including the treatment of so called ''systematic error variance'' effects as observations of random variables in the statistical sense

  19. Comparison of Identify-Friend-Foe and Blue-Force Tracking Decision Support for Combat Identification (Comparaison des Systemes d’aide a la Decision Identification ami ou Ennemi et Suivi des Forces Bleues pour l’Identification au Combat)

    Science.gov (United States)

    2011-02-01

    In the context of the CID task, sensitivity refers to subjects’ psychological discrimination between friends and foes, or their ability to...G. A. (1956). The magical number seven, plus or minus two: Some limits on our capacity for processing information. Psychological Review, 63, 81-97...Wiley. 21. Macmillan, N. A., & Creelman , C. D. (1991). Detection theory: A user’s guide. Cambridge, UK: Cambridge University Press. DRDC Toronto

  20. Hommage aux amis et collègues de l’Université Quisqueya et de l’Ecole Normale Supérieure de Port-au-Prince

    Directory of Open Access Journals (Sweden)

    Georges Eddy Lucien

    2012-01-01

    Full Text Available 12 janvier 2010 Haïti est frappée de manière terrible. La terre tremble, se déchaine contre tout ce qui lui enlève sa forme initiale : les routes, les ponts, les maisons… Deux cent milles voix se sont tues à jamais, parmi elle : des géographes, des cartographes, des urbanistes, des aménageurs…Et, avec eux, s’en vont les lycées, les universités, les lieux par excellence de formation et de communication des connaissances… Ce mardi 12 janvier, le temps s’arrête. Le jour et la nuit se confondent....

  1. Inhibition of delta-protein kinase C by delcasertib as an adjunct to primary percutaneous coronary intervention for acute anterior ST-segment elevation myocardial infarction: results of the PROTECTION AMI Randomized Controlled Trial

    NARCIS (Netherlands)

    Lincoff, A.M.; Roe, M.; Aylward, P.; Galla, J.; Rynkiewicz, A.; Guetta, V.; Zelizko, M.; Kleiman, N.; White, H.; McErlean, E.; Erlinge, D.; Laine, M.; Ferreira, J.M. Dos Santos; Goodman, S.; Mehta, S.; Atar, D.; Suryapranata, H.; Jensen, S.E.; Forster, T.; Fernandez-Ortiz, A.; Schoors, D.; Radke, P.; Belli, G.; Brennan, D.; Bell, G.; Krucoff, M.; et al.,

    2014-01-01

    AIMS: Delcasertib is a selective inhibitor of delta-protein kinase C (delta-PKC), which reduced infarct size during ischaemia/reperfusion in animal models and diminished myocardial necrosis and improved reperfusion in a pilot study during primary percutaneous coronary intervention (PCI) for ST

  2. Interactions of barley alpha-amylase isozymes with Ca2+, substrates and proteinaceous inhibitors

    DEFF Research Database (Denmark)

    Abou Hachem, Maher; Bozonnet, Sophie; Willemoes, Martin

    2006-01-01

    discovered 'sugar tongs' site in domain C of AMY1 is thus critical for binding to starch granules. Furthermore, mutations of binding sites mostly reduced the degree of multiple attack in amylose hydrolysis. AMY1 has higher substrate affinity than AMY2, but isozyme chimeras with AMY2 domain C and other...

  3. Comparisons of Copy Number, Genomic Structure, and Conserved Motifs for α-Amylase Genes from Barley, Rice, and Wheat

    Directory of Open Access Journals (Sweden)

    Qisen Zhang

    2017-10-01

    Full Text Available Barley is an important crop for the production of malt and beer. However, crops such as rice and wheat are rarely used for malting. α-amylase is the key enzyme that degrades starch during malting. In this study, we compared the genomic properties, gene copies, and conserved promoter motifs of α-amylase genes in barley, rice, and wheat. In all three crops, α-amylase consists of four subfamilies designated amy1, amy2, amy3, and amy4. In wheat and barley, members of amy1 and amy2 genes are localized on chromosomes 6 and 7, respectively. In rice, members of amy1 genes are found on chromosomes 1 and 2, and amy2 genes on chromosome 6. The barley genome has six amy1 members and three amy2 members. The wheat B genome contains four amy1 members and three amy2 members, while the rice genome has three amy1 members and one amy2 member. The B genome has mostly amy1 and amy2 members among the three wheat genomes. Amy1 promoters from all three crop genomes contain a GA-responsive complex consisting of a GA-responsive element (CAATAAA, pyrimidine box (CCTTTT and TATCCAT/C box. This study has shown that amy1 and amy2 from both wheat and barley have similar genomic properties, including exon/intron structures and GA-responsive elements on promoters, but these differ in rice. Like barley, wheat should have sufficient amy activity to degrade starch completely during malting. Other factors, such as high protein with haze issues and the lack of husk causing Lauting difficulty, may limit the use of wheat for brewing.

  4. A population-based case-cohort study of the risk of myocardial infarction following radiation therapy for breast cancer

    International Nuclear Information System (INIS)

    Paszat, Lawrence F.; Vallis, Katherine A.; Benk, Veronique M.A.; Groome, Patti A.; Mackillop, William J.; Wielgosz, Andreas

    2007-01-01

    Objective: To describe the risk of acute myocardial infarction (AMI) after radiation therapy (RT) for breast cancer (BrCa) in an exposed population. Methods: We identified and validated cases of AMI (vAMI), by electrocardiographic or enzyme criteria, among all 6680 women who received post-operative RT following lumpectomy or mastectomy, within 12 months following diagnosis of BrCa between 1982 and 1988 in Ontario, Canada. We identified women without vAMI whose death certification was ascribed to AMI (dAMI). We abstracted risk factors and treatment exposures for a random sample of women from the 6680, and for all with vAMI or dAMI. The hazards of vAMI and of dAMI were estimated using multivariate Cox proportional hazards models, corrected for study design. Results: We validated 121 cases of vAMI and identified 92 cases of dAMI. The risk of vAMI associated with RT to the left breast HR = 1.96 (1.09, 3.54) among women at age ≥ 60 at time of RT, adjusted for history of smoking and prior MI. The adjusted HR dAMI = 1.90 (1.08, 3.35) for exposure to anterior internal mammary node (IMC) RT. Among women who received anterior left breast boost RT, increasing area of the boost is associated with adjusted HR vAMI = 1.02 (1.00, 1.03)/cm 2 , and adjusted HR dAMI = 1.02 (1.01, 1.03)/cm 2 . Conclusion: The risks of vAMI and dAMI following RT for BrCa are related to anatomic sites of RT (left breast, area of anterior left breast boost field, and anterior IMC field)

  5. ejesm.v10i3.8

    African Journals Online (AJOL)

    USER

    2017-05-01

    May 1, 2017 ... Ethiopian Journal of Environmental Studies & Management 10(3): 378 ... Faculty of Basic Medical and Health Sciences, Bowen University, ... Department of Chemistry and Industrial Chemistry, Bowen ... investigated seasonal variations in well water in Iwo town, Osun ..... 5: Seasonal variation in phosphate.

  6. Download this PDF file

    African Journals Online (AJOL)

    USER

    2017-05-01

    May 1, 2017 ... Ethiopian Journal of Environmental Studies & Management 10(3): 378 ... Faculty of Basic Medical and Health Sciences, Bowen University, Iwo ... Department of Chemistry and Industrial Chemistry, Bowen ... investigated seasonal variations in well water in Iwo town, Osun ..... Figure 5 showed the pattern of.

  7. Differentiation of Self, Personal Adjustment, Problem Solving, and Ethnic Group Belonging among Persons of Color.

    Science.gov (United States)

    Skowron, Elizabeth A.

    2004-01-01

    This study focused on examining the cross-cultural validity of Bowen family systems theory (M. Bowen, 1978), namely differentiation of self for individuals of color. Ethnic minority men and women completed measures of differentiation of self, ethnic group belonging, and 3 indices of personal adjustment. Initial support for the cross-cultural…

  8. Increasing Small Arms Lethality in Afghanistan Taking Back the Infantry Half-Kilometer

    Science.gov (United States)

    2009-05-21

    John A. Malinowski , and Robert E. Bowen. "Bullet Fragmentation: A Major Cause of Tissue Disruption." JTrauma, 1984: 35-39. 67 Initial muzzle...Fackler, Martin L, M.D., M.A. John S. Surinchak, B.S. John A. Malinowski , and Robert E. Bowen. "Bullet Fragmentation: A Major Cause of Tissue

  9. Clinical and angiographic characteristics of acute myocardial infarction caused by vasospastic angina without organic coronary heart disease

    International Nuclear Information System (INIS)

    Kim, Pum-Joon; Seung, Ki-Bae; Kim, Dong-Bin

    2007-01-01

    Vasospastic angina (VA) can occasionally cause acute myocardial infarction (AMI). From January 2003 to June 2005, coronary spastic angina was diagnosed in 292 patients by performing spasm provocation tests. Among the 292 patients, 21 (7.2% of all the VA patients) had an AMI. There were 20 patients who initially visited the emergency room for AMI without suffering prior VA. One patient with a history of VA had an AMI when he discontinued his medication. Among the 21 VA patients with AMI, 14 had experienced severe emotional stress before they visited the emergency room. The spasm provocation test showed that the VA patients with AMI had more multivessel and diffuse spasm than the VA patients without AMI (p<0.001). Clinically, the VA patients with AMI usually had their first symptom of VA as the severe chest pain of AMI. Two-thirds of the VA patients with AMI had experienced emotional stress before their AMI. Angiographically, the spasm provocation test for VA patients with AMI showed more multivessel and diffuse spasm than in VA patients without AMI. (author)

  10. 78 FR 15931 - Sunshine Act Meeting; Request for Comments on Draft Evaluation of Recommended Practice on Fatigue...

    Science.gov (United States)

    2013-03-13

    ..., Attn: Amy McCormick, 2175 K Street, NW., Suite 650, Washington, DC 20037. Comments may be submitted in... establish times to review these documents at CSB headquarters, please call Amy McCormick, Board Affairs...

  11. 77 FR 9698 - Notice of Continuation of Visitor Services

    Science.gov (United States)

    2012-02-17

    ... National Parks. AMIS002-89 Lake Amistad Resort Amistad National and Marina, LLC. Recreation Area. AMIS003-87 Rough Canyon Amistad National Marina, LLC. Recreation Area. CACH001-84 White Dove, Inc., Canyon de...

  12. Review of the Afrotropical genus Dwightla McKamey (Hemiptera: Cicadellidae: Deltocephalinae: Selenocephalini) with description of a new species from Nigeria.

    Science.gov (United States)

    Lu, Lin; Zhang, Yalin

    2018-01-10

    The Afrotropical leafhopper genus Dwightla previously included five species: D. acutipennis (Linnavuori Al-Ne'amy), D. alecto (Linnavuori Al-Ne'amy), D. angolana (Linnavuori Al-Ne'amy), D. delongi Zahniser Dietrich and D. hercules (Linnavuori Al-Ne'amy). A new species, Dwightla medleri sp. nov. from Nigeria, is described and illustrated and a checklist and key to species of this genus are provided.

  13. Frontiers in biochip technology

    National Research Council Canada - National Science Library

    Xing, Wan-Li; Cheng, Jing

    2006-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . Haiching Ma, Yuan Wang, Amy S. Pomaybo, and Connie Tsai 2. Improvement of Microarray Technologies for Detecting Single Nucleotide Mismatch...

  14. A Scalable Communication Architecture for Advanced Metering Infrastructure

    OpenAIRE

    Ngo Hoang , Giang; Liquori , Luigi; Nguyen Chan , Hung

    2013-01-01

    Advanced Metering Infrastructure (AMI), seen as foundation for overall grid modernization, is an integration of many technologies that provides an intelligent connection between consumers and system operators [ami 2008]. One of the biggest challenge that AMI faces is to scalable collect and manage a huge amount of data from a large number of customers. In our paper, we address this challenge by introducing a mixed peer-to-peer (P2P) and client-server communication architecture for AMI in whic...

  15. Dicty_cDB: FC-BJ12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AEQVVKKSASLLAKLASRAKGRVLDSAIESQIG EGNFFARIT*rqgqvgkcdgyileake*nstkedskrrntnk*tyrlfys*kkkkkkkk Translated Ami...PYKQWYETHYGVVVGKKKSAKKDGEAEQVVKKSASLLAKLASRAKGRVLDSAIESQIG EGNFFARIT*rqgqvgkcdgyileake*nstkedskrrntnk*tyrlfy

  16. Dicty_cDB: SLE427 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF *immkvrqxxxiiii*q**ylnv**nlitfflmvvdlyptlkkkk*nq Translated Ami...ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF *immkvrqxxxiiii*q**ylnv

  17. Design, Construction, and Validation of Artificial MicroRNA Vectors Using Agrobacterium-Mediated Transient Expression System.

    Science.gov (United States)

    Bhagwat, Basdeo; Chi, Ming; Han, Dianwei; Tang, Haifeng; Tang, Guiliang; Xiang, Yu

    2016-01-01

    Artificial microRNA (amiRNA) technology utilizes microRNA (miRNA) biogenesis pathway to produce artificially selected small RNAs using miRNA gene backbone. It provides a feasible strategy for inducing loss of gene function, and has been applied in functional genomics study, improvement of crop quality and plant virus disease resistance. A big challenge in amiRNA applications is the unpredictability of silencing efficacy of the designed amiRNAs and not all constructed amiRNA candidates would be expressed effectively in plant cells. We and others found that high efficiency and specificity in RNA silencing can be achieved by designing amiRNAs with perfect or almost perfect sequence complementarity to their targets. In addition, we recently demonstrated that Agrobacterium-mediated transient expression system can be used to validate amiRNA constructs, which provides a simple, rapid and effective method to select highly expressible amiRNA candidates for stable genetic transformation. Here, we describe the methods for design of amiRNA candidates with perfect or almost perfect base-pairing to the target gene or gene groups, incorporation of amiRNA candidates in miR168a gene backbone by one step inverse PCR amplification, construction of plant amiRNA expression vectors, and assay of transient expression of amiRNAs in Nicotiana benthamiana through agro-infiltration, small RNA extraction, and amiRNA Northern blot.

  18. Depressive symptoms in younger women and men with acute myocardial infarction : Insights from the VIRGO Study

    NARCIS (Netherlands)

    Smolderen, Kim G.; Strait, Kelly M.; Dreyer, Rachel P.; D'Onofrio, Gail; Zhou, Shengfan; Lichtman, Judith H.; Geda, Mary; Bueno, Hector; Beltrame, John; Safdar, Basmah; Krumholz, Harlan M.; Spertus, John A.

    2015-01-01

    Background Depression was recently recognized as a risk factor for adverse medical outcomes in patients with acute myocardial infarction (AMI). The degree to which depression is present among younger patients with an AMI, the patient profile associated with being a young AMI patient with depressive

  19. Different prognostic impact of systolic function in patients with heart failure and/or acute myocardial infarction

    DEFF Research Database (Denmark)

    Thune, Jens Jakob; Carlsen, Christian; Buch, Pernille

    2005-01-01

    with either AMI or HF, a medical history and an echocardiographic assessment of left ventricular systolic function by wall motion index (WMI) were obtained. Patients were divided into four groups: AMI with or without a history of HF, and primary HF (no recent AMI) with or without a history of ischemic heart...

  20. High-sensitivity troponin assays for the early rule-out or diagnosis of acute myocardial infarction in people eith acute chest pain: a systematic review and cost-effectiveness analysis

    NARCIS (Netherlands)

    M. Westwood (Marie); T. van Asselt (Thea); B. Ramaekers (Bram); P. Whiting (Penny); P. Tokala (Praveen); M.A. Joore (Manuela); N. Armstrong (Nigel); J. Ross (Janine); J.L. Severens (Hans); J. Kleijnen (Jos)

    2015-01-01

    textabstractBackground: Early diagnosis of acute myocardial infarction (AMI) can ensure quick and effective treatment but only 20% of adults with emergency admissions for chest pain have an AMI. High-sensitivity cardiac troponin (hs-cTn) assays may allow rapid rule-out of AMI and avoidance of

  1. High-sensitivity troponin assays for the early rule-out or diagnosis of acute myocardial infarction in people with acute chest pain : a systematic review and cost-effectiveness analysis

    NARCIS (Netherlands)

    Westwood, Marie; van Asselt, Thea; Ramaekers, Bram; Whiting, Penny; Thokala, Praveen; Joore, Manuela; Armstrong, Nigel; Ross, Janine; Severens, Johan; Kleijnen, Jos

    BACKGROUND: Early diagnosis of acute myocardial infarction (AMI) can ensure quick and effective treatment but only 20% of adults with emergency admissions for chest pain have an AMI. High-sensitivity cardiac troponin (hs-cTn) assays may allow rapid rule-out of AMI and avoidance of unnecessary

  2. Presenting the networked home: a content analysis of promotion material of Ambient Intelligence applications

    NARCIS (Netherlands)

    Ben Allouch, Soumaya; van Dijk, Johannes A.G.M.; Peters, O.

    2006-01-01

    Ambient Intelligence (AmI) for the home uses information and communication technologies to make users’ everyday life more comfortable. AmI is still in its developmental phase and is headed towards the first stages of diffusion. Characteristics of AmI design can be observed, among others, in the

  3. The Acceptance of Domestic Ambient Intelligence Appliances by Prospective Users

    NARCIS (Netherlands)

    Ben Allouch, Soumaya; van Dijk, Johannes A.G.M.; Peters, O.; Tokuda, Hideyuki; Beigl, Michael; Friday, Adrian; Bernheim Brush, A.J.; Tobe, Yoshito

    2009-01-01

    Ambient intelligence (AmI) is a growing interdisciplinary area where the focus is shifted towards users instead of merely emphasizing the technological opportunities of AmI. Different methods are employed to understand the adoption of AmI appliances by users. However, these are often small-scale

  4. Equilibrium states and the ergodic theory of Anosov diffeomorphisms

    CERN Document Server

    2008-01-01

    For this printing of R. Bowen's book, J.-R. Chazottes has retyped it in TeX for easier reading, thereby correcting typos and bibliographic details. From the Preface by D. Ruelle: "Rufus Bowen has left us a masterpiece of mathematical exposition... Here a number of results which were new at the time are presented in such a clear and lucid style that Bowen's monograph immediately became a classic. More than thirty years later, many new results have been proved in this area, but the volume is as useful as ever because it remains the best introduction to the basics of the ergodic theory of hyperbolic systems."

  5. Biorhythm theory does not predict admission for acute myocardial infarction.

    Science.gov (United States)

    Joncas, Sébastien X; Carrier, Nathalie; Nguyen, Michel; Farand, Paul

    2011-02-01

    Temporal variations in the incidence of acute myocardial infarction (AMI) have been described. However, AMI occurrence and biorhythm theory, which proposes the existence of three endogenous independent infradian cycles and AMI occurrence, has not been well studied. The purpose of this study is to determine whether specific days in the biorhythm cycles are related to AMI incidence. Patients (40-85 years old) admitted for AMI at the Sherbrooke University Hospital Center, 1993-2008 were subjects of this study. Potential vulnerable days and performance days of the biorhythm cycles were calculated using birth and admission dates from the warehouse database. Observed AMI frequencies were compared to those expected using χ² tests. There were 11,395 admissions for AMI. No relation was noted between single, double, or triple critical or noncritical days and AMI (χ² = 3.78; p > 0.05). Observed and expected AMI frequencies for maximal and minimal performance days were similar (χ² = 15.06; p > 0.05). We found no evidence for a possible relationship between the date of AMI and critical maximum and minimum performance days of an individual's physical, emotional, or intellectual biorhythm cycles. We conclude that biorhythm theory does not predict admission for AMI.

  6. Acute myocardial infarction in a young bodybuilder taking anabolic androgenic steroids: A case report and critical review of the literature.

    Science.gov (United States)

    Christou, Georgios A; Christou, Konstantinos A; Nikas, Dimitrios N; Goudevenos, John A

    2016-11-01

    We describe a case report of a 30-year-old bodybuilder suffering acute myocardial infarction (AMI). He had been taking stanozolol and testosterone for two months. The coronary angiogram showed high thrombotic burden in the left anterior descending artery without underlying atherosclerosis. Few case reports of AMI in athletes taking anabolic androgenic steroids (AASs) have been reported so far. AAS-related AMI is possibly underreported in the medical literature due to the desire of the affected individuals to hide AAS use. Physicians should always consider the possibility of AAS abuse in the context of a young athlete suffering AMI. AASs can predispose to AMI through the acceleration of coronary atherosclerosis. Additionally, thrombosis without underlying atherosclerosis or vasospasm is highly possible to cause AMI in AAS users. Complications after AMI may be more frequent in AAS users. © The European Society of Cardiology 2016.

  7. Bacterial cell motility of Burkholderia gut symbiont is required to colonize the insect gut.

    Science.gov (United States)

    Lee, Jun Beom; Byeon, Jin Hee; Jang, Ho Am; Kim, Jiyeun Kate; Yoo, Jin Wook; Kikuchi, Yoshitomo; Lee, Bok Luel

    2015-09-14

    We generated a Burkholderia mutant, which is deficient of an N-acetylmuramyl-l-alanine amidase, AmiC, involved in peptidoglycan degradation. When non-motile ΔamiC mutant Burkholderia cells harboring chain form were orally administered to Riptortus insects, ΔamiC mutant cells were unable to establish symbiotic association. But, ΔamiC mutant complemented with amiC gene restored in vivo symbiotic association. ΔamiC mutant cultured in minimal medium restored their motility with single-celled morphology. When ΔamiC mutant cells harboring single-celled morphology were administered to the host insect, this mutant established normal symbiotic association, suggesting that bacterial motility is essential for the successful symbiosis between host insect and Burkholderia symbiont. Copyright © 2015 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

  8. Tips for Postpartum Dads and Partners

    Science.gov (United States)

    ... Blues: Partners Interview with Wade Bowen Coping with Suicide & Loss Tips for Postpartum Dads and Partners Pregnancy and postpartum mood and anxiety disorders affect the whole family. Here are some tips ...

  9. Parasitic diarrhoea in treatment-naïve HIV-positive patients ...

    African Journals Online (AJOL)

    2016-11-09

    Nov 9, 2016 ... (http://creativecommons.org/licenses/by/4.0) which permits unrestricted use, ... 1Department of Medical Microbiology and Parasitology, College of Health Sciences, Bowen .... in many regions of the world where HIV/AIDS.

  10. Chromosomal aberrations in Pisum sativum by magnetic field, x-rays and urea and their restitution in sucrose

    International Nuclear Information System (INIS)

    Goswami, H.K.; Dave, Neelima

    1975-01-01

    Several workers (D' Amato 1948, Bowen and Wilson 1954, Von Rosen 1957) have induced chromosomal aberrations in roots of Pisum sativum L. Present paper embodies after effect of three independent treatments and their restitution in sucrose. (auth.)

  11. Comparison of soybean evapotranspirations measured by weighing ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-07-26

    Jul 26, 2010 ... of the surface, integrating latent heat fluxes over large areas ... to determine whether Bowen ratio system could provide accurate .... glass electrode pH-meter. ... measured in soil paste using standard Wheatstone resistance.

  12. Awareness and perception of risk for cervical cancer among women ...

    African Journals Online (AJOL)

    attending Bowen University Teaching Hospital (BUTH) general outpatient clinic. Methodology: This .... the impact of current efforts at increasing awareness about cervical cancer is .... movie stars or music artists in disseminating information on.

  13. Workplace stress experienced by quantity surveyors

    African Journals Online (AJOL)

    Paul (P.A.) Bowen, Department of Construction Economics and Management,. University of Cape Town, Private ..... Explore workplace stress levels among quantity surveyors in the developing nation of ...... London: Free. Association Books.

  14. 76 FR 63909 - Draft Programmatic Environmental Impact Statement (EIS) for Modernization of Training...

    Science.gov (United States)

    2011-10-14

    ... Public Library, 75-138 Hualalai Road, Kailua-Kona; Thelma Parker Memorial Public and School Library, 67... locations for the public hearings will be published in local newspapers. Brenda S. Bowen, Army Federal...

  15. Functional properties of soy-enriched tapioca

    African Journals Online (AJOL)

    my mord

    1Department of Food Science and Technology, Bowen University, Iwo, Osun State, Nigeria. ..... a fluid. The high gelation end point of the soy tapioca samples could be as a result of .... mechanical fragmentation during heating and shear stress ...

  16. Download this PDF file

    African Journals Online (AJOL)

    Abe Olugbenga

    Material & Methods: This is a cross-sectional study of infertility cases seen at the ... ovulation induction giving the highest percentage of live births (5, 50%). ... Nigeria. Bowen University Teaching. Hospital is a young privately owned. Teaching ...

  17. Measurements and modelling of evapotransiration to assess agricultural water productivity in basins with changing land use patterns : a case study in the São Francisco River basin, Brazil

    NARCIS (Netherlands)

    Castro Teixeira, de A.H.

    2008-01-01

    Key words: Vineyards, mango, energy balance, evapotranspiration, water productivity, Bowen ratio, eddy correlation, water balance, natural vegetation, latent heat flux, sensible heat flux, biomass, water productivity, remote sensing, water management. . The São Francisco River basin in Brazil is

  18. µ µ π2 µ π2 µ π2

    African Journals Online (AJOL)

    Michael Horsfall

    1Departmement of Physics and Solar Energy, Bowen University, Iwo –Nigeria ... The interpretation of magnetic intensities of the profiles revealed a network of geological features such as ... Decane to measure the total magnetic dipoles and.

  19. Wind Speed Pattern in Nigeria (A Case Study of Some Coastal and ...

    African Journals Online (AJOL)

    ADOWIE PERE

    Department of Physics and Solar Energy, Bowen University Iwo, Osun State, Nigeria ... ABSTRACT: In this study, wind speeds were analysed using the daily wind data obtained from Nigeria ..... Selected sites from Three Geopolitical Zones in.

  20. “Factors associated with medication adherence in school-aged children with asthma.” Amy H.Y. Chan, Alistair W. Stewart, Juliet M. Foster, Edwin A. Mitchell, Carlos A. Camargo Jr and Jeff Harrison. ERJ Open Research 2016; 2: 00087-2015.

    Directory of Open Access Journals (Sweden)

    2016-04-01

    Full Text Available Unfortunately, a production error in the above article meant that the incorrect shareline (short abstract was presented alongside the main text of this article. The article has been corrected and republished with the following short abstract:

  1. Fiches pratiques: Si on jouait a la famille Dubois...; Pic et pic...et phonetique; Les rendez-vous des souvenirs; A l'ami (Practical Ideas: Let's Play House; Tick and Tick...and Phonetic; Rendezvous with Memories; To My Friend).

    Science.gov (United States)

    Bravo, Maria Antonia Lavandera; And Others

    1991-01-01

    Four activities for French language classroom use are presented, including a simulation of the relationships and communication within a family; pronunciation instruction through phonetic transcription; cultural awareness through students' analysis of their own and their parents' specific memories; and analysis and comparison of a literary text and…

  2. Le Bret, Cuigy, Casteljaloux, Bignon, Royer de Prade et Regnault des Boisclairs : du nouveau sur quelques bons amis de Cyrano et sur l’édition posthume des états et empires de la lune (1657

    Directory of Open Access Journals (Sweden)

    Madeleine Alcover

    2009-02-01

    Full Text Available This article deals mainly with Henry Le Bret, Cyrano’s friend and editor. Only Le Bret’s Parisian years are concerned here, the ones which preceeded his clerical career in Montauban.Till now very little was known of Le Bret’s Parisian period and nothing at all of his career as a « avocat au Conseil Privé du Roi ». Long investigations in Archives Nationales (Paris, CARAN, mainly in notarial deeds (Minutier Central and in Conseil Privé’s archives (series V6, as well as in Archives départementales de Tarn-et-Garonne (Montauban, allowed me to revive many of his friends and clients : in the second category can be found Bishop of Albi, Gaspard de Daillon du Lude, related to the Roquelaures, and to Cyrano through the wealthy Feydeau family ; in the first category appear many people named in Le Bret’s posthumous preface of Cyrano’s Etats et Empires de la Lune (1657, like the Cuigys, the Durets, Captain Carbon de Casteljaloux, the engraver Bignon and the dramatist and historian Royer de Prade. They were all living in a delimited area of the « Marais » (Right Bank : rues de la Verrerie, des Billettes, Sainte-Croix de la Bretonnerie, Simon Lefranc and Sainte-Avoye ; even Cyrano’s protectors were there, Regnault des Boisclairs at rue de la Verrerie, and Duke of Arpajon, whose residence partly burnt in January 1655, at Vieille rue du Temple. A precious notarial deed reveals that Le Bret was a cleric before Cyrano died, situation which should bring a new light on the making of the posthumous edition, published with numerous cuts (« lacunes » and variants ; another notarized document concerns the donation of Clamard « seigneurie » to Cuigy junior in 1656, donation which not only explains a variant of the posthumous edition but also provides an irrefutable evidence that Cyrano’s novel was altered after his death.Among the addenda completing this article are the autograph last will of Casteljaloux, written in 1642 in Clamard where he died in 1654, the donation of Clamard to Cuigy junior (1656 and a substantial repayment to Le Bret by Royer de Prade (1657 just before the former went to Montauban.

  3. On-call x-rays made easy AN Au-Yong On-call x-rays made easy , Amy Au-Yong and Nigel Broderick Churchill Livingstone Elsevier £21.99 304pp 9780702034459 0702034452 [Formula: see text].

    Science.gov (United States)

    2011-02-10

    DesigneD for clinicians involved in the management of acutely ill patients, this book enables them to recognise quickly the appearance of life-threatening conditions. It also concentrates on the interpretation of plain chest and abdominal images.

  4. Olei̇n turşusunun ami̇dləri̇ni̇n sulfat TÖRƏMƏLƏRİNİN duzlarinin SİNTEZİ və məhlullarinin XASSƏLƏRİNİN TƏDQİQİ

    OpenAIRE

    N.Ş.Rzayeva

    2014-01-01

    Olein turşusunun N-dimetil, N-dietil, N-tsikloheksilamidləri sintez edilb və onların sulfat törəmələri alınıb. Daha sonra alınmış sulfat törəmələrinin Na, K və NH4 duzları sintez olunub. Duzların izopropil spirtinin suda 30%-li məhlulunda 20%-li məhlulları hazırlanıb və fiziki-kimyəvi xassələri öyrənılıb. Məhlulların sıxlıqları bir-birinə yaxın olub 0.9431-0.9579 qr/sm3 arasında dəyişir. Məhlulların donma temperaturları amid qrupunda olan N-alkildən asılı olaraq fərqlənir. Belə ki, N-dimetil ...

  5. あわらにおけるフラックス・蒸発量観測2012

    OpenAIRE

    宇治橋, 康行; Ujihashi, Yasuyuki

    2013-01-01

    The heat fluxes and evaporation rate are observed by three methods at Awara observation site near Lake Kitagata, Awara City Fukui Prefecture in 2012. One is the water balance method using soil columns and two are meteorological methods, Bowen ratio method and eddy correlation method with heat budget equation. The measured latent heat flux by using Bowen ratio is 8.2% smaller than that of by eddy correlation method. The difference of evaporation rate between measured by soil columns and meteor...

  6. The Importance of Neurogenic Inflammation in Blast-Induced Neurotrauma

    Science.gov (United States)

    2014-05-01

    physiological dose). Even though correlation time and other phenomena are responsible for the curves behavior (intensity versus concentration is graphed...animal and that potential rarefactions from the tube opening were minimized. The neck, head, torso, and abdomen of the animal were fixed to the animal...Bowen curve of blast lethality and lung damage for mice (Bowen et al., 1968b; Richmond et al., 1967) and tested in preliminary experiments (not shown

  7. Uncommon Presentation Of Bowen′s Disease

    Directory of Open Access Journals (Sweden)

    Dawn Goutam

    1995-01-01

    Full Text Available Bowen’s disease is desired as persistent, progressive, non- elevated, red scarry or crusted plaque, which is due to an intraepidermal carcinoma and is potentially malignant. Sunlight is considered as an important aetiological factor. In the past; arsenic exposure was also said to be important 1. The curaneous lesion of Bowen’s disease can sometimes be hyperkeratotic or fissured 2. Morphology can vary depending on site of involvement.

  8. An intercomparison of surface energy flux measurement systems used during FIFE 1987

    International Nuclear Information System (INIS)

    Nie, D.; Kanemasu, E.T.; Fritschen, L.J.; Weaver, H.L.; Smith, E.A.; Verma, S.B.; Field, R.T.; Kustas, W.P.; Stewart, J.B.

    1992-01-01

    During FIFE 1987, surface energy fluxes were measured at 22 flux sites by nine groups of scientists using different measuring systems. A rover Bowen ratio station was taken to 20 of the flux stations to serve as a reference for estimating the instrument-related differences. The rover system was installed within a few meters from the host instrument of a site. Using linear regression analysis, net radiation, Bowen ratio, and latent heat fluxes were compared between the rover measurements and the host measurements. The average differences in net radiation, Bowen ratio, and latent heat flux from different types of instruments can be up to 10, 30, and 20 percent, respectively. The Didcot net radiometer gave higher net radiation while the Swissteco type showed lower values, as compared to the corrected radiation energy balance system (REBS) model. The four-way components method and the Thornthwaite type give similar values to the REBS. The surface energy radiation balance systems type Bowen ratio systems exhibit slightly lower Bowen ratios and thus higher latent heat fluxes, compared to the arid zone evapotranspiration systems. Eddy correlation systems showed slightly lower latent heat flux in comparison to the Bowen ratio systems. It is recommended that users of the flux data take these differences into account. 11 refs

  9. Expression of artificial microRNAs in transgenic Arabidopsis thaliana confers virus resistance.

    Science.gov (United States)

    Niu, Qi-Wen; Lin, Shih-Shun; Reyes, Jose Luis; Chen, Kuan-Chun; Wu, Hui-Wen; Yeh, Shyi-Dong; Chua, Nam-Hai

    2006-11-01

    Plant microRNAs (miRNAs) regulate the abundance of target mRNAs by guiding their cleavage at the sequence complementary region. We have modified an Arabidopsis thaliana miR159 precursor to express artificial miRNAs (amiRNAs) targeting viral mRNA sequences encoding two gene silencing suppressors, P69 of turnip yellow mosaic virus (TYMV) and HC-Pro of turnip mosaic virus (TuMV). Production of these amiRNAs requires A. thaliana DICER-like protein 1. Transgenic A. thaliana plants expressing amiR-P69(159) and amiR-HC-Pro(159) are specifically resistant to TYMV and TuMV, respectively. Expression of amiR-TuCP(159) targeting TuMV coat protein sequences also confers specific TuMV resistance. However, transgenic plants that express both amiR-P69(159) and amiR-HC-Pro(159) from a dimeric pre-amiR-P69(159)/amiR-HC-Pro(159) transgene are resistant to both viruses. The virus resistance trait is displayed at the cell level and is hereditable. More important, the resistance trait is maintained at 15 degrees C, a temperature that compromises small interfering RNA-mediated gene silencing. The amiRNA-mediated approach should have broad applicability for engineering multiple virus resistance in crop plants.

  10. Customization of Artificial MicroRNA Design.

    Science.gov (United States)

    Van Vu, Tien; Do, Vinh Nang

    2017-01-01

    RNAi approaches, including microRNA (miRNA) regulatory pathway, offer great tools for functional characterization of unknown genes. Moreover, the applications of artificial microRNA (amiRNA) in the field of plant transgenesis have also been advanced to engineer pathogen-resistant or trait-improved transgenic plants. Until now, despite the high potency of amiRNA approach, no commercial plant cultivar expressing amiRNAs with improved traits has been released yet. Beside the issues of biosafety policies, the specificity and efficacy of amiRNAs are of major concerns. Sufficient cares should be taken for the specificity and efficacy of amiRNAs due to their potential off-target effects and other issues relating to in vivo expression of pre-amiRNAs. For these reasons, the proper design of amiRNAs with the lowest off-target possibility is very important for successful applications of the approach in plant. Therefore, there are many studies with the aim to improve the amiRNA design and amiRNA expressing backbones for obtaining better specificity and efficacy. However, the requirement for an efficient reference for the design is still needed. In the present chapter, we attempt to summarize and discuss all the major concerns relating to amiRNA design with the hope to provide a significant guideline for this approach.

  11. Recurrent Rearrangements of Human Amylase Genes Create Multiple Independent CNV Series.

    Science.gov (United States)

    Shwan, Nzar A A; Louzada, Sandra; Yang, Fengtang; Armour, John A L

    2017-05-01

    The human amylase gene cluster includes the human salivary (AMY1) and pancreatic amylase genes (AMY2A and AMY2B), and is a highly variable and dynamic region of the genome. Copy number variation (CNV) of AMY1 has been implicated in human dietary adaptation, and in population association with obesity, but neither of these findings has been independently replicated. Despite these functional implications, the structural genomic basis of CNV has only been defined in detail very recently. In this work, we use high-resolution analysis of copy number, and analysis of segregation in trios, to define new, independent allelic series of amylase CNVs in sub-Saharan Africans, including a series of higher-order expansions of a unit consisting of one copy each of AMY1, AMY2A, and AMY2B. We use fiber-FISH (fluorescence in situ hybridization) to define unexpected complexity in the accompanying rearrangements. These findings demonstrate recurrent involvement of the amylase gene region in genomic instability, involving at least five independent rearrangements of the pancreatic amylase genes (AMY2A and AMY2B). Structural features shared by fundamentally distinct lineages strongly suggest that the common ancestral state for the human amylase cluster contained more than one, and probably three, copies of AMY1. © 2017 WILEY PERIODICALS, INC.

  12. Acute Myocardial Infarction Risk in Patients with Coronary Artery Disease Doubled after Upper Gastrointestinal Tract Bleeding: A Nationwide Nested Case-Control Study.

    Directory of Open Access Journals (Sweden)

    Chia-Jung Wu

    Full Text Available Prior studies of upper gastrointestinal bleeding (UGIB and acute myocardial infarction (AMI are small, and long-term effects of UGIB on AMI have not been delineated. We investigated whether UGIB in patients diagnosed with coronary artery disease (CAD increased their risk of subsequent AMI. This was a population-based, nested case-control study using Taiwan's National Health Insurance Research Database. After propensity-score matching for age, gender, comorbidities, CAD date, and follow-up duration, we identified 1,677 new-onset CAD patients with AMI (AMI[+] between 2001 and 2006 as the case group and 10,062 new-onset CAD patients without (AMI[-] as the control group. Conditional logistic regression was used to examine the association between UGIB and AMI. Compared with UGIB[-] patients, UGIB[+] patients had twice the risk for subsequent AMI (adjusted odds ratio [AOR] = 2.08; 95% confidence interval [CI], 1.72-2.50. In the subgroup analysis for gender and age, UGIB[+] women (AOR = 2.70; 95% CI, 2.03-3.57 and patients < 65 years old (AOR = 2.23; 95% CI, 1.56-3.18 had higher odds of an AMI. UGIB[+] AMI[+] patients used nonsignificantly less aspirin than did UGIB[-] AMI[+] patients (27.69% vs. 35.61%, respectively. UGIB increased the risk of subsequent AMI in CAD patients, especially in women and patients < 65. This suggests that physicians need to use earlier and more aggressive intervention to detect UGIB and prevent AMI in CAD patients.

  13. Predischarge maximal exercise test identifies risk for cardiac death in patients with acute myocardial infarction

    DEFF Research Database (Denmark)

    Nielsen, J R; Mickley, H; Damsgaard, E M

    1990-01-01

    A maximal exercise test was performed in 54 patients with acute myocardial infarction (AMI) before discharge and in 49 age-matched control subjects. The long-term prognosis was assessed after an average follow-up of 7.6 years in AMI patients and 5.8 years in control subjects. The maximal work...... capacity and systolic blood pressure increase in AMI patients was 59% that of control subjects (p less than 0.001). Seventeen AMI patients had significant ST-segment shifts, 13 with ST depression and 4 with ST elevation. In AMI patients experiencing a cardiac death during follow-up the maximal work...... were of no significant value. In this study maximal work capacity turned out to be the best single exercise variable for identifying groups of AMI patients with very low and relative high risk of cardiac death. When all 3 exercise variables were combined, the predischarge maximal exercise test...

  14. Prevalence of aspirin resistance in patients with an evolving acute myocardial infarction

    DEFF Research Database (Denmark)

    Poulsen, Tina Svenstrup; Jørgensen, Bo; Korsholm, Lars

    2007-01-01

    OBJECTIVE: To study the prevalence and importance of aspirin resistance in patients with an evolving acute myocardial infarction (AMI) by use of the Platelet Function Analyzer-100. INTRODUCTION: Previous studies have demonstrated the existence of aspirin resistance, but the clinical relevance...... of the phenomenon remains to be clarified. If aspirin resistant patients comprise a high-risk subgroup, it might be expected that the prevalence of aspirin resistance in patients with AMI would be higher than in patients without AMI. We hypothesized that the prevalence of aspirin resistance in patients with AMI...... was twice the prevalence in patients without AMI. METHODS: We included 298 consecutive patients with known cardiovascular disease who were admitted to hospital with symptoms suggestive of an AMI. All had been taking aspirin 150 mg/day for at least 7 days prior to hospital admission. Platelet function...

  15. The Annual American Men's Internet Survey of Behaviors of Men Who have Sex with Men in the United States: 2014 Key Indicators Report.

    Science.gov (United States)

    Sanchez, Travis; Zlotorzynska, Maria; Sineath, Craig; Kahle, Erin; Sullivan, Patrick

    2016-05-25

    The American Men's Internet Survey (AMIS) is an annual Web-based behavioral survey of men who have sex with men (MSM) who live in the United States. The purpose of this Rapid Surveillance Report is to report on the second cycle of data collection (November 2014 through April 2015; AMIS-2014) on the same key indicators previously reported for AMIS (December 2013 through May 2014; AMIS-2013). The AMIS survey methodology has not substantively changed since AMIS-2013. MSM were recruited from a variety of websites using banner advertisements or email blasts. Adult men currently residing in the United States were eligible to participate if they had ever had sex with a man. We examined demographic and recruitment characteristics using multivariable regression modeling (Prisk behaviors but were more likely to have been HIV tested, STI tested, and diagnosed with an STI.

  16. Do Japanese workers who experience an acute myocardial infarction believe their prolonged working hours are a cause?

    Science.gov (United States)

    Fukuoka, Yoshimi; Dracup, Kathleen; Froelicher, Erika Sivarajan; Ohno, Miyoshi; Hirayama, Haruo; Shiina, Hiromi; Kobayashi, Fumio

    2005-04-08

    Cardiovascular disease related to excessive work/job stress has been a significant social concern for the Japanese public. Therefore, we conducted a cross-sectional study to (1) compare job stress levels between patients with acute myocardial infarction (AMI) patients and healthy workers, and (2) examine the types of stresses associated with patients' causal belief of AMI among patients with AMI. Forty-seven patients admitted to the hospital with AMI and 47 healthy workers visiting a hospital for their annual physical examination were recruited in Japan. Both groups were employed full time and matched on age and gender. Job stress was assessed by the Brief Job Stress Questionnaire, which consists of four subscales: job demand, job control, support from supervisors, and support from coworkers. Causal belief was assessed by a semi-structured interview. Compared with healthy workers (50.7+/-8.6 h), AMI patients worked significantly longer hours per week (58.3+/-15.0 h) prior to their AMI. Among AMI patients, 38% reported that job stress might have contributed to their AMI. AMI patients who reported acute stressful events at work during the month prior to AMI were 6.88 times (95% CI: 1.84, 25.75) more likely to believe that job stress/overwork caused their AMI after controlling for working hours per week and age. Like other known cardiac risk factors, it is important for clinicians to assess patient's excessive working hours. The education and counseling of patients following AMI must take into consideration long working hours, acute stressful events at work, and the patient's perceived view of job stress.

  17. <Symposium I>Genetic dissection of age-related memory impairment in Drosophila

    OpenAIRE

    Yamazaki, Daisuke; Horiuchi, Junjiro; Saitoe, Minoru

    2010-01-01

    Age-related memory impairment (AMI) is an important phenotype of brain aging. Understandingthe molecular mechanisms underlying AMI is important not only from a scientific viewpoint but also for thedevelopment of therapeutics that may eventually lead to developing drugs to combat memory loss. AMI has beengenerally considered to be an overall or nonspecifi c decay of memory processes that results from dysfunction ofneural networks. However, extensive behavioral genetic characterization of AMI w...

  18. Audio interfaces should be designed based on data visualisation first principles

    OpenAIRE

    Dewey, Christopher; Wakefield, Jonathan P.

    2016-01-01

    Audio mixing interfaces (AMIs) commonly conform to a small number of paradigms. These paradigms have\\ud significant shortcomings. Data visualisation first principles should be employed to consider alternatives. Existing AMI\\ud paradigms are discussed and concepts of image theory and elementary perceptual elements outlined. AMIs should be evaluated by usability experiments however performing these properly is time-consuming. There are many data visualisation options and combinations. Collabora...

  19. The Causes and Prospect of the Southern Philippines Secessionist Movement

    Science.gov (United States)

    2003-12-01

    Philippines: An Historical Perspective,” in Peter G. Glowing and Robert D. McAmis, eds., The Filipino Muslim (Manila: Solidaridad Publishing House, 1974...Maguindanao,” in Peter G. Glowing and Robert D. McAmis, eds., The Filipino Muslim (Manila: Solidaridad Publishing House, 1974), 185. 31 day Yemen...Muslims,” in Peter G. Glowing and Robert D. McAmis, eds., The Filipino Muslim (Manila: Solidaridad Publishing House, 1974), 281. 86 Mamitua Saber

  20. Mechanism of amitriptyline adsorption on Ca-montmorillonite (SAz-2)

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Po-Hsiang [Department of Earth Sciences, National Cheng Kung University, 1 University Road, Tainan 70101, Taiwan (China); Jiang, Wei-Teh, E-mail: atwtj@mail.ncku.edu.tw [Department of Earth Sciences, National Cheng Kung University, 1 University Road, Tainan 70101, Taiwan (China); Li, Zhaohui, E-mail: li@uwp.edu [Department of Geosciences, University of Wisconsin – Parkside, 900 Wood Road, Kenosha, WI 53144 (United States); Kuo, Chung-Yih [Department of Public Health, College of Health Care and Management, Chung Shan Medical University, No. 110, Sec. 1, Chien-kuo N Road, Taichung 40242, Taiwan (China); Jean, Jiin-Shuh [Department of Earth Sciences, National Cheng Kung University, 1 University Road, Tainan 70101, Taiwan (China); Chen, Wan-Ru [Department of Environmental Engineering, National Cheng Kung University, 1 University Road, Tainan 70101, Taiwan (China); Lv, Guocheng [School of Materials Science and Technology, China University of Geosciences, Beijing 100083 (China)

    2014-07-30

    Graphical abstract: XRD patterns to show AMI intercalation into SAz-2 vs. direct mixing of the same amount of AMI with SAz-2. - Highlights: • Ca-montmorillonite is proven to be an efficient adsorbent or sink for amitriptyline. • The high adsorption capacity is accompanied with intercalation into interlayers. • The adsorption is mainly governed by a cation exchange mechanism. • Horizontal mono- and bi-layer conformations occur at low and high adsorption levels. • The process is an endothermic physisorption at high adsorption levels. - Abstract: The uptake of amitriptyline (AMI) from aqueous environment by Ca-montmorillonite (SAz-2) was studied in a batch system under different physicochemical conditions. The adsorbent was characterized by X-ray diffraction and Fourier transform infrared (FTIR) analyses. The AMI adsorption on SAz-2 obeyed the Langmuir isotherm with a capacity of 330 mg/g (1.05 mmol/g) at pH 6–7. The adsorption kinetics was fast, almost reaching equilibrium in 2 h, and followed a pseudo-second-order kinetic model. Desorption of exchangeable cations correlated with the AMI adsorption well, indicating that cation exchange was the major mechanism. X-ray diffraction patterns showing significant expansions of the d{sub 0} {sub 0} {sub 1} spacing and characteristic FTIR band shifts toward higher frequencies after AMI adsorption onto SAz-2 indicated that the adsorbed AMI molecules were intercalated into the interlayers of the mineral. Thermodynamic parameters based on partitioning coefficients suggested that the AMI adsorption was an endothermic physisorption at high adsorption levels. At low and higher AMI adsorption levels, the intercalated AMI molecules take a horizontal monolayer and bilayer conformation, respectively. The higher adsorption capacity suggested that SAz-2 could be a good candidate to remove AMI from wastewater and would be an important environmental sink for the fate and transport of AMI in soils and groundwater.

  1. Scalable Multi-group Key Management for Advanced Metering Infrastructure

    OpenAIRE

    Benmalek , Mourad; Challal , Yacine; Bouabdallah , Abdelmadjid

    2015-01-01

    International audience; Advanced Metering Infrastructure (AMI) is composed of systems and networks to incorporate changes for modernizing the electricity grid, reduce peak loads, and meet energy efficiency targets. AMI is a privileged target for security attacks with potentially great damage against infrastructures and privacy. For this reason, Key Management has been identified as one of the most challenging topics in AMI development. In this paper, we propose a new Scalable multi-group key ...

  2. Review of Cyber-Physical Attacks and Counter Defense Mechanisms for Advanced Metering Infrastructure in Smart Grid

    OpenAIRE

    Wei, Longfei; Rondon, Luis Puche; Moghadasi, Amir; Sarwat, Arif I.

    2018-01-01

    The Advanced Metering Infrastructure (AMI) is a vital element in the current development of the smart grid. AMI technologies provide electric utilities with an effective way of continuous monitoring and remote control of smart grid components. However, owing to its increasing scale and cyber-physical nature, the AMI has been faced with security threats in both cyber and physical domains. This paper provides a comprehensive review of the crucial cyber-physical attacks and counter defense mecha...

  3. Mechanism of amitriptyline adsorption on Ca-montmorillonite (SAz-2)

    International Nuclear Information System (INIS)

    Chang, Po-Hsiang; Jiang, Wei-Teh; Li, Zhaohui; Kuo, Chung-Yih; Jean, Jiin-Shuh; Chen, Wan-Ru; Lv, Guocheng

    2014-01-01

    Graphical abstract: XRD patterns to show AMI intercalation into SAz-2 vs. direct mixing of the same amount of AMI with SAz-2. - Highlights: • Ca-montmorillonite is proven to be an efficient adsorbent or sink for amitriptyline. • The high adsorption capacity is accompanied with intercalation into interlayers. • The adsorption is mainly governed by a cation exchange mechanism. • Horizontal mono- and bi-layer conformations occur at low and high adsorption levels. • The process is an endothermic physisorption at high adsorption levels. - Abstract: The uptake of amitriptyline (AMI) from aqueous environment by Ca-montmorillonite (SAz-2) was studied in a batch system under different physicochemical conditions. The adsorbent was characterized by X-ray diffraction and Fourier transform infrared (FTIR) analyses. The AMI adsorption on SAz-2 obeyed the Langmuir isotherm with a capacity of 330 mg/g (1.05 mmol/g) at pH 6–7. The adsorption kinetics was fast, almost reaching equilibrium in 2 h, and followed a pseudo-second-order kinetic model. Desorption of exchangeable cations correlated with the AMI adsorption well, indicating that cation exchange was the major mechanism. X-ray diffraction patterns showing significant expansions of the d 0 0 1 spacing and characteristic FTIR band shifts toward higher frequencies after AMI adsorption onto SAz-2 indicated that the adsorbed AMI molecules were intercalated into the interlayers of the mineral. Thermodynamic parameters based on partitioning coefficients suggested that the AMI adsorption was an endothermic physisorption at high adsorption levels. At low and higher AMI adsorption levels, the intercalated AMI molecules take a horizontal monolayer and bilayer conformation, respectively. The higher adsorption capacity suggested that SAz-2 could be a good candidate to remove AMI from wastewater and would be an important environmental sink for the fate and transport of AMI in soils and groundwater

  4. Recovery from Hospital-Acquired Anemia after Acute Myocardial Infarction and Effect on Outcomes

    OpenAIRE

    Salisbury, Adam C.; Kosiborod, Mikhail; Amin, Amit P.; Reid, Kimberly J.; Alexander, Karen P.; Spertus, John A.; Masoudi, Frederick A.

    2011-01-01

    New onset, hospital-acquired anemia (HAA) during acute myocardial infarction (AMI) is independently associated with poor outcomes. Patterns of recovery from HAA after AMI and their association with mortality and health status are unknown. In the prospective 24-center TRIUMPH registry, we identified 530 AMI patients with HAA (defined as normal hemoglobin at admission with development of anemia by discharge) who had repeat, protocol-driven hemoglobin measurement 1 month after discharge. The 1-m...

  5. Topical amitriptyline and ketamine for post-herpetic neuralgia and other forms of neuropathic pain.

    Science.gov (United States)

    Sawynok, Jana; Zinger, Celia

    2016-01-01

    Neuropathic pain (NP) has several therapeutic options but efficacy is limited and adverse effects occur, such that additional treatment options are needed. A topical formulation containing amitriptyline 4% and ketamine 2% (AmiKet) may provide such an option. This report summarizes both published and unpublished results of clinical trials with AmiKet. In post-herpetic neuralgia (PHN), AmiKet produces a significant analgesia which is comparable to that produced by oral gabapentin. In diabetic painful neuropathy, AmiKet showed a strong trend towards pain reduction. In mixed neuropathic pain, case series reports suggest a favourable response rate, but are limited by trial characteristics. AmiKet is absorbed minimally following topical administration. Over 700 patients have now received topical AmiKet in clinical regimens, and it is well-tolerated with the adverse effects mainly being application site reactions. Both agents are polymodal, and several mechanisms may contribute to the peripheral efficacy of AmiKet. Topical AmiKet has the potential to be a first-line treatment option for PHN, and to be useful in other NP conditions. Furthermore, AmiKet has the potential to be an adjunct to systemic therapies, with the targeting of a peripheral compartment in addition to central sites of action representing a rational drug combination.

  6. UNDERSTANDING SEVERE WEATHER PROCESSES THROUGH SPATIOTEMPORAL RELATIONAL RANDOM FORESTS

    Data.gov (United States)

    National Aeronautics and Space Administration — UNDERSTANDING SEVERE WEATHER PROCESSES THROUGH SPATIOTEMPORAL RELATIONAL RANDOM FORESTS AMY MCGOVERN, TIMOTHY SUPINIE, DAVID JOHN GAGNE II, NATHANIEL TROUTMAN,...

  7. Technical and governance considerations for advanced metering infrastructure/smart meters: Technology, security, uncertainty, costs, benefits, and risks

    International Nuclear Information System (INIS)

    McHenry, Mark P.

    2013-01-01

    The fundamental role of policymakers when considering Advanced Metering Infrastructure (AMI), or ‘smart meters for energy and water infrastructure is to investigate a broad range of complex interrelated issues. These include alternative technical and non-technical options and deployment needs, the cost and benefits of the infrastructure (risks and mitigation measures), and the impact of a number of stakeholders: consumers, distributors, retailers, competitive market operators, competing technology companies, etc. The scale and number of potential variables in the AMI space is an almost unprecedented challenge to policymakers, with the anticipation of new ancillary products and services, associated market contestability, related regulatory and policy amendments, and the adequacy of consumer protection, education, and safety considerations requiring utmost due-diligence. Embarking on AMI investment entails significant technical, implementation, and strategic risk for governments and administering bodies, and an active effort is required to ensure AMI governance and planning maximises the potential benefits, and minimise uncertainties, costs, and risks to stakeholders. This work seeks to clarify AMI fundamentals and discusses the technical and related governance considerations from a dispassionate perspective, yet acknowledges many stakeholders tend to dichotomise debate, and obfuscate both advantages and benefits, and the converse. - Highlights: • AMI presents an almost unprecedented technical and governance policy challenge. • AMI enables vertical integration of electricity, gas, water, IT, and telco entities • AMI investments involve major technical, implementation, and strategic decisions. • Adequacy of consumer education, safety, privacy, and protection is paramount. • Policy must maximise AMI benefits and minimise uncertainties, costs, and risks

  8. Dicty_cDB: SSL830 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lvsyttflgatkyhl**y*ss*cqssws m*remcdkiigdddyfkwlpgggwwstlcgcftalvasmftfashr*ikkslkvfrfdll kkk Translated Ami...sscvwnssvpncprlplvtaplvsyttflgatkyhl**y*ss*cqssws m*remcdkiigdddyfkwlpgggwwstlcgcftalvasmftfashr*ikkslkvfrfd

  9. Prognostic Impact of In-Hospital and Postdischarge Heart Failure in Patients With Acute Myocardial Infarction

    DEFF Research Database (Denmark)

    Sulo, Gerhard; Igland, Jannicke; Nygård, Ottar

    2017-01-01

    Background: Heart failure (HF) is a serious complication of acute myocardial infarction (AMI). We explored the excess mortality associated with HF as an early or late complication of AMI and describe changes over time in such excess mortality. Methods and Results: All patients hospitalized with a...... or late complication of AMI—has a negative impact on patients' survival. Changes in the excess mortality associated with HF are driven by modest improvements in survival among AMI patients with HF as compared to those without HF.......Background: Heart failure (HF) is a serious complication of acute myocardial infarction (AMI). We explored the excess mortality associated with HF as an early or late complication of AMI and describe changes over time in such excess mortality. Methods and Results: All patients hospitalized...... with an incident AMI and without history of prior HF hospitalization were followed up to 1 year after AMI discharge for episodes of HF. New HF episodes were classified as in‐hospital HF if diagnosed during the AMI hospitalization or postdischarge HF if diagnosed within 1 year after discharge from the incident AMI...

  10. The Gravitation of the Moon Plays Pivotal Roles in the Occurrence of the Acute Myocardial Infarction

    Directory of Open Access Journals (Sweden)

    Ryotaro Wake

    2008-01-01

    Full Text Available Acute myocardial infarction (AMI is a social burden. However, being able to predict AMI could lead to prevention. A previous study showed only the relation between the lunar phase and the occurrence of AMI, but the period it takes for the moon to orbit around the earth and the period of the lunar phase differ. This study investigated the effect of the gravitation of the moon on AMI. Data was comprised of 1369 consecutive patients with first AMI at 5 hospitals from October, 1984 to December, 1997. The universal gravitation of the moon was calculated and compared to the earth onset time of AMI. Universal gravitation of the moon was derived by G*m/d2 (G: universal gravitation constant, m: the mass of the moon, d: the distance between the center of the moon and the center of the earth. The relationship between m/d2 and the cases of AMI was determined. There was an increase in cases, when there is a distance of more than 399864 km from the center of the earth to the center of the moon. The gravitation of more than 399864 km was determined to be weaker gravitation. It is confirmed that the number of AMI patients significantly increases at weaker gravitation periods in this multicenter trial. In conclusion, these results suggest that the gravitation of the moon may have an influence on the occurrence of AMI.

  11. Food allergy

    National Research Council Canada - National Science Library

    Maleki, Soheila J; Burks, A. Wesley; Helm, Ricki M

    2006-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . vii ix I. CLINICAL ASPECTS 1. Clinical Manifestations of Food Allergic Disease * Tamara T. Perry, Amy M. Scurlock, and Stacie M. Jones...

  12. 77 FR 68114 - Notice of Extension of Comment Period for the Draft Environmental Impact Statement for Military...

    Science.gov (United States)

    2012-11-15

    ... may be submitted in writing to Naval Facilities Engineering Command Northwest, Attention: Mrs. Amy... Facilities Engineering Command Northwest, 1101 Tautog Circle Suite 203, Silverdale, Washington, 98315-1101...

  13. Trends in mortality, incidence and case fatality of ischaemic heart disease in Denmark, 1982-1992

    DEFF Research Database (Denmark)

    Osler, M; Sørensen, Thorkild I.A.; Sørensen, S

    1996-01-01

    identified. Cases of AMI and IHD were considered as incident cases if no admission for these diagnoses had occurred during the preceding 5 years. Sex-specific, age-standardized annual mortality, incidence and case-fatality rates of AMI (ICD8 code 410), narrowly defined IHD (NIHD, ICD8 codes 410-4......) and broadly defined IHD (BIHD, ICD8 codes 410-4, 427 and 795-6) were calculated for the period 1982-1992. RESULTS: During the entire period the age-standardized mortality of AMI, NIHD and BIHD decreased in both men and women. The incidence of AMI and NIHD decreased, while the incidence of BIHD remained...

  14. Dicty_cDB: VSB406 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GTVRKAIARVLTVFNQTQKNHLR XVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFAVKA*ici* milknkiy Translated Ami...RRLTNKQSKVVTLRVSKTATNFPQRVFAVKA*ici* milknkiy Homology vs CSM-cDNA Score E Sequences producing significant a

  15. Enzymatic properties and primary structures of two α-amylase isozymes from the Pacific abalone Haliotis discus hannai

    OpenAIRE

    Kumagai, Yuya; Satoh, Takuya; Inoue, Akira; Ojima, Takao

    2013-01-01

    Two α-amylase (EC 3.2.1.1) isozymes, HdAmy58 and HdAmy82, with approximate molecular masses of 58 kDa and 82 kDa, respectively, were isolated from the digestive fluid of the Pacific abalone Haliotis discus hannai. Optimal temperatures and pHs for HdAmy58 and HdAmy82 were at 30℃ and 6.7, and 30℃ and 6.1, respectively. Both enzymes similarly degraded starch, glycogen, and maltooligosaccharides larger than maltotriose producing maltose and maltotriose as the major degradation products. However, ...

  16. Aspergillus oryzae S2 alpha-amylase production under solid state fermentation: optimization of culture conditions.

    Science.gov (United States)

    Sahnoun, Mouna; Kriaa, Mouna; Elgharbi, Fatma; Ayadi, Dorra-Zouari; Bejar, Samir; Kammoun, Radhouane

    2015-04-01

    Aspergillus oryzae S2 was assayed for alpha-amylase production under solid state fermentation (SSF). In addition to AmyA and AmyB already produced in monitored submerged culture, the strain was noted to produce new AmyB oligomeric forms, in particular a dominant tetrameric form named AmyC. The latter was purified to homogeneity through fractional acetone precipitation and size exclusion chromatography. SDS-PAGE and native PAGE analyses revealed that, purified AmyC was an approximately 172 kDa tetramer of four 42 kDa subunits. AmyC was also noted to display the same NH2-terminal amino acid sequence residues and approximately the same physico-chemical properties of AmyA and AmyB, to exhibit maximum activity at pH 5.6 and 60 °C, and to produce maltose and maltotriose as major starch hydrolysis end-products. Soyabean meal was the best substitute to yeast extract compared to fish powder waste and wheat gluten waste. AmyC production was optimized under SSF using statistical design methodology. Moisture content of 76.25%, C/N substrate ratio of 0.62, and inoculum size of 10(6.87) spores allowed maximum activity of 22118.34 U/g of dried substrate, which was 33 times higher than the one obtained before the application of the central composite design (CCD). Copyright © 2015 Elsevier B.V. All rights reserved.

  17. Spousal depression, anxiety, and suicide after myocardial infarction

    DEFF Research Database (Denmark)

    Fosbøl, Emil L; Peterson, Eric D; Weeke, Peter

    2013-01-01

    or non-fatal AMI. Married patients with fatal or non-fatal AMI (1997-2008) were matched with their counterparts dying or hospitalized with a non-AMI cause; incident use of antidepressants and benzodiazepines, incident depression care, and suicides were compared pre- and post-event using Poisson models...... and benzodiazepine initiation (IRR 1.5 vs. 1.1, and 6.7 vs. 1.3, respectively, Pdepression and suicide. Male individuals whose spouse had a fatal or non-fatal AMI had a relatively higher increased risk of depression than female individuals...

  18. Role of Two Cell Wall Amidases in Septal Junction and Nanopore Formation in the Multicellular Cyanobacterium Anabaena sp. PCC 7120

    Directory of Open Access Journals (Sweden)

    Jan Bornikoel

    2017-09-01

    Full Text Available Filamentous cyanobacteria have developed a strategy to perform incompatible processes in one filament by differentiating specialized cell types, N2-fixing heterocysts and CO2-fixing, photosynthetic, vegetative cells. These bacteria can be considered true multicellular organisms with cells exchanging metabolites and signaling molecules via septal junctions, involving the SepJ and FraCD proteins. Previously, it was shown that the cell wall lytic N-acetylmuramyl-L-alanine amidase, AmiC2, is essential for cell–cell communication in Nostoc punctiforme. This enzyme perforates the septal peptidoglycan creating an array of nanopores, which may be the framework for septal junction complexes. In Anabaena sp. PCC 7120, two homologs of AmiC2, encoded by amiC1 and amiC2, were identified and investigated in two different studies. Here, we compare the function of both AmiC proteins by characterizing different Anabaena amiC mutants, which was not possible in N. punctiforme, because there the amiC1 gene could not be inactivated. This study shows the different impact of each protein on nanopore array formation, the process of cell–cell communication, septal protein localization, and heterocyst differentiation. Inactivation of either amidase resulted in significant reduction in nanopore count and in the rate of fluorescent tracer exchange between neighboring cells measured by FRAP analysis. In an amiC1 amiC2 double mutant, filament morphology was affected and heterocyst differentiation was abolished. Furthermore, the inactivation of amiC1 influenced SepJ localization and prevented the filament-fragmentation phenotype that is characteristic of sepJ or fraC fraD mutants. Our findings suggest that both amidases are to some extent redundant in their function, and describe a functional relationship of AmiC1 and septal proteins SepJ and FraCD.

  19. 3D Echo pilot study of geometric left ventricular changes after acute myocardial infarction.

    Science.gov (United States)

    Vieira, Marcelo Luiz Campos; Oliveira, Wercules Antonio; Cordovil, Adriana; Rodrigues, Ana Clara Tude; Mônaco, Cláudia Gianini; Afonso, Tânia; Lira Filho, Edgar Bezerra; Perin, Marco; Fischer, Cláudio Henrique; Morhy, Samira Saady

    2013-07-01

    Left ventricular remodeling (LVR) after AMI characterizes a factor of poor prognosis. There is little information in the literature on the LVR analyzed with three-dimensional echocardiography (3D ECHO). To analyze, with 3D ECHO, the geometric and volumetric modifications of the left ventricle (VE) six months after AMI in patients subjected to percutaneous primary treatment. Prospective study with 3D ECHO of 21 subjects (16 men, 56 ± 12 years-old), affected by AMI with ST segment elevation. The morphological and functional analysis (LV) with 3D ECHO (volumes, LVEF, 3D sphericity index) was carried out up to seven days and six months after the AMI. The LVR was considered for increase > 15% of the end diastolic volume of the LV (LVEDV) six months after the AMI, compared to the LVEDV up to seven days from the event. Eight (38%) patients have presented LVR. Echocardiographic measurements (n = 21 patients): I- up to seven days after the AMI: 1- LVEDV: 92.3 ± 22.3 mL; 2- LVEF: 0.51 ± 0.01; 3- sphericity index: 0.38 ± 0.05; II- after six months: 1- LVEDV: 107.3 ± 26.8 mL; 2- LVEF: 0.59 ± 0.01; 3- sphericity index: 0.31 ± 0.05. Correlation coefficient (r) between the sphericity index up to seven days after the AMI and the LVEDV at six months (n = 8) after the AMI: r: 0.74, p = 0.0007; (r) between the sphericity index six months after the AMI and the LVEDV at six months after the AMI: r: 0.85, p series, LVR has been observed in 38% of the patients six months after the AMI. The three-dimensional sphericity index has been associated to the occurrence of LVR.

  20. Recreational Marijuana Use and Acute Myocardial Infarction: Insights from Nationwide Inpatient Sample in the United States.

    Science.gov (United States)

    Desai, Rupak; Patel, Upenkumar; Sharma, Shobhit; Amin, Parth; Bhuva, Rushikkumar; Patel, Malav S; Sharma, Nitin; Shah, Manan; Patel, Smit; Savani, Sejal; Batra, Neha; Kumar, Gautam

    2017-11-03

    Background Marijuana is a widely used recreational substance. Few cases have been reported of acute myocardial infarction following marijuana use. To our knowledge, this is the first ever study analyzing the lifetime odds of acute myocardial infarction (AMI) with marijuana use and the outcomes in AMI patients with versus without marijuana use. Methods We queried the 2010-2014 National Inpatient Sample (NIS) database for 11-70-year-old AMI patients. Pearson Chi-square test for categorical variables and Student T-test for continuous variables were used to compare the baseline demographic and hospital characteristics between two groups (without vs. with marijuana) of AMI patients. The univariate and multivariate analyses were used to assess and compare the clinical outcomes between two groups. We used Cochran-Armitage test to measure the trends. All statistical analyses were executed by IBM SPSS Statistics 22.0 (IBM Corp., Armonk, NY). We used weighted data to produce national estimates in our study. Results Out of 2,451,933 weighted hospitalized AMI patients, 35,771 patients with a history of marijuana and 2,416,162 patients without a history of marijuana use were identified. The AMI-marijuana group consisted more of younger, male, African American patients. The length of stay and mortality rate were lower in the AMI-marijuana group with more patients being discharged against medical advice. Multivariable analysis showed that marijuana use was a significant risk factor for AMI development when adjusted for age, sex, race (adjusted OR 1.079, 95% CI 1.065-1.093, pmarijuana group. Conclusion The lifetime AMI odds were increased in recreational marijuana users. Overall odds of mortality were not increased significantly in AMI-marijuana group. However, marijuana users showed higher trends of AMI prevalence and related mortality from 2010-2014. It is crucial to assess cardiovascular effects related to marijuana overuse and educate patients for the same.

  1. Predicting the influence of long-range molecular interactions on macroscopic-scale diffusion by homogenization of the Smoluchowski equation

    Energy Technology Data Exchange (ETDEWEB)

    Kekenes-Huskey, P. M., E-mail: pkekeneshuskey@ucsd.edu [Department of Pharmacology, University of California San Diego, La Jolla, California 92093-0636 (United States); Gillette, A. K. [Department of Mathematics, University of Arizona, Tucson, Arizona 85721-0089 (United States); McCammon, J. A. [Department of Pharmacology, University of California San Diego, La Jolla, California 92093-0636 (United States); Department of Chemistry, Howard Hughes Medical Institute, University of California San Diego, La Jolla, California 92093-0636 (United States)

    2014-05-07

    The macroscopic diffusion constant for a charged diffuser is in part dependent on (1) the volume excluded by solute “obstacles” and (2) long-range interactions between those obstacles and the diffuser. Increasing excluded volume reduces transport of the diffuser, while long-range interactions can either increase or decrease diffusivity, depending on the nature of the potential. We previously demonstrated [P. M. Kekenes-Huskey et al., Biophys. J. 105, 2130 (2013)] using homogenization theory that the configuration of molecular-scale obstacles can both hinder diffusion and induce diffusional anisotropy for small ions. As the density of molecular obstacles increases, van der Waals (vdW) and electrostatic interactions between obstacle and a diffuser become significant and can strongly influence the latter's diffusivity, which was neglected in our original model. Here, we extend this methodology to include a fixed (time-independent) potential of mean force, through homogenization of the Smoluchowski equation. We consider the diffusion of ions in crowded, hydrophilic environments at physiological ionic strengths and find that electrostatic and vdW interactions can enhance or depress effective diffusion rates for attractive or repulsive forces, respectively. Additionally, we show that the observed diffusion rate may be reduced independent of non-specific electrostatic and vdW interactions by treating obstacles that exhibit specific binding interactions as “buffers” that absorb free diffusers. Finally, we demonstrate that effective diffusion rates are sensitive to distribution of surface charge on a globular protein, Troponin C, suggesting that the use of molecular structures with atomistic-scale resolution can account for electrostatic influences on substrate transport. This approach offers new insight into the influence of molecular-scale, long-range interactions on transport of charged species, particularly for diffusion-influenced signaling events

  2. Comparison of newer-generation drug-eluting with bare-metal stents in patients with acute ST-segment elevation myocardial infarction: a pooled analysis of the EXAMINATION (clinical Evaluation of the Xience-V stent in Acute Myocardial INfArcTION) and COMFORTABLE-AMI (Comparison of Biolimus Eluted From an Erodible Stent Coating With Bare Metal Stents in Acute ST-Elevation Myocardial Infarction) trials.

    Science.gov (United States)

    Sabaté, Manel; Räber, Lorenz; Heg, Dik; Brugaletta, Salvatore; Kelbaek, Henning; Cequier, Angel; Ostojic, Miodrag; Iñiguez, Andrés; Tüller, David; Serra, Antonio; Baumbach, Andreas; von Birgelen, Clemens; Hernandez-Antolin, Rosana; Roffi, Marco; Mainar, Vicente; Valgimigli, Marco; Serruys, Patrick W; Jüni, Peter; Windecker, Stephan

    2014-01-01

    This study sought to study the efficacy and safety of newer-generation drug-eluting stents (DES) compared with bare-metal stents (BMS) in an appropriately powered population of patients with ST-segment elevation myocardial infarction (STEMI). Among patients with STEMI, early generation DES improved efficacy but not safety compared with BMS. Newer-generation DES, everolimus-eluting stents, and biolimus A9-eluting stents, have been shown to improve clinical outcomes compared with early generation DES. Individual patient data for 2,665 STEMI patients enrolled in 2 large-scale randomized clinical trials comparing newer-generation DES with BMS were pooled: 1,326 patients received a newer-generation DES (everolimus-eluting stent or biolimus A9-eluting stent), whereas the remaining 1,329 patients received a BMS. Random-effects models were used to assess differences between the 2 groups for the device-oriented composite endpoint of cardiac death, target-vessel reinfarction, and target-lesion revascularization and the patient-oriented composite endpoint of all-cause death, any infarction, and any revascularization at 1 year. Newer-generation DES substantially reduce the risk of the device-oriented composite endpoint compared with BMS at 1 year (relative risk [RR]: 0.58; 95% confidence interval [CI]: 0.43 to 0.79; p = 0.0004). Similarly, the risk of the patient-oriented composite endpoint was lower with newer-generation DES than BMS (RR: 0.78; 95% CI: 0.63 to 0.96; p = 0.02). Differences in favor of newer-generation DES were driven by both a lower risk of repeat revascularization of the target lesion (RR: 0.33; 95% CI: 0.20 to 0.52; p stent thrombosis (RR: 0.35; 95% CI: 0.16 to 0.75; p = 0.006) compared with BMS. Among patients with STEMI, newer-generation DES improve safety and efficacy compared with BMS throughout 1 year. It remains to be determined whether the differences in favor of newer-generation DES are sustained during long-term follow-up. Copyright © 2014 American College of Cardiology Foundation. Published by Elsevier Inc. All rights reserved.

  3. Meteorological effects of heat and moisture releases from large power stations (precipitation modification)

    International Nuclear Information System (INIS)

    Patrinos, A.A.N.; Eissenberg, D.M.

    1978-01-01

    The Bowen Electric Generating Plant (Plant Bowen) in Northwest Georgia has been chosen as a test site to investigate the atmospheric effects of cooling towers. This 3,200-MWe coal-fired power plant uses four natural-draft cooling towers and is the largest of U.S. power plants having cooling towers as the sole cooling method. Results are reported from both climatological and field studies. Extensive use has been made of the U.S. National Weather Service (NWS) data accumulated over several decades in Northwest Georgia. Apart from providing preliminary indications of precipitation modification effects, these data have aided in the general understanding of the climatology in the vicinity of Plant Bowen and have paved the way for the field studies currently underway. These field studies, employing a dense network of rain gauges and windsets, are expected to provide the statistical data base necessary to estimate the plant's effect (if any) on precipitation

  4. The activity of barley alpha-amylase on starch granules is enhanced by fusion of a starch binding domain from Aspergillus niger glucoamylase

    DEFF Research Database (Denmark)

    Juge, N.; Nøhr, J.; Le Gal-Coëffet, M.-F.

    2006-01-01

    High affinity for starch granules of certain amylolytic enzymes is mediated by a separate starch binding domain (SBD). In Aspergillus niger glucoamylase (GA-I), a 70 amino acid O-glycosylated peptide linker connects SBD with the catalytic domain. A gene was constructed to encode barley alpha......-amylase 1 (AMY1) fused C-terminally to this SBD via a 37 residue GA-I linker segment. AMY1-SBD was expressed in A. niger, secreted using the AMY1 signal sequence at 25 mg x L(-1) and purified in 50% yield. AMY1-SBD contained 23% carbohydrate and consisted of correctly N-terminally processed multiple forms...... in A. niger). AMY1-SBD showed a 2-fold increased activity for soluble starch at low (0.5%) but not at high (1%) concentration. AMY1-SBD hydrolysed amylose DP440 with an increased degree of multiple attack of 3 compared to 1.9 for rAMY1. Remarkably, at low concentration (2 nM), AMY1-SBD hydrolysed...

  5. The impact of the Danish smoking ban on hospital admissions for acute myocardial infarction

    DEFF Research Database (Denmark)

    Christensen, Tabita Maria; Møller, Lisbeth; Jørgensen, Torben

    2014-01-01

    Background: Exposure to secondhand smoke is associated with an increased risk of acute myocardial infarction (AMI). The positive impact of a smoking ban on AMI hospitalization rates has been demonstrated both inside and outside Europe. A national smoking ban (SB) was implemented in Denmark on 15...

  6. Exploring distributed user interfaces in ambient intelligent environments

    NARCIS (Netherlands)

    Dadlani Mahtani, P.M.; Peregrin Emparanza, J.; Markopoulos, P.; Gallud, J.A.; Tesoriero, R.; Penichet, V.M.R.

    2011-01-01

    In this paper we explore the use of Distributed User Interfaces (DUIs) in the field of Ambient Intelligence (AmI). We first introduce the emerging area of AmI, followed by describing three case studies where user interfaces or ambient displays are distributed and blending in the user’s environments.

  7. United States stock market performance and acute myocardial infarction rates in 2008-2009 (from the Duke Databank for Cardiovascular Disease).

    Science.gov (United States)

    Fiuzat, Mona; Shaw, Linda K; Thomas, Laine; Felker, G Michael; O'Connor, Christopher M

    2010-12-01

    We sought to examine the relation between the United States economic decrease in 2008 and cardiovascular events as measured by local acute myocardial infarction (AMI) rates. Mental stress and traumatic events have been shown to be associated with increased risk of MI in patients with ischemic heart disease. This was an observational study of data from the Duke Databank for Cardiovascular Disease and includes patients undergoing angiography for evaluation of ischemic heart disease from January 2006 to July 2009. Patients with AMI occurring within 3 days before catheterization were used to calculate AMI rates. Stock market values were examined to determine the period of severe economic decrease, and time trends in AMI rates were examined over the same period. Time series models were used to assess the relation between United States stock market National Association of Securities Dealers Automated Quotation (NASDAQ) and rates of AMI. Of 11,590 patients included in the study cohort, 2,465 patients had an AMI during this period. Time series analysis showed a significant increase in AMI rates during a period of stock market decrease from October 2008 to April 2009 (p = 0.003), which remained statistically significant when adjusted for seasons (p = 0.02). In conclusion, unadjusted and adjusted analyses of patients in the Duke Databank for Cardiovascular Disease indicated a significant correlation between a period of stock market decrease and increased AMI rates in our local cohort. Copyright © 2010 Elsevier Inc. All rights reserved.

  8. Sex Differences in Financial Barriers and the Relationship to Recovery After Acute Myocardial Infarction

    OpenAIRE

    Beckman, Adam L.; Bucholz, Emily M.; Zhang, Weiwei; Xu, Xiao; Dreyer, Rachel P.; Strait, Kelly M.; Spertus, John A.; Krumholz, Harlan M.; Spatz, Erica S.

    2016-01-01

    Background Financial barriers to health care are associated with worse outcomes following acute myocardial infarction (AMI). Yet, it is unknown whether the prevalence of financial barriers and their relationship with post?AMI outcomes vary by sex among young adults. Methods and Results We assessed sex differences in patient?reported financial barriers among adults aged

  9. The relation of thrombomodulin G33A and C1418T gene ...

    African Journals Online (AJOL)

    Background: Acute myocardial infarction (AMI) is one of the major causes of morbidity and mortality worldwide. There is an increased interest in the genetic risk factors in the pathogenesis of ischemic heart disease. Thrombomodulin (TM), a natural anticoagulant, may play a critical role in the pathogenesis of AMI. Aim of the ...

  10. Predictive value of CHADS2 and CHA2DS2-VASc scores for acute myocardial infarction in patients with atrial fibrillation.

    Science.gov (United States)

    Pang, Hui; Han, Bing; Fu, Qiang; Zong, Zhenkun

    2017-07-05

    The presence of acute myocardial infarction (AMI) confers a poor prognosis in atrial fibrillation (AF), associated with increased mortality dramatically. This study aimed to evaluate the predictive value of CHADS 2 and CHA 2 DS 2 -VASc scores for AMI in patients with AF. This retrospective study enrolled 5140 consecutive nonvalvular AF patients, 300 patients with AMI and 4840 patients without AMI. We identified the optimal cut-off values of the CHADS 2 and CHA 2 DS 2 -VASc scores each based on receiver operating characteristic curves to predict the risk of AMI. Both CHADS 2 score and CHA 2 DS 2 -VASc score were associated with an increased odds ratio of the prevalence of AMI in patients with AF, after adjustment for hyperlipidaemia, hyperuricemia, hyperthyroidism, hypothyroidism and obstructive sleep apnea. The present results showed that the area under the curve (AUC) for CHADS 2 score was 0.787 with a similar accuracy of the CHA 2 DS 2 -VASc score (AUC 0.750) in predicting "high-risk" AF patients who developed AMI. However, the predictive accuracy of the two clinical-based risk scores was fair. The CHA 2 DS 2 -VASc score has fair predictive value for identifying high-risk patients with AF and is not significantly superior to CHADS 2 in predicting patients who develop AMI.

  11. Binding of carbohydrates and protein inhibitors to the surface of alpha-amylases

    DEFF Research Database (Denmark)

    Bozonnet, Sophie; Bønsager, Birgit Christine; Kramhoft, B.

    2005-01-01

    This review on barley alpha-amylases 1 (AMY1) and 2 (AMY2) addresses rational mutations at distal subsites to the catalytic site, polysaccharide hydrolysis, and interactions with proteinaceous inhibitors. Subsite mapping of barley alpha-amylases revealed 6 glycone and 4 aglycone substrate subsite...

  12. 78 FR 1224 - Supportive Housing for the Elderly; Advance Notice of Senior Preservation Rental Assistance...

    Science.gov (United States)

    2013-01-08

    ..., and for new very low income tenants (50 percent of AMI) upon unit turnover; and (2) Pool Two--those... low income tenants (50 percent of AMI) upon unit turnover, but rather for tenants at or below 80... Act of 1973, or Section 109 of the Housing and Community Development Act of 1974; iv. Has received a...

  13. Statin use after acute myocardial infarction: a nationwide study in Denmark

    DEFF Research Database (Denmark)

    Rasmussen, Jeppe Nørgaard; Gislason, Gunnar H; Abildstrom, Steen Z

    2005-01-01

    AIMS: To study outpatient statin use after first acute myocardial infarction (AMI) in Denmark between 1995 and 2002 and to determine the predictors of statin use. METHODS: This is a nationwide population-based study using administrative registries. Patients with first AMI between 1995 and 2002 ol...

  14. 76 FR 56196 - Agency Information Collection Activities; Proposed Collection; Comment Request

    Science.gov (United States)

    2011-09-12

    ..., and IV); (b) the FTC's consumer complaint systems; (c) the FTC's program evaluation activities and (d... (Nick M) and Ami Dziekan (Ami D), Division of Enforcement, Bureau of Consumer Protection, Federal Trade... Commission's Rules of Practice (primarily Parts I, II, and IV); (b) the FTC's consumer complaint systems; (c...

  15. Interoperable neuro-fuzzy services for emotion-aware ambient intelligence

    NARCIS (Netherlands)

    Acampora, G.; Vitiello, A.

    2013-01-01

    Ambient Intelligence (AmI) carries out a futuristic vision of living environments which are sensitive and responsive to the presence of people and, by taking care of their desires, intelligently respond to their actions improving their comfort and well-being. Typically, AmI frameworks are based on

  16. Philanthropy and Educational Reform during the Great Depression

    Science.gov (United States)

    Watras, Joseph

    2005-01-01

    The author discusses philanthropy and educational reform from the Great Depression to the present, contrasting the views of that time to "Making It Count" (Chester E. Finn, Jr. and Kelly Amis, 2001.) Although Finn and Amis presented their suggestions as advancing democracy, they thought that educational reform took place best when elite groups…

  17. The Battle At St. Vith, Belgium, 17-23 December 1944. An Historical Example of Armor in the Defense

    Science.gov (United States)

    1969-07-01

    deploying the advancing col- umna of the Fifth Panzer Amy towarda the northwest so as to support the Sizfh SS Penssr Amy in its drive towsrd LIFGE snd...elements on the flsnks. Because of the ever-changing tactical aituationa, com- manders wart often foiced to wo:k out solutions which ordinarily would

  18. Maltase-glucoamylase modulates gluconeogenesis and sucrase-isomaltase dominates starch digestion glucogenesis

    Science.gov (United States)

    Six enzyme activities are needed to digest starch to absorbable free glucose; 2 luminal alpha-amylases (AMY) and 4 mucosal maltase-glucoamylase (MGAM) and sucrase-isomaltase (SI) subunit activities are involved in the digestion. The AMY activities break down starch to soluble oligomeric dextrins; mu...

  19. The aminoterminal propeptide of type III procollagen provides new information on prognosis after acute myocardial infarction

    DEFF Research Database (Denmark)

    Høst, N B; Jensen, L T; Bendixen, P M

    1995-01-01

    The aim of the study was to examine sequential changes in serum levels of the aminoterminal propeptide of type III procollagen (S-PIIINP) after acute myocardial infarction (AMI), and to assess the value of S-PIIINP as a predictor of outcome. The study group comprised 74 patients with AMI, and 24 ...

  20. Effects of calcium ion concentration on starch hydrolysis of barley α-amylase isozymes

    DEFF Research Database (Denmark)

    Yuk, Jeong-Bin; Choi, Seung-Ho; Lee, Tae-Hee

    2008-01-01

    Barley (x-amylase genes, amyl and amy2, were separately cloned into the expression vector of pPICZ alpha A and recombinant Pichia strains were established by homologous recombination. Both AMYs from Pichia shared almost identical hydrolysis patterns on short maltooligosaccharides to result...

  1. In-Hospital Mortality among Rural Medicare Patients with Acute Myocardial Infarction: The Influence of Demographics, Transfer, and Health Factors

    Science.gov (United States)

    Muus, Kyle J.; Knudson, Alana D.; Klug, Marilyn G.; Wynne, Joshua

    2011-01-01

    Context/Purpose: Most rural hospitals can provide medical care to acute myocardial infarction (AMI) patients, but a need for advanced cardiac care requires timely transfer to a tertiary hospital. There is little information on AMI in-hospital mortality predictors among rural transfer patients. Methods: Cross-sectional retrospective analyses on…

  2. Identification and characterization of putative conserved IAM ...

    African Journals Online (AJOL)

    Available putative AMI sequences from a wide array of monocot and dicot plants were identified and the phylogenetic tree was constructed and analyzed. We identified in this tree, a clade that contained sequences from species across the plant kingdom suggesting that AMI is conserved and may have a primary role in plant ...

  3. Can Utilities Realize the Benefits of Advanced Metering Infrastructure? : Lessons from the World Bank’s Portfolio

    OpenAIRE

    Nangia, Varun; Oguah, Samuel; Gaba, Kwawu

    2016-01-01

    Advanced metering infrastructure (AMI) provides significant benefits to utilities around the world. Although it is entering the mainstream, technical concerns, policy challenges, capacity, and will in the Bank’s client countries hinder wider adoption. Starting out with smaller AMI deployments aimed at addressing revenue constraints seems to offer the best chance of success at utilities sup...

  4. Development and Integration of a HEMS with an Advanced Smart Metering Infrastructure

    OpenAIRE

    Diaz, Enrique Rodriguez; Palacios-Garcia, Emilio; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2016-01-01

    Advanced metering infrastructures (AMI) are required for the future smart grid operation by providing useful information about users’ behavior as well as grid performance such as the consumption and power quality. This paper is focused on the development of a LabVIEW application for user-interface and implementation of a Home Energy Management System (HEMS) based on AMI.

  5. Expression of miR-126 and its potential function in coronary artery ...

    African Journals Online (AJOL)

    Objective: This study aimed to explore the role of miR-126 in coronary artery disease ... pectoris and acute myocardial infarction (AMI) compared with controls (both P<0.01) the miR-126 expression in AMI was ..... in acute coronary syndromes.

  6. Udviklingen i dødelighed, incidens og letalitet af iskaemisk hjertesygdom i Danmark 1982-1992

    DEFF Research Database (Denmark)

    Osler, M; Sørensen, Thorkild I.A.; Sørensen, S

    1997-01-01

    (NIHD, ICD8 codes 410-4) and broadly defined IHD (BIHD, ICD8 codes 410-4, 427 & 795-6) were calculated for the period 1982 through 1992. During the entire period the age-standardized mortality of AMI, NIHD and BIHD decreased in both men and women. The incidence of AMI and NIHD decreased, while...

  7. Women as Leaders in Kinesiology and Beyond: Smashing through the Glass Obstacles

    Science.gov (United States)

    Ransdell, Lynda B.

    2014-01-01

    Amy Morris Homans was a great champion for women's pursuit of leadership in physical education and sport. In honor of her legacy, the purpose of this article is to: (a) discuss some defining leadership characteristics of Amy Morris Homans; (b) examine leadership issues related to gender; (c) examine leadership issues related to kinesiology;…

  8. Changing circadian variation of transient myocardial ischemia during the first year after a first acute myocardial infarction

    DEFF Research Database (Denmark)

    Mickley, H; Pless, P; Nielsen, J R

    1992-01-01

    In a consecutive series of 123 men (aged 55 +/- 8 years) with a recent first acute myocardial infarction (AMI), 24-hour ambulatory ST-segment monitoring was performed early after discharge (day 11 +/- 5), 6 months (day 185 +/- 6) and 1 year (day 368 +/- 8) after AMI. No difference in the prevalen...

  9. Unobtrusive Sensing of Emotions (USE).

    NARCIS (Netherlands)

    van den Broek, Egon; Schut, Marleen H.; Westerink, Joyce H.D.M.; Tuinenbreijer, Kees

    2009-01-01

    Emotions are acknowledged as a crucial element for artificial intelligence; this is, as is illustrated, no different for Ambient Intelligence (AmI). Unobtrusive Sensing of Emotions (USE) is introduced to enrich AmI with empathic abilities. USE coins the combination of speech and the

  10. A National Coordinating Center for Prehospital Trauma Research Funding Transfusion Using Stored Fresh Whole Blood

    Science.gov (United States)

    2017-09-01

    0.18 8% Regulatory oversight and coordination of reviews and reporting from site to NTI and from NTI to MRMC 4 Amy Flores Controller 0.6 5...Price at 2.5%. Monica Phillips worked on this project at 2% for 1.5 months. After 1.5 months of training, her role was filled by Amy Flores who

  11. Acute myocardial infarction in young adults with Antiphospholipid ...

    African Journals Online (AJOL)

    Abstract Acute myocardial infarction (AMI) is rarely associated with antiphospholipid syndrome. The treatment of these patients is a clinical challenge. We report the observations of 2 young adults (1 woman and 1 man), admitted in our acute care unit for acute myocardial infarction (AMI). A coagulopathy work-up concludes ...

  12. A cognitive multi-agent system for emotion-aware ambient intelligence

    NARCIS (Netherlands)

    Acampora, G.; Loia, V.; Vitiello, A.

    2011-01-01

    Ambient Intelligence (AmI) is an ubiquitous computing paradigm whose main objective is to provide living environments with personalized services for improving quality of people life. In spite of their technological definition, AmI systems are more than a straightforward integration among computer

  13. Euro Heart Survey 2009 Snapshot

    DEFF Research Database (Denmark)

    Puymirat, Etienne; Battler, Alex; Birkhead, John

    2013-01-01

    Detailed data on patients admitted for acute myocardial infarction (AMI) on a European-wide basis are lacking. The Euro Heart Survey 2009 Snapshot was designed to assess characteristics, management, and hospital outcomes of AMI patients throughout European Society of Cardiology (ESC) member...

  14. A comparative study of rapid test and routine methods for the measurement of cardiac markers in patients with suspected acute myocardial infarction

    Directory of Open Access Journals (Sweden)

    gholamreza Shahsavari

    2014-06-01

    Conclusion: The present results showed that the rapid cTnI test is very specific but not sensitive for AMI diagnosis while rapid CK-MB test is neither sensitive nor specific for AMI dignosis in patients with acute chest pain.

  15. The Time Profile of Pentraxin 3 in Patients with Acute ST-Elevation Myocardial Infarction and Stable Angina Pectoris Undergoing Percutaneous Coronary Intervention

    Directory of Open Access Journals (Sweden)

    Ragnhild Helseth

    2014-01-01

    Full Text Available Background. High levels of Pentraxin 3 (PTX3 are reported in acute myocardial infarction (AMI. Aim. To investigate circulating levels and gene expression of PTX3 in patients with AMI and stable angina pectoris (AP undergoing PCI. Methods. Ten patients with AP and 20 patients with AMI were included. Blood samples were drawn before PCI in the AP group and after 3 and 12 hours and days 1, 3, 5, 7, and 14 in both groups. Results. Circulating PTX3 levels were higher in AMI compared to AP at 3 and 12 hours (P<0.001 and P=0.003. Within the AMI group, reduction from 3 hours to all later time points was observed (all P≤0.001. Within the AP group, increase from baseline to 3 hours (P=0.022, followed by reductions thereafter (all P<0.05, was observed. PTX3 mRNA increased in the AMI group from 3 hours to days 7 and 14 in a relative manner of 62% and 73%, while a relative reduction from baseline to 3 and 12 hours of 29% and 37% was seen in the AP group. Conclusion. High circulating PTX3 levels shortly after PCI in AMI indicate that AMI itself influences PTX3 levels. PTX3 mRNA might be in response to fluctuations in circulating levels.

  16. A comparison in therapeutic efficacy of several time points of intravenous StemBell administration in a rat model of acute myocardial infarction

    NARCIS (Netherlands)

    Emmens, Reindert W.; Oedayrajsingh-Varma, Maikel; Woudstra, Linde; Kamp, Otto; Meinster, Elisa; van Dijk, Annemieke; Helder, Marco N.; Wouters, Diana; Zeerleder, Sacha; van Ham, S. Marieke; de Jong, Nico; Niessen, Hans W. M.; Juffermans, Lynda J. M.; Krijnen, Paul A. J.

    2017-01-01

    Adipose-derived stromal cells (ASCs) are a promising new therapeutic option for patients with acute myocardial infarction (AMI). Previously, we found that ASCs coupled to antibody-targeted microbubbles (StemBells [StBs]) improved cardiac function when administered intravenously 7 days post-AMI in

  17. Sustained Intervention Effects on Older Adults' Attitudes toward Alcohol and Medication Interactions

    Science.gov (United States)

    Zanjani, Faika; Allen, Hannah; Schoenberg, Nancy; Martin, Catherine; Clayton, Richard

    2018-01-01

    Background: Older adults are at risk for experiencing alcohol and medication interactions (AMIs) given their concomitant alcohol and medication use. However, there have been limited efforts to develop and evaluate AMI prevention interventions. Purpose: The current study examined sustained intervention effects on older adults' attitudes, awareness,…

  18. Comparative study of the thermal performance and emission levels ...

    African Journals Online (AJOL)

    ... internal fining with refractory material. The stove was charged with jive (5) selected wood species and a number of parameters, such as temperature projile amI flue gas composition were measured. Experimental evidence points to an improvement in the length amI peak temperatures of combustion on the modified stove ...

  19. Increased mortality associated with low use of clopidogrel in patients with heart failure and acute myocardial infarction not undergoing percutaneous coronary intervention: a nationwide study

    DEFF Research Database (Denmark)

    Bonde, Lisbeth; Sorensen, Rikke; Fosbøl, Emil Loldrup

    2010-01-01

    We studied the association of clopidogrel with mortality in acute myocardial infarction (AMI) patients with heart failure (HF) not receiving percutaneous coronary intervention (PCI).......We studied the association of clopidogrel with mortality in acute myocardial infarction (AMI) patients with heart failure (HF) not receiving percutaneous coronary intervention (PCI)....

  20. Clinical Characteristics and Risk Factors of Left Ventricular Thrombus after Acute Myocardial Infarction: A Matched Case-control Study

    Directory of Open Access Journals (Sweden)

    Yue-Xin Jiang

    2015-01-01

    Conclusions: This study indicated that lower LVEF, extensive anterior myocardial infarction, severe RWMA, and left ventricular aneurysm were independent risk factors of LVT after AMI. It also suggested that further efforts are needed for the LVT diagnosis after AMI in clinical practice.

  1. Safeguards in a world of ambient intelligence: A social, economic, legal, and ethical perspective

    NARCIS (Netherlands)

    van den Broek, Egon

    2011-01-01

    The book "Safeguards in a world of ambient intelligence" is unique in its kind. It discusses social, economic, legal, technological and ethical issues related to identity, privacy and security in Ambient Intelligence (AmI). It introduces AmI and, subsequently, makes it vivid by describing four

  2. Increased mortality associated with low use of clopidogrel in patients with heart failure and acute myocardial infarction not undergoing percutaneous coronary intervention

    DEFF Research Database (Denmark)

    Bonde, Lisbeth; Sorensen, Rikke; Fosbøl, Emil Loldrup

    2010-01-01

    with patients not treated with clopidogrel. Similarly, 2 groups without HF were identified. Risks of all-cause death were obtained by the Kaplan-Meier method and Cox regression analyses. RESULTS: We identified 56,944 patients with first-time AMI. In the matched cohort with HF (n = 5,050) and a mean follow......OBJECTIVES: We studied the association of clopidogrel with mortality in acute myocardial infarction (AMI) patients with heart failure (HF) not receiving percutaneous coronary intervention (PCI). BACKGROUND: Use of clopidogrel after AMI is low in patients with HF, despite the fact that clopidogrel...... is associated with absolute mortality reduction in AMI patients. METHODS: All patients hospitalized with first-time AMI (2000 through 2005) and not undergoing PCI within 30 days from discharge were identified in national registers. Patients with HF treated with clopidogrel were matched by propensity score...

  3. A Retrospective Audit of In-Hospital 30-day Mortality from Acute Myocardial Infarction in Connolly Hospital Blanchardstown

    LENUS (Irish Health Repository)

    Hensey, M

    2017-09-01

    In 2015, The Department of Health published the first annual report of the “National Healthcare Quality Reporting System.” Connolly Hospital was reported to a mortality rate within 30 days post-Acute Myocardial Infarction (AMI) of 9.87 per 100 cases which was statistically significantly higher than the national rate. We carried out a retrospective audit of patients who were HIPE-coded as having died within 30 days of AMI from 2011-2013 and identified 42 patients. On review, only 23 patients (54.8%) were confirmed as having had an AMI. We identified 12 patients who had AMI included on death certificate without any evidence for same. If the 22 patients incorrectly coded were excluded, the mortality rate within 30 days post-AMI in CHB would fall to 4.14 deaths per 100 cases, well below the national average. Inaccuracies of data collection can lead to erroneous conclusions when examining healthcare data.

  4. ECG and enzymatic indicators of therapeutic success after intravenous streptokinase for acute myocardial infarction

    DEFF Research Database (Denmark)

    Clemmensen, P; Grande, P; Pedersen, F

    1990-01-01

    Thrombolytic therapy has been documented to result in reperfusion of jeopardized myocardium and reduction in the size of the acute myocardial infarction (AMI). The effect of intravenous streptokinase on a creatine kinase-MB (CK-MB) reperfusion index and an ECG estimate of myocardial salvage...... was therefore studied in 65 patients with a first AMI, randomized to treatment with streptokinase (n = 33) or placebo (control group, n = 32). Reperfusion was defined as a CK-MB appearance rate constant (k1) greater than 0.185. The final AMI size was first predicted from the admission standard ECG by previously...... developed formulas based on ST segment elevation. The final AMI size was estimated from the QRS score on the predischarge ECG. Myocardial salvage was defined as a greater than or equal to 20% decrease from predicted to final AMI size. The k1 value in the control group was significantly lower than...

  5. Learned Helplessness and Depressive Symptoms Following Myocardial Infarction.

    Science.gov (United States)

    Smallheer, Benjamin A; Vollman, Michael; Dietrich, Mary S

    2018-06-01

    Psychosocial factors are known to impact depressive symptoms across clinical populations. Learned helplessness has the potential of affecting depressive symptoms following acute myocardial infarction (AMI), though little is known about this relationship. The purpose of this study was to examine the relationship between learned helplessness and depressive symptoms in patients following an AMI. Using a descriptive cross-sectional design, participants with a diagnosed AMI within the past 12 months were recruited. Standardized instruments and measures were used to evaluate learned helplessness and depressive symptoms. A statistically significant direct relationship was found between learned helplessness and depressive symptoms, suggesting that individuals with higher self-reported levels of learned helplessness also reported more depressive symptoms. These results indicate learned helplessness is associated with depressive symptoms in individuals following an AMI. In developing post-AMI treatment plans, health care staff should focus on psychologic points of intervention to the same extent as physiologic interventions.

  6. Energy Theft in the Advanced Metering Infrastructure

    Science.gov (United States)

    McLaughlin, Stephen; Podkuiko, Dmitry; McDaniel, Patrick

    Global energy generation and delivery systems are transitioning to a new computerized "smart grid". One of the principle components of the smart grid is an advanced metering infrastructure (AMI). AMI replaces the analog meters with computerized systems that report usage over digital communication interfaces, e.g., phone lines. However, with this infrastructure comes new risk. In this paper, we consider adversary means of defrauding the electrical grid by manipulating AMI systems. We document the methods adversaries will use to attempt to manipulate energy usage data, and validate the viability of these attacks by performing penetration testing on commodity devices. Through these activities, we demonstrate that not only is theft still possible in AMI systems, but that current AMI devices introduce a myriad of new vectors for achieving it.

  7. Smart Grid Applications for a Practical Implementation of IP over Narrowband Power Line Communications

    Directory of Open Access Journals (Sweden)

    Noelia Uribe-Pérez

    2017-11-01

    Full Text Available Currently, Advanced Metering Infrastructure (AMI systems have equipped the low voltage section with a communication system that is being used mainly for metering purposes, but it can be further employed for additional applications related to the Smart Grid (SG concept. This paper explores the potential applications beyond metering of the available channel in a Power Line Communication-based AMI system. To that end, IP has been implemented over Narrow Band-Power Line Communication (NB-PLC in a real microgrid, which includes an AMI system. A thorough review of potential applications for the SG that might be implemented for this representative case is included in order to provide a realistic analysis of the potentiality of NB-PLC beyond smart metering. The results demonstrate that existing AMI systems based on NB-PLC have the capacity to implement additional applications such as remote commands or status signals, which entails an added value for deployed AMI systems.

  8. Exploring disparities in acute myocardial infarction events between Aboriginal and non-Aboriginal Australians: roles of age, gender, geography and area-level disadvantage.

    Science.gov (United States)

    Randall, D A; Jorm, L R; Lujic, S; Eades, S J; Churches, T R; O'Loughlin, A J; Leyland, A H

    2014-07-01

    We investigated disparities in rates of acute myocardial infarction (AMI) between Aboriginal and non-Aboriginal people in the 199 Statistical Local Areas (SLAs) in New South Wales, Australia. Using routinely collected and linked hospital and mortality data from 2002 to 2007, we developed multilevel Poisson regression models to estimate the relative rates of first AMI events in the study period accounting for area of residence. Rates of AMI in Aboriginal people were more than two times that in non-Aboriginal people, with the disparity greatest in more disadvantaged and remote areas. AMI rates in Aboriginal people varied significantly by SLA, as did the Aboriginal to non-Aboriginal rate ratio. We identified almost 30 priority areas for universal and targeted preventive interventions that had both high rates of AMI for Aboriginal people and large disparities in rates. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.

  9. Prior blunt chest trauma may be a cause of single vessel coronary disease; hypothesis and review

    DEFF Research Database (Denmark)

    Bartels, Mette Damkjær; Nielsen, PE; Sleight, P

    2006-01-01

    Prompted by a case where a patient (with no risk factors, and single vessel disease) developed angina pectoris after previous blunt chest trauma, we searched Medline for blunt chest trauma and myocardial ischaemia. We found 77 cases describing AMI after blunt chest trauma, but only one reporting...... angina pectoris. We focused on the age and sex distribution, type of trauma, the angiography findings and the time interval between the trauma and the angiography. The age distribution was atypical, compared to AMI in general; 82% of the patients with AMI after blunt chest trauma were less than 45 years......, which strongly suggested a causal relation between the trauma and subsequent occlusion. AMI should therefore be considered in patients suffering from chest pain after blunt chest trauma. Because traumatic AMI might often be the result of an intimal tear or dissection, thrombolytic therapy might worsen...

  10. The intersection of health and wealth: association between personal bankruptcy and myocardial infarction rates in Canada.

    Science.gov (United States)

    Savu, Anamaria; Schopflocher, Donald; Scholnick, Barry; Kaul, Padma

    2016-01-13

    We examined the association between personal bankruptcy filing and acute myocardial infarction (AMI) rates in Canada. Between 2002 and 2009, aggregate and yearly bankruptcy and AMI rates were estimated for 1,155 forward sortation areas of Canada. Scatter plot and correlations were used to assess the association of the aggregate rates. Cross-lagged structural equation models were used to explore the longitudinal relationship between bankruptcy and AMI after adjustment for socio-economic factors. A cross-lagged structural equation model estimated that on average, an increase of 100 in bankruptcy filing count is associated with an increase of 1.5 (p = 0.02) in AMI count in the following year, and an increase of 100 in AMI count is associated with an increase of 7 (p stress, as indicated by personal bankruptcy rate, and vice-versa.

  11. あわら学舎における2007年のフラックス観測と蒸発量評価

    OpenAIRE

    宇治橋, 康行

    2008-01-01

    The author examined whether the meteorological data measured at Awara observation site was suitable for applying to evaluate heat fluxes and evapotranspiration based on the Bowen ration method. The obtained results as follows: 1) the calculated heat fluxes by using different sets of data are not agree with each others, and the errors are in the range of 4.1 to 11.6%, 2) the mean estimated error of daily evaporation by using the Bowen ratio is about 12%, 3) the estimated annual evaporation and...

  12. A homology theory for smale spaces

    CERN Document Server

    Putnam, Ian F

    2014-01-01

    The author develops a homology theory for Smale spaces, which include the basics sets for an Axiom A diffeomorphism. It is based on two ingredients. The first is an improved version of Bowen's result that every such system is the image of a shift of finite type under a finite-to-one factor map. The second is Krieger's dimension group invariant for shifts of finite type. He proves a Lefschetz formula which relates the number of periodic points of the system for a given period to trace data from the action of the dynamics on the homology groups. The existence of such a theory was proposed by Bowen in the 1970s.

  13. Covariance of biophysical data with digital topograpic and land use maps over the FIFE site

    Science.gov (United States)

    Davis, F. W.; Schimel, D. S.; Friedl, M. A.; Michaelsen, J. C.; Kittel, T. G. F.; Dubayah, R.; Dozier, J.

    1992-01-01

    This paper discusses the biophysical stratification of the FIFE site, implementation of the stratification utilizing geographic information system methods, and validation of the stratification with respect to field measurements of biomass, Bowen ratio, soil moisture, and the greenness vegetation index (GVI) derived from TM satellite data. Maps of burning and topographic position were significantly associated with variation in GVI, biomass, and Bowen ratio. The stratified design did not significantly alter the estimated site-wide means for surface climate parameters but accounted for between 25 and 45 percent of the sample variance depending on the variable.

  14. Los Alamos Climatology 2016 Update

    Energy Technology Data Exchange (ETDEWEB)

    Bruggeman, David Alan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-02-10

    The Los Alamos National Laboratory (LANL or the Laboratory) operates a meteorology monitoring network to support LANL emergency response, engineering designs, environmental compliance, environmental assessments, safety evaluations, weather forecasting, environmental monitoring, research programs, and environmental restoration. Weather data has been collected in Los Alamos since 1910. Bowen (1990) provided climate statistics (temperature and precipitation) for the 1961– 1990 averaging period, and included other analyses (e.g., wind and relative humidity) based on the available station locations and time periods. This report provides an update to the 1990 publication Los Alamos Climatology (Bowen 1990).

  15. Erythrocyte Saturation with IgG Is Required for Inducing Antibody-Mediated Immune Suppression and Impacts Both Erythrocyte Clearance and Antigen-Modulation Mechanisms.

    Science.gov (United States)

    Cruz-Leal, Yoelys; Marjoram, Danielle; Lazarus, Alan H

    2018-02-15

    Anti-D prevents hemolytic disease of the fetus and newborn, and this mechanism has been referred to as Ab-mediated immune suppression (AMIS). Anti-D, as well as other polyclonal AMIS-inducing Abs, most often induce both epitope masking and erythrocyte clearance mechanisms. We have previously observed that some Abs that successfully induce AMIS effects could be split into those that mediate epitope masking versus those that induce erythrocyte clearance, allowing the ability to analyze these mechanisms separately. In addition, AMIS-inducing activity has recently been shown to induce Ag modulation (Ag loss from the erythrocyte surface). To assess these mechanisms, we immunized mice with transgenic murine RBCs expressing a single Ag protein comprising a recombinant Ag composed of hen egg lysozyme, OVA sequences comprising aa 251-349, and the human Duffy transmembrane protein (HOD-Ag) with serial doses of polyclonal anti-OVA IgG as the AMIS-inducing Ab. The anti-OVA Ab induced AMIS in the absence of apparent epitope masking. AMIS occurred only when the erythrocytes appeared saturated with IgG. This Ab was capable of inducing HOD-RBC clearance, as well as loss of the OVA epitope at doses of Ab that caused AMIS effects. HOD-RBCs also lost reactivity with Abs specific for the hen egg lysozyme and Duffy portions of the Ag consistent with the initiation of Ag modulation and/or trogocytosis mechanisms. These data support the concept that an AMIS-inducing Ab that does not cause epitope masking can induce AMIS effects in a manner consistent with RBC clearance and/or Ag modulation. Copyright © 2018 by The American Association of Immunologists, Inc.

  16. Recent trends in economic burden of acute myocardial infarction in South Korea.

    Directory of Open Access Journals (Sweden)

    Hyeyoung Seo

    Full Text Available In 2010, ischemic heart disease was the leading cause of disability-adjusted life-years (DALYs worldwide. More specially, the prevalence of acute myocardial infarctions (AMI is increasing in the aged population as mortality decreases; South Korea is no exception. This study aims to examine the economic burden of AMI in the Korean population between 2007 and 2012. AMI-related costs were assessed from a societal perspective. A prevalence-based cost-of-illness framework was used for this analysis. The subjects included all South Koreans with AMI-related ICD-10 codes (I21, I22, I23, I25.0, and I25.1. Data on direct (medical and non-medical costs and indirect (productivity loss due to AMI-associated morbidity and mortality costs were collected from the Korean National Health Insurance Service's claims data. The human capital approach was used to calculate indirect costs. The total estimated cost of AMI in 2012 was $1,177,649,323 USD. The majority (52% of this amount was made up of medical costs, followed by productivity losses due to mortality and morbidity (42% of annual cost. Although the total cost declined by approximately 18% compared to 2007 ($1,427,643,854 USD, the cost of AMI in the over 60 age group amounted to 47% of the total cost of AMI in 2012. AMI led to a high economic burden in 2012. This study, which identified not only the size, but also the trends of AMI-related costs, will provide information to evaluate effects of governmental health projects and the effective allocation of public research funds.

  17. Undesired small RNAs originate from an artificial microRNA precursor in transgenic petunia (Petunia hybrida.

    Directory of Open Access Journals (Sweden)

    Yulong Guo

    Full Text Available Although artificial microRNA (amiRNA technology has been used frequently in gene silencing in plants, little research has been devoted to investigating the accuracy of amiRNA precursor processing. In this work, amiRNAchs1 (amiRchs1, based on the Arabidopsis miR319a precursor, was expressed in order to suppress the expression of CHS genes in petunia. The transgenic plants showed the CHS gene-silencing phenotype. A modified 5' RACE technique was used to map small-RNA-directed cleavage sites and to detect processing intermediates of the amiRchs1 precursor. The results showed that the target CHS mRNAs were cut at the expected sites and that the amiRchs1 precursor was processed from loop to base. The accumulation of small RNAs in amiRchs1 transgenic petunia petals was analyzed using the deep-sequencing technique. The results showed that, alongside the accumulation of the desired artificial microRNAs, additional small RNAs that originated from other regions of the amiRNA precursor were also accumulated at high frequency. Some of these had previously been found to be accumulated at low frequency in the products of ath-miR319a precursor processing and some of them were accompanied by 3'-tailing variant. Potential targets of the undesired small RNAs were discovered in petunia and other Solanaceae plants. The findings draw attention to the potential occurrence of undesired target silencing induced by such additional small RNAs when amiRNA technology is used. No appreciable production of secondary small RNAs occurred, despite the fact that amiRchs1 was designed to have perfect complementarity to its CHS-J target. This confirmed that perfect pairing between an amiRNA and its targets is not the trigger for secondary small RNA production. In conjunction with the observation that amiRNAs with perfect complementarity to their target genes show high efficiency and specificity in gene silencing, this finding has an important bearing on future applications of ami

  18. Undesired small RNAs originate from an artificial microRNA precursor in transgenic petunia (Petunia hybrida).

    Science.gov (United States)

    Guo, Yulong; Han, Yao; Ma, Jing; Wang, Huiping; Sang, Xianchun; Li, Mingyang

    2014-01-01

    Although artificial microRNA (amiRNA) technology has been used frequently in gene silencing in plants, little research has been devoted to investigating the accuracy of amiRNA precursor processing. In this work, amiRNAchs1 (amiRchs1), based on the Arabidopsis miR319a precursor, was expressed in order to suppress the expression of CHS genes in petunia. The transgenic plants showed the CHS gene-silencing phenotype. A modified 5' RACE technique was used to map small-RNA-directed cleavage sites and to detect processing intermediates of the amiRchs1 precursor. The results showed that the target CHS mRNAs were cut at the expected sites and that the amiRchs1 precursor was processed from loop to base. The accumulation of small RNAs in amiRchs1 transgenic petunia petals was analyzed using the deep-sequencing technique. The results showed that, alongside the accumulation of the desired artificial microRNAs, additional small RNAs that originated from other regions of the amiRNA precursor were also accumulated at high frequency. Some of these had previously been found to be accumulated at low frequency in the products of ath-miR319a precursor processing and some of them were accompanied by 3'-tailing variant. Potential targets of the undesired small RNAs were discovered in petunia and other Solanaceae plants. The findings draw attention to the potential occurrence of undesired target silencing induced by such additional small RNAs when amiRNA technology is used. No appreciable production of secondary small RNAs occurred, despite the fact that amiRchs1 was designed to have perfect complementarity to its CHS-J target. This confirmed that perfect pairing between an amiRNA and its targets is not the trigger for secondary small RNA production. In conjunction with the observation that amiRNAs with perfect complementarity to their target genes show high efficiency and specificity in gene silencing, this finding has an important bearing on future applications of amiRNAs in gene

  19. Relation between electrocardiographic and enzymatic methods of estimating acute myocardial infarct size.

    Science.gov (United States)

    Hindman, N; Grande, P; Harrell, F E; Anderson, C; Harrison, D; Ideker, R E; Selvester, R H; Wagner, G S

    1986-07-01

    The extent of initial acute myocardial infarction (AMI) and subsequent patient prognosis were studied using 2 independent indicators of AMI size. Two inexpensive, readily available techniques, the complete Selvester QRS score from the standard 12-lead electrocardiogram and the peak value of the isoenzyme MB of creatine kinase (CK-MB), were evaluated in 125 patients with initial AMI. The overall correlation between peak CK-MB and QRS score was fair (0.57), with marked difference according to anterior (0.72) or inferior (0.35) location. The prognostic capabilities of each measurement varied. Peak CK-MB provided significant information concerning hospital morbidity or early mortality (within 30 days) for both anterior (chi 2 = 9.83) and inferior (chi 2 = 7.68) AMI locations; however, the QRS score was significant only for anterior AMI (chi 2 = 9.50). For total 24-month mortality, the QRS score alone provided the most information (chi 2 = 10.0, p = 0.0016), which was not improved with the addition of CK-MB (chi 2 = 0.07, p = 0.79). This study shows a good relation between these 2 independent estimates of AMI size for patients with anterior AMI location. Both QRS and CK-MB results are significantly related to early morbidity and mortality; however, only the QRS score is related to total 24-month prognosis.

  20. Low protein Z plasma level is a risk factor for acute myocardial infarction in coronary atherosclerosis disease patients

    Science.gov (United States)

    Liu, Baoxin; Li, Yong; Luo, Jiachen; Dai, Liming; Zhao, Jinlong; Li, Hongqiang; Jie, Qiqiang; Wang, Dongzhi; Huang, Xin; Wei, Yidong

    2016-01-01

    Objectives To examine plasma protein Z (PZ) levels in acute myocardial infarction (AMI) and chronic coronary atherosclerosis disease (CCAD) patients without history of AMI and explore its potential clinical significance. Methods Plasma PZ concentrations were measured in 90 AMI patients (Group A), 87 CCAD patients without AMI history who remained free of major clinical events at least one year (Group B), and 88 clinically healthy controls (Group C). Results PZ was found to be significantly lower (PC (2001.7 ± 733.0 ng/mL) groups and in A+B compared with C Group (A+B 1663.1±570.0, PC groups (P=0.081). PZ level was significantly correlated with concentration of creatine kinase MB, high sensitive-cardiac troponin T, high sensitive C reactive protein, D-dimer and coagulation factor II and may be a useful predictor for AMI (OR: 1.38, 95% CI: 1.13-1.77, P=0.03). Subgroup analysis showed PZ concentration below the lowest tertile (< 1398 ng/mL) had a significantly increased risk for AMI and CCAD (OR: 3.39; 95% CI: 1.12-10.31; P=0.03 and OR: 7.39; 95% CI: 2.62-20.79; P<0.001 respectively). Conclusions PZ deficiency is found in AMI patients and could potentially reflect the myocardium injury, local coagulation activation and inflammation response during the acute phase of coronary atherosclerosis disease. PMID:27770663

  1. [Influence of weather in the incidence of acute myocardial infarction in Galicia (Spain)].

    Science.gov (United States)

    Fernández-García, José Manuel; Dosil Díaz, Olga; Taboada Hidalgo, Juan José; Fernández, José Ramón; Sánchez-Santos, Luis

    2015-08-07

    To assess the interactions between weather and the impact of each individual meteorological parameters in the incidence of acute myocardial infarctions (AMI) in Galicia. Retrospective study analyzing the number of AMI diagnosed and transferred to the hospital by the Emergencies Sanitary System of Galicia between 2002 and 2009. We included patients with clinical and ECG findings of AMI. The correlation between 10-minute meteorological variables (temperature, humidity, pressure, accumulated rainfall and wind speed) recorded by MeteoGalicia and the incidence of AMI was assessed. A total of 4,717 AMI were registered (72.8% men, 27.2% women). No seasonal variations were found. No significant correlations were detected with regard to average daily temperature (P=.683) or wind speed (P=.895). Correlation between atmospheric pressure and incidence of AMI was significant (P<.005), as well as with the daily relative humidity average (P=.005). Our study showed a statistical significant association with atmospheric pressure and with the daily relative humidity average. Since the local conditions of weather are widely variable, future studies should establish the relationship between weather patterns (including combinations of meteorological parameters), rather than seasonal variations, and the incidence of AMI. Copyright © 2013 Elsevier España, S.L.U. All rights reserved.

  2. Fractalkine levels are elevated early after PCI-treated ST-elevation myocardial infarction; no influence of autologous bone marrow derived stem cell injection.

    Science.gov (United States)

    Njerve, Ida Unhammer; Solheim, Svein; Lunde, Ketil; Hoffmann, Pavel; Arnesen, Harald; Seljeflot, Ingebjørg

    2014-09-01

    Fractalkine (CX3CL1) is a chemokine associated with atherosclerosis and inflammation. There is limited knowledge of fractalkine levels during acute myocardial infarction (AMI) and stem cell treatment. We aimed to investigate the time profile of circulating fractalkine and gene expression of its receptor CX3CR1 during AMI, and the influence of intracoronary autologous bone marrow stem cell (mBMC) transplantation (given 6 days after AMI) on fractalkine levels. We examined fractalkine levels at different time points by enzyme-linked immunosorbent assay (ELISA) in 20 patients with AMI, and 10 patients with stable angina pectoris (AP) undergoing percutaneous coronary intervention (PCI), and in 100 patients included in the randomized Autologous Stem-Cell Transplantation in Acute Myocardial Infarction (ASTAMI) trial. Patients with AMI had significantly elevated levels 3- and 12 h after PCI compared to patients with stable AP. After 12 h levels were similar in the two groups. An inverse pattern was observed in gene expression levels. No correlation between fractalkine levels and myocardial injury or infarct size was seen. We could not demonstrate any influence of autologous mBMC transplantation on fractalkine levels. Fractalkine levels are elevated the first 12 h after PCI in patients with AMI, however, not correlated to infarct size. The inverse pattern in gene expression of fractalkine receptor (CX3CR1) might be a compensatory mechanism. No effect of autologous mBMC transplantation given 6 days after AMI on fractalkine levels was observed. Copyright © 2014 Elsevier Ltd. All rights reserved.

  3. Acute Myocardial Infarction Patients

    Directory of Open Access Journals (Sweden)

    Bruce Ovbiagele

    2011-01-01

    Full Text Available Background. Diabetes mellitus (DM confers high vascular risk and is a growing national epidemic. We assessed clinical characteristics and prevalence of diagnosed DM among patients hospitalized with acute myocardial infarction (AMI in the US over the last decade. Methods. Data were obtained from all states within the US that contributed to the Nationwide Inpatient Sample. All patients admitted to hospitals between 1997 and 2006 with a primary discharge diagnosis of AMI were included. Time trends in the proportion of these patients with DM diagnosis were computed. Results. The portion of patients with comorbid diabetes among AMI hospitalizations increased substantially from 18% in 1997 to 30% in 2006 (<.0001. Absolute numbers of AMI hospitalizations in the US decreased 8% (from 729, 412 to 672, 243, while absolute numbers of AMI hospitalizations with coexisting DM rose 51% ((131, 189 to 198, 044, both (<.0001. Women with AMI were significantly more likely to have DM than similarly aged men, but these differences diminished with increasing age. Conclusion. Although overall hospitalizations for AMI in the US diminished over the last decade, prevalence of diabetes rose substantially. This may have important consequences for the future societal vascular disease burden.

  4. [Genetic factors in myocardial infarction].

    Science.gov (United States)

    Hara, Masahiko; Sakata, Yasuhiko; Sato, Hiroshi

    2013-02-01

    One of the main mechanisms of acute myocardial infarction (AMI) is plaque rupture or erosion followed by intraluminal thrombus formation and occlusion of the coronary arteries. Thus far, many underlying conditions or environmental factors, such as hypertension, diabetes, dyslipidemia, smoking or obesity, as well as a family history of coronary artery diseases have been identified as risks for the onset of AMI. These risks suggest that AMI occurs due to interactions between underlying conditions and multiple genetic susceptibilities. For this reason, many target gene-disease association studies have been performed with the recent introduction of genome-wide association studies (GWAS) that have further revealed new genetic susceptibilities for AMI. GWAS is a way to examine many common genetic variants in different individuals to see if any variant is associated with a trait in a case-control fashion, and typically focuses on associations between single-nucleotide polymorphisms (SNP) and traits. SNP on chromosome 9p21 is one of the robust susceptibility variants for AMI which has been identified by many GWAS. In this review, we overview the methodology of GWAS, introduce genetic variants identified by GWAS as those with susceptibility for AMI, and describe the foresight of using GWAS to investigate genetic susceptibility to AMI.

  5. Influence of Surface Processes over Africa on the Atlantic Marine ITCZ and South American Precipitation.

    Science.gov (United States)

    Hagos, Samson M.; Cook, Kerry H.

    2005-12-01

    Previous studies show that the climatological precipitation over South America, particularly the Nordeste region, is influenced by the presence of the African continent. Here the influence of African topography and surface wetness on the Atlantic marine ITCZ (AMI) and South American precipitation are investigated.Cross-equatorial flow over the Atlantic Ocean introduced by north south asymmetry in surface conditions over Africa shifts the AMI in the direction of the flow. African topography, for example, introduces an anomalous high over the southern Atlantic Ocean and a low to the north. This results in a northward migration of the AMI and dry conditions over the Nordeste region.The implications of this process on variability are then studied by analyzing the response of the AMI to soil moisture anomalies over tropical Africa. Northerly flow induced by equatorially asymmetric perturbations in soil moisture over northern tropical Africa shifts the AMI southward, increasing the climatological precipitation over northeastern South America. Flow associated with an equatorially symmetric perturbation in soil moisture, however, has a very weak cross-equatorial component and very weak influence on the AMI and South American precipitation. The sensitivity of the AMI to soil moisture perturbations over certain regions of Africa can possibly improve the skill of prediction.

  6. Echocardiographic predictors of early in-hospital heart failure during first ST-elevation acute myocardial infarction: does myocardial performance index and left atrial volume improve diagnosis over conventional parameters of left ventricular function?

    Directory of Open Access Journals (Sweden)

    Machado Cristiano V

    2011-06-01

    Full Text Available Abstract Background Left ventricular ejection fraction (LVEF has been considered a major determinant of early outcome in acute myocardial infarction (AMI. Myocardial performance index (MPI has been associated to early evolution in AMI in a heterogeneous population, including non ST-elevation or previous AMI. Left atrial volume has been related with late evolution after AMI. We evaluated the independent role of clinical and echocardiographic variables including LVEF, MPI and left atrial volume in predicting early in-hospital congestive heart failure (CHF specifically in patients with a first isolated ST-elevation AMI. Methods Echocardiography was performed within 30 hours of chest pain in 95 patients with a first ST-elevation AMI followed during the first week of hospitalization. Several clinical and echocardiographic variables were analyzed. CHF was defined as Killip class ≥ II. Multivariate regression analysis was used to select independent predictor of in-hospital CHF. Results Early in-hospital CHF occurred in 29 (31% of patients. LVEF ≤ 0.45 was the single independent and highly significant predictor of early CHF among other clinical and echocardiographic variables (odds ratio 17.0; [95% CI 4.1 - 70.8]; p Conclusion For patients with first, isolated ST-elevation AMI, LVEF assessed by echocardiography still constitutes a strong and accurate independent predictor of early in-hospital CHF, superior to isolated MPI and left atrial volume in this particular subset of patients.

  7. In-hospital mortality following acute myocardial infarction in Kosovo: Asingle center study

    International Nuclear Information System (INIS)

    Bajraktari, G.; Gjoka, S.; Rexhepaj, N.; Daullxhiu, I.; Thaqi, K.; Pacolli, S.; Sylejmani, X.; Elezi, S.

    2008-01-01

    Randomized trials have demonstrated that primary angioplasty is moreeffective than intravenous thrombolysis in reducing mortality and morbidityin patients with acute myocardial infarction (AMI). The aim of this study wasto assess the in-hospital mortality of patients with AMI admitted to the onlytertiary care center in Kosovo, where coronary percutaneous interventionprocedures are unavailable. We also assessed the impact of age and gender onin-hospital mortality. Consecutive patients with the diagnosis of AMI,admitted in our institution between 1999 and 2007, were included in thisretrospective study. Of 2848 patients (mean age 61+- 1.3 years, 73.4% males)admitted with AMI, 292 (10.25%) died during in-hospital stay. The overallin-hospital mortality was 12.3% for women and 9.5% for men (P<05). Women weresignificantly older than men (64.2+-11 years vs. 59.7+-11.8 years, P<.05).Mean length of stay was 12.0+-94 for women and 10.7+-7.6 for men. From 1999break was detected by the application of thepatients with Ami but themortality rate remained stable. Compared to developed countries, patientswith AMI in Kososvo present at an early age but have a higher mortality rate.Women with AMI had a significantly higher in-hospital mortality rate thanmen. The lack of percutaneous coronary intervention procedures in AMIpatients may have contributed to the high in-hospital mortality in ourpopulation. (auhor)

  8. Study on the ternary mixed ligand complex of palladium(II)-aminophylline-fluorescein sodium by resonance Rayleigh scattering, second-order scattering and frequency doubling scattering spectrum and its analytical application.

    Science.gov (United States)

    Chen, Peili; Liu, Shaopu; Liu, Zhongfang; Hu, Xiaoli

    2011-01-01

    The interaction between palladium(II)-aminophylline and fluorescein sodium was investigated by resonance Rayleigh scattering, second-order scattering and frequency doubling scattering spectrum. In pH 4.4 Britton-Robinson (BR) buffer medium, aminophylline (Ami) reacted with palladium(II) to form chelate cation([Pd(Ami)]2+), which further reacted with fluorescein sodium (FS) to form ternary mixed ligand complex [Pd(Ami)(FS)2]. As a result, resonance Rayleigh scattering (RRS), second-order scattering (SOS) and frequency doubling scattering spectrum (FDS) were enhanced. The maximum scattering wavelengths of [Pd(Ami)(FS)2] were located at 300 nm (RRS), 650 nm (SOS) and 304 nm (FDS). The scattering intensities were proportional to the Ami concentration in a certain range and the detection limits were 7.3 ng mL(-1) (RRS), 32.9 ng mL(-1) (SOS) and 79.1 ng mL(-1) (FDS), respectively. Based on it, the new simple, rapid, and sensitive scattering methods have been proposed to determine Ami in urine and serum samples. Moreover, the formation mechanism of [Pd(Ami)(FS)2] and the reasons for enhancement of RRS were fully discussed. Crown Copyright © 2010. Published by Elsevier B.V. All rights reserved.

  9. Physicians' opinions of a health information exchange.

    Science.gov (United States)

    Hincapie, Ana Lucia; Warholak, Terri L; Murcko, Anita C; Slack, Marion; Malone, Daniel C

    2011-01-01

    Arizona Medicaid developed a Health Information Exchange (HIE) system called the Arizona Medical Information Exchange (AMIE). To evaluate physicians' perceptions regarding AMIE's impact on health outcomes and healthcare costs. A focus-group guide was developed and included five domains: perceived impact of AMIE on (1) quality of care; (2) workflow and efficiency; (3) healthcare costs; (4) system usability; and (5) AMIE data content. Qualitative data were analyzed using analytical coding. A total of 29 clinicians participated in the study. The attendance rate was 66% (N=19) for the first and last month of focus-group meetings and 52% (N=15) for the focus group meetings conducted during the second month. The benefits most frequently mentioned during the focus groups included: (1) identification of "doctor shopping"; (2) averting duplicative testing; and (3) increased efficiency of clinical information gathering. The most frequent disadvantage mentioned was the limited availability of data in the AMIE system. Respondents reported that AMIE had the potential to improve care, but they felt that AMIE impact was limited due to the data available.

  10. The dynamics of platelet α-granule membrane protein and serum thromboxane B2 in patients with acute myocardial infarction and unstable angina

    International Nuclear Information System (INIS)

    Pan Yizhi; Wu Baiming; Hong Xiaosu; Wu Guoxin; Guo Hengshan

    1997-01-01

    To evaluate the dynamics of platelet activation in patients with acute myocardial infarction (AMI) and unstable angina (UA), the levels of platelet α-granule membrane protein (GMP-140)and serum thromboxane B 2 (TXB 2 ) were studied by RIA in 20 AMI and 30 UA patients and 20 controls. The results are: 1) The levels of GMP-140 and TXB 2 were significantly higher in AMI patients within 12 h after the onset than those in controls (P 0.05). TXB 2 still remained at higher level in AMI patients on the 7th day after onset (P 2 were markedly higher in UA patients when angina episode than those in controls (P 0.05), but the peak level of GMP-140 and TXB 2 and its persistent duration of elevation in UA were much lower than those in AMI. The platelet is highly activated in the patients with AMI and UA. In AMI there are more thrombplastic factors in coronary artery than in UA

  11. Artificial microRNAs and their applications in plant molecular biology

    Directory of Open Access Journals (Sweden)

    Pérez-Quintero Álvaro Luis

    2010-11-01

    Full Text Available

    Artificial microRNAs (amiRNAs are modified endogenous microRNA precursors in which the miRNA:miRNA* duplex is replaced with sequences designed to silence any desired gene. amiRNAs are used as part of new genetic transformation techniques in eukaryotes and have proven to be effective and to excel over other RNA-mediated gene silencing methods in both specificity and stability. amiRNAs can be designed to silence single or multiple genes, it is also possible to construct dimeric amiRNA precursors to silence two non-related genes simultaneously. amiRNA expression is quantitative and allows using constitutive, inducible, or tissue-specific promoters. One main application of amiRNAs is gene functional validation and to this end they have been mostly used in model plants; however, their use can be extended to any species or variety. amiRNA-mediated antiviral defense is another important application with great potential for plant molecular biology and crop improvement, but it still needs to be optimized to prevent the escape of viruses from the silencing mechanism. Furthermore, amiRNAs have propelled research in related areas allowing the development of similar tools like artificial trans-acting small interference RNAs (tasiARNs and artificial target mimicry. In this review, some applications and advantages of amiRNAs in plant molecular biology are analyzed. 

  12. Quality of life, coping strategies, social support and self-efficacy in women after acute myocardial infarction: a mixed methods approach.

    Science.gov (United States)

    Fuochi, G; Foà, C

    2018-03-01

    Quality of life, coping strategies, social support and self-efficacy are important psychosocial variables strongly affecting the experience of acute myocardial infarction (AMI) in women. To gain a more in-depth understanding of how coping strategies, self-efficacy, quality of life and social support shape women's adjustment to AMI. Mixed methods study. Quantitative data were collected through a standardised questionnaire on coping strategies, self-efficacy, quality of life and social support. Qualitative data stemmed from 57 semistructured interviews conducted with post-AMI female patients on related topics. Quantitative data were analysed with unpaired two-sample t-tests on the means, comparing women who experienced AMI (N = 77) with a control group of women who did not have AMI (N = 173), and pairwise correlations on the AMI sample. Qualitative data were grouped into coding families and analysed through thematic content analysis. Qualitative and quantitative results were then integrated, for different age groups. Quantitative results indicated statistically significant differences between women who experienced AMI and the control group: the former showed lower self-perceived health, perceived social support and social support coping, but greater self-efficacy, use of acceptance, avoidance and religious coping. Pairwise correlations showed that avoidance coping strategy was negatively correlated with quality of life, while the opposite was true for problem-oriented coping, perceived social support and self-efficacy. Qualitative results extended and confirmed quantitative results, except for coping strategies: avoidance coping seemed more present than reported in the standardised measures. Mixed methods provide understanding of the importance of social support, self-efficacy and less avoidant coping strategies to women's adjustment to AMI. Women need support from health professionals with knowledge of these topics, to facilitate their adaptation to AMI. © 2017

  13. Acute Myocardial Infarction Readmission Risk Prediction Models: A Systematic Review of Model Performance.

    Science.gov (United States)

    Smith, Lauren N; Makam, Anil N; Darden, Douglas; Mayo, Helen; Das, Sandeep R; Halm, Ethan A; Nguyen, Oanh Kieu

    2018-01-01

    Hospitals are subject to federal financial penalties for excessive 30-day hospital readmissions for acute myocardial infarction (AMI). Prospectively identifying patients hospitalized with AMI at high risk for readmission could help prevent 30-day readmissions by enabling targeted interventions. However, the performance of AMI-specific readmission risk prediction models is unknown. We systematically searched the published literature through March 2017 for studies of risk prediction models for 30-day hospital readmission among adults with AMI. We identified 11 studies of 18 unique risk prediction models across diverse settings primarily in the United States, of which 16 models were specific to AMI. The median overall observed all-cause 30-day readmission rate across studies was 16.3% (range, 10.6%-21.0%). Six models were based on administrative data; 4 on electronic health record data; 3 on clinical hospital data; and 5 on cardiac registry data. Models included 7 to 37 predictors, of which demographics, comorbidities, and utilization metrics were the most frequently included domains. Most models, including the Centers for Medicare and Medicaid Services AMI administrative model, had modest discrimination (median C statistic, 0.65; range, 0.53-0.79). Of the 16 reported AMI-specific models, only 8 models were assessed in a validation cohort, limiting generalizability. Observed risk-stratified readmission rates ranged from 3.0% among the lowest-risk individuals to 43.0% among the highest-risk individuals, suggesting good risk stratification across all models. Current AMI-specific readmission risk prediction models have modest predictive ability and uncertain generalizability given methodological limitations. No existing models provide actionable information in real time to enable early identification and risk-stratification of patients with AMI before hospital discharge, a functionality needed to optimize the potential effectiveness of readmission reduction interventions

  14. Early identification and delay to treatment in myocardial infarction and stroke: differences and similarities

    Directory of Open Access Journals (Sweden)

    Herlitz Johan

    2010-09-01

    Full Text Available Abstract Background The two major complications of atherosclerosis are acute myocardial infarction (AMI and acute ischemic stroke. Both are life-threatening conditions characterised by the abrupt cessation of blood flow to respective organs, resulting in an infarction. Depending on the extent of the infarction, loss of organ function varies considerably. In both conditions, it is possible to limit the extent of infarction with early intervention. In both conditions, minutes count. This article aims to describe differences and similarities with regard to the way patients, bystanders and health care providers act in the acute phase of the two diseases with the emphasis on the pre-hospital phase. Method A literature search was performed on the PubMed, Embase (Ovid SP and Cochrane Library databases. Results In both conditions, symptoms vary considerably. Patients appear to suspect AMI more frequently than stroke and, in the former, there is a gender gap (men suspect AMI more frequently than women. With regard to detection of AMI and stroke at dispatch centre and in Emergency Medical Service (EMS there is room for improvement in both conditions. The use of EMS appears to be higher in stroke but the overall delay to hospital admission is shorter in AMI. In both conditions, the fast track concept has been shown to influence the delay to treatment considerably. In terms of diagnostic evaluation by the EMS, more supported instruments are available in AMI than in stroke. Knowledge of the importance of early treatment has been reported to influence delays in both AMI and stroke. Conclusion Both in AMI and stroke minutes count and therefore the fast track concept has been introduced. Time to treatment still appears to be longer in stroke than in AMI. In the future improvement in the early detection as well as further shortening to start of treatment will be in focus in both conditions. A collaboration between cardiologists and neurologists and also between

  15. Established risk factors account for most of the racial differences in cardiovascular disease mortality.

    Directory of Open Access Journals (Sweden)

    Sean O Henderson

    Full Text Available BACKGROUND: Cardiovascular disease (CVD mortality varies across racial and ethnic groups in the U.S., and the extent that known risk factors can explain the differences has not been extensively explored. METHODS: We examined the risk of dying from acute myocardial infarction (AMI and other heart disease (OHD among 139,406 African-American (AA, Native Hawaiian (NH, Japanese-American (JA, Latino and White men and women initially free from cardiovascular disease followed prospectively between 1993-1996 and 2003 in the Multiethnic Cohort Study (MEC. During this period, 946 deaths from AMI and 2,323 deaths from OHD were observed. Relative risks of AMI and OHD mortality were calculated accounting for established CVD risk factors: body mass index (BMI, hypertension, diabetes, smoking, alcohol consumption, amount of vigorous physical activity, educational level, diet and, for women, type and age at menopause and hormone replacement therapy (HRT use. RESULTS: Established CVD risk factors explained much of the observed racial and ethnic differences in risk of AMI and OHD mortality. After adjustment, NH men and women had greater risks of OHD than Whites (69% excess, P<0.001 and 62% excess, P = 0.003, respectively, and AA women had greater risks of AMI (48% excess, P = 0.01 and OHD (35% excess, P = 0.007. JA men had lower risks of AMI (51% deficit, P<0.001 and OHD (27% deficit, P = 0.001, as did JA women (AMI, 37% deficit, P = 0.03; OHD, 40% deficit, P = 0.001. Latinos had underlying lower risk of AMI death (26% deficit in men and 35% in women, P = 0.03. CONCLUSION: Known risk factors explain the majority of racial and ethnic differences in mortality due to AMI and OHD. The unexplained excess in NH and AA and the deficits in JA suggest the presence of unmeasured determinants for cardiovascular mortality that are distributed unequally across these populations.

  16. Evaluation of the Role of Creatine Phosphokinase as a Biomarker in Acute Myocardial Infarction Patients

    Directory of Open Access Journals (Sweden)

    Priyal Agrawal

    2017-01-01

    Full Text Available Introduction: The study hypothesized that salivary creatine phosphokinase (CPK can act as a biomarker in diagnosing acute myocardial infarction (AMI as an alternative to serum CPK, which is a contributory effort towards noninvasive procedures to detect the disease. Aims and Objectives: The main aim of our study was to propose the normal range of salivary CPK in patients with AMI, and to explore the relationship between serum and saliva levels of CPK with comparison of salivary CPK as a biomarker between healthy individuals and patients with AMI. Materials and Methods: A case-control study was carried out including 144 participants who were divided in two main groups – 72 normal healthy individuals and 72 with AMI. CPK levels were assayed in serum and unstimulated whole saliva of AMI and controls by International Federation of Clinical Chemistry (IFCC method. Statistical Analysis: Statistical analysis was performed using unpaired t-test and Pearson correlation coefficient test. Results: The normal proposed range of salivary CPK of patients with AMI was found to range from 11.30 to 184.50 U/L in males and 20.17 to 69.00 U/L in females. The mean salivary and serum CPK was significantly higher in patients with AMI as compared to healthy individuals with P < 0.001. Saliva CPK concentration correlated significantly with serum CPK of AMI and healthy individuals with r = 0.247. Conclusion: Salivary CPK can be used as an alternative to serum CPK in patients with AMI.

  17. Increasing socioeconomic inequalities in first acute myocardial infarction in Scotland, 1990–92 and 2000–02

    Directory of Open Access Journals (Sweden)

    Dundas Ruth

    2009-05-01

    Full Text Available Abstract Background Despite substantial declines, Ischaemic Heart Disease (IHD remains the largest cause of death in Scotland and mortality rates are among the worst in Europe. There is evidence of strong, persisting regional and socioeconomic inequalities in IHD mortality, with the majority of such deaths being due to Acute Myocardial Infarction (AMI. We examine the changes in socioeconomic and geographic inequalities in first AMI events in Scotland and their interactions with age and gender. Methods We used linked hospital discharge and death records covering the Scottish Population (5.1 million. Risk ratios (RR of AMI incidence by area deprivation and age for men and women were estimated using multilevel Poisson modelling. Directly standardised rates were presented within these stratifications. Results During 1990–92 74,213 people had a first AMI event and 56,995 in 2000–02. Adjusting for area deprivation accounted for 59% of the geographic variability in AMI incidence rates in 1990–92 and 33% in 2000–02. Geographic inequalities in male incidence reduced; RR for smaller areas (comparing area on 97.5th centile to 2.5th reduced from 1.42 to 1.19. This was not true for women; RR increased from 1.45 to 1.59. The socioeconomic gradient in AMI incidence increased over time (p-value Conclusion Relative socioeconomic inequalities in AMI incidence have increased and gradients are steepest in young women. The geographical patterning of AMI incidence cannot be fully explained by socioeconomic deprivation. The reduction of inequalities in AMI incidence is key to reducing overall inequalities in mortality and must be a priority if Scotland is to achieve its health potential.

  18. Association of manganese superoxide dismutase Ala16Val polymorphism in the incidence of acute myocardial infarction in the Egyptians

    Directory of Open Access Journals (Sweden)

    Lobna M. Abdelrauf

    2017-12-01

    Full Text Available Background: Oxidative stress has been implicated in various diseases including atherosclerosis; the most common pathologic process underlying acute myocardial infarction (AMI. The manganese superoxide dismutase (MnSOD antioxidant enzyme affords the major defense against reactive oxygen species (ROS within the mitochondria. MnSOD Alanine16Valine (A16V single nucleotide polymorphism (SNP has been shown to decrease MnSOD detoxification activity. Aim: A case-control study was conducted to investigate the association between MnSOD A16V polymorphism and the incidence of AMI in the Egyptians, investigate the contribution of oxidative stress represented by hexanoyl lysine adduct (HEL, an oxidative stress biomarker, in the pathogenesis of AMI and finally correlate the MnSOD genotypes with HEL serum levels. Methods: A total of 200 Egyptian subjects were recruited for the study; 100 AMI patients and 100 control subjects. Genotypes of the MnSOD A16V polymorphism were determined using a polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP. Serum HEL was measured by ELISA. Results: A significant difference in the distribution of the MnSOD A16V genotypes was observed; VV genotype was significantly higher in AMI than controls (p ≤ 0.0001. Also, studying the allele frequencies revealed that Val allele was significantly higher in AMI than controls (p ≤ 0.0001. Serum analysis showed higher levels of HEL in AMI patients (p = 0.0142. Furthermore, HEL levels were found to be significantly higher in VV genotype in AMI (p = 0.0273. Conclusions: Our study suggests that MnSOD A16V polymorphism is associated with increased risk of developing AMI in the Egyptians. Moreover, the VV genotype is associated with higher HEL levels.

  19. Does global longitudinal speckle-tracking strain predict left ventricular remodeling in patients with myocardial infarction? a systematic review

    Directory of Open Access Journals (Sweden)

    Afsoon Fazlinejad

    2016-07-01

    Full Text Available Introduction: Left ventricular remodeling is a relatively prevalent complication of acute myocardial infarction (AMI, and it is associated with higher rates of medical issues and mortality. Left ventricle ejection fraction (LVEF and wall motion score index (WMSI are unable to detect accurately minor lesions following AMI. Global longitudinal strain (GLS, which is obtained through 2D-speckle tracking echocardiography (2D-STE, provides an angle-dependent measurement by which the infarcted area can be assessed as a means of identifying potential dysfunction. The main objective of this study was to evaluate whether GLS could adequately predict LV remodeling in AMI patients. Methods: The MEDLINE database from database inception to May 6th, 2015, was searched for relevant keywords and the reference lists of systematic reviews and eligible studies were also screened. All studies involving patients with their first reported case of AMI were examined for GLS by 2D-STE and were evaluated for LV remodeling at a three-month follow-up point.  Four English-language prospective cohort studies were eligible for inclusion in this study.Result: A total of 291 AMI patients (mean age=57.92 years were investigated across four different studies. The main finding of this study was that the most reliable and consistent measurement for the purposes of predicting LV remodeling in AMI patients is GLS obtained at the time of discharge, especially in STEMI patients.Discussion: In addition to their poor reproducibility, inability to stratify risks, and inter-observer variability, compensatory hyperkinesis of intact myocytes and myocardial stunning after an AMI are among the main reasons why LVEF and WMSI may not be the most effective predictors of LV remodeling in AMI.Conclusion: GLS obtained by 2D-STE at the time of discharge could be used as a reliable predictor of LV remodeling in AMI patients.

  20. The Arcminute Microkelvin Imager catalogue of gamma-ray burst afterglows at 15.7 GHz

    Science.gov (United States)

    Anderson, G. E.; Staley, T. D.; van der Horst, A. J.; Fender, R. P.; Rowlinson, A.; Mooley, K. P.; Broderick, J. W.; Wijers, R. A. M. J.; Rumsey, C.; Titterington, D. J.

    2018-01-01

    We present the Arcminute Microkelvin Imager (AMI) Large Array catalogue of 139 gamma-ray bursts (GRBs). AMI observes at a central frequency of 15.7 GHz and is equipped with a fully automated rapid-response mode, which enables the telescope to respond to high-energy transients detected by Swift. On receiving a transient alert, AMI can be on-target within 2 min, scheduling later start times if the source is below the horizon. Further AMI observations are manually scheduled for several days following the trigger. The AMI GRB programme probes the early-time (<1 d) radio properties of GRBs, and has obtained some of the earliest radio detections (GRB 130427A at 0.36 and GRB 130907A at 0.51 d post-burst). As all Swift GRBs visible to AMI are observed, this catalogue provides the first representative sample of GRB radio properties, unbiased by multiwavelength selection criteria. We report the detection of six GRB radio afterglows that were not previously detected by other radio telescopes, increasing the rate of radio detections by 50 per cent over an 18-month period. The AMI catalogue implies a Swift GRB radio detection rate of ≳ 15 per cent, down to ∼0.2 mJy beam-1. However, scaling this by the fraction of GRBs AMI would have detected in the Chandra & Frail sample (all radio-observed GRBs between 1997 and 2011), it is possible ∼ 44-56 per cent of Swift GRBs are radio bright, down to ∼0.1-0.15 mJy beam-1. This increase from the Chandra & Frail rate (∼30 per cent) is likely due to the AMI rapid-response mode, which allows observations to begin while the reverse-shock is contributing to the radio afterglow.

  1. Development and evaluation of the SoilClim model for water balance and soil climate estimates

    Czech Academy of Sciences Publication Activity Database

    Hlavinka, Petr; Trnka, Miroslav; Balek, J.; Semerádová, Daniela; Hayes, M.; Svoboda, M.; Eitzinger, J.; Možný, M.; Fischer, Milan; Hunter, E.; Žalud, Zdeněk

    2011-01-01

    Roč. 98, č. 8 (2011), s. 1249-1261 ISSN 0378-3774 Institutional research plan: CEZ:AV0Z60870520 Keywords : Evapotranspiration * Soil moisture * Eddy-covariance * Bowen ratio * Lysimeter * TDR * Atmometer Subject RIV: EH - Ecology, Behaviour Impact factor: 1.998, year: 2011

  2. Tipering van Wolf, wolf hoe laat is dit? (Hennie Aucamp

    Directory of Open Access Journals (Sweden)

    T. van der Merwe

    1984-05-01

    Full Text Available Wanneer ’n abstraksie van die kenmerkc van die moderne kortverhaal gemaak word (’n genologiese begrensing dus, is kortheid, wat saamhang met enkelheid, die opvaliendste aspek. Hierdeur verkry die kortverhaal bowenal ’n hegte struktuur terwyl alle ander kenmerke van die kortverhaal ook wesentlik deur die kortheid beïnvloed word.

  3. Expression of p63 and Cyclooxygenase-2 and Their Correlation in Skin Tumors

    Institute of Scientific and Technical Information of China (English)

    WU Yan; LIU Houjun; LI Jiawen

    2007-01-01

    To study the expression of p63 and cyclooxygenase-2 (cox-2) in skin tumors and evaluate the correlation between p63 and cox-2, the expressions of cox-2 and p63 were measured by streptavidin-peroxidase complex immunohistochemical technique in 17 cases of skin squamous cell carcinoma (SCC), 19 cases of Bowen's disease(Bowen), 11 cases of actinic keratosis(AK), 12 cases of seborreic keratosis(SK) and 13 specimens of normal skin. Our results showed that the expression of p63 in skin squamous cell carcinoma, Bowen's disease and actinic keratosis were significantly higher than that in seborreic keratosis, while the expression of p63 in seborreic keratosis was significantly higher than that in normal skin. The expression of cox-2 in skin squamous cell carcinoma,Bowen's disease and actinic keratosis were significantly higher than that in seborreic keratosis, while no statistical difference was noted in the expression of cox-2 between seborreic keratosis and normal skin. Cox-2 expression was positively correlated with the high p63 expression in malignant skin tumors. The increased expression of cox-2 and p63 may play an important role in the development of skin tumors and work synergetically in malignant skin tumors.

  4. Instrumental thermal neutron activation analysis of tobacco

    International Nuclear Information System (INIS)

    Faanhof, A.; Das, H.A.

    1980-01-01

    A group of 27 tobacco samples was submitted to INAA. Bowen's Kale was analyzed with the samples. The resulting data for 21 elements in tobacco were processed by a cluster programme. This combination proves to be a convenient tool for discrimination within one group of samples. (author)

  5. Integrating Work Environment Considerations Into Lean and Value Stream Mapping

    DEFF Research Database (Denmark)

    Edwards, Kasper

    (Spear & Bowen, 1999; Womack & Jones, 1996) and is based on standardisation, levelling, and optimisation of work flows through value stream mapping (VSM) (Rother & Shook, 2009) and eliminating waste. Lean is essentially a rationalization approach that will reduce waste and increase productivity thereby...

  6. Evapotranspiration of a high-density poplar stand in comparison with a reference grass cover in the Czech–Moravian Highlands

    Czech Academy of Sciences Publication Activity Database

    Fischer, M.; Trnka, M.; Kučera, J.; Deckmyn, G.; Orság, M.; Sedlák, Pavel; Žalud, Z.; Ceulemans, R.

    2013-01-01

    Roč. 181, NOV 2013 (2013), s. 43-60 ISSN 0168-1923 Institutional support: RVO:68378289 Keywords : Evapotranspiration * Short-rotation poplar coppice * Grassland * Bowen ratio/energy balance method Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 3.894, year: 2013 http://www.sciencedirect.com/science/article/pii/S0168192313001846

  7. Annual and Intra-Annual Water Balance Components of a Short Rotation Poplar Coppice Based on Sap Flow and Micrometeorological and Hydrological Approaches

    Czech Academy of Sciences Publication Activity Database

    Fischer, Milan; Orság, Matěj; Trnka, Miroslav; Pohanková, Eva; Hlavinka, Petr; Tripathi, Abishek; Žalud, Zdeněk

    2013-01-01

    Roč. 991, JUN 04-07 (2013), s. 401-408 ISSN 0567-7572 Institutional support: RVO:67179843 Keywords : short rotation poplar coppice * water balance * sap flow * Bowen ratio and energy balance method * modeling Subject RIV: EH - Ecology, Behaviour

  8. RJHS Vol 4(1).cdr

    African Journals Online (AJOL)

    ABEOLUGBENGAS

    postmenopausal women associated with a decreased body image and quality of life. ... 1Department of Obstetrics And Gynaecology, Bowen University Teaching Hospital, Ogbomosho, ... Awotunde OT . , Fehintola AO. , Ogunlaja OA. , Olujide LO. , Aaron OI. , Bakare B . , .... stress of multiple unsupervised vaginal deliveries.

  9. Five methods to interpret field measurements of energy fluxes over a micro-sprinkler-irrigated mango orchard

    NARCIS (Netherlands)

    De C. Teixeira, A.H.; Bastiaanssen, W.G.M.

    2010-01-01

    Energy balance measurements were carried out in a mango orchard during two growing seasons in the semi-arid region of Brazil. The actual evapotranspiration (ET) was acquired by eddy correlation (EC) and Bowen ratio energy balance (BR) techniques. The daily energy balance closure in the EC

  10. Agro. no 1 June Latest

    African Journals Online (AJOL)

    1Department of Crop Production, Soil and Environmental Management, Bowen University,. P.M.B 284, Iwo ... (90kgNha ) resulted in the production of seedling that was superior in dry matter yield to any other ..... Handbook of Energy Crops.

  11. AFRREV IJAH, Vol.1 (3) July, 2012

    African Journals Online (AJOL)

    Dr Abimbola

    paid to this issue which has been a regular exercise in advanced countries. However, the ... government getting involved in the business of patronage, underscoring the role of the .... subsidy because of its social contribution, moral contribution and political ... and authored by William J. Baumol and William G. Bowen (joint.

  12. Goal Direction and Effectiveness, Emotional Maturity, and Nuclear Family Functioning

    Science.gov (United States)

    Klever, Phillip

    2009-01-01

    Differentiation of self, a cornerstone concept in Bowen theory, has a profound influence over time on the functioning of the individual and his or her family unit. This 5-year longitudinal study tested this hypothesis with 50 developing nuclear families. The dimensions of differentiation of self that were examined were goal direction and…

  13. Convective environment in pre-monsoon and monsoon conditions over the Indian subcontinent: the impact of surface forcing

    Directory of Open Access Journals (Sweden)

    L. Thomas

    2018-05-01

    Full Text Available Thermodynamic soundings for pre-monsoon and monsoon seasons from the Indian subcontinent are analysed to document differences between convective environments. The pre-monsoon environment features more variability for both near-surface moisture and free-tropospheric temperature and moisture profiles. As a result, the level of neutral buoyancy (LNB and pseudo-adiabatic convective available potential energy (CAPE vary more for the pre-monsoon environment. Pre-monsoon soundings also feature higher lifting condensation levels (LCLs. LCL heights are shown to depend on the availability of surface moisture, with low LCLs corresponding to high surface humidity, arguably because of the availability of soil moisture. A simple theoretical argument is developed and showed to mimic the observed relationship between LCLs and surface moisture. We argue that the key element is the partitioning of surface energy flux into its sensible and latent components, that is, the surface Bowen ratio, and the way the Bowen ratio affects surface buoyancy flux. We support our argument with observations of changes in the Bowen ratio and LCL height around the monsoon onset, and with idealized simulations of cloud fields driven by surface heat fluxes with different Bowen ratios.

  14. 75 FR 29976 - Initiation of Antidumping and Countervailing Duty Administrative Reviews

    Science.gov (United States)

    2010-05-28

    ...., Ltd. Yancheng H&M Pressure Valve York International (Northern Asia) Ltd. Yuyao Dianbo Machinery Co... Co. Ltd. Pennengineering Automotive Fastener Pinghu City Zhapu Screw Cap Qingdao H.R. International...., Ltd. Bergstrom China Group Bowen Casting Co Ltd Broad-Ocean Motor (Hong Kong) Co., Ltd. C.H. Robinson...

  15. Redefining Student Affairs through Digital Technology: A Ten-Year Historiography of Digital Technology Use by Student Affairs Administrators

    Science.gov (United States)

    Cabellon, Edmund T.

    2016-01-01

    The student affairs profession is at a crossroads (Torres & Walbert, 2010) given digital technology's growth and the academy's administrative expansion (Bowen, 2013). Student affairs administrators must simultaneously respond to digital technology's implications in students' lives (Kirschner & Karpinski, 2010) and to new state and federal…

  16. Faculty Perceptions of Division I Male Student-Athletes: The Relationship between Student-Athlete Contact, Athletic Department Involvement, and Perceptions of Intercollegiate Athletics

    Science.gov (United States)

    Tovar, Elizabeth A.

    2011-01-01

    It has been widely recognized that student-athletes, especially in the sports of men's basketball and football, endure stereotyping (Bowen & Levin, 2003; Simons, Bosworth, Fujita, & Jensen, 2007, Baucom & Lantz, 2001). Although stereotypes about male basketball and football student-athletes academic behaviors are expressed by many sectors of the…

  17. Effect of Saw Dust Biochar and NPK 15:15:15 Inorganic Fertilizer on ...

    African Journals Online (AJOL)

    A factorialexperiment was conducted in the screen house of Bowen University, Iwo, Nigeria to examine the response of Moringa oleifera Lam. seedlings to saw dust biochar and NPK 15:15:15 inorganic fertilizer amendments. The plants were grown for twelve weeks in top soil (0-30cm) collected from an Oxisol in the ...

  18. The man behind the machine

    Science.gov (United States)

    Cerf, Vint

    2018-01-01

    As a practising computer scientist, I thought I had a fairly good grasp of Alan Turing’s many contributions to the field. But The Turing Guide by Jack Copeland, Jonathan Bowen, Mark Sprevak and Robin Wilson has opened up a universe of Turing's other pursuits I knew nothing about, inflating my admiration for him and his work.

  19. Long term effects of formaldehyde preservation on subsequent bone ...

    African Journals Online (AJOL)

    This study was conducted to compare the effectiveness of cold and hot water maceration techniques for the development of bone specimens from cadavers. Three already dissected bodies of both sexes (two males and a female) obtained from the Department of Anatomy, Bowen University, Iwo, Osun State, Nigeria were ...

  20. Volatilization of tri-allate, ethoprophos and parathion measured with four methods after spraying on a sandy soil

    NARCIS (Netherlands)

    Bor, G.; Berg, van den F.; Smelt, J.H.; Smidt, R.A.; Peppel-Groen, van de A.E.; Leistra, M.

    1995-01-01

    At about eleven times after application of tri-allate, ethoprophos and parathion to a sandy soil, their rates of volatilization were determined by the aerodynamic method (AD), the Bowen-ratio method (BR), the theoretical-profile method (TP) and the Box method. The volatilization was highest for

  1. Volatilization of parathion and chlorothalonil after spraying onto a potato crop

    NARCIS (Netherlands)

    Berg, van den F.; Bor, G.; Smidt, R.A.; Peppel-Groen, van de A.E.; Smelt, J.H.; Müller, T.; Maurer, T.

    1995-01-01

    At fourteen times after application of parathion and chlorothalonil to a potato crop their rates of volatilization were determined by the aerodynamic and Bowen ratio methods. The highest volatilization rate of parathion occurred shortly after application. In the first hours after application its

  2. Evaluation of the soil organic carbon, nitrogen and available ...

    African Journals Online (AJOL)

    The result obtained indicates that the level of these chemical properties were generally low as compared to standard measures and parameter for ratings soil fertility in the Nigerian Savanna. Keywords: Status of organic carbon, total nitrogen, available phosphorus, top horizons, research farm. Bowen Journal of Agriculture ...

  3. The Effects of Environmental Conditions on Activity, Feeding, and Body Weight in Male and Female Adolescent Rats

    Science.gov (United States)

    2006-03-31

    cookies, potato chips, salami, marshmallows , etc.) gained more weight than did the rats that were provided standard chow. The animals with access to...chip and cream filled cookies, salami, cheese, bananas, marshmallows , milk chocolate, and peanut butter (Sclafani & Springer, 1976). In fact... marshmallows , milk chocolate, potato chips, and peanut butter (Sclafani & Springer, 1976; Grunberg, Bowen, Maycock, & Nespor, 1985; Sclafani 2004

  4. Household food security status and coping strategies of rural ...

    African Journals Online (AJOL)

    Household food security status and coping strategies of rural dwellers in Irewole local government areas of Osun State. CG Ajala. Abstract. No Abstract. Bowen Journal of Agriculture Vol. 3 (2) 2006: pp. 192-199. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  5. Key Issue: Enhancing Teacher Leadership

    Science.gov (United States)

    National Comprehensive Center for Teacher Quality, 2007

    2007-01-01

    "Teachers are leaders when they function in professional communities to affect student learning; contribute to school improvement; inspire excellence in practice; and empower stakeholders to participate in educational improvement" (Childs-Bowen, Moller, & Scrivner, 2000, p. 28). Enhancing teacher leadership can help schools and districts reach the…

  6. 78 FR 64205 - Army Science Board Fall Plenary Meeting

    Science.gov (United States)

    2013-10-28

    ... by 41 CFR 102-3.150(a). Therefore, the Advisory Committee Management Officer for the Department of..., (703) 545-8652, william.m.mclagan.mil @mail.mil"> william.m.mclagan.mil @mail.mil or Carolyn German, (703) 545-8654, carolyn.t.german[email protected] . SUPPLEMENTARY INFORMATION: None. Brenda S. Bowen, Army...

  7. Mixtures of Gaussians for uncertainty description in bivariate latent heat flux proxies

    NARCIS (Netherlands)

    Wójcik, R.; Troch, P.A.A.; Stricker, J.N.M.; Torfs, P.J.J.F.

    2006-01-01

    This paper proposes a new probabilistic approach for describing uncertainty in the ensembles of latent heat flux proxies. The proxies are obtained from hourly Bowen ratio and satellite-derived measurements, respectively, at several locations in the southern Great Plains region in the United States.

  8. The Aeronautics Education, Research, and Industry Alliance (AERIAL) 2002 Report. UNO Aviation Monograph Series. UNOAI Report.

    Science.gov (United States)

    Bowen, Brent D.; Box, Richard C.; Fink, Mary M.; Gogos, George; Lehrer, Henry R.; Narayanan, Ram M.; Nickerson, Jocelyn S.; O'Neil, Patrick D.; Tarry, Scott E.; Vlasek, Karisa D.

    This document contains four papers on aeronautics education, research, and partnerships that partly supported through the Aeronautics Education, Research, and Industry Alliance (AERIAL). The paper "2002 AERIAL Monograph" (Brent D. Bowen, Jocelyn S. Nickerson, Mary M. Fink, et al.) presents an overview of research and development in the…

  9. 76 FR 38122 - Notice of Availability for Exclusive, Non-Exclusive, or Partially-Exclusive Licensing of an...

    Science.gov (United States)

    2011-06-29

    ... compounds have radical curative antimalarial activity. Brenda S. Bowen, Army Federal Register Liaison... Guanidylimidazoline Derivatives as Antimalarial Agents, Synthesis of and Methods of Use Thereof AGENCY: Department of... ``Guanidylimidazole and Guanidylimidazoline Derivatives as Antimalarial Agents, Synthesis of and Methods of Use...

  10. variability of volatile organic compounds emitted by seedlings of ...

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    1Department of Crop Production, Soil and Environmental Management, Bowen University, P.M.B. 284, ... pathogen of native African grasses. .... infestation de la cicadelle étaient classes comme suit par ordre descendant: ... a farmer's entire crop can be wiped out by Maize ... Seeds were pre-germinated and then planted.

  11. Footprint-weighted tile approach for a spruce forest and a nearby patchy clearing using the ACASA model

    Science.gov (United States)

    Gatzsche, Kathrin; Babel, Wolfgang; Falge, Eva; Pyles, Rex David; Tha Paw U, Kyaw; Raabe, Armin; Foken, Thomas

    2018-05-01

    The ACASA (Advanced Canopy-Atmosphere-Soil Algorithm) model, with a higher-order closure for tall vegetation, has already been successfully tested and validated for homogeneous spruce forests. The aim of this paper is to test the model using a footprint-weighted tile approach for a clearing with a heterogeneous structure of the underlying surface. The comparison with flux data shows a good agreement with a footprint-aggregated tile approach of the model. However, the results of a comparison with a tile approach on the basis of the mean land use classification of the clearing is not significantly different. It is assumed that the footprint model is not accurate enough to separate small-scale heterogeneities. All measured fluxes are corrected by forcing the energy balance closure of the test data either by maintaining the measured Bowen ratio or by the attribution of the residual depending on the fractions of sensible and latent heat flux to the buoyancy flux. The comparison with the model, in which the energy balance is closed, shows that the buoyancy correction for Bowen ratios > 1.5 better fits the measured data. For lower Bowen ratios, the correction probably lies between the two methods, but the amount of available data was too small to make a conclusion. With an assumption of similarity between water and carbon dioxide fluxes, no correction of the net ecosystem exchange is necessary for Bowen ratios > 1.5.

  12. Author Details

    African Journals Online (AJOL)

    Bowen, P. Vol 20, No 2 (2013) - Articles Workplace stress experienced by quantity surveyors. Abstract PDF · Vol 20, No 2 (2013) - Articles Harassment and discrimination experienced by quantity surveyors in South Africa Abstract PDF. ISSN: 1023-0564. AJOL African Journals Online. HOW TO USE AJOL... for Researchers ...

  13. Crop water parameters of irrigated wine and table grapes to support water productivity analysis in the Sao Francisco river basin, Brazil

    NARCIS (Netherlands)

    Castro Teixeira, de A.H.; Bastiaanssen, W.G.M.; Bassoi, L.H.

    2007-01-01

    Energy and water balance parameters were measured in two commercial vineyards in the semiarid region of the São Francisco river basin, Brazil. Actual evapotranspiration (ET) was acquired with the Bowen ratio surface energy balance method. The ratio of the latent heat flux to the available energy, or

  14. Visual Impairment and Self-Esteem: What Makes a Difference?

    Science.gov (United States)

    Bowen, Jayne

    2010-01-01

    This account follows on from the research report "Visual impairment and its impact on self-esteem" (Bowen, 2010) published in this journal. The original article reported the results of an investigation of self-esteem levels amongst a sample group of 60 children with visual impairment. Four children, whose self-esteem was measured as…

  15. Southwest Seminar and Development Project of the District of Columbia Public Schools; Report of Evaluation 1967-1968.

    Science.gov (United States)

    Mackenzie, Gordon N.; And Others

    This report described the Tri-School Plan initiated by the Board of Education in Washington, D.C. to equalize educational opportunities in an urban renewal area. Under the plan, children attended the Syphax School for grades 1 and 2; the Amidon School for grades 3 and 4; the Bowen School for grades 5 and 6. Children from various socioeconomic…

  16. Soil heat flux and day time surface energy balance closure

    Indian Academy of Sciences (India)

    Soil heat flux; surface energy balance; Bowen's ratio; sensible and latent ... The energy storage term for the soil layer 0–0.05 m is calculated and the ground heat ... When a new method that accounts for both soil thermal conduction and soil ...

  17. Collegiate Aviation Research and Education Solutions to Critical Safety Issues. UNO Aviation Monograph Series. UNOAI Report.

    Science.gov (United States)

    Bowen, Brent, Ed.

    This document contains four papers concerning collegiate aviation research and education solutions to critical safety issues. "Panel Proposal Titled Collegiate Aviation Research and Education Solutions to Critical Safety Issues for the Tim Forte Collegiate Aviation Safety Symposium" (Brent Bowen) presents proposals for panels on the…

  18. Saddami kohtumõistmine ei too Iraaki kriisist välja / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2005-01-01

    18. oktoobril tunnistas Iraagi sõjajärgse tsiviilülesehitustöö eest vastutav Stuart Bowen USA kongressi ees, et USA-l on sealsete infrastruktuuride taastamiseks ettenähtud raha otsa saamas. Vt. samas: Kohus Saddami üle lükkus 28. novembrile

  19. Involvement of individual subsites and secondary substrate binding sites in multiple attack on amylose by barley alpha-amylase

    DEFF Research Database (Denmark)

    Kramhøft, Birte; Bak-Jensen, Kristian Sass; Mori, Haruhide

    2005-01-01

    Barley alpha-amylase 1 (AMY1) hydrolyzed amylose with a degree of multiple attack (DMA) of 1.9; that is, on average, 2.9 glycoside bonds are cleaved per productive enzyme-substrate encounter. Six AMY1 mutants, spanning the substrate binding cleft from subsites -6 to +4, and a fusion protein, AMY1...... translocation of substrate in the binding cleft upon the initial cleavage to produce G6-G10, essentially independent of subsite mutations, and short-distance moves resulting in individually very different rates of release of G1-G4. Accordingly, the degree of multiple attack as well as the profile of products...

  20. Oligosaccharide binding to barley alpha-amylase 1

    DEFF Research Database (Denmark)

    Robert, X.; Haser, R.; Mori, H.

    2005-01-01

    Enzymatic subsite mapping earlier predicted 10 binding subsites in the active site substrate binding cleft of barley alpha-amylase isozymes. The three-dimensional structures of the oligosaccharide complexes with barley alpha-amylase isozyme 1 (AMY1) described here give for the first time a thorough...... in barley alpha-amylase isozyme 2 (AMY2), and the sugar binding modes are compared between the two isozymes. The "sugar tongs" surface binding site discovered in the AMY1-thio-DP4 complex is confirmed in the present work. A site that putatively serves as an entrance for the substrate to the active site...

  1. Amidase encapsulated O-carboxymethyl chitosan nanoparticles for vaccine delivery.

    Science.gov (United States)

    Smitha, K T; Sreelakshmi, M; Nisha, N; Jayakumar, R; Biswas, Raja

    2014-02-01

    This work reports the development of amidase encapsulated O-carboxymethyl chitosan nanoparticles (Ami-O-CMC NPs) of 300±50 nm size by ionic cross-linking method. The prepared Ami-O-CMC NPs had an encapsulation efficiency of 55.39%. Haemolysis assay and cytotoxicity studies proved the hemocompatibility and cytocompatibility of the prepared NPs. The sustained release of Ami from the NPs is expected to prolong its immunogenicity and in turn lead to development of better protective immunity against Staphylococcus aureus infections. Copyright © 2013 Elsevier B.V. All rights reserved.

  2. DIAGNOSTIC EFFICACY OF CARDIAC TROPONIN-T IN ACUTE MYOCARDIAL INFARCTION PATIENTS ADMITTED IN INTENSIVE CARDIAC CARE UNIT

    Directory of Open Access Journals (Sweden)

    Tapan

    2016-03-01

    Full Text Available INTRODUCTION Myocardial infarction is a common and severe manifestation of ischaemic heart disease (IHD. Acute myocardial infarction (AMI is the result of death of heart muscle cells following either from a prolonged or severe ischaemia. The World Health Organisation emphasises IHD as our "Modern Epidemic" and AMI as common cause of sudden death. AIM The present study has been undertaken with the aim to assess the role of cardiac Troponin-T in early diagnosis of AMI and to evaluate its positive roles over CK-MB and LDH enzyme assays. The study also aims to find out the role of cardiac Troponin-T test, where ECG changes are nondiagnostic and inconclusive for AMI. MATERIAL & METHOD One hundred cases of provisionally diagnosed AMI, who were admitted during June 2012 to July 2015 in ICC Unit of TMC & Dr. BRAM Teaching Hospital, formed the subjects for the study. Those patients reported 2 to 10 hours after onset of chest pain were included in this study. Patients reported beyond 10 hours after onset of chest pain of AMI cases and patients having chest pain of non-AMI causes are excluded from the study. The provisional diagnosis of AMI was done on the basis of the history, chest pain, clinical findings and ECG changes. Trop-T test (Troponin-T sensitive rapid test by Muller Bardoff, et al, 1991 as well as CK-MB (creatine kinase-MB isoenzymeassays were performed immediately for each and every patient. Trop-T test was repeated in some selective cases where the early changes were insignificant and the results were compared with those of CK-MB, at different period of the disease onset. RESULTS The rapid cardiac Troponin-T test (CTn-T has 100% specificity for AMI whereas CK-MB and LDH have specificities of 80% and 60% respectively. The CTn-T has diagnostic efficiency of 92% for AMI but ECG has only 69% sensitivity and 80% specificity. The overall diagnostic efficacy of cardiac Troponin-T is higher than that of CK-MB, LDH and ECG (94% versus 92%, 91 % and 72

  3. Activation of Inflammatory and Pro-Thrombotic Pathways in Acute Stress Cardiomyopathy

    Directory of Open Access Journals (Sweden)

    Timothy P. Fitzgibbons

    2017-08-01

    Full Text Available Stress cardiomyopathy (SCM is a unique cardiac disorder that more often occurs in women. SCM presents in a similar fashion as acute myocardial infarction (AMI, with chest pain, ECG changes, and congestive heart failure. The primary distinguishing feature is the absence of thrombotic coronary occlusion in SCM. How this reduction in cardiac function occurs in the absence of coronary occlusion remains unknown. Therefore, we tested the hypothesis that a targeted proteomic comparison of patients with acute SCM and AMI might identify relevant mechanistic differences. Blood was drawn in normal controls (n = 6, women with AMI (n = 12, or women with acute SCM (n = 15. Two-week follow-up samples were available in AMI (n = 4 and SCM patients (n = 11. Relative concentrations of 1,310 serum proteins were measured in each of the 48 samples using the SOMAscan assay. Women with AMI had greater myocyte necrosis, as reflected by a higher peak troponin I concentration (AMI 32.03 ± 29.46 vs. SCM 2.68 ± 2.6 ng/ml, p < 0.05. AMI and SCM patients had equivalent reductions in left ventricular ejection fraction [LVEF (% 39 ± 12 vs. 37 ± 12, p = 0.479]. In follow-up, women with SCM had a greater improvement in cardiac function [LVEF (% 60 ± 7 vs. 45 ± 13, p < 0.001]. No differentially expressed proteins were detected (absolute log2-fold change >1; q < 0.05 between AMI and SCM in the acute or recovery phase. However, when we compared normal controls to patients with AMI, there was differential expression of 35 proteins. When we compared normal controls to patients with SCM, 45 proteins were differentially expressed. In comparison to normal controls, biological processes such as complement, coagulation, and inflammation were activated in both AMI and SCM. There were four proteins that showed a non-significant trend to be increased in acute SCM vs. AMI (netrin-1, follistatin-like 3, kallikrein 7

  4. Dynamic changes in sRAGE levels and relationship with cardiac function in STEMI patients

    DEFF Research Database (Denmark)

    Jensen, Louise J N; Lindberg, Søren; Hoffmann, Søren

    2015-01-01

    the dynamic changes in sRAGE levels during AMI and relationship with cardiac dysfunction. DESIGN AND METHODS: We prospectively included 80 patients with ST-elevation myocardial infarction (STEMI) treated with primary percutaneous coronary intervention (pPCI). sRAGE concentrations were measured before p...... in the early phase of AMI; sRAGE levels significantly increased after pPCI compared with sRAGE before pPCI (median ratio: 1.25, 95% CI: 1.15-1.35, P...phase rather than in the days after AMI and pPCI. The increase...

  5. The proof of (un)certainty: diagnostic research on 'chest pain' in a GP setting

    OpenAIRE

    Bruyninckx, Rudi

    2010-01-01

    Over the last 20 years, a substantial change in the epidemiology of acute myocardial syndrome (ACS) has occurred. Non-ST-segment elevation myocardial infarction (NSTEMI) now constitutes the majority of AMIs and the 30-days fatality rate of hospitalized AMI patients has improved markedly with a decrease of 56%.(1) One of the reasons for the decrease is the decline in AMI severity, probably due to the contribution of prevention therapy and the use of aspirin and beta-blockers before admission.(...

  6. Intrusion detection system using Online Sequence Extreme Learning Machine (OS-ELM) in advanced metering infrastructure of smart grid.

    Science.gov (United States)

    Li, Yuancheng; Qiu, Rixuan; Jing, Sitong

    2018-01-01

    Advanced Metering Infrastructure (AMI) realizes a two-way communication of electricity data through by interconnecting with a computer network as the core component of the smart grid. Meanwhile, it brings many new security threats and the traditional intrusion detection method can't satisfy the security requirements of AMI. In this paper, an intrusion detection system based on Online Sequence Extreme Learning Machine (OS-ELM) is established, which is used to detecting the attack in AMI and carrying out the comparative analysis with other algorithms. Simulation results show that, compared with other intrusion detection methods, intrusion detection method based on OS-ELM is more superior in detection speed and accuracy.

  7. Model Driven Development of Agents for Ambient Intelligence

    OpenAIRE

    Ayala Viñas, Inmaculada

    2013-01-01

    En esta tesis se define un proceso dirigido por modelos para el desarrollo de sistemas de Inteligencia Ambiental (AmI) basados en agentes auto-gestionados que pueden ser ejecutados en los dispositivos más usuales de los entornos AmI, teléfonos inteligentes o sensores. Nuestra solución está centrada en una arquitectura de MAS totalmente distribuida y descentralizada, gracias a la integración de los agentes en los dispositivos heterogéneos que suelen formar parte de un sistema AmI.

  8. Development and Integration of a HEMS with an Advanced Smart Metering Infrastructure

    DEFF Research Database (Denmark)

    Diaz, Enrique Rodriguez; Palacios-Garcia, Emilio; Savaghebi, Mehdi

    2016-01-01

    Advanced metering infrastructures (AMI) are required for the future smart grid operation by providing useful information about users’ behavior as well as grid performance such as the consumption and power quality. This paper is focused on the development of a LabVIEW application for user-interfac......Advanced metering infrastructures (AMI) are required for the future smart grid operation by providing useful information about users’ behavior as well as grid performance such as the consumption and power quality. This paper is focused on the development of a LabVIEW application for user......-interface and implementation of a Home Energy Management System (HEMS) based on AMI....

  9. Socio-economic impact assessment and community engagement to reduce conflict over mine operations

    Energy Technology Data Exchange (ETDEWEB)

    John Rolfe; Stewart Lockie [Central Queensland University, Qld. (Australia)

    2007-09-15

    The broad aim of this project was to assist coal mining companies develop effective processes for engaging with their communities and developing impact assessment and planning processes that can be agreed by their stakeholders. The range of project outcomes have been summarised in a series of reports, as follows. Report 1. Overview of social and economic issues associated with the Bowen Basin coal industry; Report 2. A review of environmental impact assessments (EIA) for coal mine developments and the use of economic and social impact assessment in the Bowen Basin - tools and trends; Report 3. Accounting for social and economic impacts in annual sustainability reporting; Report 4. Regional Economic impact assessment: an overview of the input-output methods; Report 5. The impact of coal industry development projects on the Central Highlands, Fitzroy and Queensland economies: An application of input-output method; Report 6. Regional Economic impact assessment: factors influencing workforce mobility to regional mining towns; Report 7. Social and economic impacts associated with changes in the coal mining industry in the Bowen Basin on the township of Blackwater; Report 8. Social and economic impacts associated with changes in the coal mining industry in the Bowen Basin on the Bauhinia Shire (Springsure and Rolleston); Report 9. Results of the extended stakeholder analysis (Blackwater); Report 10. Results of the extended stakeholder analysis (the Bauhinia Shire); and Report 11. Summary and Recommendations. This report includes a number of summary findings about the social and economic impacts of coal mining on the communities in the Bowen Basin. The approaches used are outlined and briefly discussed.

  10. Indigenous Elementary Students' Science Instruction in Taiwan: Indigenous Knowledge and Western Science

    Science.gov (United States)

    Lee, Huei; Yen, Chiung-Fen; Aikenhead, Glen S.

    2012-12-01

    This preliminary ethnographic investigation focused on how Indigenous traditional wisdom can be incorporated into school science and what students learned as a result. Participants included community elders and knowledge keepers, as well as 4th grade (10-year-old) students, all of Amis ancestry, an Indigenous tribe in Taiwan. The students' non-Indigenous teacher played a central role in developing a science module `Measuring Time' that combined Amis knowledge and Western science knowledge. The study identified two cultural worldview perspectives on time; for example, the place-based cyclical time held by the Amis, and the universal rectilinear time presupposed by scientists. Students' pre-instructional fragmented concepts from both knowledge systems became more informed and refined through their engagement in `Measuring Time'. Students' increased interest and pride in their Amis culture were noted.

  11. Blood count in new onset atrial fibrillation after acute myocardial infarction - A hypothesis generating study

    Directory of Open Access Journals (Sweden)

    Klaus Distelmaier

    2014-01-01

    Interpretation & conclusions: This study shows a significant independent association between serum haemoglobin, haematocrit, erythrocyte count and occurrence of AF after AMI. However, the pathophysiologic mechanism underlying these associations and its potential clinical applicability need to be further elucidated.

  12. Contribution of coagulation factor VII R353Q polymorphism to the ...

    African Journals Online (AJOL)

    Hanan Azzam

    2016-12-05

    Dec 5, 2016 ... Conclusion: FVII R353Q polymorphism did not contribute to an increased risk of thrombosis (arterial and venous); also .... smoking and obesity were assessed in the AMI and DVT groups as well as the control ..... perspectives.

  13. One-pot Reductive Amination of Carbonyl Compounds with NaBH4 ...

    Indian Academy of Sciences (India)

    Chemistry Department, Faculty of Science, Shahid Chamran University of Ahvaz, Ahvaz, Iran ... amination of aldehydes and ketones.1 Reductive ami- nation is a great and ..... sive Organic Synthesis B M Trost and I Fleming (Eds.) Vol.

  14. Internal Bleeding

    Science.gov (United States)

    ... Fractures (Part II) Additional Content Medical News Internal Bleeding By Amy H. Kaji, MD, PhD, Associate Professor, ... Emergency First Aid Priorities Cardiac Arrest Choking Internal Bleeding Severed or Constricted Limbs or Digits Soft-Tissue ...

  15. Clinical Manifestation of Acute Myocardial Infarction in the Elderly

    Directory of Open Access Journals (Sweden)

    Miftah Suryadipradja

    2003-12-01

    Full Text Available A retrospective study were performed in patients with acute myocardial infarction (AMI that hospitalized in ICCU Cipto Mangunkusumo hospital, Jakarta during the period of January 1994 until Decmber 1999. There were 513 patients hospitalized with MCI, 227 patients (44.2% were classified as elderly, and 35.2% of them were female. Most of the elderly AMI patients reported typical chest pain just like their younger counterparts. Elderly AMI patients tend to come later to the hospital, and more Q-wave myocardial infarction were identified compared to non- Q-wave myocardial infarction. Risk factors of diabetes mellitus and hypertension were more common among the elderly. The prevalence of atrial fibrillation and the mortality rate were higher among elderly AMI patients. (Med J Indones 2003; 12: 229-35 Keywords: clinical manifestation, acute myocardial infarction, elderly

  16. The Doppler echocardiographic myocardial performance index predicts left-ventricular dilation and cardiac death after myocardial infarction

    DEFF Research Database (Denmark)

    Møller, J E; Søndergaard, E; Poulsen, S H

    2001-01-01

    To investigate the value of the Doppler-derived myocardial performance index to predict early left-ventricular (LV) dilation and cardiac death after a first acute myocardial infarction (AMI), Doppler echocardiography was performed within 24 h of hospital admission, on day 5, 1 and 3 months after...... AMI in 125 consecutive patients. The index measured on day 1 correlated well with the change in end-diastolic volume index observed from day 1 to 3 months following AMI (r = 0.66, p 0.0001). One-year survival in patients with Doppler index index > or = 0......, we conclude that the Doppler echocardiographic myocardial performance index is a predictor of LV dilation and cardiac death after a first AMI....

  17. Plasma Ceramides as Prognostic Biomarkers and Their Arterial and Myocardial Tissue Correlates in Acute Myocardial Infarction

    Directory of Open Access Journals (Sweden)

    Leonardo P. de Carvalho, MD, PhD

    2018-04-01

    Full Text Available Summary: We identified a plasma signature of 11 C14 to C26 ceramides and 1 C16 dihydroceramide predictive of major adverse cardiovascular events in patients with acute myocardial infarction (AMI. Among patients undergoing coronary artery bypass surgery, those with recent AMI, compared with those without recent AMI, showed a significant increase in 5 of the signature’s 12 ceramides in plasma but not simultaneously-biopsied aortic tissue. In contrast, a rat AMI model, compared with sham control, showed a significant increase in myocardial concentrations of all 12 ceramides and up-regulation of 3 ceramide-producing enzymes, suggesting ischemic myocardium as a possible source of this ceramide signature. Key Words: acute coronary syndrome, ceramides, dihydroceramides, major adverse cardiovascular and cerebrovascular events, prognosis, risk prediction

  18. Significant decline in case fatality after acute myocardial infarction in Denmark--a population-based study from 1994 to 2001

    DEFF Research Database (Denmark)

    Abildstrom, Steen Z; Rasmussen, Søren; Madsen, Mette

    2002-01-01

    OBJECTIVE: We evaluated trends in in-hospital case fatality after acute myocardial infarction (AMI) in Denmark and analysed changes in the hospitalization rate for AMI. DESIGN: National population-based registries were used to identify patients (> or =30 years) who were admitted for their first AMI...... from 1994 to 2001. RESULTS: The annual relative decline in case-fatality rate was constant at 10.5% (95% confidence interval (CI) 9.5-11.5%). The decline was similar for both genders at all ages. The hospitalization rate decreased from 1994 to 1999 at an annual average of 4.3% (95% CI 3.......4-5.1%). In 2000 and 2001 the average annual increase was 7-8%. CONCLUSION: The case-fatality rate after AMI declined significantly in Denmark, similar to other Western countries, but the level is still higher than that of the USA. The increasing hospitalization rate coincided with changes in risk factors...

  19. A farmer becomes a social pedagogue

    DEFF Research Database (Denmark)

    Mellon, Karsten

    2016-01-01

    for bachelor programmes. This article examines the case of a woman named Amy, a mature, nontraditional university college student who becomes a social pedagogue. Because of severe allergies, Amy had to quit her job as a farmer and began to study to become a social pedagogue. Becoming a social pedagogue...... is a tremendously complex process that involves taking on a new professional identity and acquiring new skills. In order to ascertain the extent of this complexity, this article uses a psychosocietal approach derived from a Danish/German life history research approach. This article offers a brief presentation...... of the theoretical and methodological framework applied before analysing the process Amy undergoes to become a social pedagogue. The analysis demonstrates that this type of significant career change is demanding and, for Amy, filled with feelings of ambivalence and defensiveness....

  20. original articles

    African Journals Online (AJOL)

    1999-06-06

    Jun 6, 1999 ... dysplasia: long-term outcome. Ami V,orae Surg ... Prognosis and long-term development of .... sensory stimuli and to have subjective experiences. Impaired ... there was no evidence of cognitive skills, memory or reasoning,.

  1. Genetic Testing for Hereditary Colorectal Cancer

    Science.gov (United States)

    ... before 50). Dave has Lynch syndrome and had colorectal cancer at 28. Amy found out she has Lynch syndrome when she was diagnosed with colorectal cancer days after turning 47. Why is it Important ...

  2. Love, lust and the emotional context of multiple and concurrent ...

    African Journals Online (AJOL)

    Love, lust and the emotional context of multiple and concurrent sexual partnerships among young Swazi adults. Allison Ruark, Lunga Dlamini, Nonhlanhla Mazibuko, Edward C Green, Caitlin Kennedy, Amy Nunn, Timothy Flanigan, Pamela J Surkan ...

  3. A search for the formation of the quark-gluon plasma by measurement of cross sections for direct photons and leptons: Annual progress report, April 1, 1986-March 31, 1987

    International Nuclear Information System (INIS)

    Kirk, P.N.

    1986-01-01

    Research of The Intermediate Energy Nuclear Physics Group are presented. Contributions of this group to the DLS and the AMY collaborations are outlined. A list of publications, theses, honors, and distinctions associated with this research are given

  4. 77 FR 11152 - Notice of Intent To Prepare a Revision to the Carson City District Resource Management Plan and...

    Science.gov (United States)

    2012-02-24

    ... and schedule considerations; (12) The RMP revision will incorporate and observe the principles of...; sociology and economics; and Geographic Information Systems. Authority: 40 CFR 1501.7, 43 CFR 1610.2. Amy...

  5. 75 FR 10293 - Office of Biotechnology Activities; Office of Science Policy; Office of the Director; Notice of a...

    Science.gov (United States)

    2010-03-05

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Office of Biotechnology... meeting, please contact Ms. Laurie Lewallen, Advisory Committee Coordinator, Office of Biotechnology...: March 1, 2010. Amy P. Patterson, Director, Office of Biotechnology Activities, National Institutes of...

  6. Facing Fibromyalgia | NIH MedlinePlus the Magazine

    Science.gov (United States)

    ... of this page please turn JavaScript on. Feature: Fibromyalgia Facing Fibromyalgia Past Issues / Spring 2016 Table of Contents Amy ... conditions. When did you start having symptoms of fibromyalgia? I actually think I've had it since ...

  7. Trends in hospital discharges, management and in-hospital mortality from acute myocardial infarction in Switzerland between 1998 and 2008

    Science.gov (United States)

    2013-01-01

    Background Since the late nineties, no study has assessed the trends in management and in-hospital outcome of acute myocardial infarction (AMI) in Switzerland. Our objective was to fill this gap. Methods Swiss hospital discharge database for years 1998 to 2008. AMI was defined as a primary discharge diagnosis code I21 according to the ICD10 classification. Invasive treatments and overall in-hospital mortality were assessed. Results Overall, 102,729 hospital discharges with a diagnosis of AMI were analyzed. The percentage of hospitalizations with a stay in an Intensive Care Unit decreased from 38.0% in 1998 to 36.2% in 2008 (p for trend Switzerland, a steep rise in hospital discharges and in revascularization procedures for AMI occurred between 1998 and 2008. The increase in revascularization procedures could explain the decrease in in-hospital mortality rates. PMID:23530470

  8. Reasons for Intrauterine Device Use, Discontinuation and Non-Use ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    in Malawi: A Qualitative Study of Women and their Partners. Amy G. Bryant. 1* ... Women and their partners expressed a strong desire for family planning, and perceived numerous benefits of the IUD. However, ..... Health Organization. Beyond ...

  9. Naisfotograafid, kes avavad meie silmad / Katie Breen

    Index Scriptorium Estoniae

    Breen, Katie

    2008-01-01

    Fotograafid Ami Vitale, Helene David, Stephanie Sinclair, Lauren Greenfield, Deirdre Brennan, Veronique de Viguerie, Christine Spengler pildistavad võõraid kultuure Aafrikas, Alaskal, Afganistanis, Iraagis. 9 fotot. Portreefotod fotograafidest

  10. Meta-analysis of cell-based CaRdiac stUdiEs (ACCRUE) in patients with acute myocardial infarction based on individual patient data

    DEFF Research Database (Denmark)

    Gyöngyösi, Mariann; Wojakowski, Wojciech; Lemarchand, Patricia

    2015-01-01

    RATIONALE: The meta-Analysis of Cell-based CaRdiac study is the first prospectively declared collaborative multinational database, including individual data of patients with ischemic heart disease treated with cell therapy. OBJECTIVE: We analyzed the safety and efficacy of intracoronary cell...... therapy after acute myocardial infarction (AMI), including individual patient data from 12 randomized trials (ASTAMI, Aalst, BOOST, BONAMI, CADUCEUS, FINCELL, REGENT, REPAIR-AMI, SCAMI, SWISS-AMI, TIME, LATE-TIME; n=1252). METHODS AND RESULTS: The primary end point was freedom from combined major adverse.......1), end-diastolic volume, or systolic volume were observed compared with controls. These results were not influenced by anterior AMI location, reduced baseline ejection fraction, or the use of MRI for assessing left ventricular parameters. CONCLUSIONS: This meta-analysis of individual patient data from...

  11. Diagnosing and treating acute myocardial infarction in pregnancy.

    LENUS (Irish Health Repository)

    Merrigan, Orla

    2012-02-01

    Acute myocardial infarction (AMI) in pregnancy is a very rare occurrence. However, statistics indicate high mortality rates, with a maternal death rate at 20-37%. Nursing and medical care of AMI in pregnancy is a very complex issue. Risk factors such as stress, smoking, obesity, high cholesterol and family history of heart disease may increase the risk of AMI in pregnancy. There are a variety of challenges for the nurse caring for this patient, as the presenting signs and symptoms of AMI in pregnancy can mimic regular pregnancy symptoms and therefore may be misdiagnosed. There is limited nursing literature on this topic to guide and educate nurses. Recommendations need to be implemented across multiple nursing settings. There is a need for both national and international guidelines on care of this type of patient. There is also a need for policies to be in place and links within the hospital setting and the community.

  12. Intracoronary and systemic melatonin to patients with acute myocardial infarction

    DEFF Research Database (Denmark)

    Halladin, Natalie L; Busch, Sarah Ekeløf; Jensen, Svend Eggert

    2014-01-01

    INTRODUCTION: Ischaemia-reperfusion injury following acute myocardial infarctions (AMI) is an unavoidable consequence of the primary percutaneous coronary intervention (pPCI) procedure. A pivotal mechanism in ischaemia-reperfusion injury is the production of reactive oxygen species following...

  13. Valuation of measurement data for low voltage network expansion planning

    NARCIS (Netherlands)

    Nijhuis, M.; Gibescu, M.; Cobben, J.F.G.

    2017-01-01

    The introduction of electric vehicles and photovoltaics is changing the residential electricity consumption. Distribution network operators (DNO) are investing in an advanced metering infrastructure (AMI) to enable cost reduction through smart grid applications. The DNO also benefits from the

  14. Service-oriented advanced metering infrastructure for smart grids

    NARCIS (Netherlands)

    Chen, S.; Lukkien, J.J.; Zhang, L.

    2011-01-01

    Advanced Metering Infrastructure (AMI) enables smart grids to involve power consumers in the business process of power generation transmission, distribution and consumption. However, the participant of consumers challenges the current power systems with system integration and cooperation and

  15. Service-oriented advanced metering infrastructure for smart grids

    NARCIS (Netherlands)

    Chen, S.; Lukkien, J.J.; Zhang, L.

    2010-01-01

    Advanced Metering Infrastructure (AMI) enables smart grids to involve power consumers in the business process of power generation, transmission, distribution and consumption. However, the participant of consumers challenges the current power systems with system integration and cooperation and

  16. Prognostic impact of atrial fibrillation in patients with acute myocardial infarction

    Directory of Open Access Journals (Sweden)

    Shunta Tateyama, MD

    2014-12-01

    Conclusions: AF is a common complication of AMI and associated with a more complicated clinical course. However, AF is not an independent predictor of both in-hospital and long-term mortalities in the PCI era.

  17. Human aspects in ambient intelligence contemporary challenges and solutions

    CERN Document Server

    Bosse, Tibor; Neerincx, Mark

    2013-01-01

    This book presents recent developments in the field of human aspects in Ambient Intelligence. It addresses multidisciplinary aspects of AmI with human-directed disciplines such as psychology, social science, neuroscience and biomedical sciences.

  18. The septins

    National Research Council Canada - National Science Library

    Hall, Peter A; Russell, S.E. Hilary; Pringle, John R

    2008-01-01

    ... and Caenorhabditis elegans Christine M. Field, Amy Shaub Maddox, John R. Pringle and Karen Oegema 147 Section III Septins in mammals 169 Chapter 7 The genomics and regulation of the human septin genes S.E....

  19. Genetic dissection reveals effects of interaction between high ...

    Indian Academy of Sciences (India)

    2013-04-15

    Apr 15, 2013 ... Wheat quality is mainly influenced by protein and starch, which are responsible for ... Starch contains two components: amylose and amy- lopectin. .... (Voorrips 2002). The QTL analysis was performed and the main effect QTL.

  20. Digital forensics issues in advanced metering infrastructure | Ibrahim ...

    African Journals Online (AJOL)

    Journal Home > Vol 10, No 6S (2018) > ... the architecture of telecommunications and energy infrastructure, along with Internet networks. Various ... A core component of the smart grid is advanced metering infrastructure (AMI), in which a utility ...