WorldWideScience

Sample records for humphreys ai korea

  1. Humans and Machines in the Evolution of AI in Korea

    OpenAIRE

    Zhang, Byoung-Tak

    2016-01-01

    Artificial intelligence in Korea is currently prospering. The media is regularly reporting AI-enabled products such as smart advisors, personal robots, autonomous cars, and human-level intelligence machines. The IT industry is investing in deep learning and AI to maintain the global competitive edge in their services and products. The Ministry of Science, ICT, and Future Planning (MSIP) has launched new funding programs in AI and cognitive science to implement the government’s newly adopted e...

  2. Ai

    African Journals Online (AJOL)

    :=g=~!Ai~~~~~g~~ ~~~~~~. Jim Taylor, Rob O'Donoghue and Alistair Clacherty. INTRODUCTION. The Department of Environment Affairs, in cooperation with ...

  3. AIS authentication

    CERN Multimedia

    2006-01-01

    Users are invited to use the NICE password for AIS authentication. As announced in CNL June-August 2006 (see http://www.cerncourier.com/articles/cnl/3/6/14/1) it is possible to use the NICE username and password to log on to AIS. The procedure is now fully operational and users can themselves reset the AIS password such that the NICE password will be used for authentication required by AIS applications. We strongly recommend CERN users who have a NICE account (this is the case of most users) to do this, with the objective to reduce the number of passwords they need to remember. This can be achieved very easily, directly from the Change Password option on the AIS login (https://aislogin.cern.ch/). Users should just select the '[Change Password]' option displayed at the bottom of the page, provide the 'Old Password' and then click on the button 'Use Nice password' followed by 'Submit'. Change Password option on the AIS login windowSetting the AIS password - Use Nice Password It should be noted that the proce...

  4. Comparison of Peristat Online Perimetry with the Humphrey Perimetry in a Clinic-Based Setting

    OpenAIRE

    Lowry, Eugene A.; Hou, Jing; Hennein, Lauren; Chang, Robert T.; Lin, Shan; Keenan, Jeremy; Wang, Sean K.; Ianchulev, Sean; Pasquale, Louis R.; Han, Ying

    2016-01-01

    Purpose We determined the receiver operating characteristic (ROC) curves for Peristat online perimetry at detecting varying degrees of glaucoma and the correlation between Peristat online perimetry and Humphrey visual field. Methods: A prospective, comparative study of Peristat online perimetry (an achromatic static computer threshold testing program) and Humphrey visual field (HVF) 24-2 SITA standard testing was performed by 63 glaucoma patients and 30 healthy controls in random order. The n...

  5. Visual field examination method using virtual reality glasses compared with the Humphrey perimeter

    Directory of Open Access Journals (Sweden)

    Tsapakis S

    2017-08-01

    Full Text Available Stylianos Tsapakis, Dimitrios Papaconstantinou, Andreas Diagourtas, Konstantinos Droutsas, Konstantinos Andreanos, Marilita M Moschos, Dimitrios Brouzas 1st Department of Ophthalmology, National and Kapodistrian University of Athens, Athens, Greece Purpose: To present a visual field examination method using virtual reality glasses and evaluate the reliability of the method by comparing the results with those of the Humphrey perimeter.Materials and methods: Virtual reality glasses, a smartphone with a 6 inch display, and software that implements a fast-threshold 3 dB step staircase algorithm for the central 24° of visual field (52 points were used to test 20 eyes of 10 patients, who were tested in a random and consecutive order as they appeared in our glaucoma department. The results were compared with those obtained from the same patients using the Humphrey perimeter.Results: High correlation coefficient (r=0.808, P<0.0001 was found between the virtual reality visual field test and the Humphrey perimeter visual field.Conclusion: Visual field examination results using virtual reality glasses have a high correlation with the Humphrey perimeter allowing the method to be suitable for probable clinical use. Keywords: visual fields, virtual reality glasses, perimetry, visual fields software, smartphone

  6. Humphrey Davy and the Safety Lamp: The Use of Metal Gauze as a Flame Barrier

    Science.gov (United States)

    Mills, Allan

    2015-01-01

    The "safety lamp" invented by Humphrey Davy in 1815 utilised the cooling effect of metal gauze to prevent the flame of a candle or oil lamp (essential for illumination in mines) from passing through such a screen. It is therefore rendered unable to ignite any potentially explosive mixture of air and methane in the atmosphere surrounding…

  7. Artificial Intelligence Study (AIS).

    Science.gov (United States)

    1987-02-01

    ARTIFICIAL INTELLIGNECE HARDWARE ....... 2-50 AI Architecture ................................... 2-49 AI Hardware ....................................... 2...ftf1 829 ARTIFICIAL INTELLIGENCE STUDY (RIS)(U) MAY CONCEPTS 1/3 A~NLYSIS AGENCY BETHESA RD R B NOJESKI FED 6? CM-RP-97-1 NCASIFIED /01/6 M |K 1.0...p/ - - ., e -- CAA- RP- 87-1 SAOFŔ)11 I ARTIFICIAL INTELLIGENCE STUDY (AIS) tNo DTICFEBRUARY 1987 LECT 00 I PREPARED BY RESEARCH AND ANALYSIS

  8. T'ai Chi

    Science.gov (United States)

    ... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

  9. Modeling Progress in AI

    OpenAIRE

    Brundage, Miles

    2015-01-01

    Participants in recent discussions of AI-related issues ranging from intelligence explosion to technological unemployment have made diverse claims about the nature, pace, and drivers of progress in AI. However, these theories are rarely specified in enough detail to enable systematic evaluation of their assumptions or to extrapolate progress quantitatively, as is often done with some success in other technological domains. After reviewing relevant literatures and justifying the need for more ...

  10. Areal Informations Systemet - AIS

    DEFF Research Database (Denmark)

    Nielsen, K.; Stjernholm, M.; Olsen, B. Ø.

    Forord: Denne rapport giver en kort beskrivelse af Areal Informations Systemet (AIS), som er et databasesystem med natur- og miljødata, som kan stedfæstes geografisk. Projektet er gennemført i perioden 1996-2000 som et samarbejdsprojekt mellem Danmarks Miljøundersøgelser (DMU), Danmarks og...... og enkeltpersoner med interesse for natur- og miljøforhold i Danmark. Yderligere oplysninger om Areal Informations Systemet, herunder adgangsforhold, kan fås på DMU's hjemmeside med følgende adresse: http://ais.dmu.dk/ Projektet er finansieret af Miljø- og Energiministeriet, mens en række...... (planlægning, beskyttelse), geologi (overfladegeologi og marin geologi), samt marin dybdemodel. # Etablering af dataadgang for Miljø- og Energiministeriets institutioner til AIS-data. # Afprøvning af systemet i forhold til konkrete projekter. # Formidling af produkterne til brugerkredsen....

  11. MassAI

    DEFF Research Database (Denmark)

    2011-01-01

    A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX.......A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX....

  12. Visual discrimination training improves Humphrey perimetry in chronic cortically induced blindness.

    Science.gov (United States)

    Cavanaugh, Matthew R; Huxlin, Krystel R

    2017-05-09

    To assess if visual discrimination training improves performance on visual perimetry tests in chronic stroke patients with visual cortex involvement. 24-2 and 10-2 Humphrey visual fields were analyzed for 17 chronic cortically blind stroke patients prior to and following visual discrimination training, as well as in 5 untrained, cortically blind controls. Trained patients practiced direction discrimination, orientation discrimination, or both, at nonoverlapping, blind field locations. All pretraining and posttraining discrimination performance and Humphrey fields were collected with online eye tracking, ensuring gaze-contingent stimulus presentation. Trained patients recovered ∼108 degrees 2 of vision on average, while untrained patients spontaneously improved over an area of ∼16 degrees 2 . Improvement was not affected by patient age, time since lesion, size of initial deficit, or training type, but was proportional to the amount of training performed. Untrained patients counterbalanced their improvements with worsening of sensitivity over ∼9 degrees 2 of their visual field. Worsening was minimal in trained patients. Finally, although discrimination performance improved at all trained locations, changes in Humphrey sensitivity occurred both within trained regions and beyond, extending over a larger area along the blind field border. In adults with chronic cortical visual impairment, the blind field border appears to have enhanced plastic potential, which can be recruited by gaze-controlled visual discrimination training to expand the visible field. Our findings underscore a critical need for future studies to measure the effects of vision restoration approaches on perimetry in larger cohorts of patients. Copyright © 2017 The Author(s). Published by Wolters Kluwer Health, Inc. on behalf of the American Academy of Neurology.

  13. Tweeting AI: Perceptions of AI-Tweeters (AIT) vs Expert AI-Tweeters (EAIT)

    OpenAIRE

    Manikonda, Lydia; Dudley, Cameron; Kambhampati, Subbarao

    2017-01-01

    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals started debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users from two categories -- general AI-Tweeters (AIT) and the expert AI-Tweeters (EAIT) who ...

  14. AIS ASM Operational Integration Plan

    Science.gov (United States)

    2013-08-01

    Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary AIS ASM Operational... AIS ASM Operational Integration Plan Distribution Statement A: Approved for public release; distribution is unlimited. August 2013 Report No...CD-D-07-15 AIS ASM Operational Integration Plan ii UNCLAS//Public | CG-926 R&DC | I. Gonin, et al. | Public August 2013 N O T I C

  15. General general game AI

    OpenAIRE

    Togelius, Julian; Yannakakis, Georgios N.; 2016 IEEE Conference on Computational Intelligence and Games (CIG)

    2016-01-01

    Arguably the grand goal of artificial intelligence research is to produce machines with general intelligence: the capacity to solve multiple problems, not just one. Artificial intelligence (AI) has investigated the general intelligence capacity of machines within the domain of games more than any other domain given the ideal properties of games for that purpose: controlled yet interesting and computationally hard problems. This line of research, however, has so far focuse...

  16. AI and health

    OpenAIRE

    Martin Anderson

    2018-01-01

    ntelligence refers to the ability of an individual to learn or understand something, or to deal with a new situation. When a machine or software exhibits such characteristics, it is referred to as artificial intelligence (AI). Artificial Intelligence is therefore defined as the theory and development of computer systems able to perform tasks that normally require human intelligence, such as visual perception, speech recognition, decision-making, and translation between languages.

  17. AI and Mathematical Education

    Directory of Open Access Journals (Sweden)

    Angel Garrido

    2012-01-01

    Full Text Available From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI. Great mathematical minds have played a key role in AI in recent years; to name only a few: Janos Neumann (also known as John von Neumann, Konrad Zuse, Norbert Wiener, Claude E. Shannon, Alan M. Turing, Grigore Moisil, Lofti A. Zadeh, Ronald R. Yager, Michio Sugeno, Solomon Marcus, or Lászlo A. Barabási. Introducing the study of AI is not merely useful because of its capability for solving difficult problems, but also because of its mathematical nature. It prepares us to understand the current world, enabling us to act on the challenges of the future.

  18. 76 FR 2432 - Bureau of Educational and Cultural Affairs (ECA) Request for Grant Proposals: FY2012 Humphrey...

    Science.gov (United States)

    2011-01-13

    ... countries' development needs in key areas including public health, sustainable growth, and democratic... leadership skills for public service in their countries. Each year the Humphrey Program brings accomplished... combining non-degree graduate study, leadership training, and professional development. Candidates for the...

  19. AI 3D Cybug Gaming

    OpenAIRE

    Ahmed, Zeeshan

    2010-01-01

    In this short paper I briefly discuss 3D war Game based on artificial intelligence concepts called AI WAR. Going in to the details, I present the importance of CAICL language and how this language is used in AI WAR. Moreover I also present a designed and implemented 3D War Cybug for AI WAR using CAICL and discus the implemented strategy to defeat its enemies during the game life.

  20. AI its nature and future

    CERN Document Server

    Boden, Margaret A

    2016-01-01

    least - on the Internet. Margaret Boden considers the realistic and unrealistic expectations we have placed on AI, analyses its progress, and considers the value of its byproducts. ations we have placed on AI, analyses its progress, and considers the value of its byproducts.

  1. Spanish-Language Adaptation of Morgeson and Humphrey's Work Design Questionnaire (WDQ).

    Science.gov (United States)

    Fernández Ríos, Manuel; Ramírez Vielma, Raúl G; Sánchez García, José Carlos; Bargsted Aravena, Mariana; Polo Vargas, Jean David; Ruiz Díaz, Miguel Ángel

    2017-06-09

    Since work organizations became the subject of scientific research, how to operationalize and measure dimensions of work design has been an issue, mainly due to concerns about internal consistency and factor structure. In response, Morgeson and Humphrey (2006) built the Work Design Questionnaire -WDQ-, an instrument that identifies and measures these dimensions in different work and organizational contexts. This paper presents the instruent's adaptation into Spanish using reliability and validity analysis and drawing on a sample of 1035 Spanish workers who hold various jobs in an array of occupational categories. The total instrument's internal consistency was Cronbach's alpha of .92 and the various scales' reliability ranged from .70 to .96, except for three dimensions. There was initially a difference in the comparative fit of the two versions' factor structures, but the model with 21 work characteristics (motivational -task and knowledge-, social, and work context) showed the highest goodness of fit of the various models tested, confirming previous results from the U.S. version as well as adaptations into other languages and contexts. CFA results indicated goodness of fit of factor configurations corresponding to each of the four major categories of work characteristics, with CFI and TLI around .90, as well as SRMR and RMSEA below .08. Thus it brings to the table a reliable, valid measure of work design with clear potential applications in research as well as professional practice, applications that could improve working conditions, boost productivity, and generate more personal and professional development opportunities for workers.

  2. South Korea

    International Nuclear Information System (INIS)

    Hayes, P.

    1990-01-01

    South Korea aspires to become a major nuclear supplier in the world nuclear market. There is no doubt that South Korea has great potential to fulfill these aspirations. South Korea is well positioned in terms of competitiveness, market relationships, institutional capability, ability to deliver, and commitment to nonproliferation values. As a mercantilist state, South Korea hopes to capitalize on its close relationships with transnational nuclear corporations in this endeavor. It hopes to participate in two- or three-way joint ventures---especially with the American firms that have traditionally predominated in the South Korean domestic nuclear business---to market their nuclear wares abroad. This paper is divided into four parts. The first section describes South Korea's intent to become a nuclear supplier in the 1990s. It delineates the networks of prior transactions and relationships that South Korea may use to penetrate export markets. The second section reviews South Korea's nuclear export potential, particularly its technological acquisitions from the domestic nuclear program. These capabilities will determine the rate at which South Korea can enter specific nuclear markets. The third section describes the institutional framework in South Korea for the review and approval of nuclear exports

  3. The luminosities of cool supergiants in the Magellanic Clouds, and the Humphreys-Davidson limit revisited

    Science.gov (United States)

    Davies, Ben; Crowther, Paul A.; Beasor, Emma R.

    2018-05-01

    The empirical upper luminosity boundary Lmax of cool supergiants, often referred to as the Humphreys-Davidson limit, is thought to encode information on the general mass-loss behaviour of massive stars. Further, it delineates the boundary at which single stars will end their lives stripped of their hydrogen-rich envelope, which in turn is a key factor in the relative rates of Type-II to Type-Ibc supernovae from single star channels. In this paper we have revisited the issue of Lmax by studying the luminosity distributions of cool supergiants (SGs) in the Large and Small Magellanic Clouds (LMC/SMC). We assemble samples of cool SGs in each galaxy which are highly-complete above log L/L⊙=5.0, and determine their spectral energy distributions from the optical to the mid-infrared using modern multi-wavelength survey data. We show that in both cases Lmax appears to be lower than previously quoted, and is in the region of log L/L⊙=5.5. There is no evidence for Lmax being higher in the SMC than in the LMC, as would be expected if metallicity-dependent winds were the dominant factor in the stripping of stellar envelopes. We also show that Lmax aligns with the lowest luminosity of single nitrogen-rich Wolf-Rayet stars, indicating of a change in evolutionary sequence for stars above a critical mass. From population synthesis analysis we show that the Geneva evolutionary models greatly over-predict the numbers of cool SGs in the SMC. We also argue that the trend of earlier average spectral types of cool SGs in lower metallicity environments represents a genuine shift to hotter temperatures. Finally, we use our new bolometric luminosity measurements to provide updated bolometric corrections for cool supergiants.

  4. Code AI Personal Web Pages

    Science.gov (United States)

    Garcia, Joseph A.; Smith, Charles A. (Technical Monitor)

    1998-01-01

    The document consists of a publicly available web site (george.arc.nasa.gov) for Joseph A. Garcia's personal web pages in the AI division. Only general information will be posted and no technical material. All the information is unclassified.

  5. [North] Korea.

    Science.gov (United States)

    1986-05-01

    In 1985, the population of the Democratic People's Republic of Korea (North Korea) stood at 20 million, with an annual growth rate of 2.3%. The infant mortality rate was 30/1000 live births and life expectancy was 66 years. The gross national product (GNP) was US$23 billion in 1984, with a per capita GNP of $1175. Both North Korea's labor force and natural resources have been concentrated in recent years on an effort to achieve rapid economic development. During the early 1970s, a large-scale modernization program involving the importation of Western technology, primarily in the heavy industiral sectors of the economy, was attempted and resulted in a massive foreign debt. North Korea has a strongly centralized government under the control of the communist Korean Workers' Party. Literacy in the country is at the 99% level. Medical treatment is free. There is 1 physician/600 population and 1 hospital bed/350 inhabitants.

  6. harnessing_ai_20180319.pptx

    OpenAIRE

    Johnson, Matthew

    2018-01-01

    There have been great strides made in Artificial Intelligence in recent years, but it is often not clear how to apply these recent advances to new problems. In this talk I propose one method of thinking about problems in the sciences and how to find the right AI techniques to aid in research.

  7. An Image of Britain during the Second World War: The films of Humphrey Jennings (1939-1945 Une image de la Grande-Bretagne pendant la Seconde Guerre mondiale : les films de Humphrey Jennings (1939-1945

    Directory of Open Access Journals (Sweden)

    Elena Von Kassel

    2009-10-01

    Full Text Available Il s’agit de chercher à comprendre comment le style poétique a pu atteindre des sommets avec les films de Humphrey Jennings dans le documentaire anglais et comment ces films résultent d’un mélange entre deux traditions du cinéma britannique, traditions jusque-là opposées. A l’initiative d’Alberto Cavalcanti, en 1939, The First Days, coréalisé par Humphrey Jennings, Harry Watt et Pat Jackson, fut, au tout début la guerre, le premier film offrant une réflexion sur des réalités, lorsque l’on avait essayé de manipuler le public dans Le lion a des ailes, tourné la même année, mais aussi  le premier film anglais de propagande de la Seconde Guerre mondiale, dont Alexander Korda avait lancé et soutenu la réalisation. Quand, partant pour Ealing Studios, Cavalcanti quitte la direction de la GPO Film Unit, il est remplacé par Ian Dalrymple, le producteur du film Le lion a des ailes. C’est sous la direction de Dalrymple qu’au GPO, désormais appelé Crown Film Unit, un nouveau genre de film put émerger. Dans cet esprit démocratique, après The First Days, fut tourné en coréalisation London Can Take It (1940, par Humphrey Jennings et Harry Watt, le thème portant sur la façon dont les Londoniens supportaient les bombardements. Puis, Jennings a réalisé Heart of Britain, le thème portant, cette fois, sur la résistance de toute l’Angleterre. Words for Battle, qui suivit, était un film de propagande historique. Toutefois, c’est avec Listen to Britain, en 1942, que Jennings put vraiment toucher le public. La guerre n’était pas encore gagnée, mais la propagande dans le documentaire anglais était bien plus efficace que celle de l’ennemi, et parvenait, en même temps, à toucher toutes les couches de la population.

  8. Organisational intelligence and distributed AI

    OpenAIRE

    Kirn, Stefan

    1995-01-01

    The analysis of this chapter starts from organisational theory, and from this it draws conclusions for the design, and possible organisational applications, of Distributed AI systems. We first review how the concept of organisations has emerged from non-organised black-box entities to so-called computerised organisations. Within this context, organisational researchers have started to redesign their models of intelligent organisations with respect to the availability of advanced computing tec...

  9. Optimizing Limousine Service with AI

    OpenAIRE

    Chun, Andy Hon Wai

    2011-01-01

    A common problem for companies with strong business growth is that it is hard to find enough experienced staff to support expansion needs. This problem is particular pronounced for operations planners and controllers who must be very highly knowledgeable and experienced with the business domain. This article is a case study of how one of the largest travel agencies in Hong Kong alleviated this problem by using AI to support decision-making and problem-solving so that their planners and contro...

  10. An SDR based AIS receiver for satellites

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2011-01-01

    For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

  11. USACE AIS Transmit Technical Support Summary Report

    Science.gov (United States)

    2014-09-01

    the TAG block for the correct transmitters, and then send to the USACE AIS network. B. Outbound openings in the USCG firewall for the USCG Message...USACE AIS Transmit Technical Support Summary Report Distribution Statement A: Approved for public release; distribution is unlimited...September 2014 Report No. CD-D-09-15 USACE AIS Transmit Technical Support Summary Report ii UNCLAS//Public | CG-926 RDC | I. Gonin et al. Public

  12. Adaptive Motion Gaming AI for Health Promotion

    OpenAIRE

    Paliyawan, Pujana; Kusano, Takahiro; Nakagawa, Yuto; Harada, Tomohiro; Thawonmas, Ruck

    2017-01-01

    This paper presents a design of a non-player character (AI) for promoting balancedness in use of body segments when engaging in full-body motion gaming. In our experiment, we settle a battle between the proposed AI and a player by using FightingICE, a fighting game platform for AI development. A middleware called UKI is used to allow the player to control the game by using body motion instead of the keyboard and mouse. During gameplay, the proposed AI analyze health states of the player; it d...

  13. Beyond AI: Artificial Dreams Conference

    CERN Document Server

    Zackova, Eva; Kelemen, Jozef; Beyond Artificial Intelligence : The Disappearing Human-Machine Divide

    2015-01-01

    This book is an edited collection of chapters based on the papers presented at the conference “Beyond AI: Artificial Dreams” held in Pilsen in November 2012. The aim of the conference was to question deep-rooted ideas of artificial intelligence and cast critical reflection on methods standing at its foundations.  Artificial Dreams epitomize our controversial quest for non-biological intelligence, and therefore the contributors of this book tried to fully exploit such a controversy in their respective chapters, which resulted in an interdisciplinary dialogue between experts from engineering, natural sciences and humanities.   While pursuing the Artificial Dreams, it has become clear that it is still more and more difficult to draw a clear divide between human and machine. And therefore this book tries to portrait such an image of what lies beyond artificial intelligence: we can see the disappearing human-machine divide, a very important phenomenon of nowadays technological society, the phenomenon which i...

  14. Korea prospects

    International Nuclear Information System (INIS)

    Wyman, V.

    1990-01-01

    Contacts between the South Korean nuclear industry and a combined United Kingdom mission representing AEA Technology and British Nuclear Fuels Limited (BNFL) are reported. Prospects for entering the Korean market in two areas are perceived. The first is waste management and the second is the Safe Integral Reactor (SIR), an advanced pressurized water reactor design. AEA Technology and three collaborators have been promoting SIR as an inherently safe reactor design. Korean interest could be expressed in financial backing for the building of SIR stations in Korea and the opportunity could arise for BNFL to win fuel supply contracts. (UK)

  15. Mapping the Structure-Function Relationship in Glaucoma and Healthy Patients Measured with Spectralis OCT and Humphrey Perimetry

    Science.gov (United States)

    Muñoz–Negrete, Francisco J.; Oblanca, Noelia; Rebolleda, Gema

    2018-01-01

    Purpose To study the structure-function relationship in glaucoma and healthy patients assessed with Spectralis OCT and Humphrey perimetry using new statistical approaches. Materials and Methods Eighty-five eyes were prospectively selected and divided into 2 groups: glaucoma (44) and healthy patients (41). Three different statistical approaches were carried out: (1) factor analysis of the threshold sensitivities (dB) (automated perimetry) and the macular thickness (μm) (Spectralis OCT), subsequently applying Pearson's correlation to the obtained regions, (2) nonparametric regression analysis relating the values in each pair of regions that showed significant correlation, and (3) nonparametric spatial regressions using three models designed for the purpose of this study. Results In the glaucoma group, a map that relates structural and functional damage was drawn. The strongest correlation with visual fields was observed in the peripheral nasal region of both superior and inferior hemigrids (r = 0.602 and r = 0.458, resp.). The estimated functions obtained with the nonparametric regressions provided the mean sensitivity that corresponds to each given macular thickness. These functions allowed for accurate characterization of the structure-function relationship. Conclusions Both maps and point-to-point functions obtained linking structure and function damage contribute to a better understanding of this relationship and may help in the future to improve glaucoma diagnosis. PMID:29850196

  16. Stratigraphy, palaeoenvironments and palaeoecology of the Loch Humphrey Burn lagerst?tte and other Mississippian palaeobotanical localities of the Kilpatrick Hills, southwest Scotland

    OpenAIRE

    Bateman, Richard M.; Stevens, Liadan G.; Hilton, Jason

    2016-01-01

    Background and Aims. The largely Mississippian strata of the Kilpatrick Hills, located at the western end of the Scottish Midland Valley, enclose several macrofossil floras that together contain ca 21 organ-species of permineralised plants and ca 44 organ-species of compressed plants, here estimated to represent 25 whole-plant species (Glenarbuck = nine, Loch Humphrey Burn Lower = 11, Upper = seven). The most significant locality is the internationally important volcanigenic sequence that is ...

  17. JGOMAS: New Approach to AI Teaching

    Science.gov (United States)

    Barella, A.; Valero, S.; Carrascosa, C.

    2009-01-01

    This paper presents a new environment for teaching practical work in AI subjects. The main purpose of this environment is to make AI techniques more appealing to students and to facilitate the use of the toolkits which are currently widely used in research and development. This new environment has a toolkit for developing and executing agents,…

  18. Adaptive game AI with dynamic scripting

    NARCIS (Netherlands)

    Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

    2006-01-01

    Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should

  19. The Relevance of AI Research to CAI.

    Science.gov (United States)

    Kearsley, Greg P.

    This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

  20. Nonlinear study of AI Velorum

    International Nuclear Information System (INIS)

    Cox, A.N.; Hodson, S.W.

    1979-01-01

    Using results from earlier studies of double-mode dwarf Cepheids by Cox, King, and Hodson, hydrodynamic calculations were undertaken for AI Vel. The earlier derived evolution theory mass of 1.8 M sub solar, a luminosity of of 23 L sub solar and a T/sub e/ of 7500 0 K give the observed period of 0.11 day and the observed period ratio PI 1 /PI 0 = 0.773. A cooler T/sub e/ than the observed one (7620 0 K) was used because 7620 0 K is beyond the fundamental pulsation mode blue edge. The composition used is X = 0.70 Z = 0.01. This lower than normal Z is necessary to make the period ratio as large as observed. The goal is to see if double-mode behavior, due to either mode switching or a permanent state, can be predicted for the model. Progress in converging the model to a periodic pulsation solution by the von Sengbusch--Stellingwerf relaxation method will be reported. 17 references

  1. Artificial intelligence. Fears of an AI pioneer.

    Science.gov (United States)

    Russell, Stuart; Bohannon, John

    2015-07-17

    From the enraged robots in the 1920 play R.U.R. to the homicidal computer H.A.L. in 2001: A Space Odyssey, science fiction writers have embraced the dark side of artificial intelligence (AI) ever since the concept entered our collective imagination. Sluggish progress in AI research, especially during the “AI winter” of the 1970s and 1980s, made such worries seem far-fetched. But recent breakthroughs in machine learning and vast improvements in computational power have brought a flood of research funding— and fresh concerns about where AI may lead us. One researcher now speaking up is Stuart Russell, a computer scientist at the University of California, Berkeley, who with Peter Norvig, director of research at Google, wrote the premier AI textbook, Artificial Intelligence: A Modern Approach, now in its third edition. Last year, Russell joined the Centre for the Study of Existential Risk at Cambridge University in the United Kingdom as an AI expert focusing on “risks that could lead to human extinction.” Among his chief concerns, which he aired at an April meeting in Geneva, Switzerland, run by the United Nations, is the danger of putting military drones and weaponry under the full control of AI systems. This interview has been edited for clarity and brevity.

  2. Humphrey Ridley (1653-1708): 17th century evolution in neuroanatomy and selective cerebrovascular injections for cadaver dissection.

    Science.gov (United States)

    Thakur, Jai Deep; Sonig, Ashish; Chittiboina, Prashant; Khan, Imad Saeed; Wadhwa, Rishi; Nanda, Anil

    2012-08-01

    Humphrey Ridley, M.D. (1653-1708), is a relatively unknown historical figure, belonging to the postmedieval era of neuroanatomical discovery. He was born in the market town of Mansfield, 14 miles from the county of Nottinghamshire, England. After studying at Merton College, Oxford, he pursued medicine at Leiden University in the Netherlands. In 1688, he was incorporated as an M.D. at Cambridge. Ridley authored the first original treatise in English language on neuroanatomy, The Anatomy of the Brain Containing its Mechanisms and Physiology: Together with Some New Discoveries and Corrections of Ancient and Modern Authors upon that Subject. Ridley described the venous anatomy of the eponymous circular sinus in connection with the parasellar compartment. His methods were novel, unique, and effective. To appreciate the venous anatomy, he preferred to perform his anatomical dissections on recently executed criminals who had been hanged. These cadavers had considerable venous engorgement, which made the skull base venous anatomy clearer. To enhance the appearance of the cerebral vasculature further, he used tinged wax and quicksilver in the injections. He set up experimental models to answer questions definitively, in proving that the arachnoid mater is a separate meningeal layer. The first description of the subarachnoid cisterns, blood-brain barrier, and the fifth cranial nerve ganglion with its branches are also attributed to Ridley. This historical vignette revisits Ridley's life and academic work that influenced neuroscience and neurosurgical understanding in its infancy. It is unfortunate that most of his novel contributions have gone unnoticed and uncited. The authors hope that this article will inform the neurosurgical community of Ridley's contributions to the field of neurosurgery.

  3. "All-In-One Test" (AI1)

    DEFF Research Database (Denmark)

    Giacalone, Davide; Bredie, Wender Laurentius Petrus; Frøst, Michael Bom

    2013-01-01

    by the Check-All-That-Apply (CATA) technique is reported. In this exploratory "All-In-One Test"(AI1), subjects (N = 160) filled out a questionnaire with demographic and psychographic variables, and appropriateness ratings for specific sensory descriptors of beer. Subsequently, subjects gave hedonic ratings...... between appropriateness and actual hedonic response. Overall, the AI1 test provided interpretable results concerning consumer perception (sensory/hedonic) of the beers, and revealed relations with consumers' background information. Initial results with AI1 test show that it is an efficient and versatile...

  4. Health Information in French (français)

    Science.gov (United States)

    ... Biopsy - français (French) Bilingual PDF Health Information Translations Breast Biopsy - français (French) Bilingual PDF Health Information Translations Colposcopy - français (French) Bilingual PDF ...

  5. AIS Ship Traffic: Hawaii: 2011-2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

  6. Cracks appear in the AI gravy train

    Energy Technology Data Exchange (ETDEWEB)

    Mill, J.

    1983-10-01

    This article highlights some of the problems facing the Alvey committee and outlines some reasons for believing that the optimistically founded Alvey and Esprit funding programmes are no guarantee Britain will win the AI race.

  7. National AIS at 1 Minute Intervals

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — OCM plans to contract for AIS data per the following description. The United States Automatic Identification System Database contains vessel traffic data for...

  8. AI applications in sheet metal forming

    CERN Document Server

    Hussein, Hussein

    2017-01-01

    This book comprises chapters on research work done around the globe in the area of artificial intelligence (AI) applications in sheet metal forming. The first chapter offers an introduction to various AI techniques and sheet metal forming, while subsequent chapters describe traditional procedures/methods used in various sheet metal forming processes, and focus on the automation of those processes by means of AI techniques, such as KBS, ANN, GA, CBR, etc. Feature recognition and the manufacturability assessment of sheet metal parts, process planning, strip-layout design, selecting the type and size of die components, die modeling, and predicting die life are some of the most important aspects of sheet metal work. Traditionally, these activities are highly experience-based, tedious and time consuming. In response, researchers in several countries have applied various AI techniques to automate these activities, which are covered in this book. This book will be useful for engineers working in sheet metal industri...

  9. Learning game AI programming with Lua

    CERN Document Server

    Young, David

    2014-01-01

    If you are a game developer or a general programmer who wishes to focus on programming systems and techniques to build your game AI without creating low-level interfaces in a game engine, then this book is for you. Knowledge of C++ will come in handy to debug the entirety of the AI sandbox and expand on the features present within the book, but it is not required.

  10. Adaptive game AI with dynamic scripting

    OpenAIRE

    Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

    2006-01-01

    Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should meet four computational and four functional requirements. The computational requirements are speed, effectiveness, robustness and ef- ficiency. The functional requirements are clarity, variety, consi...

  11. Research Directions for AI in Computer Games

    OpenAIRE

    Fairclough, Chris; Fagan, Michael; Cunningham, Padraig; Mac Namee, Brian

    2001-01-01

    The computer games industry is now bigger than the film industry. Until recently, technology in games was driven by a desire to achieve real-time, photo-realistic graphics. To a large extent, this has now been achieved. As game developers look for new and innovative technologies to drive games development, AI is coming to the fore. This paper will examine how sophisticated AI techniques, such as those being used in mainstream academic research, can be applied to computer games ...

  12. BASEMAP, HUMPHREYS COUNTY, MS

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — FEMA Framework Basemap datasets comprise six of the seven FGDC themes of geospatial data that are used by most GIS applications (Note: the seventh framework theme,...

  13. An evaluation of fresh gas flow rates for spontaneously breathing cats and small dogs on the Humphrey ADE semi-closed breathing system.

    Science.gov (United States)

    Gale, Elizabeth; Ticehurst, Kim E; Zaki, Sanaa

    2015-05-01

    To evaluate the fresh gas flow (FGF) rate requirements for the Humphrey ADE semi-closed breathing system in the Mapleson A mode; to determine the FGF at which rebreathing occurs, and compare the efficiency of this system to the Bain (Mapleson D) system in spontaneously breathing cats and small dogs. Prospective clinical study. Twenty-five healthy (ASA score I or II) client-owned cats and dogs (mean ± SD age 4.7 ± 5.0 years, and body weight 5.64 ± 3.26 kg) undergoing elective surgery or minor procedures. Anaesthesia was maintained with isoflurane delivered via the Humphrey ADE system in the A mode using an oxygen FGF of 100 mL kg(-1) minute(-1). The FGF was then reduced incrementally by 5-10 mL kg(-1) minute(-1) at approximately five-minute intervals, until rebreathing (inspired CO(2) >5 mmHg (0.7 kPa)) was observed, after which flow rates were increased. In six animals, once the minimum FGF at which rebreathing occurred was found, the breathing system was changed to the Bain, and the effects of this FGF delivery examined, before FGF was increased. Rebreathing did not occur at the FGF recommended by the manufacturer for the ADE. The mean ± SD FGF that resulted in rebreathing was 60 ± 20 mL kg(-1) minute(-1). The mean minimum FGF at which rebreathing did not occur with the ADE was 87 ± 39 mL kg(-1) minute(-1). This FGF resulted in significant rebreathing (inspired CO(2) 8.8 ± 2.6 mmHg (1.2 ± 0.3 kPa)) on the Bain system. The FGF rates recommended for the Humphrey ADE are adequate to prevent rebreathing in spontaneously breathing cats and dogs cats and small dogs. © 2014 Association of Veterinary Anaesthetists and the American College of Veterinary Anesthesia and Analgesia.

  14. Beyond AI: Interdisciplinary Aspects of Artificial Intelligence

    CERN Document Server

    Romportl, Jan; Zackova, Eva; Beyond Artificial Intelligence : Contemplations, Expectations, Applications

    2013-01-01

    Products of modern artificial intelligence (AI) have mostly been formed by the views, opinions and goals of the “insiders”, i.e. people usually with engineering background who are driven by the force that can be metaphorically described as the pursuit of the craft of Hephaestus. However, since the present-day technology allows for tighter and tighter mergence of the “natural” everyday human life with machines of immense complexity, the responsible reaction of the scientific community should be based on cautious reflection of what really lies beyond AI, i.e. on the frontiers where the tumultuous ever-growing and ever-changing cloud of AI touches the rest of the world.   The chapters of this boo are based on the selected subset of the presentations that were delivered by their respective authors at the conference “Beyond AI: Interdisciplinary Aspects of Artificial Intelligence” held in Pilsen in December 2011.   From its very definition, the reflection of the phenomena that lie beyond AI must be i...

  15. Two new Oxalis species (Oxalidaceae) from the Ai-Ais / Richtersveld Transfrontier Park, South Africa

    NARCIS (Netherlands)

    Roets, F.; Oberlander, K.C.; Dreyer, L.L.

    2012-01-01

    South Africa has a rich, but scantily surveyed, desert flora. Documenting annual and geophytic species in this biome is challenging, as they usually only flower after adequate precipitation, which is characteristically erratic and infrequent. Recent floristic surveys in the Ai-Ais / Richtersveld

  16. Use of AI-1024 and AI-4096 analyzers in multiple regimes

    International Nuclear Information System (INIS)

    Zaika, N.D.; Kovtunenko, I.S.; Savchuk, O.G.

    1975-01-01

    The operation of pulse multichannel analyzers in the following multidimensional modes: AI-1024-4 - amplitude mode from several transducers; amplitude mode from several transducers at different time intervals; AI-4096-3M - amplitude mode at different time intervals in each of four groups with unit BVI-1

  17. Artificial Intelligence Safety and Cybersecurity: a Timeline of AI Failures

    OpenAIRE

    Yampolskiy, Roman V.; Spellchecker, M. S.

    2016-01-01

    In this work, we present and analyze reported failures of artificially intelligent systems and extrapolate our analysis to future AIs. We suggest that both the frequency and the seriousness of future AI failures will steadily increase. AI Safety can be improved based on ideas developed by cybersecurity experts. For narrow AIs safety failures are at the same, moderate, level of criticality as in cybersecurity, however for general AI, failures have a fundamentally different impact. A single fai...

  18. Tweeting AI: Perceptions of Lay vs Expert Twitterati

    OpenAIRE

    Manikonda, Lydia; Kambhampati, Subbarao

    2017-01-01

    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals are debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users belonging to two categories -- general AI-Tweeters (AIT) and expert AI-Tweeters (EAIT) who ...

  19. How to Improve the ROK and U.S. Military Alliance Against North Korea’s Threats to Cyberspace: Lessons From NATO’s Defense Cooperation

    Science.gov (United States)

    2017-12-01

    North Korea’s policy. For instance, North Korea has been interested in developing technology like Artificial Intelligence (AI) and has made efforts to...No. 8 NPT Nuclear Proliferation Treaty OSINT Open Source intelligence RGB Reconnaissance General Bureau (of North Korea) ROK Republic of Korea... Cybersecurity is linked directly to national security in the ROK. Although challenging for the military, as the primary target of adversaries, the

  20. Strategic Team AI Path Plans: Probabilistic Pathfinding

    Directory of Open Access Journals (Sweden)

    Tng C. H. John

    2008-01-01

    Full Text Available This paper proposes a novel method to generate strategic team AI pathfinding plans for computer games and simulations using probabilistic pathfinding. This method is inspired by genetic algorithms (Russell and Norvig, 2002, in that, a fitness function is used to test the quality of the path plans. The method generates high-quality path plans by eliminating the low-quality ones. The path plans are generated by probabilistic pathfinding, and the elimination is done by a fitness test of the path plans. This path plan generation method has the ability to generate variation or different high-quality paths, which is desired for games to increase replay values. This work is an extension of our earlier work on team AI: probabilistic pathfinding (John et al., 2006. We explore ways to combine probabilistic pathfinding and genetic algorithm to create a new method to generate strategic team AI pathfinding plans.

  1. AI Researchers, Video Games Are Your Friends!

    OpenAIRE

    Togelius, Julian

    2016-01-01

    If you are an artificial intelligence researcher, you should look to video games as ideal testbeds for the work you do. If you are a video game developer, you should look to AI for the technology that makes completely new types of games possible. This chapter lays out the case for both of these propositions. It asks the question "what can video games do for AI", and discusses how in particular general video game playing is the ideal testbed for artificial general intelligence research. It the...

  2. AI, automation and the Flight Telerobotic Servicer

    Science.gov (United States)

    Goforth, Andre; Dominy, Robert

    1988-01-01

    A NASA study for the preliminary definition of a teleoperated robotic device has been recently completed. The Fligt Telerobotic Servicer (FTS) will be used to assist astronauts in many of the on-board tasks of assembly, maintenance, servicing, and inspection of the Space Station. The role of artificial intelligence (AI) in furthering the FTS automation capabilities and, hence, extending its capacity for growth and evolution is discussed. Relevant system engineering issues are identified, and an approach for insertion of AI technology is presented in terms of the NASA/NBS Standard Reference Model control architecture NASREM.

  3. SNAP and AI Fuel Summary Report

    International Nuclear Information System (INIS)

    Lords, R.E.

    1994-08-01

    The SNAP and AI Fuel Summary Report provides a detailed overview of treatment and storage of these fuels from fabrication through current storage including design parameters and reactor history. Chemical and physical characteristics are described, and potential indicators of as-stored fuel conditions are emphasized

  4. The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

    Energy Technology Data Exchange (ETDEWEB)

    Caron, Sascha [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands); Nikhef, Amsterdam (Netherlands); Kim, Jong Soo [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); Rolbiecki, Krzysztof [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); University of Warsaw, Faculty of Physics, Warsaw (Poland); Ruiz de Austri, Roberto [IFIC-UV/CSIC, Instituto de Fisica Corpuscular, Valencia (Spain); Stienen, Bob [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands)

    2017-04-15

    A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

  5. The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

    International Nuclear Information System (INIS)

    Caron, Sascha; Kim, Jong Soo; Rolbiecki, Krzysztof; Ruiz de Austri, Roberto; Stienen, Bob

    2017-01-01

    A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

  6. Stratigraphy, palaeoenvironments and palaeoecology of the Loch Humphrey Burn lagerstätte and other Mississippian palaeobotanical localities of the Kilpatrick Hills, southwest Scotland

    Directory of Open Access Journals (Sweden)

    Richard M. Bateman

    2016-02-01

    Full Text Available Background and Aims. The largely Mississippian strata of the Kilpatrick Hills, located at the western end of the Scottish Midland Valley, enclose several macrofossil floras that together contain ca 21 organ-species of permineralised plants and ca 44 organ-species of compressed plants, here estimated to represent 25 whole-plant species (Glenarbuck = nine, Loch Humphrey Burn Lower = 11, Upper = seven. The most significant locality is the internationally important volcanigenic sequence that is reputedly intercalated within the Clyde Plateau Lava Formation at Loch Humphrey Burn, where ca 30 m of reworked tuffs and other clastic sediments enclose one of the world’s most important terrestrial lagerstätten of this period. We here explore the palaeoecology and palaeoenvironments of the locality, and elucidate its controversial age. Methods. Repeated re-excavation of key exposures allowed recognition of five main depositional units, differing in thickness from 4 m to 12 m. It also permitted detailed sampling for plant macrofossils and microfossils throughout the succession. Several approaches are integrated to re-assess the taphonomy and preservation of these exceptional plant fossils. Key Results. The deposits are rich in taxonomically diverse miospores and in toto contain at least six well-developed compression floras, together with two beds yielding nodules that enclose well-researched anatomically preserved plants permineralised in calcite. Bulk geochemistry shows that the upper nodules formed by migration of Ca with subordinate Mn and Na. Some phylogenetically important plant fossils recovered in the early 20th century have been traced to their source horizons. Trends in relative proportions of macrofossil and microfossil taxa through the sequence are only moderately congruent, perhaps reflecting the likelihood that microfossils sample the regional rather than the local flora. Conclusions. The Loch Humphrey Burn sequence encompasses a wide range

  7. Stratigraphy, palaeoenvironments and palaeoecology of the Loch Humphrey Burn lagerstätte and other Mississippian palaeobotanical localities of the Kilpatrick Hills, southwest Scotland.

    Science.gov (United States)

    Bateman, Richard M; Stevens, Liadan G; Hilton, Jason

    2016-01-01

    Background and Aims. The largely Mississippian strata of the Kilpatrick Hills, located at the western end of the Scottish Midland Valley, enclose several macrofossil floras that together contain ca 21 organ-species of permineralised plants and ca 44 organ-species of compressed plants, here estimated to represent 25 whole-plant species (Glenarbuck = nine, Loch Humphrey Burn Lower = 11, Upper = seven). The most significant locality is the internationally important volcanigenic sequence that is reputedly intercalated within the Clyde Plateau Lava Formation at Loch Humphrey Burn, where ca 30 m of reworked tuffs and other clastic sediments enclose one of the world's most important terrestrial lagerstätten of this period. We here explore the palaeoecology and palaeoenvironments of the locality, and elucidate its controversial age. Methods. Repeated re-excavation of key exposures allowed recognition of five main depositional units, differing in thickness from 4 m to 12 m. It also permitted detailed sampling for plant macrofossils and microfossils throughout the succession. Several approaches are integrated to re-assess the taphonomy and preservation of these exceptional plant fossils. Key Results. The deposits are rich in taxonomically diverse miospores and in toto contain at least six well-developed compression floras, together with two beds yielding nodules that enclose well-researched anatomically preserved plants permineralised in calcite. Bulk geochemistry shows that the upper nodules formed by migration of Ca with subordinate Mn and Na. Some phylogenetically important plant fossils recovered in the early 20th century have been traced to their source horizons. Trends in relative proportions of macrofossil and microfossil taxa through the sequence are only moderately congruent, perhaps reflecting the likelihood that microfossils sample the regional rather than the local flora. Conclusions. The Loch Humphrey Burn sequence encompasses a wide range of depositional

  8. Comparison of visual field test results obtained through Humphrey matrix frequency doubling technology perimetry versus standard automated perimetry in healthy children.

    Science.gov (United States)

    Kocabeyoglu, Sibel; Uzun, Salih; Mocan, Mehmet Cem; Bozkurt, Banu; Irkec, Murat; Orhan, Mehmet

    2013-10-01

    The aim of this study was to compare the visual field test results in healthy children obtained via the Humphrey matrix 24-2 threshold program and standard automated perimetry (SAP) using the Swedish interactive threshold algorithm (SITA)-Standard 24-2 test. This prospective study included 55 healthy children without ocular or systemic disorders who underwent both SAP and frequency doubling technology (FDT) perimetry visual field testing. Visual field test reliability indices, test duration, global indices (mean deviation [MD], and pattern standard deviation [PSD]) were compared between the 2 tests using the Wilcoxon signed-rank test and paired t-test. The performance of the Humphrey field analyzer (HFA) 24-2 SITA-standard and frequency-doubling technology Matrix 24-2 tests between genders were compared with Mann-Whitney U-test. Fifty-five healthy children with a mean age of 12.2 ± 1.9 years (range from 8 years to 16 years) were included in this prospective study. The test durations of SAP and FDT were similar (5.2 ± 0.5 and 5.1 ± 0.2 min, respectively, P = 0.651). MD and the PSD values obtained via FDT Matrix were significantly higher than those obtained via SAP (P tests in terms of MD (r = 0.352, P = 0.008) and PSD (r = 0.329, P = 0.014) was observed. Children were able to complete both the visual test algorithms successfully within 6 min. However, SAP testing appears to be associated with less depression of the visual field indices of healthy children. FDT Matrix and SAP should not be used interchangeably in the follow-up of children.

  9. Comparison of visual field test results obtained through Humphrey matrix frequency doubling technology perimetry versus standard automated perimetry in healthy children

    Directory of Open Access Journals (Sweden)

    Sibel Kocabeyoglu

    2013-01-01

    Full Text Available Aims : The aim of this study was to compare the visual field test results in healthy children obtained via the Humphrey matrix 24-2 threshold program and standard automated perimetry (SAP using the Swedish interactive threshold algorithm (SITA-Standard 24-2 test. Materials and Methods: This prospective study included 55 healthy children without ocular or systemic disorders who underwent both SAP and frequency doubling technology (FDT perimetry visual field testing. Visual field test reliability indices, test duration, global indices (mean deviation [MD], and pattern standard deviation [PSD] were compared between the 2 tests using the Wilcoxon signed-rank test and paired t-test. The performance of the Humphrey field analyzer (HFA 24-2 SITA-standard and frequency-doubling technology Matrix 24-2 tests between genders were compared with Mann-Whitney U-test. Results: Fifty-five healthy children with a mean age of 12.2 ± 1.9 years (range from 8 years to 16 years were included in this prospective study. The test durations of SAP and FDT were similar (5.2 ± 0.5 and 5.1 ± 0.2 min, respectively, P = 0.651. MD and the PSD values obtained via FDT Matrix were significantly higher than those obtained via SAP (P < 0.001, and fixation losses and false negative errors were significantly less with SAP (P < 0.05. A weak positive correlation between the two tests in terms of MD (r = 0.352, P = 0.008 and PSD (r = 0.329, P = 0.014 was observed. Conclusion: Children were able to complete both the visual test algorithms successfully within 6 min. However, SAP testing appears to be associated with less depression of the visual field indices of healthy children. FDT Matrix and SAP should not be used interchangeably in the follow-up of children.

  10. Launching AI in NASA ground systems

    Science.gov (United States)

    Perkins, Dorothy C.; Truszkowski, Walter F.

    1990-01-01

    This paper will discuss recent operational successes in implementing expert systems to support the complex functions of NASA mission control systems at the Goddard Space Flight Center, including fault detection and diagnosis for real time and engineering analysis functions in the Cosmic Background Explorer and Gamma Ray Observatory missions and automation of resource planning and scheduling functions for various missions. It will also discuss ongoing developments and prototypes that will lead to increasingly sophisticated applications of artificial intelligence. These include the use of neural networks to perform telemetry monitoring functions, the implementation of generic expert system shells that can be customized to telemetry handling functions specific to NASA control centers, the applications of AI in training and user support, the long-term potential of implementing systems based around distributed, cooperative problem solving, and the use of AI to control and assist system development activities.

  11. AI systems approach in particle accelerators

    International Nuclear Information System (INIS)

    Kataria, S.K.; Bhagwat, P.V.; Kori, S.A.

    1992-01-01

    The large particle accelerators machines like pelletron accelerator at Tata Institute of Fundamental Research (T.I.F.R) have several levels of controls with operators responsible for overall global control decisions and closed loop feedback controllers for relatively small subsystems of the machines. As the accelerator machines are becoming more complicated and the requirements more stringent, there is a need to provide the operators with an artificial intelligence (AI) system to aid in the tuning the machine and in failure diagnosis. There are few major areas in the pelletron operation, which can be done more efficiently using AI systems approach so that useful beam is available for much more time: 1) Accelerator Conditioning, 2) Accelerator Tuning, and 3) Maintaining the Tune beams. The feasibility study for using expert system for above areas and also for safety evaluation of the various subsystems is carried out. (author). 10 refs., 4 figs

  12. Deploying Embodied AI into Virtual Worlds

    Science.gov (United States)

    Burden, David J. H.

    The last two years have seen the start of commercial activity within virtual worlds. Unlike computer games where Non-Player-Character avatars are common, in most virtual worlds they are the exception — and until recently in Second Life they were non-existent. However there is real commercial scope for Als in these worlds — in roles from virtual sales staff and tutors to personal assistants. Deploying an embodied AI into a virtual world offers a unique opportunity to evaluate embodied Als, and to develop them within an environment where human and computer are on almost equal terms. This paper presents an architecture being used for the deployment of chatbot driven avatars within the Second Life virtual world, looks at the challenges of deploying an AI within such a virtual world, the possible implications for the Turing Test, and identifies research directions for the future.

  13. Managing bioengineering complexity with AI techniques.

    Science.gov (United States)

    Beal, Jacob; Adler, Aaron; Yaman, Fusun

    2016-10-01

    Our capabilities for systematic design and engineering of biological systems are rapidly increasing. Effectively engineering such systems, however, requires the synthesis of a rapidly expanding and changing complex body of knowledge, protocols, and methodologies. Many of the problems in managing this complexity, however, appear susceptible to being addressed by artificial intelligence (AI) techniques, i.e., methods enabling computers to represent, acquire, and employ knowledge. Such methods can be employed to automate physical and informational "routine" work and thus better allow humans to focus their attention on the deeper scientific and engineering issues. This paper examines the potential impact of AI on the engineering of biological organisms through the lens of a typical organism engineering workflow. We identify a number of key opportunities for significant impact, as well as challenges that must be overcome. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  14. The Potential of AI Techniques for Remote Sensing

    Science.gov (United States)

    Estes, J. E.; Sailer, C. T. (Principal Investigator); Tinney, L. R.

    1984-01-01

    The current status of artificial intelligence AI technology is discussed along with imagery data management, database interrogation, and decision making. Techniques adapted from the field of artificial intelligence (AI) have significant, wide ranging impacts upon computer-assisted remote sensing analysis. AI based techniques offer a powerful and fundamentally different approach to many remote sensing tasks. In addition to computer assisted analysis, AI techniques can also aid onboard spacecraft data processing and analysis and database access and query.

  15. AI in space: Past, present, and possible futures

    Science.gov (United States)

    Rose, Donald D.; Post, Jonathan V.

    1992-01-01

    While artificial intelligence (AI) has become increasingly present in recent space applications, new missions being planned will require even more incorporation of AI techniques. In this paper, we survey some of the progress made to date in implementing such programs, some current directions and issues, and speculate about the future of AI in space scenarios. We also provide examples of how thinkers from the realm of science fiction have envisioned AI's role in various aspects of space exploration.

  16. SDI satellite autonomy using AI and Ada

    Science.gov (United States)

    Fiala, Harvey E.

    1990-01-01

    The use of Artificial Intelligence (AI) and the programming language Ada to help a satellite recover from selected failures that could lead to mission failure are described. An unmanned satellite will have a separate AI subsystem running in parallel with the normal satellite subsystems. A satellite monitoring subsystem (SMS), under the control of a blackboard system, will continuously monitor selected satellite subsystems to become alert to any actual or potential problems. In the case of loss of communications with the earth or the home base, the satellite will go into a survival mode to reestablish communications with the earth. The use of an AI subsystem in this manner would have avoided the tragic loss of the two recent Soviet probes that were sent to investigate the planet Mars and its moons. The blackboard system works in conjunction with an SMS and a reconfiguration control subsystem (RCS). It can be shown to be an effective way for one central control subsystem to monitor and coordinate the activities and loads of many interacting subsystems that may or may not contain redundant and/or fault-tolerant elements. The blackboard system will be coded in Ada using tools such as the ABLE development system and the Ada Production system.

  17. Monitoring severe accidents using AI techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Ahn, Kwang Il; Kim, Ju Hyun; Na, Man Gyun; Lim, Dong Hyuk

    2012-01-01

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  18. Monitoring severe accidents using AI techniques

    Energy Technology Data Exchange (ETDEWEB)

    No, Young Gyu; Ahn, Kwang Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Ju Hyun; Na, Man Gyun [Dept. of Nuclear Engineering, Chosun University, Gwangju (Korea, Republic of); Lim, Dong Hyuk [Korea Institute of Nuclear Nonproliferation and Control, Daejon (Korea, Republic of)

    2012-05-15

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  19. Why Don't Accounting Students like AIS?

    Science.gov (United States)

    Vatanasakdakul, Savanid; Aoun, Chadi

    2011-01-01

    Purpose: The demand for Accounting Information Systems (AIS) knowledge has increased exponentially over the past two decades, but studying AIS has not proved easy for many accounting students. The aim of the study is to understand the challenges accounting students face in studying AIS through investigation of the factors which may be contributing…

  20. Dicty_cDB: FC-AI04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

  1. Dicty_cDB: FC-AI10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

  2. Dicty_cDB: FC-AI23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

  3. Dicty_cDB: FC-AI05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

  4. Dicty_cDB: FC-AI21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

  5. Terrorism in South Korea.

    Science.gov (United States)

    Wang, Soon Joo; Choi, Jin Tae; Arnold, Jeffrey

    2003-01-01

    South Korea has experienced > 30 suspected terrorism-related events since 1958, including attacks against South Korean citizens in foreign countries. The most common types of terrorism used have included bombings, shootings, hijackings, and kidnappings. Prior to 1990, North Korea was responsible for almost all terrorism-related events inside of South Korea, including multiple assassination attempts on its presidents, regular kidnappings of South Korean fisherman, and several high-profile bombings. Since 1990, most of the terrorist attacks against South Korean citizens have occurred abroad and have been related to the emerging worldwide pattern of terrorism by international terrorist organizations or deranged individuals. The 1988 Seoul Olympic Games provided a major stimulus for South Korea to develop a national emergency response system for terrorism-related events based on the participation of multiple ministries. The 11 September 2001 World Trade Center and Pentagon attacks and the 2001 United States of America (US) anthrax letter attacks prompted South Korea to organize a new national system of emergency response for terrorism-related events. The system is based on five divisions for the response to specific types of terrorist events, involving conventional terrorism, bioterrorism, chemical terrorism, radiological terrorism, and cyber-terrorism. No terrorism-related events occurred during the 2002 World Cup and Asian Games held in South Korea. The emergency management of terrorism-related events in South Korea is adapting to the changing risk of terrorism in the new century.

  6. Dicty_cDB: FC-AI01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

  7. Dicty_cDB: FC-AI13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

  8. North Korea Conundrum

    Energy Technology Data Exchange (ETDEWEB)

    Samore, G

    2002-07-01

    Proliferation has become an important political issue over the last decades, marked simultaneously by the nuclearization of South Asia, the strengthening of international regimes (TNP, CW, MTCR) and the discovery of fraud and trafficking. This paper presents the motivations and strategy of North Korea in violating existing agreements and developing an alternative source of weapons grade material. Then it analyses the US gradual economical and political strategy to pressure North Korea to eliminate its nuclear weapons program. The future position of the US will depend on the Iraq outcome and on the results of its pressure policy on North Korea. (J.S.)

  9. North Korea Conundrum

    International Nuclear Information System (INIS)

    Samore, G.

    2002-01-01

    Proliferation has become an important political issue over the last decades, marked simultaneously by the nuclearization of South Asia, the strengthening of international regimes (TNP, CW, MTCR) and the discovery of fraud and trafficking. This paper presents the motivations and strategy of North Korea in violating existing agreements and developing an alternative source of weapons grade material. Then it analyses the US gradual economical and political strategy to pressure North Korea to eliminate its nuclear weapons program. The future position of the US will depend on the Iraq outcome and on the results of its pressure policy on North Korea. (J.S.)

  10. Developing Pokemon AI For Finding Comfortable Settings

    OpenAIRE

    Panumate, Chetprayoon; Iida, Hiroyuki

    2016-01-01

    This paper explores an innovative way to find a comfortable setting of video games. Pokemon is chosen as benchmark and game refinement measure is employed for the assessment. The number of Pokemon that one trainer can carry (i.e., setting with n=6) has never been changed after the first episode of Pokemon was released in 1996. Pokemon battle is simulated and various AIs are developed for the experiments. The results show that the original setting is the best for many players of various levels.

  11. AI techniques in geomagnetic storm forecasting

    Science.gov (United States)

    Lundstedt, Henrik

    This review deals with how geomagnetic storms can be predicted with the use of Artificial Intelligence (AI) techniques. Today many different Al techniques have been developed, such as symbolic systems (expert and fuzzy systems) and connectionism systems (neural networks). Even integrations of AI techniques exist, so called Intelligent Hybrid Systems (IHS). These systems are capable of learning the mathematical functions underlying the operation of non-linear dynamic systems and also to explain the knowledge they have learned. Very few such powerful systems exist at present. Two such examples are the Magnetospheric Specification Forecast Model of Rice University and the Lund Space Weather Model of Lund University. Various attempts to predict geomagnetic storms on long to short-term are reviewed in this article. Predictions of a month to days ahead most often use solar data as input. The first SOHO data are now available. Due to the high temporal and spatial resolution new solar physics have been revealed. These SOHO data might lead to a breakthrough in these predictions. Predictions hours ahead and shorter rely on real-time solar wind data. WIND gives us real-time data for only part of the day. However, with the launch of the ACE spacecraft in 1997, real-time data during 24 hours will be available. That might lead to the second breakthrough for predictions of geomagnetic storms.

  12. Dissecting phenotypic variation among AIS patients

    International Nuclear Information System (INIS)

    Wang Minghua; Wang Jiucun; Zhang Zhen; Zhao Zhimin; Zhang Rongmei; Hu Xiaohua; Tan Tao; Luo Shijing; Luo Zewei

    2005-01-01

    We have created genital skin fibroblast cell lines directly from three patients in a Chinese family affected by androgen insensitivity syndrome (AIS). All patients in the family share an identical AR Arg 840 Cys mutant but show different disease phenotypes. By using the cell lines, we find that the mutation has not influenced a normal androgen-binding capacity at 37 deg C but has reduced the affinity for androgens and may cause thermolability of the androgen-receptor complex. The impaired nuclear trafficking of the androgen receptor in the cell lines is highly correlated with the severity of donors' disease phenotype. The transactivity of the mutant is substantially weakened and the extent of the reduced transactivity reflects severity of the donors' disease symptom. Our data reveal that although etiology of AIS is monogenic and the mutant may alter the major biological functions of its wild allele, the function of the mutant AR can also be influenced by the different genetic backgrounds and thus explains the divergent disease phenotypes

  13. Monitoring Severe Accidents Using AI Techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Kim, Ju Hyun; Na, Man Gyun; Ahn, Kwang Il

    2011-01-01

    It is very difficult for nuclear power plant operators to monitor and identify the major severe accident scenarios following an initiating event by staring at temporal trends of important parameters. The objective of this study is to develop and verify the monitoring for severe accidents using artificial intelligence (AI) techniques such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH) and fuzzy neural network (FNN). The SVC and PNN are used for event classification among the severe accidents. Also, GMDH and FNN are used to monitor for severe accidents. The inputs to AI techniques are initial time-integrated values obtained by integrating measurement signals during a short time interval after reactor scram. In this study, 3 types of initiating events such as the hot-leg LOCA, the cold-leg LOCA and SGTR are considered and it is verified how well the proposed scenario identification algorithm using the GMDH and FNN models identifies the timings when the reactor core will be uncovered, when CET will exceed 1200 .deg. F and when the reactor vessel will fail. In cases that an initiating event develops into a severe accident, the proposed algorithm showed accurate classification of initiating events. Also, it well predicted timings for important occurrences during severe accident progression scenarios, which is very helpful for operators to perform severe accident management

  14. East Asia: Korea

    Science.gov (United States)

    1988-02-01

    fermenting within the parties as a result of the party standard-bearers and their subordi- nates’ different assessments of the causes of the defeat...Explosives, Korea Yogurt and Sammi Group each has four PhD’s, and Tong-yang Chemical, Pacific Chem- ical Group, Hanil Pharmaceutical, Korea Electrical...including insecticides by using microorganisms and pharmaceutical materials. Dr Sin Sok-pong, manager in the PCC, got his degree in fermentation

  15. Nuclear power of Korea

    International Nuclear Information System (INIS)

    Chun Bee-Ho

    2011-01-01

    National nuclear is presented. Nuclear energy safety after Fukushima, international cooperation in nuclear energy is discussed. Nuclear projects with the United Arab Emirates have been developed to build 4 nuclear power plants in the UAE - APR 1400. At the Korea-Bulgaria Industrial Committee Meeting in Sofia (March 2011) Korean side proposed Nuclear Safety Training Program in Korea for Bulgarian government officials and experts transfer of know-how and profound expertise on world-class nuclear technology and nuclear safety

  16. AI model for computer games based on case based reasoning and AI planning

    NARCIS (Netherlands)

    Menkovski, V.; Metafas, D.

    2008-01-01

    Making efficient AI models for games with imperfect information can be a particular challenge. Considering the large number of possible moves and the incorporated uncertainties building game trees for these games becomes very difficult due to the exponential growth of the number of nodes at each

  17. AI Based Personal Learning Environments: Directions for Long Term Research. AI Memo 384.

    Science.gov (United States)

    Goldstein, Ira P.; Miller, Mark L.

    The application of artificial intelligence (AI) techniques to the design of personal learning environments is an enterprise of both theoretical and practical interest. In the short term, the process of developing and testing intelligent tutoring programs serves as a new experimental vehicle for exploring alternative cognitive and pedagogical…

  18. Risk Reducing Effect of AIS Implementation on Collision Risk

    DEFF Research Database (Denmark)

    Lützen, Marie; Friis-Hansen, Peter

    2003-01-01

    AIS (Automatic Identification System) is a transponder system developed for sea traffic purposes. The system sends and receives important ship information and other safety-related information between other ships and shore-based AIS stations. The implementation of AIS has now been initiated and......, as a result, the community will undoubtedly observe an increase in navigational safety. However, to the authors? knowledge, no study has so far rigorously quantified the risk reducing effect of using AIS as an integrated part of the navigational system. The objective of this study is to fill this gap....... The risk reducing effect of AIS is quantified by building a Bayesian network facilitating an evaluation of the effect of AIS on the navigational officer?s reaction ability in a potential, critical collision situation. The time-dependent change in the risk reducing effect on ship collisions is analysed...

  19. Comparison of 30-2 Standard and Fast programs of Swedish Interactive Threshold Algorithm of Humphrey Field Analyzer for perimetry in patients with intracranial tumors.

    Science.gov (United States)

    Singh, Manav Deep; Jain, Kanika

    2017-11-01

    To find out whether 30-2 Swedish Interactive Threshold Algorithm (SITA) Fast is comparable to 30-2 SITA Standard as a tool for perimetry among the patients with intracranial tumors. This was a prospective cross-sectional study involving 80 patients aged ≥18 years with imaging proven intracranial tumors and visual acuity better than 20/60. The patients underwent multiple visual field examinations using the two algorithms till consistent and repeatable results were obtained. A total of 140 eyes of 80 patients were analyzed. Almost 60% of patients undergoing perimetry with SITA Standard required two or more sessions to obtain consistent results, whereas the same could be obtained in 81.42% with SITA Fast in the first session itself. Of 140 eyes, 70 eyes had recordable field defects and the rest had no defects as detected by either of the two algorithms. Mean deviation (MD) (P = 0.56), pattern standard deviation (PSD) (P = 0.22), visual field index (P = 0.83) and number of depressed points at P 0.5% on MD and PSD probability plots showed no statistically significant difference between two algorithms. Bland-Altman test showed that considerable variability existed between two algorithms. Perimetry performed by SITA Standard and SITA Fast algorithm of Humphrey Field Analyzer gives comparable results among the patients of intracranial tumors. Being more time efficient and with a shorter learning curve, SITA Fast my be recommended as a standard test for the purpose of perimetry among these patients.

  20. Towards a science of integrated AI and Robotics

    OpenAIRE

    Rajan, Kanna; Saffiotti, Alessandro

    2017-01-01

    The early promise of the impact of machine intelligence did not involve the partitioning of the nascent field of Artificial Intelligence. The founders of AI envisioned the notion of embedded intelligence as being conjoined between perception, reasoning and actuation. Yet over the years the fields of AI and Robotics drifted apart. Practitioners of AI focused on problems and algorithms abstracted from the real world. Roboticists, generally with a background in mechanical and electrical engineer...

  1. Discussion on AI Technology in Information Library Design

    OpenAIRE

    日比野, 省三; Shozo, HIBINO; 中京大学社会学部

    1987-01-01

    This paper deals with the discussion on the importance of AI (Artificial Intelligence) Technology in planning and designing a library information system in the near future. First of all, the history of Library and Information Science is reviewed and it is identified that the key technology in the future library will be AI as a mega-trend. After reviewing the concepts of AI technology, a model of a Knowledge-Base system is discussed as a case study, using micro-PROLOG.

  2. Automatic Identification System (AIS) Transmit Testing in Louisville Phase 2

    Science.gov (United States)

    2014-08-01

    Firewall Louisville QM 65.206.28.x NAIS Site Controller PC RS232 Serial cable TV32 Computer Cmd Center Serial splitter SAAB R40 AIS Base Station...172.17.14.6 Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary serial connection...Automatic Identification System ( AIS ) Transmit Testing in Louisville Phase 2 Distribution Statement A: Approved for public release

  3. The implementation of AI technologies in computer wargames

    Science.gov (United States)

    Tiller, John A.

    2004-08-01

    Computer wargames involve the most in-depth analysis of general game theory. The enumerated turns of a game like chess are dwarfed by the exponentially larger possibilities of even a simple computer wargame. Implementing challenging AI is computer wargames is an important goal in both the commercial and military environments. In the commercial marketplace, customers demand a challenging AI opponent when they play a computer wargame and are frustrated by a lack of competence on the part of the AI. In the military environment, challenging AI opponents are important for several reasons. A challenging AI opponent will force the military professional to avoid routine or set-piece approaches to situations and cause them to think much deeper about military situations before taking action. A good AI opponent would also include national characteristics of the opponent being simulated, thus providing the military professional with even more of a challenge in planning and approach. Implementing current AI technologies in computer wargames is a technological challenge. The goal is to join the needs of AI in computer wargames with the solutions of current AI technologies. This talk will address several of those issues, possible solutions, and currently unsolved problems.

  4. Little AI: Playing a constructivist robot

    Science.gov (United States)

    Georgeon, Olivier L.

    Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated "baby robot". The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player's commands. The player must learn, at the same time, the functioning of the robot's body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937), [1]).

  5. AI tools in computer based problem solving

    Science.gov (United States)

    Beane, Arthur J.

    1988-01-01

    The use of computers to solve value oriented, deterministic, algorithmic problems, has evolved a structured life cycle model of the software process. The symbolic processing techniques used, primarily in research, for solving nondeterministic problems, and those for which an algorithmic solution is unknown, have evolved a different model, much less structured. Traditionally, the two approaches have been used completely independently. With the advent of low cost, high performance 32 bit workstations executing identical software with large minicomputers and mainframes, it became possible to begin to merge both models into a single extended model of computer problem solving. The implementation of such an extended model on a VAX family of micro/mini/mainframe systems is described. Examples in both development and deployment of applications involving a blending of AI and traditional techniques are given.

  6. Dicty_cDB: FC-AI17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

  7. Dicty_cDB: FC-AI18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

  8. Dicty_cDB: FC-AI03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

  9. AI technology and automobile. ; Toward vehicle autonomy. AI gijutsu to jidosha. ; Sharyo no jiritsuka ni mukatte

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, A. (Mazda Motor Corp., Hiroshima (Japan))

    1991-01-01

    This report describes the vehicle autonomy by using artificial intelligence (AI) technology. Owing to a remarkable progress of AI technology, it is forecasted that driving support system will be introduced into the market till 2000, and higher autonomous navigation system will be introduced since about 2010. Autonomous vehicles have capacities of recognizing the outside world and of navigating roads by themselves, and with their enfanced environment adaptability the road transportation in the future is expected to be much more safer than in the present. The autonomous vehicle can warn its driver of potential dangers and correct operational errors of the driver. In order to realize such autonomous vehicles, extensive researches on perception systems, decision making systems and driving support systems are needed. 9 refs., 10 figs., 1 tab.

  10. Ada in AI or AI in Ada. On developing a rationale for integration

    Science.gov (United States)

    Collard, Philippe E.; Goforth, Andre

    1988-01-01

    The use of Ada as an Artificial Intelligence (AI) language is gaining interest in the NASA Community, i.e., by parties who have a need to deploy Knowledge Based-Systems (KBS) compatible with the use of Ada as the software standard for the Space Station. A fair number of KBS and pseudo-KBS implementations in Ada exist today. Currently, no widely used guidelines exist to compare and evaluate these with one another. The lack of guidelines illustrates a fundamental problem inherent in trying to compare and evaluate implementations of any sort in languages that are procedural or imperative in style, such as Ada, with those in languages that are functional in style, such as Lisp. Discussed are the strengths and weakness of using Ada as an AI language and a preliminary analysis provided of factors needed for the development of criteria for the integration of these two families of languages and the environments in which they are implemented. The intent for developing such criteria is to have a logical rationale that may be used to guide the development of Ada tools and methodology to support KBS requirements, and to identify those AI technology components that may most readily and effectively be deployed in Ada.

  11. Nuclear Power in Korea

    International Nuclear Information System (INIS)

    Ha, Duk-Sang

    2009-01-01

    Full text: Korea's nuclear power program has been promoted by step-by-step approach; the first stage was 1970's when it depended on the foreign contractors' technology and the second was 1980's when it accumulated lots of technology and experience by jointly implementing the project. Lastly in the third stage in 1990's, Korea successfully achieved the nuclear power technological self-reliance and developed its standard nuclear power plant, so-called Optimized Power Reactor 1000 (OPR 1000). Following the development of OPR 1000, Korea has continued to upgrade the design, known as the Advanced Power Reactor 1400 (APR 1400) and APR+. Korea is one of the countries which continuously developed the nuclear power plant projects during the last 30 years while the other advanced countries ceased the project, and therefore, significant reduction of project cost and construction schedule were possible which benefits from the repetition of construction project. And now, its nuclear industry infrastructure possesses the strong competitiveness in this field.The electricity produced from the nuclear power is 150,958 MWh in 2008, which covers approximately 36% of the total electricity demand in Korea, while the installed capacity of nuclear power is 17,716 MW which is 24% of the total installed capacity. We are currently operating 20 units of nuclear power plants in Korea, and also are constructing 8 additional units (9,600 MW). Korea's nuclear power plants have displayed their excellent operating performance; the average plant capacity factor was 93.4% in 2008, which are about 15% higher than the world average of 77.8%. Moreover, the number of unplanned trips per unit was only 0.35 in 2008, which is the world top class performance. Also currently we are operating four CANDU nuclear units in Korea which are the same reactor type and capacity as the Cernavoda Units. They have been showing the excellent operating performance, of which capacity in 2008 is 92.8%. All the Korean

  12. Ai Weiwei - 21. sajandi märter? / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2011-01-01

    Hiina kunstniku, inimõiguslase ja teisitimõtleja Ai Weiwei elust, õpingutest, loomingust ja tegevusest. Hiinas kunstniku tagakiusamisest, arreteerimisest, maksupettuses süüdistamisest jm. Kunstniku toetajatest. Inglise kunstileht Art Review valis Ai Weiwei 2011. a. kõige mõjuvõimsamaks kunstitegelaseks

  13. Integrating the Wall Street Journal into AIS Courses

    Science.gov (United States)

    Kohlmeyer, James M., III

    2008-01-01

    While it is important for accounting information systems (AIS) students to understand computer technology, internal controls and business processes, such knowledge is of little use without reference to appropriate contexts. Integrating Wall Street Journal (WSJ) readings and discussions into AIS classes can enrich learning by stimulating…

  14. Brosimacutins A-I, nine new flavonoids from Brosimum acutifolium.

    Science.gov (United States)

    Takashima, Junko; Ohsaki, Ayumi

    2002-12-01

    Nine new flavonoids, brosimacutins A-I (1-9), and four known flavonoids were isolated from the bark of Brosimum acutifolium, a Brazilian folk medicine ("Mururé"). Their structures were elucidated by spectroscopic methods, including 2D NMR. Brosimacutins A-I possess differentially functionalized isoprene units at C-8.

  15. An Immune Agent for Web-Based AI Course

    Science.gov (United States)

    Gong, Tao; Cai, Zixing

    2006-01-01

    To overcome weakness and faults of a web-based e-learning course such as Artificial Intelligence (AI), an immune agent was proposed, simulating a natural immune mechanism against a virus. The immune agent was built on the multi-dimension education agent model and immune algorithm. The web-based AI course was comprised of many files, such as HTML…

  16. the Lexique kikongo–français by

    African Journals Online (AJOL)

    Gilles-Maurice de Schryver

    français by the Jesuit missionary Charles Polis, is analysed in great detail. Section 1 expounds on the goal and ... dictionary manuscript for Kikongo: the Lexique kikongo–français by Charles Polis. s.j. (1885–†1943). .... Inkisi River, and all but one (Leverville, the present Lusanga) are close to that river, which thus strongly ...

  17. Radioimmunoassay of apolipoprotein A-I of rat serum

    International Nuclear Information System (INIS)

    Fainaru, M.; Havel, R.J.; Felker, T.E.

    1976-01-01

    A double antibody radioimmunoassay technique was developed for quantification of apolipoprotein A-I, the major apoprotein of rat high density lipoprotein. Apo A-I was labelled with 125 I by the chloramine-T method. 125 I-labeled apo A-I had the same electrophoretic mobility as unlabeled apo A-I and more than 80% of the 125 I was precipitated by rabbit anti apo A-I antibodies. The assay is sensitive at the level of 0.5-5 ng, and has intraassay and interassay coefficients of variation of 4.5 and 6.5% respectively. The specificity of the assay was established by competitive displacement of 125 I-labeled apo A-I from its antibody by apo A-I and lipoproteins containing apo A-I, but not by rat albumin and other apoproteins. Immunoreactivity of high density lipoprotein and serum was only about 35% of that of their delipidated forms when Veronal buffer was used as a diluent. Inclusion of 5 mM sodium decyl sulfate in the incubation mixture brought out reactivity equivalent to that found after delipidation. Completeness of the reaction was verified by comparison with the amount of apo A-I in chromatographic fractions of the total apoprotein of high density lipoprotein. Content (weight %, mean values +- S.D.) of immunoassayable apo A-I was: 62.3 +- 5.9 in high density lipoprotein; 1.7 +- 0.3 in low density lipoprotein; 0.09 +- 0.03 in very low density lipoprotein and 25.0 +- 5.0 in lymph chylomicrons. Concentration in whole serum was 51.4 +- 8.9 mg/dl and 33.6 +- 4.1 mg/dl for female and male rats, respectively (p 1.21 g/ml and <1% in lipoproteins of d<1.063 g/ml

  18. South Korea's nuclear fuel industry

    International Nuclear Information System (INIS)

    Clark, R.G.

    1990-01-01

    March 1990 marked a major milestone for South Korea's nuclear power program, as the country became self-sufficient in nuclear fuel fabrication. The reconversion line (UF 6 to UO 2 ) came into full operation at the Korea Nuclear Fuel Company's fabrication plant, as the last step in South Korea's program, initiated in the mid-1970s, to localize fuel fabrication. Thus, South Korea now has the capability to produce both CANDU and pressurized water reactor (PWR) fuel assemblies. This article covers the nuclear fuel industry in South Korea-how it is structures, its current capabilities, and its outlook for the future

  19. Little AI: Playing a constructivist robot

    Directory of Open Access Journals (Sweden)

    Olivier L. Georgeon

    2017-01-01

    Full Text Available Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated “baby robot”. The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player’s commands. The player must learn, at the same time, the functioning of the robot’s body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937, [1].

  20. [Artificial intelligence] AI for protection systems

    Energy Technology Data Exchange (ETDEWEB)

    Aggarwal, R.; Johns, A.

    1997-12-31

    The reliable operation of large power systems with small stability margins is highly dependent on control systems and protection devices. Progress in the field of microprocessor systems and demanding requirements in respect of the performance of protective relays are the reasons for digital device applications to power system protection. The superiority of numeric protection over its analogue alternatives is attributed to such factors as accurate extraction of the fundamental voltage and current components through filtering, functional benefits resulting from multi-processor design and extensive self-monitoring, etc. However, all these reasons have not led to a major impact on speed, sensitivity and selectivity of primary protective relays, and the gains are only marginal; this is so because conventional digital relays still rely on deterministic signal models and a heuristic approach for decision making, so that only a fraction of the information contained within voltage and current signals as well as knowledge about the plant to be protected is used. The performance of digital relays may be substantially improved if the decision making is based on elements of artificial intelligence (AI). (Author)

  1. Data of evolutionary structure change: 1AIFB-2AI0K [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ignment> 0 n> 1AIF n>B 1AI... CA 272 n> 2AI0 n>K ...n>2AI0Kn> VAHPASSTKVD EEE EEEE...1AIFB-2AI0K 1AIF 2AI0 B K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

  2. Nuclear power in Korea

    International Nuclear Information System (INIS)

    Rim, C.S.

    1990-01-01

    Before addressing the issue of public and utility acceptance of nuclear power in Korea, let me briefly explain the Korean nuclear power program and development plan for a passively safe nuclear power plant in Korea. At present, there are eight PWRs and one CANDU in operation; two PWRs are under construction, and contract negotiations are underway for one more CANDU and two more PWRs, which are scheduled to be completed by 1997,1998 and 1999, respectively. According to a recent forecast for electricity demand in Korea, about fifty additional nuclear power plants with a generating capacity of 1000MWe are required by the year 2030. Until around 2006, Korean standardized nuclear power plants with evolutionary features such as those in the ALWR program are to be built, and a new type of nuclear power plant with passive safety features is expected to be constructed after 2006. The Korean government is making a serious effort to increase public understanding of the safety of nuclear power plants and radioactive waste storage and disposal. In addition, the Korean government has recently introduced a program of benefits for residents near nuclear power plants. By this program, common facilities such as community centers and new roads are constructed, and scholarships are given to the local students. Nuclear power is accepted positively by the utility and reasonably well by the public in Korea

  3. Teaching About South Korea.

    Science.gov (United States)

    Schisgall, Jane

    1983-01-01

    Identifies reasons why social studies educators should improve their teaching about South Korea. Included in the list is the increasing numbers of Koreans being educated in the United States, the summer Olympics in 1988, and the use of Korean culture as a case study demonstrating the effects of cultural transmission and society in transition. (JDH)

  4. Nuclear power in Korea

    Energy Technology Data Exchange (ETDEWEB)

    Rim, C S [Radioactive Waste Management Centre, Korea Atomic Energy Research Institute, Taejon, Choong-Nam (Korea, Republic of)

    1990-07-01

    Before addressing the issue of public and utility acceptance of nuclear power in Korea, let me briefly explain the Korean nuclear power program and development plan for a passively safe nuclear power plant in Korea. At present, there are eight PWRs and one CANDU in operation; two PWRs are under construction, and contract negotiations are underway for one more CANDU and two more PWRs, which are scheduled to be completed by 1997,1998 and 1999, respectively. According to a recent forecast for electricity demand in Korea, about fifty additional nuclear power plants with a generating capacity of 1000MWe are required by the year 2030. Until around 2006, Korean standardized nuclear power plants with evolutionary features such as those in the ALWR program are to be built, and a new type of nuclear power plant with passive safety features is expected to be constructed after 2006. The Korean government is making a serious effort to increase public understanding of the safety of nuclear power plants and radioactive waste storage and disposal. In addition, the Korean government has recently introduced a program of benefits for residents near nuclear power plants. By this program, common facilities such as community centers and new roads are constructed, and scholarships are given to the local students. Nuclear power is accepted positively by the utility and reasonably well by the public in Korea.

  5. Sustainable energy in Korea

    International Nuclear Information System (INIS)

    IJspelder, S.

    2010-10-01

    This report provides an overview of the renewable energy sector in South Korea, with attention to the hitherto small size of the market, the strong growth of investments in the last five years, the market concentration consisting of a number of large conglomerates and many SMEs, the entry barriers to the market for Dutch companies, and the market penetration. [nl

  6. China, South Korea, Japan

    International Nuclear Information System (INIS)

    Anon.

    1988-01-01

    Intended for Canadian readers, this popular account was suggested by the Sixth Pacific Basin Nuclear Conference. Economic, political, geographic, sociological and historical aspects of the nuclear programmes of China, South Korea and Japan are discussed. The importance of past, present and future Canadian nuclear trade with the area is indicated

  7. Dance Education in Korea

    Science.gov (United States)

    Byeon, Jae-Kyung

    2012-01-01

    Despite a structured physical education system and related policies, dance education in Korea largely exists as a course in name only, without achieving its unique goals. It lacks standards within the physical education curriculum, which indicates that dance education is not conducted properly. Thus, the content and level of dance education vary…

  8. Divided Korea: United Future?

    Science.gov (United States)

    Cumings, Bruce

    1995-01-01

    Korea's recorded history extends back before the birth of Christ. Through their long history, the Koreans have endured a variety of social, political, and economical crises. Confucianism has long been one of the most popular religions by which the Korean people have lived. However, Koreans also have embraced Buddhism and Christianity while…

  9. Dicty_cDB: FC-AI12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

  10. Dicty_cDB: FC-AI07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

  11. Dicty_cDB: FC-AI19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

  12. Dicty_cDB: FC-AI14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

  13. Dicty_cDB: FC-AI15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

  14. Dicty_cDB: FC-AI24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

  15. Dicty_cDB: FC-AI06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

  16. Dicty_cDB: FC-AI09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

  17. Dicty_cDB: FC-AI22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

  18. Dicty_cDB: FC-AI08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

  19. El profesor George H. Humphreys

    Directory of Open Access Journals (Sweden)

    Manuel José Luque

    1948-11-01

    Y es un goce espiritual magnìfico por el tamaño y la nobleza de su finalidad, el objetivo mismo de sus actividades y su altura moral. Por el duelo que se entabla con la muerte, cara a cara, y en fin, por la sagrada satisfacción de vencer la enfermedad con el poder de un cerebro servido por diez dedos.

  20. Recent progresses on AI-2 bacterial quorum sensing inhibitors.

    Science.gov (United States)

    Zhu, Peng; Li, Minyong

    2012-01-01

    Quorum sensing (QS) is a communication procedure that predominates gene expression in response to cell density and fluctuations in the neighboring environment as a result of discerning molecules termed autoinducers (AIs). It has been embroiled that QS can govern bacterial behaviors such as the secretion of virulence factors, biofilm formation, bioluminescence production, conjugation, sporulation and swarming motility. Autoinducer 2 (AI-2), a QS signaling molecule brought up to be involved in interspecies communication, exists in both gram-negative and -positive bacteria. Therefore, novel approaches to interrupt AI-2 quorum sensing are being recognized as next generation antimicrobials. In the present review article, we summarized recent progresses on AI-2 bacterial quorum sensing inhibitors and discussed their potential as the antibacterial agents.

  1. Expanding the Possibilities of AIS Data with Heuristics

    Directory of Open Access Journals (Sweden)

    Bjørnar Brende Smestad

    2017-06-01

    Full Text Available Automatic Identification System (AIS is primarily used as a tracking system for ships, but with the launch of satellites to collect these data, new and previously untested possibilities are emerging. This paper presents the development of heuristics for establishing the specific ship type using information retrieved from AIS data alone. These heuristics expand the possibilities of AIS data, as the specific ship type is vital for several transportation research cases, such as emission analyses of ship traffic and studies on slow steaming. The presented method for developing heuristics can be used for a wider range of vessels. These heuristics may form the basis of large-scale studies on ship traffic using AIS data when it is not feasible or desirable to use commercial ship data registers.

  2. Creating an AI modeling application for designers and developers

    Science.gov (United States)

    Houlette, Ryan; Fu, Daniel; Jensen, Randy

    2003-09-01

    Simulation developers often realize an entity's AI by writing a program that exhibits the intended behavior. These behaviors are often the product of design documents written by designers. These individuals, while possessing a vast knowledge of the subject matter, might not have any programming knowledge whatsoever. To address this disconnect between design and subsequent development, we have created an AI application whereby a designer or developer sketches an entity's AI using a graphical "drag and drop" interface to quickly articulate behavior using a UML-like representation of state charts. Aside from the design-level benefits, the application also features a runtime engine that takes the application's data as input along with a simulation or game interface, and makes the AI operational. We discuss our experience in creating such an application for both designer and developer.

  3. 4th June: AIS and NICE/MAIL unique authentication

    CERN Multimedia

    AIS and NICE teams

    2007-01-01

    Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. So starting on 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

  4. 4th June: AIS and NICE/MAIL unique authentication

    CERN Multimedia

    The AIS and NICE teams

    2007-01-01

    Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on the 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. Thus starting on the 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

  5. Quality measures and assurance for AI (Artificial Intelligence) software

    Science.gov (United States)

    Rushby, John

    1988-01-01

    This report is concerned with the application of software quality and evaluation measures to AI software and, more broadly, with the question of quality assurance for AI software. Considered are not only the metrics that attempt to measure some aspect of software quality, but also the methodologies and techniques (such as systematic testing) that attempt to improve some dimension of quality, without necessarily quantifying the extent of the improvement. The report is divided into three parts Part 1 reviews existing software quality measures, i.e., those that have been developed for, and applied to, conventional software. Part 2 considers the characteristics of AI software, the applicability and potential utility of measures and techniques identified in the first part, and reviews those few methods developed specifically for AI software. Part 3 presents an assessment and recommendations for the further exploration of this important area.

  6. Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS. The MAGI mission is to use the Wave Glider to sample the late summer chlorophyll bloom that develops near...

  7. NASA space station automation: AI-based technology review

    Science.gov (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

    1985-01-01

    Research and Development projects in automation for the Space Station are discussed. Artificial Intelligence (AI) based automation technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics. AI technology will also be developed for the servicing of satellites at the Space Station, system monitoring and diagnosis, space manufacturing, and the assembly of large space structures.

  8. Human-Assisted AI: an Intelligence Augmentation Approach

    OpenAIRE

    Alicea, Bradly

    2018-01-01

    As a flavor of Human-Computer Interaction (HCI), Human-Assisted AI can serve to both augment both human performance and artificial systems. This talk will feature a discussion of Human-assisted AI as an instance of Intelligence Augmentation (IA). We will discuss instances of weak and strong IA, in addition to contemporary examples of and paths forward for such systems. In the variety of models presented, data plays a critical role in the structure of interactions between human and artificial ...

  9. Emotion Oriented Programming: Computational Abstractions for AI Problem Solving

    OpenAIRE

    Darty , Kevin; Sabouret , Nicolas

    2012-01-01

    International audience; In this paper, we present a programming paradigm for AI problem solving based on computational concepts drawn from Affective Computing. It is believed that emotions participate in human adaptability and reactivity, in behaviour selection and in complex and dynamic environments. We propose to define a mechanism inspired from this observation for general AI problem solving. To this purpose, we synthesize emotions as programming abstractions that represent the perception ...

  10. It Takes Two to Tango: Towards Theory of AI's Mind

    OpenAIRE

    Chandrasekaran, Arjun; Yadav, Deshraj; Chattopadhyay, Prithvijit; Prabhu, Viraj; Parikh, Devi

    2017-01-01

    Theory of Mind is the ability to attribute mental states (beliefs, intents, knowledge, perspectives, etc.) to others and recognize that these mental states may differ from one's own. Theory of Mind is critical to effective communication and to teams demonstrating higher collective performance. To effectively leverage the progress in Artificial Intelligence (AI) to make our lives more productive, it is important for humans and AI to work well together in a team. Traditionally, there has been m...

  11. AI, Native Supercomputing and The Revival of Moore's Law

    OpenAIRE

    Lu, Chien-Ping

    2017-01-01

    Based on Alan Turing's proposition on AI and computing machinery, which shaped Computing as we know it today, the new AI computing machinery should comprise a universal computer and a universal learning machine. The later should understand linear algebra natively to overcome the slowdown of Moore's law. In such a universal learnig machine, a computing unit does not need to keep the legacy of a universal computing core. The data can be distributed to the computing units, and the results can be...

  12. PACS industry in Korea

    Science.gov (United States)

    Kim, Hee-Joung

    2002-05-01

    PACS industry in Korea has been rapidly growing, since government had supported collaborative PACS project between industry and university hospital. In the beginning, PACS industry had focused on developing peripheral PACS solutions, while the Korea PACS society was being formed. A few companies had started developing and installing domestic large-scale full-PACS system for teaching hospitals. Several years later, many hospitals have installed full-PACS system with national policy of reimbursement for PACS exams in November 1999. Both experiences of full-PACS installation and national policy generated tremendous intellectual and technological expertise about PACS at all levels, clinical, hospital management, education, and industrial sectors. There are now more than 20 domestic PACS companies. They have enough experiences which are capable of installing a truly full-PACS system for large-scale teaching hospitals. As an example, a domestic company had installed more than 40 full-PACS systems within 2-3 years. Enough experiences of full-PACS installation in Korea lead PACS industry to start exporting their full-PACS solutions. However, further understanding and timely implementation of continuously evolving international standard and integrated healthcare enterprise concepts may be necessary for international leading of PACS technologies for the future.

  13. AI-2 of Aggregatibacter actinomycetemcomitans Inhibits Candida albicans Biofilm Formation

    Directory of Open Access Journals (Sweden)

    Endang W. Bachtiar

    2014-07-01

    Full Text Available Aggregatibacter actinomycetemcomitans, a Gram-negative bacterium, and Candida albicans, a polymorphic fungus, are both commensals of the oral cavity but both are opportunistic pathogens that can cause oral diseases. A. actinomycetemcomitans produces a quorum-sensing molecule called autoinducer-2 (AI-2, synthesized by LuxS, that plays an important role in expression of virulence factors, in intra- but also in interspecies communication. The aim of this study was to investigate the role of AI-2 based signaling in the interactions between C. albicans and A. actinomycetemcomitans. A. actinomycetemcomitans adhered to C. albicans and inhibited biofilm formation by means of a molecule that was secreted during growth. C. albicans biofilm formation increased significantly when co-cultured with A. actinomycetemcomitans luxS, lacking AI-2 production. Addition of wild-type-derived spent medium or synthetic AI-2 to spent medium of the luxS strain, restored inhibition of C. albicans biofilm formation to wild-type levels. Addition of synthetic AI-2 significantly inhibited hypha formation of C. albicans possibly explaining the inhibition of biofilm formation. AI-2 of A. actinomycetemcomitans is synthesized by LuxS, accumulates during growth and inhibits C. albicans hypha- and biofilm formation. Identifying the molecular mechanisms underlying the interaction between bacteria and fungi may provide important insight into the balance within complex oral microbial communities.

  14. Highlights on artificial insemination (AI technology in the pig

    Directory of Open Access Journals (Sweden)

    Tarek Khalifa

    2014-03-01

    Full Text Available Over the past decade, there has been a tremendous increase in the development of field AI services in the majority of countries concerned with pig production. The objective of this paper is to review: (a the current status of swine AI in the world, (b significance and limitation of AI with liquid and frozen semen, (c the biological traits of porcine semen in relation to in-vitro sperm storage, (d the criteria used for selection of a boar stud as a semen supplier, (e how to process boar semen for liquid and frozen storage in the commercial settings and (f how to improve fertility and prolificacy of boar semen. More than 99% of the inseminations conducted worldwide are made with liquid-stored semen. AI with frozen semen is used only for upgrading the genetic base in a particular country or herd. Determining the initial quality of semen ejaculates along with the selection of the optimum storage extender has a profound effect on the quality and fertility of AI doses. Different procedures have been used for improving the fertility of preserved spermatozoa including colloidal centrifugation of the semen, intrauterine insemination and modulation of the uterine defense mechanism after AI. Development of an efficient protocol for synchronizing the time of ovulation in sows and gilts coupled with improving uterine horn insemination technique will make a breakthrough in the commercial use of frozen boar semen.

  15. Calibrating AIS images using the surface as a reference

    Science.gov (United States)

    Smith, M. O.; Roberts, D. A.; Shipman, H. M.; Adams, J. B.; Willis, S. C.; Gillespie, A. R.

    1987-01-01

    A method of evaluating the initial assumptions and uncertainties of the physical connection between Airborne Imaging Spectrometer (AIS) image data and laboratory/field spectrometer data was tested. The Tuscon AIS-2 image connects to lab reference spectra by an alignment to the image spectral endmembers through a system gain and offset for each band. Images were calibrated to reflectance so as to transform the image into a measure that is independent of the solar radiant flux. This transformation also makes the image spectra directly comparable to data from lab and field spectrometers. A method was tested for calibrating AIS images using the surface as a reference. The surface heterogeneity is defined by lab/field spectral measurements. It was found that the Tuscon AIS-2 image is consistent with each of the initial hypotheses: (1) that the AIS-2 instrument calibration is nearly linear; (2) the spectral variance is caused by sub-pixel mixtures of spectrally distinct materials and shade, and (3) that sub-pixel mixtures can be treated as linear mixtures of pure endmembers. It was also found that the image can be characterized by relatively few endmembers using the AIS-2 spectra.

  16. Application of AI methods to aircraft guidance and control

    Science.gov (United States)

    Hueschen, Richard M.; Mcmanus, John W.

    1988-01-01

    A research program for integrating artificial intelligence (AI) techniques with tools and methods used for aircraft flight control system design, development, and implementation is discussed. The application of the AI methods for the development and implementation of the logic software which operates with the control mode panel (CMP) of an aircraft is presented. The CMP is the pilot control panel for the automatic flight control system of a commercial-type research aircraft of Langley Research Center's Advanced Transport Operating Systems (ATOPS) program. A mouse-driven color-display emulation of the CMP, which was developed with AI methods and used to test the AI software logic implementation, is discussed. The operation of the CMP was enhanced with the addition of a display which was quickly developed with AI methods. The display advises the pilot of conditions not satisfied when a mode does not arm or engage. The implementation of the CMP software logic has shown that the time required to develop, implement, and modify software systems can be significantly reduced with the use of the AI methods.

  17. Mis toimub Põhja-Koreas? / Aadu Hiietamm

    Index Scriptorium Estoniae

    Hiietamm, Aadu, 1954-

    2004-01-01

    Infoagentuuri UPI teatel võib Põhja-Korea liider Kim Jong-il olla surnud, avalikest kohtadest on hakatud maha võtma tema portreesid. Põhja-Korea infoagentuur eitab seda. Ekspertide versioonidest Põhja-Koreas toimuva kohta

  18. Energy policy of North Korea

    International Nuclear Information System (INIS)

    Rueth, G.

    2006-01-01

    Since the year 1990, North Korea suffers internal-policy problems as well as foreign-political problems. The gross domestic investment decreased by 3.8% yearly between the years 1990 and 1998. Many actual problems of North Korea correspond with the energy crisis in this land affecting nearly all sectors of economy and society. This energy crisis was released by the fact, that the former Soviet Union has stopped the supply of primary energy in the year 1991. In the contribution under consideration, the author reports on the energy policy of North Korea. The main themes of this contribution are: (a) Development and characteristics of the energy sector; (b) Crisis of the energy sector; (c) Consequences of the energy crisis in North Korea; (d) Possibilities of the solution of the energy crisis. For the U.S.A. and the international community, the energy crisis offers the possibility to turn North Korea to negotiations by means of remedial measures in the energy sector. In response, North Korea should drop its nuclear energy program. Apart from such positive incentives, the threat of sanctions is conceivable. North Korea imports nearly 70 % of its oil demand from the People's Republic of China. Therefore, China has an great influence on North Korea. The energy crisis of North Korea shows the fatal consequences of a falsely performed energy policy with respect to the population of this land and with respect to the stability and disposing capacity of the political leadership

  19. Prevalence of avian influenza virus in wild birds before and after the HPAI H5N8 outbreak in 2014 in South Korea.

    Science.gov (United States)

    Shin, Jeong-Hwa; Woo, Chanjin; Wang, Seung-Jun; Jeong, Jipseol; An, In-Jung; Hwang, Jong-Kyung; Jo, Seong-Deok; Yu, Seung Do; Choi, Kyunghee; Chung, Hyen-Mi; Suh, Jae-Hwa; Kim, Seol-Hee

    2015-07-01

    Since 2003, highly pathogenic avian influenza (HPAI) virus outbreaks have occurred five times in Korea, with four HPAI H5N1 outbreaks and one HPAI H5N8 outbreak. Migratory birds have been suggested to be the first source of HPAI in Korea. Here, we surveyed migratory wild birds for the presence of AI and compared regional AI prevalence in wild birds from September 2012 to April 2014 for birds having migratory pathways in South Korea. Finally, we investigated the prevalence of AI in migratory birds before and after HPAI H5N8 outbreaks. Overall, we captured 1617 migratory wild birds, while 18,817 feces samples and 74 dead birds were collected from major wild bird habitats. A total of 21 HPAI viruses were isolated from dead birds, and 86 low pathogenic AI (LPAI) viruses were isolated from captured birds and from feces samples. Spatiotemporal distribution analysis revealed that AI viruses were spread southward until December, but tended to shift north after January, consistent with the movement of migratory birds in South Korea. Furthermore, we found that LPAI virus prevalences within wild birds were notably higher in 2013-2014 than the previous prevalence during the northward migration season. The data from our study demonstrate the importance of the surveillance of AI in wild birds. Future studies including in-depth genetic analysis in combination with evaluation of the movement and ecology of migratory birds might help us to bridge the gaps in our knowledge and better explain, predict, and ultimately prevent future HPAI outbreaks.

  20. North Korea, Quo Vadis?

    Directory of Open Access Journals (Sweden)

    Karl H. Stingeder

    2014-03-01

    Full Text Available North Korean politics appears neither irrational nor unpredictable: the logic of its actions may at first seem opaque, but it nonetheless displays its own rationale and patterns. – North Korea: a ruthless political actor, now under the leadership of Kim Jong-Un who inherited the regime’s leadership from his father and "Supreme Leader", Kim Jong-Il, in 2011. The country’s policy is based on its ongoing political agenda of (nuclear brinkmanship, a true threat to the world – or at least that's how the Western hemisphere sees it. Yet our factual knowledge of this post-Leninist and totalitarian regime is extremely limited and relatively distorted; it is largely circumstantial evidence and judgmental speculation that accounts for our perception of this East Asian state. Northeast Asia (China, Japan, South and North Korea, Taiwan is a region dominated by the legacy of the Cold War. The North Korean leadership has indeed established its priorities, primarily its isolationist orientation, but in the long term the regime cannot survive without external stimulus. Most importantly, even in a long-term, non-violent and gradual transformation of North Korea considerable danger can ultimately result in the demise of the regime. Apart from few signs of a North Korean "civil society", currently only the army might have the resources to see through a regime change. In the meantime, the strategies of isolationism as well as tight control of the media remain as fundamental cornerstones of the regime. A close-knit network of social control has been established and access to the internet for the most part is limited to the regime’s entrusted cadre.

  1. 77 FR 68150 - Meeting of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2012-11-15

    .../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting... Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative... violence within AI/AN communities. Dates and Locations: The meeting will be held on the reservation of the...

  2. Data of evolutionary structure change: 1AIFL-2AI0L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /ss_2> 0 n> 1AIF L...n> 1AIFLn> VSSSI----SSSNL 2AI0 Ln> 2AI0L...1AIFL-2AI0L 1AIF 2AI0 L L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...line> SER CA 273 SER CA 260 ASN CA 337 LEU CA 408

  3. Data of evolutionary structure change: 1AIFA-2AI0O [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available s_2> 0 n> 1AIF A...n> 1AIFAn> VSSSI----SSSNL n> 2AI0 n>O 2AI...1AIFA-2AI0O 1AIF 2AI0 A O DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...e>SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

  4. Data of evolutionary structure change: 1AIFH-2AI0K [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available > 0 n> 1AIF n>H ...n>1AIFHn> VAHPA-SSTKV n> 2AI0 n>K 2AI...1AIFH-2AI0K 1AIF 2AI0 H K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

  5. Data of evolutionary structure change: 1AIFA-2AI0L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2> 0 n> 1AIF n>A ...n>1AIFAn> VSSSI----SSSNL...n> 2AI0 n>L 2AI...1AIFA-2AI0L 1AIF 2AI0 A L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

  6. Nuclear Option in Korea

    International Nuclear Information System (INIS)

    Han, K. I.

    2002-01-01

    With sixteen(16) operating nuclear units in Korea, the share of nuclear power generation reached 41% of the total electric power generation as of December 2000. A prediction is that it would further increase to 44.5% by year 2015 according to the national long term power development plan. Four units are currently under construction with 6 more units in order. With little domestic energy resource and increasing energy demand to support national economic growth, Korea has chosen nuclear power as one of the major energy sources to ensure stable power supply and to promote energy self-sufficiency. It has been recognized that nuclear power in Korea is not a selective option but rather a necessity. The Korean nuclear power development started with construction of a 600 MWe size reactor that was designed and constructed by foreign vendors. As the national grid capacity became larger, the size of nuclear units increased to 1000 MWe class. In the mean time, the need for nuclear technology self-reliance grew not only in operation and maintenance but also in construction, manufacturing and design. For this, a nuclear technology self-reliance program has been embarked with the support of the Government and utility, and the 1000 MWe class KSNP(Korean Standard Nuclear Power Plant) has been developed. The KSNPs are currently being designed, manufactured, constructed and operated by relevant Korean entities themselves. To fit into a larger capacity national grid and also to improve nuclear economic competitiveness, the 1400 MWe class KNGR(Korean Next Generation Reactor) design has been developed uprating the 1000 MWe KSNP design. Its construction project is currently under contract negotiation, and is planned to be finished by 2010. In the mean time, to be ready for future electric power market deregulation, the 600 MWe class small KSNP design is being developed downsizing the KSNP. A modular small size reactor, SMART(System Integrated Modular Advanced Reactor) is also being

  7. Proceedings of conference on AI applications in physical sciences

    International Nuclear Information System (INIS)

    1993-01-01

    A Conference cum workshop on AI applications in Physical Sciences was organised by the Indian Physics Association at Bhabha Atomic Research Centre, Bombay during January 15-17, 1992. It was held in memory of Late Shri S.N. Seshadri, who was the moving spirit behind self reliance in instrumentation development for research and industry. The two day conference which was followed by one day workshop covered the following broad spectrum of topics in Artificial Intelligence: AI Tools and Techniques, Neural Networks, Robotics and Machine Vision, Fuzzy Control and Applications, Natural Language and Speech Processing, Knowledge based Systems, and AI and Allied applications. The conference dealt with recent advances and achievements in AI. It provided a forum for the exchange of valuable information and expertise in this fast emerging field. Over 200 scientists, engineers and computer professionals from various universities, R and D institutes and industries actively participated. 45 contributed papers and 8 invited talks were presented in the symposium. The volume contains selected papers which were contributed by the participants. Some of them dealt with AI applications in nuclear science and technology. (original)

  8. Present status of application of AI in nuclear industry

    International Nuclear Information System (INIS)

    Kitamura, Masaharu

    1989-01-01

    Artificial intelligence (AL) techniques have been introduced actively in the nuclear industry in pursuit of increased safety and efficiency. The present report outlines some AI techniques currently used in nuclear facilities. This type of techniques have increasingly been introduced to such areas as design, construction, operation, maintenance, quality control and analysis. Most of them use knowledge engineering techniques including expert systems. Positive efforts at research and application of various more advance AI techniaues have started recently. For application of AI techniques, activities in nuclear power plants can be divided into two groups. One includes 'analytical' activities such as operation, maintenance and analysis, while the other includes 'synthetic' activities such as design, construction and fuel control. The most important AI technology for the analytical activities is diagnosis. Thus the report outlines major processes to which diagnostic techniques are applicable, and knowledge description and inference methods used for diagnosis. For AI techniques for synthetic activities, some problems and possible solutions are addressed. Development efforts in and outside Japan are also outlined. (Nogami, K.)

  9. Discovering Knowledge from AIS Database for Application in VTS

    Science.gov (United States)

    Tsou, Ming-Cheng

    The widespread use of the Automatic Identification System (AIS) has had a significant impact on maritime technology. AIS enables the Vessel Traffic Service (VTS) not only to offer commonly known functions such as identification, tracking and monitoring of vessels, but also to provide rich real-time information that is useful for marine traffic investigation, statistical analysis and theoretical research. However, due to the rapid accumulation of AIS observation data, the VTS platform is often unable quickly and effectively to absorb and analyze it. Traditional observation and analysis methods are becoming less suitable for the modern AIS generation of VTS. In view of this, we applied the same data mining technique used for business intelligence discovery (in Customer Relation Management (CRM) business marketing) to the analysis of AIS observation data. This recasts the marine traffic problem as a business-marketing problem and integrates technologies such as Geographic Information Systems (GIS), database management systems, data warehousing and data mining to facilitate the discovery of hidden and valuable information in a huge amount of observation data. Consequently, this provides the marine traffic managers with a useful strategic planning resource.

  10. A framework for AI-based nuclear design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke

    1991-01-01

    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an exploration model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  11. Analysis of raw AIS spectrum recordings from a LEO satellite

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter

    2014-01-01

    The AAUSAT3 satellite is a 1U cubesat, which has been developed by students at Aalborg University, Denmark in collaboration with the Danish Maritime Authority. The satellite was launched in February 2013 on a mission to monitor ships from space using their AIS broadcast signals as an indication...... of position. The SDR receiver developed to listen for these AIS signals also allows for sampling and storing of the raw intermediate frequency spectrum, which has been used in order to map channel utilization over the areas of interest for the mission, which is mainly the arctic regions. The SDR based...... receiver used onboard the satellite is using a single chip front-end solution, which down converts the AIS signal located around 162 MHz into an intermediate frequency, with a up to 200 kHz bandwidth. This I/F signal is sampled with a 750 kSPS A/D converter and further processed by an Analog Devices DSP...

  12. Framework for AI-based nuclear reactor design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke

    1992-01-01

    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an explorative abduction model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  13. Towards AI-powered personalization in MOOC learning

    Science.gov (United States)

    Yu, Han; Miao, Chunyan; Leung, Cyril; White, Timothy John

    2017-12-01

    Massive Open Online Courses (MOOCs) represent a form of large-scale learning that is changing the landscape of higher education. In this paper, we offer a perspective on how advances in artificial intelligence (AI) may enhance learning and research on MOOCs. We focus on emerging AI techniques including how knowledge representation tools can enable students to adjust the sequence of learning to fit their own needs; how optimization techniques can efficiently match community teaching assistants to MOOC mediation tasks to offer personal attention to learners; and how virtual learning companions with human traits such as curiosity and emotions can enhance learning experience on a large scale. These new capabilities will also bring opportunities for educational researchers to analyse students' learning skills and uncover points along learning paths where students with different backgrounds may require different help. Ethical considerations related to the application of AI in MOOC education research are also discussed.

  14. AI-guided parameter optimization in inverse treatment planning

    International Nuclear Information System (INIS)

    Yan Hui; Yin Fangfang; Guan Huaiqun; Kim, Jae Ho

    2003-01-01

    An artificial intelligence (AI)-guided inverse planning system was developed to optimize the combination of parameters in the objective function for intensity-modulated radiation therapy (IMRT). In this system, the empirical knowledge of inverse planning was formulated with fuzzy if-then rules, which then guide the parameter modification based on the on-line calculated dose. Three kinds of parameters (weighting factor, dose specification, and dose prescription) were automatically modified using the fuzzy inference system (FIS). The performance of the AI-guided inverse planning system (AIGIPS) was examined using the simulated and clinical examples. Preliminary results indicate that the expected dose distribution was automatically achieved using the AI-guided inverse planning system, with the complicated compromising between different parameters accomplished by the fuzzy inference technique. The AIGIPS provides a highly promising method to replace the current trial-and-error approach

  15. Procedure for Marine Traffic Simulation with AIS Data

    Directory of Open Access Journals (Sweden)

    Rina Miyake

    2015-03-01

    Full Text Available It is essential to evaluate safety of marine traffic for the improvement of efficiency and safety of marine traffic. Spread of AIS makes observation of actual marine traffic more easily and faster than before. Besides, description of collision avoidance behaviours of ships are indispensable to simulate a realistic marine traffic. It is important to develop and implement an algorithm of collision avoidance corresponding to a target traffic or target area into the marine traffic simulation because actual actions for collision avoidance depend on circumstances where ships are sailing. The authors developed an automated marine traffic simulation system with AIS data. And in this paper, we proposed a series of systematic procedures for marine traffic simulation including analysing for collision avoidance behaviours using AIS data.

  16. Estonia builds ties with South Korea

    Index Scriptorium Estoniae

    2010-01-01

    Korea Vabariigis toimunud välisminister Urmas Paeti ja Lõuna-Korea välis- ja kaubandusministri Yu Myung-hwani kohtumisel räägiti Eesti ja Lõuna-Korea poliitilise, majandus-, teadus- ning infotehnoloogiaalase koostöö arendamisest. Urmas Paet kohtus ka Lõuna-Korea energia ja infotehnoloogia aseministri Cho Seokiga

  17. Application of AI technology to nuclear plant operations

    International Nuclear Information System (INIS)

    Sackett, J.I.

    1988-01-01

    In this paper, applications of Artificial Intelligence (AI) Technology to nuclear-power plant operation are reviewed. AI Technology is advancing rapidly and in the next five years is expected to enjoy widespread application to operation, maintenance, management and safety. Near term emphasis on a sensor validation, scheduling, alarm handling, and expert systems for procedural assistance. Ultimate applications are envisioned to culminate in autonomous control such as would be necessary for a power system in space, where automatic control actions are taken based upon reasoned conclusions regarding plant conditions, capability and control objectives

  18. AiGERM: A logic programming front end for GERM

    Science.gov (United States)

    Hashim, Safaa H.

    1990-01-01

    AiGerm (Artificially Intelligent Graphical Entity Relation Modeler) is a relational data base query and programming language front end for MCC (Mission Control Center)/STP's (Space Test Program) Germ (Graphical Entity Relational Modeling) system. It is intended as an add-on component of the Germ system to be used for navigating very large networks of information. It can also function as an expert system shell for prototyping knowledge-based systems. AiGerm provides an interface between the programming language and Germ.

  19. Clinical neuropsychology in South Korea.

    Science.gov (United States)

    Kim, Myung-Sun; Chey, Jeanyung

    2016-11-01

    Clinical neuropsychology in South Korea, albeit its relatively short history, has advanced dramatically. We review a brief history and current status of clinical neuropsychology in South Korea. The history, the educational pathway, the training pathway, the certification process, and careers in clinical neuropsychology in South Korea are reviewed. We have reviewed the neuropsychological services, including assessment and treatment, research on neurological and psychiatric populations, and neuropsychology education and the requirements related to education, training, and board examinations of those providing neuropsychological services in South Korea. We also describe how the Korean Society for Neuropsychology Research, the first and only meeting for neuropsychologists in the country established in 1999, has played a major role in how clinical neuropsychology is practiced and developed as a professional field in South Korea. Clinical neuropsychology in South Korea has achieved major progress over just a quarter of a century, and its future is promising in light of the increasing demand for neuropsychological services and advances in neuroscience in the country. Challenges that the community of clinical neuropsychologists are currently facing in South Korea, including formalizing neuropsychological curriculum and training programs and developing advanced credentialing procedures, are discussed.

  20. North Korea: a mercenary proliferator?

    International Nuclear Information System (INIS)

    Hemez, Remy

    2015-01-01

    After having recalled that North Korea possesses a rather advanced ballistic programme which has been started in the 1970 with the Chinese support, that North Korea is the fourth world producer of ballistic missiles, the author outlines that this country has become a major proliferator as it exports this production to different States and non-State actors. He recalls the long history of relationships between North Korea and terrorist organisations (even during the Cold War), comments the current and major support of North Korea to Hamas and Hezbollah in Gaza and in Lebanon. These relationships are then related with those these both organisations have with Syria and Iran who are in fact the relays between them and North Korea. The author explains why Hamas and Hezbollah must buy their weapons to such a far country: Iran is submitted to international sanctions, Iran and Syria want to avoid being banned from the international community for selling weapon to a terrorist (or so-said) organisation, and prices are rather competitive. If North Korea is also submitted to international sanctions, weapon smuggling seems to be institutional in this country. The author finally briefly evokes the issue of chemical weapons: North Korea possesses few thousand tonnes of these weapons, and could export them to non-state organisations

  1. CPI Bias in Korea

    Directory of Open Access Journals (Sweden)

    Chul Chung

    2007-12-01

    Full Text Available We estimate the CPI bias in Korea by employing the approach of Engel’s Law as suggested by Hamilton (2001. This paper is the first attempt to estimate the bias using Korean panel data, Korean Labor and Income Panel Study(KLIPS. Following Hamilton’s model with non­linear specification correction, our estimation result shows that the cumulative CPI bias over the sample period (2000-2005 was 0.7 percent annually. This CPI bias implies that about 21 percent of the inflation rate during the period can be attributed to the bias. In light of purchasing power parity, we provide an interpretation of the estimated bias.

  2. A Note on the Lithuanian 2nd Sg. Ending "-ai."

    Science.gov (United States)

    Schmalstieg, William R.

    1980-01-01

    Discusses an attempt by Chr. S. Stang to establish a proto-Lithuanian present paradigm for the verb "megti" (to like), questioning the existence of the second singular form "-ai." Argues that the few examples of this form, all from a single Bible translation source, afford shaky support for its existence. (Executive Office of the AABS, 231 Miller…

  3. Exploring AI Language Assistants with Primary EFL Students

    Science.gov (United States)

    Underwood, Joshua

    2017-01-01

    The main objective of this study was to identify ways to incorporate voice-driven Artificial Intelligence (AI) effectively in classroom language learning. This nine month teacher-led design research study employed technology probes (Amazon's Alexa, Apple's Siri, Google voice search) and co-design methods with a class of primary age English as a…

  4. Archiving AIS messages in a Geo-DBMS

    NARCIS (Netherlands)

    Meijers, B.M.; Quak, C.W.; van Oosterom, P.J.M.; Bregt, Arnold; Sarjakoski, Tapani; Lammeren, Ron van; Rip, Frans

    2017-01-01

    This paper reports on the result of two studies for using a geographical database management system for archiving Automated Identification System (AIS) message data. In this paper, we analyse the storage (using MongoDB and PostgreSQL) and we give a more in-depth description of a possible data model

  5. PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL ...

    African Journals Online (AJOL)

    PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL PRODUCTION SYSTEMS. P. de V. Booysen. University of Natal, King George V Avenue, Durban. (Key words: .... inherent in biotic simplification is the danger of increased susceptibility of the abiotic component to degradation. So as the agriculturalist ...

  6. The hidden dangers of experimenting in distributed AI

    NARCIS (Netherlands)

    Meyer, A.P.; Smit, A.; Kempen, M.; Wijngaards, N.

    2006-01-01

    Research on multi-agent systems often involves experiments, also in situations where humans interact with agents. Consequently, the field of experimental (human) sciences becomes more and more relevant. This paper clarifies how things can and often do go wrong in distributed AI experiments. We show

  7. The 2010 Mario AI Championship: Level Generation Track

    DEFF Research Database (Denmark)

    Shaker, Noor; Togelius, Julian; Yannakakis, Georgios N.

    2011-01-01

    The Level Generation Competition, part of the IEEE CIS-sponsored 2010 Mario AI Championship, was to our knowledge the world’s first procedural content generation competition. Competitors participated by submitting level generators — software that generates new levels for a version of Super Mario...

  8. AIS reception from a CubeSat in LEO

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2013-01-01

    The primary payloads on board the AAUSAT3 satellite are two different AIS receivers, one is a traditional hardware-based receiver, the other one is a software-defined radio receiver. The hardware-based receiver has been developed around an ADF-7020 transceiver, with an appropriate LNA in front...... into a low-Earth orbit with a semi-major axis of 7156 km, i.e. 800 km altitude, near circular, dusk-dawn Sun-synchronous orbit. From this orbit the AIS antenna system, which consists of a dipole antenna, has a foot print diameter of approximately 6000 km. During the first pass over the primary ground station...... at Aalborg University, basic telemetry and the first few AIS messages were downloaded. During the first 14 days of the mission, the two receivers managed to detect more than 100,000 different AIS messages from ships all around the world, and more than 35,000 of these messages have been successfully...

  9. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Erickson, S.A.

    1984-04-25

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project.

  10. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    International Nuclear Information System (INIS)

    Erickson, S.A.

    1984-01-01

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project

  11. Measuring the Value of AI in Space Science and Exploration

    Science.gov (United States)

    Blair, B.; Parr, J.; Diamond, B.; Pittman, B.; Rasky, D.

    2017-10-01

    FDL is tackling knowledge gaps useful to the space program by forming small teams of industrial partners, cutting-edge AI researchers and space science domain experts, and tasking them to solve problems that are important to NASA as well as humanity's future.

  12. On the homotopy equivalence of simple AI-algebras

    International Nuclear Information System (INIS)

    Aristov, O Yu

    1999-01-01

    Let A and B be simple unital AI-algebras (an AI-algebra is an inductive limit of C*-algebras of the form BigOplus i k C([0,1],M N i ). It is proved that two arbitrary unital homomorphisms from A into B such that the corresponding maps K 0 A→K 0 B coincide are homotopic. Necessary and sufficient conditions on the Elliott invariant for A and B to be homotopy equivalent are indicated. Moreover, two algebras in the above class having the same K-theory but not homotopy equivalent are constructed. A theorem on the homotopy of approximately unitarily equivalent homomorphisms between AI-algebras is used in the proof, which is deduced in its turn from a generalization to the case of AI-algebras of a theorem of Manuilov stating that a unitary matrix almost commuting with a self-adjoint matrix h can be joined to 1 by a continuous path consisting of unitary matrices almost commuting with h

  13. Artificial Intelligence: Is the Future Now for A.I.?

    Science.gov (United States)

    Ramaswami, Rama

    2009-01-01

    In education, artificial intelligence (AI) has not made much headway. In the one area where it would seem poised to lend the most benefit--assessment--the reliance on standardized tests, intensified by the demands of the No Child Left Behind Act of 2001, which holds schools accountable for whether students pass statewide exams, precludes its use.…

  14. Predicting Vessel Trajectories from Ais Data Using R

    Science.gov (United States)

    2017-06-01

    Source: Hampton (2009). A vessel operator with AIS is able to get useful information about the other vessels in the area by selecting a vessel icon ...random forest model on our computer. All calculations are done on a MacBook-Pro with 2.7GHz quad-core Intel Core i7, and 16GB of memory . H2O allows us

  15. South Korea's aid to North Korea's transformation process: Social market perspective

    OpenAIRE

    Jang, Tae-seok

    2007-01-01

    South Korea's aid to North Korea is deviated from the international trend in development aid. As a stylized fact, we find that South Korea's policy keeping economic relationship with North Korea was inconsistent and ineffective during the last decade. Since South Korea played a major role in promoting economic transformation process in North Korea, perspectives from social market economy, open economy, stabilization, and investment in infrastructure provide insights in dealing with developmen...

  16. EPA Collaboration with South Korea

    Science.gov (United States)

    EPA, the Ministry of Environment of Korea, and partner agencies in both countries cooperate to strengthen environmental governance, improve air and water quality, and reduce exposure to toxic chemicals.

  17. South Korea - oil refining overview

    International Nuclear Information System (INIS)

    Hayes, D.

    1999-01-01

    Following the economic problems of the 1990s, the petroleum refining industry of South Korea underwent much involuntary restructuring in 1999 with respect to takeovers and mergers and these are discussed. The demand for petroleum has now pretty well recovered. The reasons for fluctuating prices in the 1990s, how the new structure should be cushioned against changes in the future, and the potential for South Korea to export refined petroleum, are all discussed

  18. 29 November 2013 - U. Humphrey Orjiako Nigerian Ambassador Extraordinary and Plenipotentiary Permanent Mission to the United Nations Office and other international organisations in Geneva signing the Guest Book with Head of International Relations R. Voss, visiting the LHC tunnel at Point 2 and the ALICE cavern with ALICE Collaboration Deputy Spokesperson Y. Schutz.

    CERN Multimedia

    Noemi Caraban

    2013-01-01

    29 November 2013 - U. Humphrey Orjiako Nigerian Ambassador Extraordinary and Plenipotentiary Permanent Mission to the United Nations Office and other international organisations in Geneva signing the Guest Book with Head of International Relations R. Voss, visiting the LHC tunnel at Point 2 and the ALICE cavern with ALICE Collaboration Deputy Spokesperson Y. Schutz.

  19. Korea's developmental program for superconductivity

    Science.gov (United States)

    Hong, Gye-Won; Won, Dong-Yeon; Kuk, Il-Hyun; Park, Jong-Chul

    1995-04-01

    Superconductivity research in Korea was firstly carried out in the late 70's by a research group in Seoul National University (SNU), who fabricated a small scale superconducting magnetic energy storage system under the financial support from Korea Electric Power Company (KEPCO). But a few researchers were involved in superconductivity research until the oxide high Tc superconductor was discovered by Bednorz and Mueller. After the discovery of YBaCuO superconductor operating above the boiling point of liquid nitrogen (77 K)(exp 2), Korean Ministry of Science and Technology (MOST) sponsored a special fund for the high Tc superconductivity research to universities and national research institutes by recognizing its importance. Scientists engaged in this project organized 'High Temperature Superconductivity Research Association (HITSRA)' for effective conducting of research. Its major functions are to coordinate research activities on high Tc superconductivity and organize the workshop for active exchange of information. During last seven years the major superconductivity research has been carried out through the coordination of HITSRA. The major parts of the Korea's superconductivity research program were related to high temperature superconductor and only a few groups were carrying out research on conventional superconductor technology, and Korea Atomic Energy Research Institute (KAERI) and Korea Electrotechnology Research Institute (KERI) have led this research. In this talk, the current status and future plans of superconductivity research in Korea will be reviewed based on the results presented in interim meeting of HITSRA, April 1-2, 1994. Taejeon, as well as the research activity of KAERI.

  20. Nuclear energy in Korea

    International Nuclear Information System (INIS)

    Ahn, J.-H.

    2000-01-01

    The total electricity generated in 1998 was 215,300 GWh with 43,261 MWe of total installed capacity of electric power, while in 1978 when the first Nuclear Power Plant began operation it was 31,510 GWh with 6,916 MWe installed capacity. The share of nuclear power generation in 1998 increased up to 41.7%. Currently, 16 units of nuclear power are operating with an additional four units under construction. Nuclear power has contributed to enhancing energy security and supplying stable energy for Korea. The government's strong commitment to the nuclear power program together with a long-term national policy resulted in favorable conditions for KEPCO to manage the program and promote increasing levels of national participation in successive nuclear power projects. The role of nuclear power as a sustainable energy resource can not be emphasized enough with respect to global environmental issues. Increasing the share of nuclear power in the total installed capacity for electricity generation will undoubtedly play a very important role. (author)

  1. PA strategies in Korea

    International Nuclear Information System (INIS)

    Chung, J.K.

    1998-01-01

    The main purpose of promoting nuclear public acceptance in Korea is to secure necessary sites for construction of large nuclear facilities in a timely manner. Another important purpose is to maintain a good neighbor relationship between the operator of nuclear facilities and local population. To promote better understanding about the nation's peaceful nuclear programs to the general public is another facet of nuclear information activities. However, opposition by the local population living around the nuclear facilities has always been aggressive. The primary concern of the local population is basically focused on the financial issues. Professional nationwide anti-nuclear groups are abetting the local population directly but with fabricated information in order to increase psychological fears. In an effort to compensate for the psychological and sociological burdens of the local population, the Korean government arranged legal provisions. To this end, beginning in 1990, community support programs have been implemented. As the nation's nuclear power program expanded, anti-nuclear activities also became very active. Public information programs should be expanded. Some highlights of public acceptance programs of the nuclear industries are 'Go and Meet' rather than 'Come and See', 'Act rather than react', 'Proper messages to proper target groups', 'Maximum use of the third party communicators', and so on. An orchestrated effort among the nation's nuclear industries is essential to the successful implementation of the PA strategies. (author)

  2. Artemisiae Argyi Folium and its geo-authentic crude drug qi ai

    Directory of Open Access Journals (Sweden)

    Diangang Liu

    2017-01-01

    Conclusion: The superior quality of qi ai compared with general AAF may be due to relatively higher contents of bioactive components. This study provides basic information for further study and utilization of AAF and qi ai.

  3. Future role of AI/Robotics in physical security

    International Nuclear Information System (INIS)

    Jacobs, J.

    1986-01-01

    Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (l) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper discusses the various types of security applications that are presently being considered for the above areas and briefly describes a few examples of the application of this technology

  4. AI mass spectrometers for space shuttle health monitoring

    Science.gov (United States)

    Adams, F. W.

    1991-01-01

    The facility Hazardous Gas Detection System (HGDS) at Kennedy Space Center (KSC) is a mass spectrometer based gas analyzer. Two instruments make up the HGDS, which is installed in a prime/backup arrangement, with the option of using both analyzers on the same sample line, or on two different lines simultaneously. It is used for monitoring the Shuttle during fuel loading, countdown, and drainback, if necessary. The use of complex instruments, operated over many shifts, has caused problems in tracking the status of the ground support equipment (GSE) and the vehicle. A requirement for overall system reliability has been a major force in the development of Shuttle GSE, and is the ultimate driver in the choice to pursue artificial intelligence (AI) techniques for Shuttle and Advanced Launch System (ALS) mass spectrometer systems. Shuttle applications of AI are detailed.

  5. Oil spills and AI: How to manage resources through simulation

    International Nuclear Information System (INIS)

    Giribone, P.; Bruzzone, A.G.; Caddeo, S.

    1995-01-01

    Today, in the Mediterranean theater of the Upper Tyrrhenian, the ecological risk involving oil installations is still quite high. This is due to the fact that valuable environmental and tourist areas exist together with large industrial and port structures; in particular, recent events have demonstrated the danger involving oil spills along the Ligurian coastline. This study proposes an approach to plan the operations that should be performed when accidents occur, based on the use of AI techniques

  6. Companion Cognitive Systems: A Step toward Human-Level AI

    OpenAIRE

    Forbus, Kenneth D.; Hinrichs, Thomas R.

    2006-01-01

    We are developing Companion Cognitive Systems, a new kind of software that can be effectively treated as a collaborator. Aside from their potential utility, we believe this effort is important because it focuses on three key problems that must be solved to achieve human-level AI: Robust reasoning and learning, interactivity, and longevity. We describe the ideas we are using to develop the first architecture for Companions: analogical processing, grounded in cognitive science for reasoning and...

  7. Conversational AI: The Science Behind the Alexa Prize

    OpenAIRE

    Ram, Ashwin; Prasad, Rohit; Khatri, Chandra; Venkatesh, Anu; Gabriel, Raefer; Liu, Qing; Nunn, Jeff; Hedayatnia, Behnam; Cheng, Ming; Nagar, Ashish; King, Eric; Bland, Kate; Wartick, Amanda; Pan, Yi; Song, Han

    2018-01-01

    Conversational agents are exploding in popularity. However, much work remains in the area of social conversation as well as free-form conversation over a broad range of domains and topics. To advance the state of the art in conversational AI, Amazon launched the Alexa Prize, a 2.5-million-dollar university competition where sixteen selected university teams were challenged to build conversational agents, known as socialbots, to converse coherently and engagingly with humans on popular topics ...

  8. General Video Game AI: Learning from Screen Capture

    OpenAIRE

    Kunanusont, Kamolwan; Lucas, Simon M.; Perez-Liebana, Diego

    2017-01-01

    General Video Game Artificial Intelligence is a general game playing framework for Artificial General Intelligence research in the video-games domain. In this paper, we propose for the first time a screen capture learning agent for General Video Game AI framework. A Deep Q-Network algorithm was applied and improved to develop an agent capable of learning to play different games in the framework. After testing this algorithm using various games of different categories and difficulty levels, th...

  9. Artificial intelligence (AI) systems for interpreting complex medical datasets.

    Science.gov (United States)

    Altman, R B

    2017-05-01

    Advances in machine intelligence have created powerful capabilities in algorithms that find hidden patterns in data, classify objects based on their measured characteristics, and associate similar patients/diseases/drugs based on common features. However, artificial intelligence (AI) applications in medical data have several technical challenges: complex and heterogeneous datasets, noisy medical datasets, and explaining their output to users. There are also social challenges related to intellectual property, data provenance, regulatory issues, economics, and liability. © 2017 ASCPT.

  10. Annealing Induced Softening in Deformed AI-4043 Alloy

    International Nuclear Information System (INIS)

    Saad, G.; Fawzy, A.; Soliman, H.N.; Mohammed, Gh.; Fayek, S.A.

    2011-01-01

    The present paper is devoted to study the effect of annealing temperature for different annealing periods of time on the structure and consequently on the tensile properties of Al-4043 alloy. The obtained results showed that the microstructure of AI-4043 alloy is characterized by the presence of spherically shaped Si-particles, which were found to be uniformly distributed within the AI-matrix. Stress-strain characterizations of AI-4043 samples annealed at different temperatures (T a = 573, 673 and 773 K) for different periods of time (t a = 0.5, 1,2.5,5 and 10 h), showed that the tensile parameters; yield stress ε y 0.2 and fracture stress ε f were decreased with increasing Ta and/or ta while the total strain ε T was increased. This was interpreted in terms of growth of Si-particles with increasing T a and/or t a . Attention has been also paid to the role of the minor elements Fe, Cu and Ti on the structure and tensile response behavior of the alloy under investigation

  11. The deep learning AI playbook strategy for disruptive artificial intelligence

    CERN Document Server

    Perez, Carlos E

    2017-01-01

    Deep Learning Artificial Intelligence involves the interplay of Computer Science, Physics, Biology, Linguistics and Psychology. In addition to that, it is technology that can be extremely disruptive. The ramifications to society and even our own humanity will be profound. There are few subjects that are as captivating and as consequential as this. Surprisingly, there is very little that is written about this new technology in a more comprehensive and cohesive way. This book is an opinionated take on the developments of Deep Learning AI. One question many have will be "how to apply Deep Learning AI in a business context?" Technology that is disruptive does not automatically imply that its application to valuable use cases will be apparent. For years, many people could not figure out how to monetize the World Wide Web. We are in a similar situation with Deep Learning AI. The developments may be mind-boggling but its monetization is far from being obvious. This book presents a framework to address this shortcomi...

  12. Artificial Intelligence (AI) Based Tactical Guidance for Fighter Aircraft

    Science.gov (United States)

    McManus, John W.; Goodrich, Kenneth H.

    1990-01-01

    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within Visual Range (WVR) air combat engagements is discussed. The application of AI programming and problem solving methods in the development and implementation of the Computerized Logic For Air-to-Air Warfare Simulations (CLAWS), a second generation TDG, is presented. The Knowledge-Based Systems used by CLAWS to aid in the tactical decision-making process are outlined in detail, and the results of tests to evaluate the performance of CLAWS versus a baseline TDG developed in FORTRAN to run in real-time in the Langley Differential Maneuvering Simulator (DMS), are presented. To date, these test results have shown significant performance gains with respect to the TDG baseline in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify and maintain than the baseline FORTRAN TDG programs. Alternate computing environments and programming approaches, including the use of parallel algorithms and heterogeneous computer networks are discussed, and the design and performance of a prototype concurrent TDG system are presented.

  13. Accretion in Radiative Equipartition (AiRE) Disks

    Energy Technology Data Exchange (ETDEWEB)

    Yazdi, Yasaman K.; Afshordi, Niayesh, E-mail: yyazdi@pitp.ca, E-mail: nafshordi@pitp.ca [Perimeter Institute for Theoretical Physics, 31 Caroline Street N, Waterloo, ON N2L 2Y5 (Canada)

    2017-07-01

    Standard accretion disk theory predicts that the total pressure in disks at typical (sub-)Eddington accretion rates becomes radiation pressure dominated. However, radiation pressure dominated disks are thermally unstable. Since these disks are observed in approximate steady state over the instability timescale, our accretion models in the radiation-pressure-dominated regime (i.e., inner disk) need to be modified. Here, we present a modification to the Shakura and Sunyaev model, where the radiation pressure is in equipartition with the gas pressure in the inner region. We call these flows accretion in radiative equipartition (AiRE) disks. We introduce the basic features of AiRE disks and show how they modify disk properties such as the Toomre parameter and the central temperature. We then show that the accretion rate of AiRE disks is limited from above and below, by Toomre and nodal sonic point instabilities, respectively. The former leads to a strict upper limit on the mass of supermassive black holes as a function of cosmic time (and spin), while the latter could explain the transition between hard and soft states of X-ray binaries.

  14. AIS Algorithm for Smart Antenna Application in WLAN

    Directory of Open Access Journals (Sweden)

    Evizal Abdul Kadir

    2015-07-01

    Full Text Available Increasing numbers of wireless local area networks (WLAN replacing wired networks have an impact on wireless network systems, causing issues such as interference. The smart antenna system is a method to overcome interference issues in WLANs. This paper proposes an artificial immune system (AIS for a switch beam smart antenna system. A directional antenna is introduced to aim the beam at the desired user. The antenna consists of 8 directional antennas, each of which covers 45 degrees, thus creating an omnidirectional configuration of which the beams cover 360 degrees. To control the beam switching, an inexpensive PIC 16F877 microchip was used. An AIS algorithm was implemented in the microcontroller, which uses the received radio signal strength of the mobile device as reference. This is compared for each of the eight beams, after which the AIS algorithm selects the strongest signal received by the system and the microcontroller will then lock to the desired beam. In the experiment a frequency of 2.4 GHz (ISM band was used for transmitting and receiving. A test of the system was conducted in an outdoor environment. The results show that the switch beam smart antenna worked fine based on locating the mobile device.

  15. Functional subdivisions in low-frequency primary auditory cortex (AI).

    Science.gov (United States)

    Wallace, M N; Palmer, A R

    2009-04-01

    We wished to test the hypothesis that there are modules in low-frequency AI that can be identified by their responsiveness to communication calls or particular regions of space. Units were recorded in anaesthetised guinea pig AI and stimulated with conspecific vocalizations and a virtual motion stimulus (binaural beats) presented via a closed sound system. Recording tracks were mainly oriented orthogonally to the cortical surface. Some of these contained units that were all time-locked to the structure of the chutter call (14/22 tracks) and/or the purr call (12/22 tracks) and/or that had a preference for stimuli from a particular region of space (8/20 tracks with four contralateral, two ipsilateral and two midline), or where there was a strong asymmetry in the response to beats of different direction (two tracks). We conclude that about half of low-frequency AI is organized into modules that are consistent with separate "what" and "where" pathways.

  16. Nuclear program of South Korea

    International Nuclear Information System (INIS)

    Brown, D.S.; James, K.R.

    1993-01-01

    Slightly larger than Portugal, South Korea comprises the lower half on the Korean Peninsula, covering approximately 38 thousand square miles. the Republic of Korea (South Korea) was established in 1948, and until 1962 the country grew slowly. However, through a series of five-year economic plans initiated by South Korean President Park Ching Hee, South Korea has since created an export-oriented economy, which now plays a major role in regional as well as global trade. South Korea has been forced to constantly upgrade its power generation structure in order to sustain the explosive growth it has experienced. Nuclear power has been a major player in this expansion and is expected to play an ever-increasing role. The country presently operates nine nuclear reactors with a total net generating capacity of 7,266 MWe. By the year 2006, the nuclear program is scheduled to grow to 27 reactors, with a net generating capacity exceeding 23 thousand MWe. Once this goal is reached, nuclear-generated power would account for more than 40 percent of the country's total installed electrical capacity

  17. Next Generation Reactors in Korea

    International Nuclear Information System (INIS)

    Oh, Yongshick; Choi, Youngsang; Park, Keecheol

    1990-01-01

    In Korea, nuclear power will be continuously needed to meet the trend of steady increase in electricity demand. But in relation to the further development of nuclear energy, there are still many uncertainties to be solved such as power demand forecast, site availability, thermal energy utilization and technology enhancement for economic and safety. To cope with those uncertainties effectively and to proceed the nuclear projects uninterruptedly, KEPCO decided to initiate two research project. i. e., one is 'the outlook and developmental strategy of nuclear energy for the early 21st century in the R. O. K' and the other is 'the feasibility study on the advanced reactors in Korea. Prospects of nuclear energy in Korea was overviewed and recommendations from the industry were introduced. It is strong opinion of Korea nuclear industry that nuclear policy should be changed from the support policy to the target management policy. In the point of reactor strategy, the life of light water reactor technology might be longer than expected before in Korea and it is emphasized that good maintenance of light water reactor technology and smooth transition program to the advanced technologies should be carefully considered. There are differences in the opinions between preferences to the evolutionary and/or passive, inherently safe reactors but, in the long-term point of view, it is judged to be desirable to have alternatives

  18. Two chemists in two Koreas.

    Science.gov (United States)

    Kim, Dong-Won

    2005-03-01

    Taikyu Ree (1902-92) and Seung Ki Li (1905-96) were the most famous and influential scientists in twentieth-century Korea. Trained at Kyoto Imperial University during the Japanese occupation period (1910-45), both followed parallel career paths until 1945 but after that year those paths began to diverge. In 1948 Taikyu Ree moved to the University of Utah where he ran an informal graduate programme to train Korea chemists during the 1950s and 1960s. He became a model scholar in pursuit of knowledge for its own sake. In 1950 Seung Ki Li moved to North Korea where he succeeded in industrialising a new synthetic fibre from polyvinyl alcohol. He became a popular hero who demonstrated the utility of science. His success also helped Kim Il Sung, North Korea dictator, to consolidate his political ideology of Self-Reliance. Despite their different career patterns in very different circumstances, they shared something common; apolitical views and commitment to their work. An investigation of the careers of these two chemists illustrates the interwoven scientific, ideological and economic developments of South and North Korea during the second half of the twentieth century.

  19. 76 FR 44045 - Establishment of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2011-07-22

    ... SANE/SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of... Nurse Examiner (SANE) Sexual Assault Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative Committee'' or ``Committee'') is being established in accordance...

  20. 78 FR 17232 - Meeting of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2013-03-20

    .../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting. SUMMARY: The National Coordination Committee on the American Indian/ Alaska Native (AI/AN) Sexual Assault... violence within AI/AN communities. DATES AND LOCATIONS: The meeting will be held via webinar on Wednesday...

  1. 10 CFR 1017.28 - Processing on Automated Information Systems (AIS).

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Processing on Automated Information Systems (AIS). 1017.28... UNCLASSIFIED CONTROLLED NUCLEAR INFORMATION Physical Protection Requirements § 1017.28 Processing on Automated Information Systems (AIS). UCNI may be processed or produced on any AIS that complies with the guidance in OMB...

  2. South Korea as an emerging donor

    DEFF Research Database (Denmark)

    Chun, Hong-Min; Munyi, Elijah Nyaga; Lee, Heejin

    2010-01-01

    South Korea's official development assistance (ODA) has been increasing rapidly and will continue to do so. Korea is one of the few countries which have successfully transitioned from a recipient to a donor. It became a member of DAC (development assistance committee), OECD in November 2009. Korea......'s ODA policy, along with its growth in quantity, is at a crossroads for the enhancement of its quality. Discussions and debates are going on regarding the reforms in Korea's ODA activities, and this paper examines key issues raised. It first reviews the past and present of Korea's ODA, and identifies...... like the objective of ODA, positioning of Korea's ODA as an emerging donor and the nature of aid to North Korea. We also argue that a shift of ODA policy is required to promote reform, based on a thorough reflection on the role of ODA in the alleviation of poverty and promoting sustainable development...

  3. North Korea's Nuclear Weapons: Latest Developments

    National Research Council Canada - National Science Library

    Nikitin, Mary B

    2007-01-01

    .... The Six-Party Talks include the United States, South Korea, Japan, China, Russia, and North Korea, and were begun in August 2003 to attempt to resolve the current crisis over North Korean nuclear weapons...

  4. Korea keele õpetamisest / Angelina Tšaikovskaja

    Index Scriptorium Estoniae

    Tšaikovskaja, Angelina

    1999-01-01

    Tallinna Pedagoogikaülikooli külastas 7. dets. 1999 Korea Vabariigi suursaadik Helsingis Dong-chil Yang, kes tundis huvi idamaade keelte õpetamise vastu TPÜ-s ja lubas toetada korea keele õpetamist ülikoolis

  5. Meanwhile, North Korea

    International Nuclear Information System (INIS)

    Hautecouverture, Benjamin

    2014-08-01

    The progress regarding weapons of mass destruction (WMD) programmes in North Korea and the instability on the Korean Peninsula have taken a back seat in the international community's analysis and perhaps its concerns for more than a year. The last event to provoke a wave of protest and tangible renewed interest occurred on 12 February 2013 when Pyongyang carried out its third nuclear test with an estimated yield of 6 to 8 kilo-tonnes. The United Nations Security Council condemned the test on 7 March (Resolution 2094). With the exception of several recent Security Council declarations, it is clear that activity on the part of the international community has been sparse. The same can be said with regard to the European Union and the United States. This state of affairs is not surprising. The analysis takes note of it by ceasing, there or thereabouts, to produce new material. Firstly, the North Korean crisis is a long-term one and the diplomatic process that is meant to lead to its resolution has been interrupted; the Six-Party Talks have been at a standstill since the end of 2008. A agreement between the United States and North Korea, concluded on 29 February 2012 under which the North Korean regime accepted the principle of a moratorium on long-range missile tests, nuclear tests, and all activity at the Yongbyon nuclear complex lastly barely a few days. Many actors involved in the management of this crisis are suffering from a weariness whose acknowledgement is politically incorrect: with regard to Pyongyang's launch of missiles and rockets last spring, the U.S. admiral Samuel Locklear told the Associated Press in July 'you become somewhat numb, you start to say, well, it's not so much of a big deal'. Moreover, since 2013, the focus of international security with regard to WMD and beyond has also largely shifted from North-East Asia to the Middle East and Eastern Europe. Pell-mell, the worsening and broadening of the war in Syria, the terrorist surge in Iraq, the

  6. Distribution of lichen flora on South Korea.

    Science.gov (United States)

    Hur, Jae-Seoun; Harada, Hiroshi; Oh, Soon-Ok; Lim, Kwang-Mi; Kang, Eui-Sung; Lee, Seung Mi; Kahng, Hyung-Yeel; Kim, Hyun-Woo; Jung, Jae-Sung; Koh, Young Jin

    2004-06-01

    After an overview on the temporary situation of the lichenology in South Korea, localities of 95 macrolichen taxa are reported for South Korea. In this revised lichen flora of South Korea, 16 species are apparently new to the territory. Voucher specimens have been deposited in the Korean Lichen Research Institute (KoLRI) at Sunchon National University in Korea, and duplicates have also been donated to the National History Museum and Institute, in Chiba, (CBM) Japan.

  7. Fusion research program in Korea

    International Nuclear Information System (INIS)

    Hwang, Y.S.

    1996-01-01

    Fusion research in Korea is still premature, but it is a fast growing program. Groups in several universities and research institutes were working either in small experiments or in theoretical areas. Recently, couple of institutes who have small fusion-related experiments, proposed medium-size tokamak programs to jump into fusion research at the level of international recognition. Last year, Korean government finally approved to construct 'Superconducting Tokamak' as a national fusion program, and industries such as Korea Electric Power Corp. (KEPCO) and Samsung joined to support this program. Korea Basic Science Institute (KBSI) has organized national project teams including universities, research institutes and companies. National project teams are performing design works since this March. (author)

  8. Geothermal resource assessment in Korea

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Youngmin; Kim, Hyoung Chan [Korea Institute of Geoscience and Mineral Resources (Korea); Park, Sungho; Kim, Jongchan; Koo, Min-Ho [Kongju National University (Korea)

    2010-10-15

    To estimate available geothermal energy and to construct temperature at depth maps in Korea, various geothermal data have been used. Those include 1560 thermal property data such as thermal conductivity, specific heat and density, 353 heat flow data, 54 surface temperature data, and 180 heat production data. In Korea, subsurface temperature ranges from 23.9 C to 47.9 C at a depth of 1 km, from 34.2 C to 79.7 C at 2 km, from 44.2 C to 110.9 C at 3 km, from 53.8 C to 141.5 C at 4 km, and from 63.1 C to 171.6 C at 5 km. The total available subsurface geothermal energy in Korea is 4.25 x 10{sup 21} J from surface to a depth of 1 km, 1.67 x 10{sup 22} J to 2 km, 3.72 x 10{sup 22} J to 3 km, 6.52 x 10{sup 22} J to 4 km, and 1.01 x 10{sup 23} J to 5 km. In particular, the southeastern part of Korea shows high temperatures at depths and so does high geothermal energy. If only 2% of geothermal resource from surface to a depth of 5 km is developed in Korea, energy from geothermal resources would be equivalent to about 200 times annual consumption of primary energy ({proportional_to}2.33 x 10{sup 8} TOE) in Korea in 2006. (author)

  9. Impact Analysis of Economic Linkages of South Korea with North Korea Using a CGE Model

    OpenAIRE

    Kim, Euijune; Shin, Hyewon

    2014-01-01

    The purpose of this paper is to estimate impacts of core infrastructure investments in North Korea on South and North Koreas. The investment expenditures of core infrastructure projects in North Korea are calibrated as 9.35 billion US$ including highway, railroad and industrial complex. Since South and North Koreas are based on market and planned economies respectively, the Computable General Equilibrium model is applied to the economic analysis of South Korea and an Input-Output Model for th...

  10. Radioactive waste management in Korea

    International Nuclear Information System (INIS)

    Lee, Ik Hwan

    1997-01-01

    In order to meet the increasing energy demand in Korea, continuous promotion of nuclear power program will be inevitable in the future. However, the use of nuclear energy eventually requires effective and reliable radioactive waste management. For the safe and economical management of radioactive waste, first of all, volume reduction is essentially required and hence the development of related technologies continuously be pursued. A site for overall radioactive waste management has to be secured in Korea. KEPCO-NETEC will improve public understanding by reinforcing PA and will maintain transparency of radioactive waste management. (author). 1 fig

  11. Development of Korea telecommunication technology

    International Nuclear Information System (INIS)

    1992-06-01

    It concentrates on development of Korea telecommunication technology, which is made up seven chapters. It gives description of manual central telephone exchange or private automatic telephone exchange, transmission technology on wire line and cable line technology and optical transmission, radio communication technology on mobile and natural satellite communication, network technology with intelligent network, broadband ISDN and packet switched Data Network, terminal technology with telephone and data communication terminal and development of Information Technology in Korea. It has an appendix about development of military communication system.

  12. New Media Practices in Korea

    OpenAIRE

    Ok, Hyeryoung

    2011-01-01

    This article looks at new media practices in Korea, such as the Internet, mobile phones, gaming, and new media production. In spite of Korea's reputation for achieving the most advanced IT and digital media culture, Korean youths' concrete practices of navigating this new techno-sphere are not well known to the rest of the world. To fill this gap in knowledge, this piece synthesizes findings from academic as well as popular sources in Korean and English on Korean digital youth. Studies of Kor...

  13. Health impact assessment in Korea

    International Nuclear Information System (INIS)

    Kang, Eunjeong; Lee, Youngsoo; Harris, Patrick; Koh, Kwangwook; Kim, Keonyeop

    2011-01-01

    Recently, Health Impact Assessment has gained great attention in Korea. First, the Ministry of Environment introduced HIA within existing Environment Impact Assessment. Second, the Korea Institute for Health and Social Affairs began an HIA program in 2008 in alliance with Healthy Cities. In this short report, these two different efforts are introduced and their opportunities and challenges discussed. We believe these two approaches complement each other and both need to be strengthened. We also believe that both can contribute to the development of health in policy and project development and ultimately to improvements in the Korean population's health.

  14. QML-AiNet: An immune network approach to learning qualitative differential equation models.

    Science.gov (United States)

    Pang, Wei; Coghill, George M

    2015-02-01

    In this paper, we explore the application of Opt-AiNet, an immune network approach for search and optimisation problems, to learning qualitative models in the form of qualitative differential equations. The Opt-AiNet algorithm is adapted to qualitative model learning problems, resulting in the proposed system QML-AiNet. The potential of QML-AiNet to address the scalability and multimodal search space issues of qualitative model learning has been investigated. More importantly, to further improve the efficiency of QML-AiNet, we also modify the mutation operator according to the features of discrete qualitative model space. Experimental results show that the performance of QML-AiNet is comparable to QML-CLONALG, a QML system using the clonal selection algorithm (CLONALG). More importantly, QML-AiNet with the modified mutation operator can significantly improve the scalability of QML and is much more efficient than QML-CLONALG.

  15. Beyond AI: Multi-Intelligence (MI Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

    Directory of Open Access Journals (Sweden)

    Stephen Fox

    2017-06-01

    Full Text Available Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, the extensive post-anthropocentric research into intelligence is not given sufficient consideration. Third, AI is discussed often in reductionist mechanistic terms. Rather than in organicist emergentist terms as a contributor to multi-intelligence (MI hybrid beings and/or systems. Thus, current framing of AI can be a self-validating reduction within which AI development is focused upon AI becoming the single-variable mechanism causing future effects. In this paper, AI is reframed as a contributor to MI.

  16. Tritium research activities in Korea

    Energy Technology Data Exchange (ETDEWEB)

    Jung, Ki Jung, E-mail: kjjung@nfri.re.kr [National Fusion Research Institute, Yusung-gu, Daejeon 305-333 (Korea, Republic of); Yun, Sei-Hun, E-mail: shyun@nfri.re.kr [National Fusion Research Institute, Yusung-gu, Daejeon 305-333 (Korea, Republic of); Chang, Min Ho; Kang, Hyun-Goo; Chung, Dongyou; Cho, Seungyon; Lee, Hyeon Gon [National Fusion Research Institute, Yusung-gu, Daejeon 305-333 (Korea, Republic of); Chung, Hongsuk; Choi, Woo-Seok [Korea Atomic Energy Research Institute, Yusung-gu, Daejeon 305-353 (Korea, Republic of); Song, Kyu-Min; Moon, Chang-Bae [Korea Hydro & Nuclear Power Central Research Institute, Yusung-gu, Daejeon 305-343 (Korea, Republic of); Lee, Euy Soo [Dongguk University, Jung-gu, Seoul, 100-715 (Korea, Republic of); Cho, Jungho; Kim, Dong-Sun [Kongju National University, Cheonan, Chungnam, 330-717 (Korea, Republic of); Moon, Hung-Man [Daesung Industrial Gases Co., Ltd., Danwon-gu, Ansan-si, Gyeonggi-do, 425-090 (Korea, Republic of); Noh, Seung Jeong [Dankook University, Suji-gu, Yongin-si, Gyeonggi-do, 448-701 (Korea, Republic of); Ju, Hyunchul [Inha University, Nam-gu, Incheon, 402-751 (Korea, Republic of); Hong, Tae-Whan [Korea National University of Transportation, Chungju, Chungbuk, 380-702 (Korea, Republic of)

    2016-12-15

    Highlights: • NFRI, KAERI and KHNP CRI are major leading group for the ITER tritium SDS design; studying engineering, simulation of hydride bed, risk analysis (on safety, HAZOP), basic study, control logic & sequential operation, and others. KHNP has WTRF which gives favorable experiences for collaboration researchers. • Supplementary research partners: Five Universities (Dongguk University and POSTECH, Inha University, Dankook University, Korea National Transport University, and Kongju National University) and one industrial company (Daesung Industrial Gases Co., Ltd.); studying on basic and engineering, programming & simulation on the various topics for ITER tritium SDS, TEP, ISS, ADS, and etc. - Abstract: Major progress in tritium research in the Republic of Korea began when Korea became responsible for ITER tritium Storage and Delivery System (SDS) procurement package which is part of the ITER Fuel Cycle. To deliver the tritium SDS package, a variety of research institutes, universities and industry have respectively taken roles and responsibilities in developing technologies that have led to significant progress. This paper presents the current work and status of tritium related technological research and development (R&D) in Korea and introduces future R&D plans in the area of fuel cycle systems for fusion power generation.

  17. Inclusive Education in South Korea

    Science.gov (United States)

    Kim, Yong-Wook

    2014-01-01

    The purpose of this paper is to examine the current implementation of inclusive education in South Korea and discuss its challenges. The history of special education is first described followed by an introduction to policies relevant to special and inclusive education. Next, a critical discussion of the state of inclusive education follows built…

  18. Life in South Korea Today.

    Science.gov (United States)

    Lew, Seok-Choon

    1988-01-01

    Characterizes the past 40 years in South Korea as a time of modernization, industrialization, urbanization, and internationalization. Discusses Korean religion and social values; family, kinship, and social life; education; housing, food, and clothing; leisure and sports; and the maintenance of national identity. Examines the Korean synthesis of…

  19. STAR - A computer language for hybrid AI applications

    Science.gov (United States)

    Borchardt, G. C.

    1986-01-01

    Constructing Artificial Intelligence application systems which rely on both symbolic and non-symbolic processing places heavy demands on the communication of data between dissimilar languages. This paper describes STAR (Simple Tool for Automated Reasoning), a computer language for the development of AI application systems which supports the transfer of data structures between a symbolic level and a non-symbolic level defined in languages such as FORTRAN, C and PASCAL. The organization of STAR is presented, followed by the description of an application involving STAR in the interpretation of airborne imaging spectrometer data.

  20. Pavlovian, Skinner, and Other Behaviourists' Contributions to AI. Chapter 9

    Science.gov (United States)

    Kosinski, Withold; Zaczek-Chrzanowska, Dominika

    2007-01-01

    A version of the definition of intelligent behaviour will be supplied in the context of real and artificial systems. Short presentation of principles of learning, starting with Pavlovian s classical conditioning through reinforced response and operant conditioning of Thorndike and Skinner and finishing with cognitive learning of Tolman and Bandura will be given. The most important figures within behaviourism, especially those with contribution to AI, will be described. Some tools of artificial intelligence that act according to those principles will be presented. An attempt will be made to show when some simple rules for behaviour modifications can lead to a complex intelligent behaviour.

  1. Alarm processing system using AI techniques for nuclear power plant

    International Nuclear Information System (INIS)

    Yang, Joon On; Chang, Soon Heung

    1990-01-01

    An alarm processing system (APS) has been developed using artificial intelligence (AI) techniques. The alarms of nuclear power plants (NPP's) are classified into the generalized and special alarms. The generalized alarms are also classified into the global and local alarms. For each type of alarms, the specific processing rules are applied to filter and suppress unnecessary and potentially misleading alarms. The local processing are based on 'model-based reasoning.' The global and special alarms are processed by using the general cause-consequence check rules. The priorities of alarms are determined according to the plant state and the consistencies between them

  2. Deep Learning Neural Networks in Cybersecurity - Managing Malware with AI

    OpenAIRE

    Rayle, Keith

    2017-01-01

    There’s a lot of talk about the benefits of deep learning (neural networks) and how it’s the new electricity that will power us into the future. Medical diagnosis, computer vision and speech recognition are all examples of use-cases where neural networks are being applied in our everyday business environment. This begs the question…what are the uses of neural-network applications for cyber security? How does the AI process work when applying neural networks to detect malicious software bombar...

  3. How AI turned the chess world upside down

    KAUST Repository

    Polgar, Susan

    2018-01-22

    Man vs. Machine! In 1977 an IBM supercomputer \\'Deep Blue\\' beat the reigning World Chess Champion Gary Kasparov in a 6 game chess match played under tournament conditions. This was the first time a machine beat a human at chess. It symbolized the emergence of Artificial Intelligence (AI) and the potential for great good (and great harm) from machines that have aspects of human intelligence. During this lecture Susan Polgar, a pioneer for Women in Chess, will share her remarkable story as well as how technology has changed the world of chess.

  4. Korea Earth Observation Satellite Program

    Science.gov (United States)

    Baek, Myung-Jin; Kim, Zeen-Chul

    via Korea Aerospace Research Institute (KARI) as the prime contractor in the area of Korea earth observation satellite program to enhance Korea's space program development capability. In this paper, Korea's on-going and future earth observation satellite programs are introduced: KOMPSAT- 1 (Korea Multi Purpose Satellite-1), KOMPSAT-2 and Communication, Broadcasting and Meteorological Satellite (CBMS) program. KOMPSAT-1 satellite successfully launched in December 1999 with Taurus launch vehicle. Since launch, KOMPSAT-1 is downlinking images of Korea Peninsular every day. Until now, KOMPSAT-1 has been operated more than 2 and half years without any major hardware malfunction for the mission operation. KOMPSAT-1 payload has 6.6m panchromatic spatial resolution at 685 km on-orbit and the spacecraft bus had NASA TOMS-EP (Total Ozone Mapping Spectrometer-Earth Probe) spacecraft bus heritage designed and built by TRW, U.S.A.KOMPSAT-1 program was international co-development program between KARI and TRW funded by Korean Government. be launched in 2004. Main mission objective is to provide geo-information products based on the multi-spectral high resolution sensor called Multi-Spectral Camera (MSC) which will provide 1m panchromatic and 4m multi-spectral high resolution images. ELOP of Israel is the prime contractor of the MSC payload system and KARI is the total system prime contractor including spacecraft bus development and ground segment. KARI also has the contract with Astrium of Europe for the purpose of technical consultation and hardware procurement. Based on the experience throughout KOMPSAT-1 and KOMPSAT-2 space system development, Korea is expecting to establish the infrastructure of developing satellite system. Currently, KOMPSAT-2 program is in the critical design stage. are scheduled to launch in 2008 and in 2014, respectively. The mission of CBMS consists of two areas. One is of space technology test for the communications mission, and the other is of a real

  5. Future role of AI/Robotics in physical security

    International Nuclear Information System (INIS)

    Jacobs, J.

    1986-06-01

    Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (1) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper will discuss the various types of security applications that are presently being considered for the above areas and will briefly describe a few examples of the application of this technology. Examples will include ground mobile platforms carrying alarm assessment and/or surveillance sensors and operating either autonomously or with telepresence by a remote operator. An airborne platform performing similar functions will also be discussed. An application of a type of robot sentry that would be fixed and incorporate very simple portable displays will also be described. A third type of robot, an interior robot, that could be used in sensitive or hazardous areas to do detection and assessment functions will be reviewed

  6. Sensor assignment to mission in AI-TECD

    Science.gov (United States)

    Ganger, Robert; de Mel, Geeth; Pham, Tien; Rudnicki, Ronald; Schreiber, Yonatan

    2016-05-01

    Sensor-mission assignment involves the allocation of sensors and other information-providing resources to missions in order to cover the information needs of the individual tasks within each mission. The importance of efficient and effective means to find appropriate resources for tasks is exacerbated in the coalition context where the operational environment is dynamic and a multitude of critically important tasks need to achieve their collective goals to meet the objectives of the coalition. The Sensor Assignment to Mission (SAM) framework—a research product of the International Technology Alliance in Network and Information Sciences (NIS-ITA) program—provided the first knowledge intensive resource selection approach for the sensor network domain so that contextual information could be used to effectively select resources for tasks in coalition environments. Recently, CUBRC, Inc. was tasked with operationalizing the SAM framework through the use of the I2WD Common Core Ontologies for the Communications-Electronics Research, Development and Engineering Center (CERDEC) sponsored Actionable Intelligence Technology Enabled Capabilities Demonstration (AI-TECD). The demonstration event took place at Fort Dix, New Jersey during July 2015, and this paper discusses the integration and the successful demonstration of the SAM framework within the AI-TECD, lessons learned, and its potential impact in future operations.

  7. Republic of Korea

    International Nuclear Information System (INIS)

    Lee, Tae-Young

    2003-01-01

    The Korea Atomic Energy Research Institute (KAERI) has a state-of-the-art In Vivo Radioassay and Research Facility (IVRRF) facility designed expressly for in vivo measurement of radioactive material. Although the IVRRF's primary activity is providing routine in vivo counting services to KAERI radiation workers, the facility also conducts work for clients including a fuel fabrication facilities and nuclear facilities. Counting System KAERI in vivo counter combines the characteristics of the U/Pu lung counter and the advantage of a high sensitivity scanning NaI(Tl) whole body counter into one compact system. The low energy lung counter is designed for facilities that need to accurately measure lung depositions of actinides such as uranium, plutonium and americium. The scanning whole body counter is designed to detect and identify the location of higher energy nuclides anywhere in the body. The detection system of the low energy lung counter consists of two arrays of ACT (Actinide)-II detector system which combines two ACT I LEGe (Low Energy Germanium) detectors and end caps onto a single 7 liter multi-attitude cryostat. These have been designed specially for the detection of internally deposited actinides, particularly uranium, plutonium and americium. Figure shows the detectors in place over the JAERI Phantom. For comparison, Figure 2 shows the same detector placed over the Livermore Realistic Torso Phantom. Each LEGe detector equipped with a 0.5 mm. Be window has active area of 20 cm 2 and thickness of 20 mm. The resolution of four LEGe detectors averages 400 eV FWHM at 5.9 keV and 700 eV FWHM at 122 keV. One cm Pb and 0.5 mm Cu are attached around sides of ACT-II detectors to reduce the contribution from 40 K and scattered background from the subject and surrounding materials. The detector-subject positioning mechanism allows the optimum placement of detectors on the chest of the subject. The whole body counter utilizes a large 7.6 cm x 12.7 cm x 40.6 cm scanning

  8. Applying AI tools to operational space environmental analysis

    Science.gov (United States)

    Krajnak, Mike; Jesse, Lisa; Mucks, John

    1995-01-01

    The U.S. Air Force and National Oceanic Atmospheric Agency (NOAA) space environmental operations centers are facing increasingly complex challenges meeting the needs of their growing user community. These centers provide current space environmental information and short term forecasts of geomagnetic activity. Recent advances in modeling and data access have provided sophisticated tools for making accurate and timely forecasts, but have introduced new problems associated with handling and analyzing large quantities of complex data. AI (Artificial Intelligence) techniques have been considered as potential solutions to some of these problems. Fielding AI systems has proven more difficult than expected, in part because of operational constraints. Using systems which have been demonstrated successfully in the operational environment will provide a basis for a useful data fusion and analysis capability. Our approach uses a general purpose AI system already in operational use within the military intelligence community, called the Temporal Analysis System (TAS). TAS is an operational suite of tools supporting data processing, data visualization, historical analysis, situation assessment and predictive analysis. TAS includes expert system tools to analyze incoming events for indications of particular situations and predicts future activity. The expert system operates on a knowledge base of temporal patterns encoded using a knowledge representation called Temporal Transition Models (TTM's) and an event database maintained by the other TAS tools. The system also includes a robust knowledge acquisition and maintenance tool for creating TTM's using a graphical specification language. The ability to manipulate TTM's in a graphical format gives non-computer specialists an intuitive way of accessing and editing the knowledge base. To support space environmental analyses, we used TAS's ability to define domain specific event analysis abstractions. The prototype system defines

  9. The Growing Relationship Between South Korea and China: Consequences for North Korea

    National Research Council Canada - National Science Library

    Renner, Laura

    2006-01-01

    ... maintains friendly relations with both Koreas, currently the only country to do so. Nearly fifteen years after this normalization, South Korea and China still enjoy a strong relationship that generally continues to improve...

  10. Computing Facilities for AI: A Survey of Present and Near-Future Options

    OpenAIRE

    Fahlman, Scott

    1981-01-01

    At the recent AAAI conference at Stanford, it became apparent that many new AI research centers are being established around the country in industrial and governmental settings and in universities that have not paid much attention to AI in the past. At the same time, many of the established AI centers are in the process of converting from older facilities, primarily based on Decsystem-10 and Decsystem-20 machines, to a variety of newer options. At present, unfortunately, there is no simple an...

  11. A Review of Future and Ethical Perspectives of Robotics and AI

    OpenAIRE

    Jim Torresen

    2018-01-01

    In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to ...

  12. Nuclear safety endeavour in Korea

    International Nuclear Information System (INIS)

    Sang-hoon lee

    1987-01-01

    Korea's nuclear power plant program is growing. As it grows, nuclear safety becomes an important issue. This article traces the development of Korean nuclear power program, the structure of the nuclear industries, the Nuclear Safety Center and its roles in the regulation and licensing of nuclear power plant, and also identifies some of the activities carried out to enhance the safety of nuclear power plants. (author)

  13. Alternative Modernities for Colonial Korea

    Directory of Open Access Journals (Sweden)

    Steven Lee

    2016-06-01

    Full Text Available Sunyoung Park. The Proletarian Wave: Literature and Leftist Culture in Colonial Korea, 1910–1945. Cambridge, MA: Harvard University Asia Center, 2015. 348 pp. $50 (cloth. Vladimir Tikhonov. Modern Korea and Its Others: Perceptions of the Neighbouring Countries and Korean Modernity. London: Routledge, 2016. 218 pp. $160 (cloth. It has become a global scholarly undertaking: how to rethink modernity so as to decouple it from Westernization (Chakrabarty 2000. Strategies have included foregrounding the plurality of history to disrupt linear progress; positing non-Western centers of modernity in, say, Moscow or Shanghai; and tracing anticolonial circuits connecting Asia to Africa to Latin America. The two recent books under review here add colonial-era Korea to such far-reaching discussions by situating the country across national boundaries. Interestingly, one connecting thread here is the alternative world system provided by the interwar, Soviet-oriented Left. The result is an unsettling of binaries that subsequently became entrenched during the Cold War: for example, north-south, socialist-nationalist, and, for literature, realist-modernist. But more broadly, pervading both books is the sense that history could have turned out differently—that revisiting northeast Asia’s porous borders in the early twentieth century reveals the Korean peninsula’s lost, internationalist potential...

  14. Vitamin D Status in Korea

    Directory of Open Access Journals (Sweden)

    Han Seok Choi

    2013-03-01

    Full Text Available The majority of the vitamin D in our body is produced by cutaneous synthesis in response to sunlight. As more and more people live in cities and spend the bulk of their time indoors, it can be difficult to get sufficient sun exposure for adequate cutaneous production of vitamin D. Therefore, vitamin D insufficiency has become a very common health problem worldwide. The Korea National Health and Nutrition Examination Survey IV 2008 showed that the prevalence of vitamin D insufficiency, defined as a serum 25-hydroxyvitamin D [25(OHD] level below 50 nmol/L, was 47.3% in males and 64.5% in females. Only 13.2% of males and 6.7% of females had a serum 25(OHD level of greater than 75 nmol/L. In Korea, vitamin D insufficiency was more prevalent in young adults than in elderly people, likely due to the indoor lifestyle of younger people. Compared with the United States and Canada, Korea has a lower mean 25(OHD level and a higher prevalence of vitamin D insufficiency. To improve the vitamin D status of the Korean population, more aggressive policies on food fortification and vitamin D supplementation are needed.

  15. Foreign workers in South Korea

    Directory of Open Access Journals (Sweden)

    Su-Jin Lim

    2010-07-01

    Full Text Available In today’s global age many people cross national borders in search of better work and more wages. According to IOM, more than 100 000 000 workers leave their homeland and migrate to another country for this reason. Europe and North America have already experienced increase in foreign labor for many decades but nowadays, it is very common to see foreign laborers in Asian countries. As the number of foreign laborers rapidly increased, however, so did many social problems in relation to these workers. No country is safe from or immune to such social problems in regards to the foreign workers especially with a much easier and more efficient transportation system. In case of South Korea, the history of foreign labor may not be as long as other nations but as of 2007, it boasts of more than 250 000 foreign laborers and is thus facing just as many social problems as well. In order to investigate such social issues, this article explores the history of foreign laborers and their current situation in South Korea. Furthermore, this artticle examines both internal and external factors which may have caused exponential growth of foreign labor market in South Korea in the past decade.

  16. Off The Beaten Lane: AI Challenges In MOBAs Beyond Player Control

    OpenAIRE

    Cook, Michael; Summerville, Adam; Colton, Simon

    2017-01-01

    MOBAs represent a huge segment of online gaming and are growing as both an eSport and a casual genre. The natural starting point for AI researchers interested in MOBAs is to develop an AI to play the game better than a human - but MOBAs have many more challenges besides adversarial AI. In this paper we introduce the reader to the wider context of MOBA culture, propose a range of challenges faced by the community today, and posit concrete AI projects that can be undertaken to begin solving them.

  17. Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

    OpenAIRE

    Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

    2015-01-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Bas...

  18. Rural and urban suicide in South Korea.

    Science.gov (United States)

    Park, B C Ben; Lester, David

    2012-10-01

    Suicide rates in 2005 in South Korea were higher in rural areas than in urban areas. Those in rural areas more often used pesticides and chemicals as a method for suicide, and there was a greater proportion of men and the elderly, both groups at higher risk for suicide in South Korea. These three factors may account for the high rural suicide rate in South Korea.

  19. Korea's Post-Crisis Monetary Policy Reforms

    OpenAIRE

    Donghyun Park; Junggun Oh

    2005-01-01

    Korea's financial crisis of 1997–1998 was brought about by the unsustainable combination of large capital inflows and an inefficient financial system. The Bank of Korea contributed to the crisis primarily through its failures as the regulator of the financial system rather than as the conductor of monetary policy. Our paper explores the role of the two major monetary policy reforms Korea has implemented in response to the crisis — the establishment of a new financial regulator and the adoptio...

  20. Fully automatic AI-based leak detection system

    Energy Technology Data Exchange (ETDEWEB)

    Tylman, Wojciech; Kolczynski, Jakub [Dept. of Microelectronics and Computer Science, Technical University of Lodz in Poland, ul. Wolczanska 221/223, Lodz (Poland); Anders, George J. [Kinectrics Inc., 800 Kipling Ave., Toronto, Ontario M8Z 6C4 (Canada)

    2010-09-15

    This paper presents a fully automatic system intended to detect leaks of dielectric fluid in underground high-pressure, fluid-filled (HPFF) cables. The system combines a number of artificial intelligence (AI) and data processing techniques to achieve high detection capabilities for various rates of leaks, including leaks as small as 15 l per hour. The system achieves this level of precision mainly thanks to a novel auto-tuning procedure, enabling learning of the Bayesian network - the decision-making component of the system - using simulated leaks of various rates. Significant new developments extending the capabilities of the original leak detection system described in and form the basis of this paper. Tests conducted on the real-life HPFF cable system in New York City are also discussed. (author)

  1. Planning chemical syntheses with deep neural networks and symbolic AI

    Science.gov (United States)

    Segler, Marwin H. S.; Preuss, Mike; Waller, Mark P.

    2018-03-01

    To plan the syntheses of small organic molecules, chemists use retrosynthesis, a problem-solving technique in which target molecules are recursively transformed into increasingly simpler precursors. Computer-aided retrosynthesis would be a valuable tool but at present it is slow and provides results of unsatisfactory quality. Here we use Monte Carlo tree search and symbolic artificial intelligence (AI) to discover retrosynthetic routes. We combined Monte Carlo tree search with an expansion policy network that guides the search, and a filter network to pre-select the most promising retrosynthetic steps. These deep neural networks were trained on essentially all reactions ever published in organic chemistry. Our system solves for almost twice as many molecules, thirty times faster than the traditional computer-aided search method, which is based on extracted rules and hand-designed heuristics. In a double-blind AB test, chemists on average considered our computer-generated routes to be equivalent to reported literature routes.

  2. Le français de la communication professionnelle

    CERN Document Server

    Danilo, Michel; Lincoln, M

    A partir de 150 heures de français. - Pour acquérir une bonne maîtrise des pratiques professionnelles. - Pour améliorer ses connaissances de la langue tout en se familiarisant avec les pratiques langagières spécifiques du monde du travail. - Pour préparer les examens de la Chambre de Commerce et d'Industrie de Paris. Dix dossiers : - La communication dans les affaires - Le travail administratif - Le téléphone - La communication interne - Le courrier de l'entreprise - L'offre et la commande - Livraison, transport, assurance - La facturation et le règlement - La communication avec les partenaires - Les nouveaux outils de communication Une cassette audio ainsi que des corrigés accompagnent ce livre.

  3. Age and helium content of the eclipsing binary AI Phoenicis

    International Nuclear Information System (INIS)

    VandenBerg, D.A.; Hrivnak, B.J.

    1985-01-01

    Comparisons of new theoretical isochrones for heavy-element abundances Z = 0.0169 (solar) and Z = 0.04 with recently published parameters of AI Phoenicis suggest that this system has an age of approximately (3.6 +- 0.7) x 10 9 yr and a helium content of Y = 0.38 +- 0.05. The indicated uncertainty is largely due to the lack of precise knowledge about the metallicity of the binary, since the fits to the data by both sets of isochrones are exceedingly good. The high helium content, which is required in order to reproduce the observed mass-luminosity relation, is suggested to be comparable with the values generally derived for binaries if the latter are adjusted to take into account the effect of the new Los Alamos opacities

  4. Conjugaison progressive du français avec 400 exercices

    CERN Document Server

    Boularès, Michèle

    1999-01-01

    La Conjugaison progressive du français s'adresse aux grands adolescents et aux adultes de tous niveaux. C'est un ouvrage d'apprentissage des formes verbales. On trouve sur la page de gauche : - la règle de formation de chaque temps ; - les verbes types présentés en tableaux et accompagnés d'une liste de verbes conjugués sur le même modèle ; - des remarques phonétiques ou orthographiques ; - des explications sur les difficultés particulières. La page de droite propose des exercices et des activités de difficulté progressive. C'est également un ouvrage de référence grâce aux nombreux tableaux de conjugaison qu'il contient.

  5. Applying AI techniques to improve alarm display effectiveness

    International Nuclear Information System (INIS)

    Gross, J.M.; Birrer, S.A.; Crosberg, D.R.

    1987-01-01

    The Alarm Filtering System (AFS) addresses the problem of information overload in a control room during abnormal operations. Since operators can miss vital information during these periods, systems which emphasize important messages are beneficial. AFS uses the artificial intelligence (AI) technique of object-oriented programming to filter and dynamically prioritize alarm messages. When an alarm's status changes, AFS determines the relative importance of that change according to the current process state. AFS bases that relative importance on relationships the newly changed alarm has with other activated alarms. Evaluations of a alarm importance take place without regard to the activation sequence of alarm signals. The United States Department of Energy has applied for a patent on the approach used in this software. The approach was originally developed by EG and G Idaho for a nuclear reactor control room

  6. Development of an advanced educational system using AI techniques

    International Nuclear Information System (INIS)

    Yoshimura, Seiichi

    1990-01-01

    This paper describes an advanced educational system that realizes effective education using AI techniques. The system is composed of three devices. One is a knowledge-processing computer that evaluates the operator's knowledge level and presents educational materials. Another is a computer for displaying transients. The other is a computer for voice input and output. The educational materials utilize cause-and-effect relationships. The relationships enable to perform effective education by pointing out the parts the operator failed to understand. An evaluation test was performed by actually operating the system. As a result, the system's fundamental characteristics, such as the ease of understanding the relationships, and the usefulness of the advanced evaluation of the operator's knowledge level, were evaluated highly. (author)

  7. Orthogonally Evolved AI to Improve Difficulty Adjustment in Video Games

    DEFF Research Database (Denmark)

    Hintze, Arend; Olson, Randal; Lehman, Joel Anthony

    2016-01-01

    Computer games are most engaging when their difficulty is well matched to the player's ability, thereby providing an experience in which the player is neither overwhelmed nor bored. In games where the player interacts with computer-controlled opponents, the difficulty of the game can be adjusted...... not only by changing the distribution of opponents or game resources, but also through modifying the skill of the opponents. Applying evolutionary algorithms to evolve the artificial intelligence that controls opponent agents is one established method for adjusting opponent difficulty. Less-evolved agents...... (i.e. agents subject to fewer generations of evolution) make for easier opponents, while highly-evolved agents are more challenging to overcome. In this publication we test a new approach for difficulty adjustment in games: orthogonally evolved AI, where the player receives support from collaborating...

  8. Effects of radiation and apolipoprotein E on lipid profile among workers of nuclear power plants in Korea

    International Nuclear Information System (INIS)

    Ki-Eun Moon; Mee-Seon Jung; Suk-Hee Sung; Youn-Koun Chang; Il-Keun Park; Yun-Mi Paek; Tae-In Choi; Soo-Geun Kim

    2007-01-01

    Complete text of publication follows. Several studies reported that the radiation was positively related to fatty liver, low HDL cholesterol, and hypertriglyceridemia. Genetic polymorphism affect prevalence of chronic disease by molecular epidemiology studies. Apolipoprotein E is an important genetic determinant of cardiovascular disease (CVD), namely through its influence on lipid metabolism. Thus, we investigated whether radiation and apo E polymorphism, and environmental factors contribute to the lipid profile in workers of nuclear power plants in Korea. DNA was extracted from the whole blood of 6896 study subjects (6357 males and 359 females), and apo E polymorphism was investigated using PCR. Plasma lipid profiles were measured by standardized enzymatic procedures and radiation dose was measured by the thermoluminescence dosemeter (TLD). Environmental factors such as exercise, smoking were measured from health management database of KHNP. Total of 6802 subjects (aged 20-58) were investigated and radiation exposure dose was 168.51±463.94 mSv in the recent 1-year dose and 248.24±559.21 mSv in the total accumulative dose. In addition, Apo E polymorphism was associated with significant differences in total cholesterol, HDL cholesterol, radiation dose, AI but others no significant. The multiple regression model showed that total cholesterol was positively correlated with age, SBP, BMI, AI, fasting glucose. HDL cholesterol was negatively correlated with AI. LDL cholesterol was positively correlated with age, BMI, fasting glucose. And triglyceride was significantly correlated in the BMI, AI, somking dose, vegetables but others no significant. Metabolic syndrome did not show any relation to the others; only age, SBP, DBP, BMI, fasting glucose, HOMA-IR influenced. However, there was no significant association between radiation dose and lipid profile. In conclusion, Apo E and well-known variables such as SBP, BMI were significantly associated with lipid profile level

  9. Comparison of disability duration of lumbar intervertebral disc disorders among types of insurance in Korea.

    Science.gov (United States)

    Lee, Choong Ryeol; Kim, Joon Youn; Hong, Young Seoub; Lim, Hyun Sul; Lee, Yong Hwan; Lee, Jong Tae; Moon, Jai Dong; Jeong, Baek Geun

    2005-10-01

    The incidence of work-related musculoskeletal disorder including low back pain sharply increased since 2000 in Korea. The objectives of the present study are to compare disability duration of lumbar intervertebral disc displacement among types of insurances, and to obtain its appropriate duration. The medical records of all patients whose final diagnosis in discharge summary of chart was lumber specified intervertebral disc displacement (LIVD) in 6 large general hospitals in Korea were reviewed to compare the length of admission and disability among different types of insurances. The information on age, gender, the length of admission, the length of follow-up for LIVD, occupation, operation, combined musculoskeletal diseases, and type of insurance was investigated. 552 cases were selected and analyzed to calculate arithmetic mean, median, mode, and geometric mean of disability duration. There was a significant difference in the length of admission and disability among types of insurance after controlling covariates such as age and combined diseases by the analysis of covariance. The length of admission in cases of IACI and AI was much longer than that of HI, and the length of disability in cases of IACI was much longer than that of HI. Prolonged duration of admission and disability was not assumed due to combined diseases, complication or other unexplainable personal factors in cases of those with industrial accidents compensation insurance and automobile insurance. This means that proper management of evidence-based disability duration guidelines is urgently needed in Korea.

  10. GPU: the biggest key processor for AI and parallel processing

    Science.gov (United States)

    Baji, Toru

    2017-07-01

    Two types of processors exist in the market. One is the conventional CPU and the other is Graphic Processor Unit (GPU). Typical CPU is composed of 1 to 8 cores while GPU has thousands of cores. CPU is good for sequential processing, while GPU is good to accelerate software with heavy parallel executions. GPU was initially dedicated for 3D graphics. However from 2006, when GPU started to apply general-purpose cores, it was noticed that this architecture can be used as a general purpose massive-parallel processor. NVIDIA developed a software framework Compute Unified Device Architecture (CUDA) that make it possible to easily program the GPU for these application. With CUDA, GPU started to be used in workstations and supercomputers widely. Recently two key technologies are highlighted in the industry. The Artificial Intelligence (AI) and Autonomous Driving Cars. AI requires a massive parallel operation to train many-layers of neural networks. With CPU alone, it was impossible to finish the training in a practical time. The latest multi-GPU system with P100 makes it possible to finish the training in a few hours. For the autonomous driving cars, TOPS class of performance is required to implement perception, localization, path planning processing and again SoC with integrated GPU will play a key role there. In this paper, the evolution of the GPU which is one of the biggest commercial devices requiring state-of-the-art fabrication technology will be introduced. Also overview of the GPU demanding key application like the ones described above will be introduced.

  11. Apolipoprotein A-I metabolism in cynomolgus monkey. Identification and characterization of beta-migrating pools

    International Nuclear Information System (INIS)

    Melchior, G.W.; Castle, C.K.

    1989-01-01

    Fresh plasma from control (C) and hypercholesterolemic (HC) cynomolgus monkeys was analyzed by agarose electrophoresis-immunoblotting with antibody to cynomolgus monkey apolipoprotein (apo) A-I. Two bands were evident on the autoradiogram: an alpha-migrating band (high density lipoprotein) and a beta-migrating band that comigrated exactly with cynomolgus monkey low density lipoprotein (LDL). The presence of beta-migrating apo A-I in the plasma of these monkeys was confirmed by Geon-Pevikon preparative electrophoresis, crossed immunoelectrophoresis, and isotope dilution studies in which radiolabeled apo A-I was found to equilibrate also with alpha- and beta-migrating pools of apo A-I in the plasma. Subfractionation of C and HC plasma by agarose column chromatography (Bio-Gel A-0.5M and A-15M) followed by agarose electrophoresis-immunoblotting indicated that the beta-migrating apo A-I in C was relatively homogeneous and eluted with proteins of Mr approximately 50 kD [apo A-I(50 kD)], whereas two beta-migrating fractions were identified in HC, one that eluted with the 50-kD proteins, and the other that eluted in the LDL Mr range [apo A-I(LDL)]. The apo A-I(LDL) was precipitated by antibody to cynomolgus monkey apo B. The apo A-I(50 kD) accounted for 5 +/- 1% (mean +/- SD) of the plasma apo A-I in C plasma, and 15 +/- 7% in HC plasma. No apo A-I(LDL) was detected in C plasma, but that fraction accounted for 9 +/- 7% of the apo A-I in HC plasma. These data establish the presence of multiple pools of apo A-I in the cynomolgus monkey, which must be taken into consideration in any comprehensive model of apo A-I metabolism in this species

  12. Squeeze Casting Method Of AI-Si Alloy For Piston Material

    International Nuclear Information System (INIS)

    Wagiyo, H.; Dani, Muhammad; Sulistioso, G.S.; Pardede, Elman; Handayani, Ari; Teguh, Yulius S.P.P.

    2001-01-01

    The AI-Si alloy is an alloy used as piston material. This alloys could be as AI-Si hypereutectic alloy (Si content more than 12.5 % wt.), as AI-Si eutectic alloy (Si cuntent 12.5 % wt, and as AI-Si hypoeutectic alloy (Si content less than 12.5 % wt.). The synthesize of AI-Si alloy piston generally using the technique of gravity casting in a dies. This method is causing high porousity. By using the squeeze technique, amount ofporousity in AI-Si alloy is possibly reduced and the density of this alloy should be higher. The other factors such as alloying elements of AI-Si alloy (Mg. Cu, Zn) would increase the mechanical properties especially the hardness. The focuses of this research are the microstructure and the maximum hardness during the heat treatment of AI-Si alloy which was added by alloying elments. The result of hardness at test shows the maximum hardness at 94.7 kg/mm 2 obtained at aging temperature of 210 o C for hours with homogenous dendritic microstructure

  13. Activity of autoinducer two (AI-2) in bacteria isolated from surface ripened cheeses

    DEFF Research Database (Denmark)

    Gori, Klaus; Jespersen, Lene

    2007-01-01

    ). Corynebacterium casei, Microbacterium barkeri, Microbacterium gubbeenense and S. equorum subsp. linens (all isolated from the smear of surface ripened cheeses) using the AI-2 bioluminescence assay. This indicates that AI-2 signaling could take place between bacteria found in the smear of surface ripened cheeses....

  14. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    2010-01-01

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, the goal of

  15. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, an important

  16. On how AI & Law can help autonomous systems obey the law: a position paper

    NARCIS (Netherlands)

    Prakken, Hendrik

    2016-01-01

    In this position paper I discuss to what extent current and past AI & law research is relevant for research on autonomous intelligent systems that exhibit legally relevant behaviour. After a brief review of the history of AI & law, I will compare the problems faced by autonomous intelligent systems

  17. In Orbit Validation of the AAUSAT3 SDR based AIS receiver

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter

    2013-01-01

    During the past years, there has been a high interest in monitoring the global ship traffic from space. The recently launched AAUSAT3 satellite carries an SDR based AIS receiver, which during the past months have been transmitting space based AIS data down to the Aalborg University Ground Station...

  18. Development and application of AI technology to plant operation and support

    International Nuclear Information System (INIS)

    Sackett, J.I.; Mott, J.E.

    1989-01-01

    This paper discusses a framework for the development and application of artificial intelligence (AI) technology in existing nuclear facilities and reviews the status of development. We consider those areas best addressed by AI technology, e.g., equipment diagnostics, sensor validation, and expert systems for procedural response or planning. A brief discussion of work in computer displays is also given. (orig./GL)

  19. Teaching AI Search Algorithms in a Web-Based Educational System

    Science.gov (United States)

    Grivokostopoulou, Foteini; Hatzilygeroudis, Ioannis

    2013-01-01

    In this paper, we present a way of teaching AI search algorithms in a web-based adaptive educational system. Teaching is based on interactive examples and exercises. Interactive examples, which use visualized animations to present AI search algorithms in a step-by-step way with explanations, are used to make learning more attractive. Practice…

  20. Study on AI-2 signaling molecules activity and the effect of matrine on AI-2 in Staphylococcus epidermidis LuxS/AI-2 quorum sensing%产膜表皮葡萄球菌LuxS/AI-2型密度感应系统AI-2的活性及苦参碱对其的影响

    Institute of Scientific and Technical Information of China (English)

    李雪; 何芳; 卢金霞; 管翠萍; 周学章

    2017-01-01

    [Objective] This study investigated the activity of AI-2 signaling molecules in Staphylococcus epidermidis planktonic bacteria and biofilm bacteria and the effect of matrine.[Method] The growth curve of Staphylococcus epidermidis planktonic bacteria and biofilm bacteria was drawn and AI-2 concentration was measured using the V.harveyi bioluminescence assay.The transcription level of luxS gene was analyzed using real-time PCR.The AI-2 signaling molecules of Staphylococcus epidermidis ATCC35984 were treated with matrine and the changes of AI-2 signaling molecules activity were determined.[Result] In Staphylococcus epidermidis planktonic bacteria growth process,AI-2 signaling molecule activity and the relative expression quantity of luxS gene reached the maximum in the logarithmic phase before decreasing gradually.Their change curves were similar with planktonic growth curve.However,in the growth process of Staphylococcus epidermidis biofilm bacteria,the activity trend was similar with the biofilm growth.The relative expression quantity of luxS gene had an opposite trend to biofilm growth.Matrine had inhibitory effect on AI-2 signaling molecule activity in planktonic and biofilm bacteria,and the inhibitory effect was stronger to planktonic bacteria.[Conclusion] AI-2 signaling molecule activity and relative expression quantity of luxS gene highly correlated with the growth of Staphylococcus epidermidis and its biofilm formation.Matrine significantly reduced the AI-2 signaling molecule activity of Staphylococcus epidermidis.%[目的]研究产膜表皮葡萄球菌生物被膜菌和液相浮游菌LuxS/AI-2型密度感应系统中AI-2信号分子的活性及苦参碱对其的影响.[方法]绘制产膜表皮葡萄球菌ATCC35984液相浮游菌及生物被膜菌的生长曲线;利用哈维氏弧菌BB170(Vibrio harveyi BB170)作为报告菌株检测表皮葡萄球菌AI-2信号分子的活性;用荧光定量PCR法检测luxS基因的转录水平;用苦参碱

  1. Divorce in Korea: Trends and Educational Differentials

    Science.gov (United States)

    Park, Hyunjoon; Raymo, James M.

    2013-01-01

    The authors extend comparative research on educational differences in divorce by analyzing data from Korea. A primary motivation was to assess whether the theoretically unexpected negative educational gradient in divorce in Japan is also observed in Korea. Using vital statistics records for marriages and divorces registered between 1991 and 2006,…

  2. South Korea's Development Success: Lessons for Uganda ...

    African Journals Online (AJOL)

    From a least developed and aid receiving country to a developed and donor country within six decades, South Korea represents one of the unprecedented world's phenomenal and remarkable development experience. A combination of political and economic elements has been the key driver behind Korea's development ...

  3. Guides about nuclear energy in South Korea

    International Nuclear Information System (INIS)

    2004-03-01

    This document summarizes the main information on nuclear energy in South Korea: number of reactors in operation, type, date of commissioning, nuclear facilities under construction, nuclear share in power production, companies and organizations (Korea electric power company (KEPCO), Korea atomic energy institute (KAERI), Korea institute of nuclear safety (KINS), Korea nuclear energy foundation (KNEF), Korea hydro and nuclear power (KHNP), nuclear environment technology institute (NETEC), Korea basic science institute (KBSI)), nuclear fuel fabrication, research works on waste disposal, nuclear R and D in fission and fusion, safety of nuclear facilities, strategies under study (1000 MWe Korea standard nuclear power plant (KSNP), 1400 MWe advanced power reactor (APR), small power water cooled reactors (system-integrated modular advanced reactor (SMART) research program), development of fast reactors (Kalimer research program), development of the process of direct use of PWR fuel in Candu (DUPIC), use of reprocessing uranium, transmutation of trans-uranian and wastes (KOMAC program), first dismantling experience (Triga Mark II and III research reactors). (J.S.)

  4. Servicing NPPs in Japan, Korea and Taiwan

    International Nuclear Information System (INIS)

    Bohmann, W.; Poetz, F.

    1991-01-01

    More than 45 comparable orders (for equipment or services ) have been carried out in Japan, Korea and Taiwan by ABB Reaktor since 1982. Recently contracts to deliver inspection and repair equipment for the core baffle former bolts of Japanese NPPs, and in 1990, a contract to clean two steam generators in Korea, together with Pacific Nuclear Services, USA, were won. 2 figs

  5. Nuclear data activities in Korea

    International Nuclear Information System (INIS)

    Chang, Jonghwa; Lee, Young-Ouk

    2002-01-01

    The situation of the nuclear data project in Korea is reviewed in this paper. The results of the first stage from 1997 - 2000 are reviewed with associated application projects such as a test reactor HANARO, a light water reactor project SMART, a liquid metal reactor project KALIMER, an ADS project KOMAC, a waste project, medial application, and electron linac application. The strategy for setting up the second stage, during 2001 - 2004, are introduced. The user requirement, quality assurance, nuclear data processing, service, and measurement activity are reviewed. (author)

  6. Graafikatriennaali grand prix Korea kunstnikule

    Index Scriptorium Estoniae

    1998-01-01

    Tallinna XI graafikatriennaali rahvusvaheline žürii andis grand prix korea kunstnikule Chung¡Sang-Gonile, kolm võrdset preemiat - soome kunstnikele Anita Jensenile ja Tapani Mikkonenile ning jaapani kunstnikule Estuko Obatale. Eesti Kunstimuuseumi preemia - Wendy Swallow. Tallinna linna preemia ja Ivar Luki sponsoripreemia - Walter Jule. Sponsoripreemiad : Paletti Eesti AS preemia - Inga Heamägi; Rannila Profiili preemia - Mojca Zlokarnik; UNDP preemia - Andrea Juan. Rotermanni soolalao arhitektuuri- ja kunstikeskuse diplom - Lis Ingram, Heli Päivikki Kurunsaari, Randi Strand, Wendy Swallow

  7. Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS): A conceptual framework

    Science.gov (United States)

    Parnell, Gregory S.; Rowell, William F.; Valusek, John R.

    1987-01-01

    In recent years there has been increasing interest in applying the computer based problem solving techniques of Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS) to analyze extremely complex problems. A conceptual framework is developed for successfully integrating these three techniques. First, the fields of AI, OR, and DSS are defined and the relationships among the three fields are explored. Next, a comprehensive adaptive design methodology for AI and OR modeling within the context of a DSS is described. These observations are made: (1) the solution of extremely complex knowledge problems with ill-defined, changing requirements can benefit greatly from the use of the adaptive design process, (2) the field of DSS provides the focus on the decision making process essential for tailoring solutions to these complex problems, (3) the characteristics of AI, OR, and DSS tools appears to be converging rapidly, and (4) there is a growing need for an interdisciplinary AI/OR/DSS education.

  8. Enabling technologies and methods for the retro-fitting of AI software into NPPS

    International Nuclear Information System (INIS)

    Pymm, P.

    1994-01-01

    Scottish Nuclear have a number of plant monitoring and training applications at their operational nuclear power plant which could benefit from the introduction of artificial intelligence (AI) software. An outline of early work on two current AI developments in the areas of advanced operator aids and intelligent training is given. A generic workstation based engineering simulator (WES) which provides a prototyping environment for AI product application development and evaluation and development of human-computer interface (HCI) designs for plant installation is described. It is concluded that the WES architecture facilitates both migration of the prototype AI application to the plant and collaboration in the AI field between Scottish Nuclear and other organizations. (author). 1 ref., 6 figs

  9. Present status of nuclear containments in Korea

    International Nuclear Information System (INIS)

    Park, Jihong; Hong, Jaekeun; Lee, Byunghoon; Son, Youngho

    2007-01-01

    Since the first nuclear power plant in Korea, Kori unit no.1, was started in commercial service in 1978, 20 units including Kori unit no.1 have been operated and maintained until now in Korea. Recently several units were started to be constructed and also, additionally more than 4 units were planned to be constructed in the near future. The importance of nuclear containments has been always one of the hottest issues for the safety and protection of nuclear power plants until now. At the beginning of nuclear power plants construction in Korea, several typed nuclear containment systems were adopted. For those reasons, various codes, standards, and inspection technologies are applied to nuclear containment systems differently. In this study, the status of inservice inspection performed for the safety and maintenance of nuclear containments in Korea was researched. Overall nuclear containment systems and inspections performed up to recently in Korea including trends, inspection items, periods, and regulations were described briefly. (author)

  10. LuxS-independent formation of AI-2 from ribulose-5-phosphate

    Directory of Open Access Journals (Sweden)

    Hardie Kim R

    2008-06-01

    Full Text Available Abstract Background In many bacteria, the signal molecule AI-2 is generated from its precursor S-ribosyl-L-homocysteine in a reaction catalysed by the enzyme LuxS. However, generation of AI-2-like activity has also been reported for organisms lacking the luxS gene and the existence of alternative pathways for AI-2 formation in Escherichia coli has recently been predicted by stochastic modelling. Here, we investigate the possibility that spontaneous conversion of ribulose-5-phosphate could be responsible for AI-2 generation in the absence of luxS. Results Buffered solutions of ribulose-5-phosphate, but not ribose-5-phosphate, were found to contain high levels of AI-2 activity following incubation at concentrations similar to those reported in vivo. To test whether this process contributes to AI-2 formation by bacterial cells in vivo, an improved Vibrio harveyi bioassay was used. In agreement with previous studies, culture supernatants of E. coli and Staphylococcus aureus luxS mutants were found not to contain detectable levels of AI-2 activity. However, low activities were detected in an E. coli pgi-eda-edd-luxS mutant, a strain which degrades glucose entirely via the oxidative pentose phosphate pathway, with ribulose-5-phosphate as an obligatory intermediate. Conclusion Our results suggest that LuxS-independent formation of AI-2, via spontaneous conversion of ribulose-5-phosphate, may indeed occur in vivo. It does not contribute to AI-2 formation in wildtype E. coli and S. aureus under the conditions tested, but may be responsible for the AI-2-like activities reported for other organisms lacking the luxS gene.

  11. The AI&M procedure for learning from incomplete data

    DEFF Research Database (Denmark)

    Jaeger, Manfred

    2006-01-01

    We investigate methods for parameter learning from incomplete data that is not missing at random. Likelihood-based methods then require the optimization of a profile likelihood that takes all possible missingness mechanisms into account. Optimizing this profile likelihood poses two main difficult......We investigate methods for parameter learning from incomplete data that is not missing at random. Likelihood-based methods then require the optimization of a profile likelihood that takes all possible missingness mechanisms into account. Optimizing this profile likelihood poses two main...... by operations in the space of data completions, rather than directly in the parameter space of the profile likelihood. We apply the AI\\&M method to learning parameters for Bayesian networks. The method is compared against conservative inference, which takes into account each possible data completion......, and against EM. The results indicate that likelihood-based inference is still feasible in the case of unknown missingness mechanisms, and that conservative inference is unnecessarily weak. On the other hand, our results also provide evidence that the EM algorithm is still quite effective when the data...

  12. Building regional early flood warning systems by AI techniques

    Science.gov (United States)

    Chang, F. J.; Chang, L. C.; Amin, M. Z. B. M.

    2017-12-01

    Building early flood warning system is essential for the protection of the residents against flood hazards and make actions to mitigate the losses. This study implements AI technology for forecasting multi-step-ahead regional flood inundation maps during storm events. The methodology includes three major schemes: (1) configuring the self-organizing map (SOM) to categorize a large number of regional inundation maps into a meaningful topology; (2) building dynamic neural networks to forecast multi-step-ahead average inundated depths (AID); and (3) adjusting the weights of the selected neuron in the constructed SOM based on the forecasted AID to obtain real-time regional inundation maps. The proposed models are trained, and tested based on a large number of inundation data sets collected in regions with the most frequent and serious flooding in the river basin. The results appear that the SOM topological relationships between individual neurons and their neighbouring neurons are visible and clearly distinguishable, and the hybrid model can continuously provide multistep-ahead visible regional inundation maps with high resolution during storm events, which have relatively small RMSE values and high R2 as compared with numerical simulation data sets. The computing time is only few seconds, and thereby leads to real-time regional flood inundation forecasting and make early flood inundation warning system. We demonstrate that the proposed hybrid ANN-based model has a robust and reliable predictive ability and can be used for early warning to mitigate flood disasters.

  13. Computational intelligence from AI to BI to NI

    Science.gov (United States)

    Werbos, Paul J.

    2015-05-01

    This paper gives highlights of the history of the neural network field, stressing the fundamental ideas which have been in play. Early neural network research was motivated mainly by the goals of artificial intelligence (AI) and of functional neuroscience (biological intelligence, BI), but the field almost died due to frustrations articulated in the famous book Perceptrons by Minsky and Papert. When I found a way to overcome the difficulties by 1974, the community mindset was very resistant to change; it was not until 1987/1988 that the field was reborn in a spectacular way, leading to the organized communities now in place. Even then, it took many more years to establish crossdisciplinary research in the types of mathematical neural networks needed to really understand the kind of intelligence we see in the brain, and to address the most demanding engineering applications. Only through a new (albeit short-lived) funding initiative, funding crossdisciplinary teams of systems engineers and neuroscientists, were we able to fund the critical empirical demonstrations which put our old basic principle of "deep learning" firmly on the map in computer science. Progress has rightly been inhibited at times by legitimate concerns about the "Terminator threat" and other possible abuses of technology. This year, at SPIE, in the quantum computing track, we outline the next stage ahead of us in breaking out of the box, again and again, and rising to fundamental challenges and opportunities still ahead of us.

  14. AI empowered context-aware smart system for medication adherence

    Directory of Open Access Journals (Sweden)

    Qiong Wu

    2017-06-01

    Full Text Available Purpose – Poor medication adherence leads to high hospital admission rate and heavy amount of health-care cost. To cope with this problem, various electronic pillboxes have been proposed to improve the medication adherence rate. However, most of the existing electronic pillboxes use time-based reminders which may often lead to ineffective reminding if the reminders are triggered at inopportune moments, e.g. user is sleeping or eating. Design/methodology/approach – In this paper, the authors propose an AI-empowered context-aware smart pillbox system. The pillbox system collects real-time sensor data from a smart home environment and analyzes the user’s contextual information through a computational abstract argumentation-based activity classifier. Findings – Based on user’s different contextual states, the smart pillbox will generate reminders at appropriate time and on appropriate devices. Originality/value – This paper presents a novel context-aware smart pillbox system that uses argumentation-based activity recognition and reminder generation.

  15. Dictionnaire étymologique du français

    CERN Document Server

    Picoche, Jacqueline

    1979-01-01

    Cette nouvelle édition du Dictionnaire étymologique du français, largement enrichie, présente l'arbre généalogique de près de 35 000 mots. Savez-vous que concerto, décret et discernement ont la même racine que crible ?. Que chauvin, espiègle et rocambolesque viennent de noms de personnages de la littérature ?. Que le sens premier de amadouer est " frotter avec de l'amadou " pour se jaunir le teint ?. Pour chaque mot, retrouvez sa famille, son origine, son sens originel ou le sens de sa racine, les diverses formes qu'il a prises depuis sa première attestation et les règles phonétiques expliquant son évolution. Des annexes traitent plus particulièrement des mots à syllabes redoublées (coco, zigzag), de ceux formés sur des onomatopées (hennir, ouistiti) et de ceux venant de noms de personnes (dahlia, praline) ou de lieux (bougie, rugby).

  16. AI and simulation: What can they learn from each other

    Science.gov (United States)

    Colombano, Silvano P.

    1988-01-01

    Simulation and Artificial Intelligence share a fertile common ground both from a practical and from a conceptual point of view. Strengths and weaknesses of both Knowledge Based System and Modeling and Simulation are examined and three types of systems that combine the strengths of both technologies are discussed. These types of systems are a practical starting point, however, the real strengths of both technologies will be exploited only when they are combined in a common knowledge representation paradigm. From an even deeper conceptual point of view, one might even argue that the ability to reason from a set of facts (i.e., Expert System) is less representative of human reasoning than the ability to make a model of the world, change it as required, and derive conclusions about the expected behavior of world entities. This is a fundamental problem in AI, and Modeling Theory can contribute to its solution. The application of Knowledge Engineering technology to a Distributed Processing Network Simulator (DPNS) is discussed.

  17. CURRENT ISSUES IN OUTSOURCING: MIS, AIS AND BEYOND

    Directory of Open Access Journals (Sweden)

    AIDA SY

    2012-01-01

    Full Text Available En años recientes, el outsourcing se ha venido convirtiendo en una tendencia tanto en empresas de Europa y los Estados Unidos. Ni siquiera, trabajadores muy calificados se salvan de este asalto.La vanidad de los intelectuales y los profesionales que ejecutan tanto sistemas de información contable(AIS, como sistemas de información de gestión (MIS es su creencia de que están exentos de estosprocesos de outsourcing. Algunos creen que disfrutan de una vida de ensueño, que la demanda de sus servicios está asegurada. Se consuelan pensando que el aumento de su dominiotécnico les ofrece una defensa suficiente contra los ataques provenientes del mercado laboral y de productos.Una interpretación desde los estudios críticos indicará que esta posición es un acto dearrogancia, siendo esto el eje de la discusión de este documento. Tal actitud de los profesionales contables es una reminiscencia del Rey Canuto esperando que la marea retroceda.

  18. Seismic risk map of Korea

    International Nuclear Information System (INIS)

    Lee, S.H.; Lee, Y.K.; Eum, S.H.; Yang, S.J.; Chun, M.S.

    1983-01-01

    A study on seismic hazard level in Korea has been performed and the main results of the study are summarized as follows: 1. Historians suggest that the quality of historical earthquake data may be accurate in some degree and the data should be used in seismic risk analysis. 2. The historical damage events are conformed in historical literatures and their intensities are re-evaluated by joint researchers. The maximum MM intensity of them is VIII evaluated for 17 events. 3. The relation of earthquakes to surface fault is not clear. It seems resonable to related them to tectonic provinces. 4. Statistical seismic risk analysis shows that the acceleration expected within 50O year return period is less than 0.25G when only instrumental earthquakes are used and less than 0.10G if all of instrumental and historical earthquakes are used. The acceleration in Western Coast and Kyungsang area is higher than the other regions in Korea. 5. The maximum horizontal acceleration determined by conservative method is 0.26G when historical earthquake data are used and less than 0.20G if only instrumental earthquakes are used. The return period of 0.26G is 240 years in Kyungsang province and longer in other provinces. (Author)

  19. Household Arthropod Allergens in Korea

    Science.gov (United States)

    Jeong, Kyoung Yong

    2009-01-01

    Arthropods are important in human health, which can transmit pathogens to humans, parasitize, or produce important allergens. Allergy prevalence becomes higher in Korea recently as well as other developed countries in contrast to a decrease of infectious diseases. Allergic diseases caused by household arthropods have increased dramatically during the last few decades since human beings spend more their time for indoor activities in modernized life style. Household arthropods are one of the most common causes of allergic diseases. Biological characterization of household arthropods and researches on their allergens will provide better understanding of the pathogenesis of allergic diseases and suggest new therapeutic ways. Therefore, studies on arthropods of allergenic importance can be considered one of the major research areas in medical arthropodology and parasitology. Here, the biology of several household arthropods, including house dust mites and cockroaches, the 2 most well known arthropods living indoor together with humans worldwide, and characteristics of their allergens, especially the research activities on these allergens performed in Korea, are summarized. PMID:19885330

  20. Occupational hearing loss in Korea.

    Science.gov (United States)

    Kim, Kyoo Sang

    2010-12-01

    In this article, current status of noise exposure in workplaces, trend of workers with noise-induced hearing loss (NIHL), and prevalence of NIHL in workers by industry and job category in Korea were reviewed. In addition, trends of research on the audiological effects such as hearing loss from noise and occupational hearing loss from non-noise in Korea were addressed through reports in industrial audiology. Though noise exposure level has improved, noise still shows the highest rate of cases exceeding exposure limit among workplace hazards. NIHL is the most common occupational disease except work-related disease such as musculoskeletal disorders and cerebrovascular diseases, and NIHL prevalence is thought to be much higher than reported in official publications. Noise affecting hearing comes from various sources such as workplaces, military settings, areas with exposure to high noise, and specific noise sources. There is also occupational hearing loss by non-noise including chemicals such as organic solvents and heavy metals, barotrauma, and trauma due to welding spark. Noise affects daily life through audiological effects such as hearing loss and tinnitus, non-audiological physical effects (e.g., cardiovascular), and psychosocial and behavioral effects. Development of systematic and comprehensive hearing conservation programs for lowering the noise level in workplaces and preventing the NIHL, and preparation of technological, administrative system for its settlement at workplace are urgently needed.

  1. Effects of a T'ai Chi-Based Health Promotion Program on Metabolic Syndrome Markers, Health Behaviors, and Quality of Life in Middle-Aged Male Office Workers: A Randomized Trial.

    Science.gov (United States)

    Choi, Ye-Sook; Song, Rhayun; Ku, Bon Jeong

    2017-12-01

    To determine the effects of a t'ai chi-applied worksite health promotion program on metabolic syndrome markers, health behaviors, and quality of life in middle-aged male office workers at a high risk of metabolic syndrome. A prospective randomized controlled study. Health center of a government office building in Korea. Forty-three male office workers with two or more metabolic syndrome markers. The office workers were randomly assigned either to an experimental group that received t'ai chi combined with health education twice weekly for 12 weeks, or to a control group that received health education only. Blood sampling for metabolic syndrome markers and structured questionnaires for health behaviors and quality of life. The experimental group showed significant reductions in systolic (t = -3.103, p = 0.003) and diastolic (t = -2.159, p = 0.037) blood pressures and the triglyceride level (t = -2.451, p = 0.019) compared with the control group. Those in the experimental group also performed health behaviors more frequently (t = 4.047, p effective adjunctive intervention in a worksite health promotion program for middle-aged office workers at a high risk of metabolic syndrome. Future studies should examine the long-term effects of t'ai chi-applied worksite health promotion programs in individuals with confirmed metabolic syndrome.

  2. Higher education and local communities | Humphreys | South ...

    African Journals Online (AJOL)

    ... and advocate for human resource development and the third, as a service provider, building intellectual capital. The article examines the proposition that the most significant contribution that a university or technikon can make to the development of a locality derives from its recruitment of students from the local community.

  3. Neonatal Vitamin A supplementation | Humphrey | South African ...

    African Journals Online (AJOL)

    South African Medical Journal. Journal Home · ABOUT · Advanced Search · Current Issue · Archives · Journal Home > Vol 89, No 2 (1999) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Download this PDF file. The PDF file you selected should load here if your ...

  4. Neonatal Vitamin A supplementation | Humphrey | South African ...

    African Journals Online (AJOL)

    Vitamin A deficiency is a major public health problem throughout the developing world, affecting an estimated 124 million young children and accounting for more than 1 million child deaths each year.' A meta-analysis of eight controlled trials estimated that community-based vitamin A supplementation resulted in a 23% ...

  5. Novel cross-linked alcohol-insoluble solid (CL-AIS) affinity gel from pea pod for pectinesterase purification.

    Science.gov (United States)

    Wu, Ming-Chang; Lin, Guan-Hui; Wang, Yuh-Tai; Jiang, Chii-Ming; Chang, Hung-Min

    2005-10-05

    Alcohol-insoluble solids (AIS) from pea pod were cross-linked (CL-AIS) and used as an affinity gel matrix to isolate pectin esterases (PEs) from tendril shoots of chayote (TSC) and jelly fig achenes (JFA), and the results were compared with those isolated by ion-exchange chromatography with a commercial resin. CL-AIS gel matrix in a column displayed poor absorption and purification fold of PE; however, highly methoxylated CL-AIS (HM-CL-AIS), by exposing CL-AIS to methanolic sulfuric acid to increase the degree of esterification (DE) to 92%, facilitated the enzyme purification. The purified TSC PE and JFA PE by the HM-CL-AIS column were proofed as a single band on an SDS-PAGE gel, showing that the HM-CL-AIS column was a good matrix for purification of PE, either with alkaline isoelectric point (pI) (TSC PE) or with acidic pI (JFA PE).

  6. A model of lipid-free apolipoprotein A-I revealed by iterative molecular dynamics simulation.

    Directory of Open Access Journals (Sweden)

    Xing Zhang

    Full Text Available Apolipoprotein A-I (apo A-I, the major protein component of high-density lipoprotein, has been proven inversely correlated to cardiovascular risk in past decades. The lipid-free state of apo A-I is the initial stage which binds to lipids forming high-density lipoprotein. Molecular models of lipid-free apo A-I have been reported by methods like X-ray crystallography and chemical cross-linking/mass spectrometry (CCL/MS. Through structural analysis we found that those current models had limited consistency with other experimental results, such as those from hydrogen exchange with mass spectrometry. Through molecular dynamics simulations, we also found those models could not reach a stable equilibrium state. Therefore, by integrating various experimental results, we proposed a new structural model for lipid-free apo A-I, which contains a bundled four-helix N-terminal domain (1-192 that forms a variable hydrophobic groove and a mobile short hairpin C-terminal domain (193-243. This model exhibits an equilibrium state through molecular dynamics simulation and is consistent with most of the experimental results known from CCL/MS on lysine pairs, fluorescence resonance energy transfer and hydrogen exchange. This solution-state lipid-free apo A-I model may elucidate the possible conformational transitions of apo A-I binding with lipids in high-density lipoprotein formation.

  7. Validation of the Avoidance and Inflexibility Scale (AIS) among treatment-seeking smokers.

    Science.gov (United States)

    Farris, Samantha G; Zvolensky, Michael J; DiBello, Angelo M; Schmidt, Norman B

    2015-06-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as a smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.2% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at 3 time points (baseline, quit-day, and 1 month postquit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a 2-factor solution, described by inflexibility and avoidance because of smoking related "thoughts/feelings" (9 items) and "somatic sensations" (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. (c) 2015 APA, all rights reserved).

  8. Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

    Science.gov (United States)

    Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

    2015-01-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Baseline, Quit day, 1 month post-quit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a two-factor solution, described by inflexibility and avoidance due to smoking related “thoughts/feelings” (9 items) and “somatic sensations” (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically-relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. PMID:25642937

  9. Rapid and simple colorimetric method for the quantification of AI-2 produced from Salmonella Typhimurium.

    Science.gov (United States)

    Wattanavanitchakorn, Siriluck; Prakitchaiwattana, Cheunjit; Thamyongkit, Patchanita

    2014-04-01

    The aim of this study was to evaluate the feasibility of Fe(III) ion reduction for the simple and rapid quantification of autoinducer-2 (AI-2) produced from bacteria using Salmonella Typhimurium as a model. Since the molecular structure of AI-2 is somewhat similar to ascorbic acid it was expected that AI-2 would also act as a reducing agent and reduce Fe(III) ions in the presence of 1,10-phenanthroline to form the colored [(o-phen)3 Fe(II)]SO4 ferroin complex that could be quantified colorimetrically. In support of this, colony rinses and cell free supernatants from cultures of all tested AI-2 producing strains, but not the AI-2 negative Sinorhizobium meliloti, formed a colored complex with a λmax of 510nm. The OD510 values of these culture supernatants or colony rinses were in broad agreement with the % activity observed in the same samples using the standard Vibrio harveyi bioluminescence assay for AI-2 detection, and with previously reported results. This methodology could potentially be developed as an alternative method for the simple and rapid quantification of AI-2 levels produced in bacterial cultures. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. The Atomics International (AI) prototype large breeder reactor (PLBR)

    International Nuclear Information System (INIS)

    McDonald, J.S.; Campise, A.V.; Brunings, J.

    1978-01-01

    The AI-PLBR breeder plant design prepared for ERDA and EPRI is of 1000 MWe size, utilizing a loop-type sodium system configuration and producing 2200 psig/850 0 F steam. A 'bullseye' core geometry type sodium system configuration and is employed with Pu0 2 -UO 2 fuel and UO 2 fertile material. The reactor outlet coolant temperature is 930 0 F. A modified 'A'-frame refueling system is employed, which is capable of handling 1/3 of a core loading in 12 days. An inducer-type mechanical pump is used in the primary circuit because of its excellent NPSH characteristics. Hockey sticks steam generators are used to produce near-fossil steam conditions at the turbine throttle. The balance of plant (BOP) design was developed by the architectural-engineering firm of Burns and Roe. It includes Allis-Chalmers - KWU 1800-rpm tandem-compound turbine, selected with high-,intermediate-, and two double-flow low-pressure cylinders equipped with two moisture separator cyclones. A design feature to enhance the licensability of the reference design is the three-level Decay Heat Removal System (DHRS), which consists of normal, backup, and diverse decay heat removal paths. The Atomics International PLBR design illustrated the technical soundness of the LMFBR system for meeting the world's long-term electrical energy supply needs. The design includes design features to assure licensability and innovative engineering features to enhance reliability, constructability, economics, and U.S. utility grid compatibility. The design concept provides a sound basis for the future detailed design of a prototype plant and subsequent development of larger LMFBR plants. (author)

  11. Man-machine communication in reactor control using AI methods

    International Nuclear Information System (INIS)

    Klebau, J.; Lindner, A.; Fiedler, U.

    1987-01-01

    In the last years the interest in process control has expecially focused on problems of man-machine communication. It depends on its great importance to process performance and user acceptance. Advanced computerized operator aids, e.g. in nuclear power plants, are as well as their man-machine interface. In the Central Institute for Nuclear Research in Rossendorf a computerized operator support system for nuclear power plants is designed, which is involved in a decentralized process automation system. A similar but simpler system, the Hierarchical Informational System (HIS) at the Rossendorf Research Reactor, works with a computer controlled man-machine interface, based on menu. In the special case of the disturbance analysis program SAAP-2, which is included in the HIS, the limits of menu techniques are obviously. Therefore it seems to be necessary and with extended hard- and software possible to realize an user controlled natural language interface using Artificial Intelligence (AI) methods. The draft of such a system is described. It should be able to learn during a teaching phase all phrases and their meanings. The system will work on the basis of a self-organizing, associative data structure. It is used to recognize a great amount of words which are used in language analysis. Error recognition and, if possible, correction is done by means of a distance function in the word set. Language analysis should be carried out with a simplified word class controlled functional analysis. With this interface it is supposed to get experience in intelligent man-machine communication to enhance operational safety in future. (author)

  12. AI Techniques in a Context-Aware Ubiquitous Environment

    Science.gov (United States)

    Coppola, Paolo; Mea, Vincenzo Della; di Gaspero, Luca; Lomuscio, Raffaella; Mischis, Danny; Mizzaro, Stefano; Nazzi, Elena; Scagnetto, Ivan; Vassena, Luca

    Nowadays, the mobile computing paradigm and the widespread diffusion of mobile devices are quickly changing and replacing many common assumptions about software architectures and interaction/communication models. The environment, in particular, or more generally, the so-called user context is claiming a central role in everyday’s use of cellular phones, PDAs, etc. This is due to the huge amount of data “suggested” by the surrounding environment that can be helpful in many common tasks. For instance, the current context can help a search engine to refine the set of results in a useful way, providing the user with a more suitable and exploitable information. Moreover, we can take full advantage of this new data source by “pushing” active contents towards mobile devices, empowering the latter with new features (e.g., applications) that can allow the user to fruitfully interact with the current context. Following this vision, mobile devices become dynamic self-adapting tools, according to the user needs and the possibilities offered by the environment. The present work proposes MoBe: an approach for providing a basic infrastructure for pervasive context-aware applications on mobile devices, in which AI techniques (namely a principled combination of rule-based systems, Bayesian networks and ontologies) are applied to context inference. The aim is to devise a general inferential framework to make easier the development of context-aware applications by integrating the information coming from physical and logical sensors (e.g., position, agenda) and reasoning about this information in order to infer new and more abstract contexts.

  13. Using experimental game theory to transit human values to ethical AI

    OpenAIRE

    Wang, Yijia; Wan, Yan; Wang, Zhijian

    2017-01-01

    Knowing the reflection of game theory and ethics, we develop a mathematical representation to bridge the gap between the concepts in moral philosophy (e.g., Kantian and Utilitarian) and AI ethics industry technology standard (e.g., IEEE P7000 standard series for Ethical AI). As an application, we demonstrate how human value can be obtained from the experimental game theory (e.g., trust game experiment) so as to build an ethical AI. Moreover, an approach to test the ethics (rightness or wrongn...

  14. How AI localisation in plant tissues determines the targeted pest spectrum of different chemistries

    DEFF Research Database (Denmark)

    Buchholz, Anke; Trapp, Stefan

    penetration as first crucial step can be modified by formulation whereas the active ingredient (AI) distribution within cells is usually solely determined by physicochemical properties. This passive AI distribution was calculated with the Fick-Nernst-Planck equation implemented in a cell model....... The predictions were compared to the measured biological effects against three different arthropods. Test compounds differed in log P (-0.1 to 4.3) and pKa (4.1 to 10.7). Efficacies in different bioassays are discussed with the postulated cellular AI localisation and the individual feeding behaviour...

  15. Combining AI Methods for Learning Bots in a Real-Time Strategy Game

    OpenAIRE

    Robin Baumgarten; Simon Colton; Mark Morris

    2009-01-01

    We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generat...

  16. A Review of Future and Ethical Perspectives of Robotics and AI

    Directory of Open Access Journals (Sweden)

    Jim Torresen

    2018-01-01

    Full Text Available In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to avoid a dystopian future. References to recent initiatives to outline ethical guidelines for both the design of systems and how they should operate are included.

  17. Selective oxidation of methionine residues in apolipoprotein A-I and its potential biological consequences

    International Nuclear Information System (INIS)

    Panzenboeck, U.; Waldeck, R.; Rye, K.A.; Sloane, T.; Kritharides, L.; Stocker, R.

    1998-01-01

    The earliest stages of HDL oxidation are accompanied by the oxidation of specific Met residues in apolipoprotein AI and AII and the formation of Met sulfoxides (Met(O)) has been proposed to play a significant role in the reduction and hence detoxification of lipid hydroperoxides associated with HDL. Oxidation of HDL may generally decrease the anti-atherogenic properties of this lipoprotein, although both, the inhibition and the enhancement of cholesterol removal from cells has been reported for different types of oxidation. In light of these findings we have investigated the secondary structure, lipid affinity, LCAT activation and cholesterol-efflux promoting properties of native and selectively oxidized apo A-I(apo A-I +32 , containing Met(O) at Met l12 and Met l48 ) in purified or reconstituted forms. Data obtained by circular dichroism revealed that selective oxidation of Met residues 112 and 148 does not alter alpha helicity of the protein in solution, indicating that this oxidation is not sufficient to influence significantly this type of secondary structure of apo A-I in its 'lipid-free' form. The lipid affinity of native apo A-I and apo A-I +32 was determined as the rate of clearance of DMPC multilamellar to small unilamellar vesicles. Compared with the native protein, apo A-I +32 induced a 2-3 fold faster rate of clearance, suggesting that the increased hydrophilicity due Met(O) increased the rate for protein-lipid interactions. Met residues 112 and 148 reside in the hydrophobic faces of helices 5 and 7, and both these regions have been suggested to be important for both, LCAT activation and cholesterol efflux. Kinetic experiments have revealed that the affinity for LCAT is comparable for HDL reconstituted with either apo A-I or apo A-I +32 . Efflux of [ 3 H]-cholesterol from lipid-laden human monocytederived macrophages to isolated apolipoproteins was enhanced for apo A-I +32 compared with apo A-I, consistent with the DMPC clearance data. Together these

  18. Detection of possible AI-2-mediated quorum sensing system in commensal intestinal bacteria.

    Science.gov (United States)

    Lukás, F; Gorenc, G; Kopecný, J

    2008-01-01

    The Vibrio harveyi strain BB170-autoinducer bioassay was used to detect possible quorum sensing autoinducer-2 molecule (AI-2) in culture fluids of commensal intestinal bacteria. Culture fluids of Bacteroides vulgatus, Clostridium proteoclasticum, Escherichia coli, Eubacterium rectale, Lachnospira multipara, Pseudobutyrivibrio ruminis, Roseburia intestinalis, Ruminococcus albus and Ruminococcus flavefaciens contained AI-2-like molecules. The PCR bands from some of the tested strains could be also amplified using primers designed for the luxS gene. These findings suggest that AI-2 is present in the gastrointestinal tract; however, it has not yet been proved whether it is used for bacterial cell-to-cell communication.

  19. 78 FR 63494 - Meeting of the National Coordination Committee on the AI/AN SANE-SART Initiative

    Science.gov (United States)

    2013-10-24

    ... National Coordination Committee on the AI/AN SANE--SART Initiative AGENCY: Office for Victims of Crime.../ Alaska Native (AI/AN) Sexual Assault Nurse Examiner (SANE)--Sexual Assault Response Team (SART..., victim-centered responses to sexual violence within AI/AN communities. DATES: The meeting will be held...

  20. Space Weather Services of Korea

    Science.gov (United States)

    Yoon, K.; Hong, S.; Jangsuk, C.; Dong Kyu, K.; Jinyee, C.; Yeongoh, C.

    2016-12-01

    The Korean Space Weather Center (KSWC) of the National Radio Research Agency (RRA) is a government agency which is the official source of space weather information for Korean Government and the primary action agency of emergency measure to severe space weather condition. KSWC's main role is providing alerts, watches, and forecasts in order to minimize the space weather impacts on both of public and commercial sectors of satellites, aviation, communications, navigations, power grids, and etc. KSWC is also in charge of monitoring the space weather condition and conducting research and development for its main role of space weather operation in Korea. In this study, we will present KSWC's recent efforts on development of application-oriented space weather research products and services on user needs, and introduce new international collaborative projects, such as IPS-Driven Enlil model, DREAM model estimating electron in satellite orbit, global network of DSCOVR and STEREO satellites tracking, and ARMAS (Automated Radiation Measurement for Aviation Safety).

  1. Regional cooperation prospects in Korea

    International Nuclear Information System (INIS)

    Yoon, Wan Ki

    2006-01-01

    The Republic of Korea follows a well-established nuclear nonproliferation policy and could consider regional cooperation as proposed by many nuclear experts over the years. Real problems exist in establishing cooperation, but as the nuclear industry continues to grow, the motivation increases. The US should be a partner in the regional cooperation also. This paper summarizes significant advances made by the NNCA in applying remote monitoring technologies to support international safeguards in the ROK, providing the technical foundation for the use of these technologies for transparency between partner countries. Concrete steps are proposed to form an institutional and then a governmental approach for transparency in the use of nuclear material and even, eventual establishment of a regional safeguards inspection regime. (author)

  2. Dental PACS development in Korea

    International Nuclear Information System (INIS)

    Kim, Eun Kyung

    2008-01-01

    Picture archiving and communication system (PACS) is an image information technology system for the transmission and storage of medical images. In Korea the first full PACS was installed at Samsung Medical Center in 1994, but, the rate of distribution was very slow. The government's approval for the medical insurance reimbursement for full PACS examinations in November 1999 became the turning point. Thereafter the number of hospitals with full PACS has steeply increased. In September of this year, PACS was installed at 906 medical institutes, including most of university hospitals and general hospitals. The first full dental PACS was installed at Wonkwang University Dental Hospital in 2002. Now ten out of eleven university dental hospitals implemented full dental PACS. The current status and technological factors of dental PACS in Korean university dental hospitals and the future perspectives of dental PACS are described.

  3. Korea's 1-watt plan ''Standby Korea 2010''

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Yungrae

    2010-09-15

    Korea announced standby power of all electronics shall be reduced to below 1W by 2010. Ministry of Knowledge Economy (MKE, Korean government) and Korea Energy Management Corporation (KEMCO) established ''Standby Korea 2010'' which is a roadmap to limit standby power below 1W by 2010. Korea implemented mandatory program over a relatively short period of time, incorporating the better elements from the more established national program and adding new initiatives, such as the threat of using mandatory warning label for products that fail to meet standby power targets.

  4. Detection of Warming Effects Due to Industrialization: An Accumulated Intervention Model with an Application in Pohang, Korea.

    Science.gov (United States)

    Ryoo, S. B.; Moon, S. E.

    1995-06-01

    Modifications of surface air temperature caused by anthropogenic impacts have received much attention recently because of the heightened interest in climatic change. When an industrial area is constructed, resulting in a large-scale anthropogenic heat source, is it possible to detect the warming effect of the heat source? In this paper, the intensity of warming is estimated in the area of the source. A statistical model is suggested to estimate the warming caused by that anthropogenic heat source. The model used in this study is an accumulated intervention (AI) model that is applied to industrial heat perturbations that occurred in the area. To evaluate the AI model performance, the forecast experiment was carried out with an independent dataset. The data used in this study are the monthly mean temperatures at Pohang, Korea. The AI model was developed based on the data for the 38-year period from 1953 to 1990, and the forecast experiment was carried out with an independent dataset for the 2-year period from 1991 to 1992.

  5. Another Engagement Strategy for North Korea

    National Research Council Canada - National Science Library

    Bailey, Marta J

    2003-01-01

    At the conclusion of the six-nation talks in Beijing last August, North Korea announced there was no reason for further negotiations and their only option was to continue their nuclear weapons development program...

  6. Maximum daily rainfall in South Korea

    Indian Academy of Sciences (India)

    and Dongseok Choi. 2. 1. School of Mathematics, University of Manchester, Manchester M60 1QD, UK. ... This paper provides the first application of extreme value distributions to rainfall data from South Korea. 1. ..... protection. This paper only ...

  7. AI AND SAR APPROACHES FOR PREDICTING CHEMICAL CARCINOGENICITY: SURVEY AND STATUS REPORT

    Science.gov (United States)

    A wide variety of artificial intelligence (AI) and structure-activity relationship (SAR approaches have been applied to tackling the general problem of predicting rodent chemical carcinogenicity. Given the diversity of chemical structures and mechanisms relative to this endpoin...

  8. So Sorry––Never Sorry. Ai Weiwei’s Art between Tradition and Modernity

    Directory of Open Access Journals (Sweden)

    Tania Becker

    2011-12-01

    Full Text Available Ai Weiwei’s 艾未未 (b. 1957 artistic expression revolves around his use of traditional Chinese techniques to create new designs and forms, shaping traditional materials into contemporary configurations. In the face of obstruction from state officials and local politicians, Ai Weiwei exposes himself to considerable personal risk in order to continue his activities as an artist and stay loyal to his convictions. This paper examines the roots of Ai Weiwei’s work in Chinese art history and looks at how the artist has deliberately adapted traditional motifs to bring about a sense of alienation. Ai Weiwei’s unique stance between current trends in western art and the Chinese feeling for handicrafts is also explored.

  9. Application of artificial intelligence (AI) methods for designing and analysis of reconfigurable cellular manufacturing system (RCMS)

    CSIR Research Space (South Africa)

    Xing, B

    2009-12-01

    Full Text Available This work focuses on the design and control of a novel hybrid manufacturing system: Reconfigurable Cellular Manufacturing System (RCMS) by using Artificial Intelligence (AI) approach. It is hybrid as it combines the advantages of Cellular...

  10. South Korea's Experience with International Capital Flows

    OpenAIRE

    Marcus Noland

    2005-01-01

    South Korea%u2019s experience is unparalleled in its combination of sustained prosperity, capital controls, and financial crisis. Over several decades, South Korea experienced rapid sustained growth in the presence of capital controls. These controls and the de-linking of domestic and international financial markets were an essential component of the country's state-led development strategy. As the country developed, opportunities for easy technological catch-up eroded, requiring more sophist...

  11. U.S.- South Korea Relations

    Science.gov (United States)

    2016-03-28

    in the future. Currency Issues Given its dependence on international trade , fluctuations in currency valuations can have significant impacts on...D. Nikitin Specialist in Nonproliferation Ian E. Rinehart Analyst in Asian Affairs Brock R. Williams Analyst in International Trade and Finance...posed by North Korea. Third, the two countries’ economies are closely entwined and are joined by the Korea-U.S. Free Trade Agreement (KORUS FTA

  12. Korea goes as low as reasonably achievable

    International Nuclear Information System (INIS)

    D'yukhi, Li.; Chun Vu Kha; Seon Kho Na; S'yu Khan.

    1995-01-01

    Consideration is given to problems of development of nuclear power industry in the South Korea, which has no experience in this field and trained personnel and is characterized by high density of population. Introduction of modern standards on nuclear safety in global and local scales, advisability of organizing the ALARA - center in Korea are based. This center will enable to adopt the ALARA principles in practice of management and infrastructure development, using the international experience of developed countries

  13. U.S.-South Korea Relations

    Science.gov (United States)

    2012-05-15

    After Realignment Plan Is Implemented................................................... 22 Tables Table 1. Annual U.S.-South Korea Merchandise ...In addition to their formal dinner, Obama and Lee had a private dinner at a local Korean restaurant and made a joint visit to a General Motors...U.S. trade. Table 1. Annual U.S.-South Korea Merchandise Trade, Selected Years (Billions of Nominal U.S. Dollars) Year U.S. Exports U.S. Imports

  14. North Korea: Economic Leverage and Policy Analysis

    Science.gov (United States)

    2010-01-22

    although non- governmental groups do run operations in the DPRK in activities such as goat dairy farming and transportation. North -South Korean...Finance Minister Says “At Least” 34m US Dollars Sent to North Korea. Financial Times Information, Global News Wire—Asia Africa Intelligence Wire. June 6...CRS Report for Congress Prepared for Members and Committees of Congress North Korea: Economic Leverage and Policy Analysis Dick K

  15. Energy policy of Republic of Korea

    International Nuclear Information System (INIS)

    Kim Bong-ki

    2006-01-01

    No other country in the world has so few resources of fossil sources of energy and depends on imports of power as the Republic of Korea. As a consequence of economical and political processes of globalization, new challenges are developed: elevated regional and global conflicts relating to resources as well as new possibilities of cooperation by means of amore intensely international division of labour. Under this aspect, the author of the contribution under consideration reports on the energy policy of the Republic of Korea. Especially, the author reports on the following aspects: (a) Characteristics of the power structure of the Republic of Korea; (b) National energy policy and measures for energy security; (c) Practical measures of energy security; (d) Regional co-operation for energy security from the view of the Republic of Korea. The Republic of Korea has a very weak energy structure and strongly depends on foreign countries. Among the successful measures of energy security, there exist measures for energy saving in industrial areas, diversification of sources of energy and exporting countries, increase of competitiveness of the energy economy due to restructuring and privatization of national companies as well as liberalisation of the energy market. Investments in the research of energy saving technologies and renewable energy such as solar energy, hydraulic power and fuel cells are trend-setting. The development of new sources of energy and the increase of the self-fund relating to petroleum, coal and natural gas are encouraging. The Republic of Korea is not attached at the international power net. Therefore, the Republic of Korea highly is susceptible according to energy crisis. The elevated dependence from other countries will exist furthermore. The Republic of Korea should expend its activities relating to foreign affairs and the large oil producers

  16. An Empirical Study of AI Population Dynamics with Million-agent Reinforcement Learning

    OpenAIRE

    Yang, Yaodong; Yu, Lantao; Bai, Yiwei; Wang, Jun; Zhang, Weinan; Wen, Ying; Yu, Yong

    2017-01-01

    In this paper, we conduct an empirical study on discovering the ordered collective dynamics obtained by a population of artificial intelligence (AI) agents. Our intention is to put AI agents into a simulated natural context, and then to understand their induced dynamics at the population level. In particular, we aim to verify if the principles developed in the real world could also be used in understanding an artificially-created intelligent population. To achieve this, we simulate a large-sc...

  17. PERFORMATIVITAS DALAM MANGA SHONEN-AI: SEKAIICHI HATSUKOI, HENSHIN DEKINAI DAN HIMANANODE HAJIMETE MIMASHITA

    OpenAIRE

    Savitri Paramita, Ni Made

    2014-01-01

    This research underlies the analysis on the performance and performativity of characters in shonen-ai: Sekaiichi Hatsukoi, Henshin Dekinai, and Himananode Hajimete Mimashita manga. Characterization in shonen-ai manga is based on the characters’ role within the same-sex relationship, which are the male role (seme) and the female role (uke). The character of Seme tends to be aggressive, protective, smart, good looking, and unemotional. On the other hand, Uke is feminine, smaller, physically wea...

  18. Beyond AI: Multi-Intelligence (MI) Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

    OpenAIRE

    Stephen Fox

    2017-01-01

    Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI) are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, t...

  19. Towards an unanimous international regulatory body for responsible use of Artificial Intelligence [UIRB-AI

    OpenAIRE

    Chidambaram, Rajesh

    2017-01-01

    Artificial Intelligence (AI), is once again in the phase of drastic advancements. Unarguably, the technology itself can revolutionize the way we live our everyday life. But the exponential growth of technology poses a daunting task for policy researchers and law makers in making amendments to the existing norms. In addition, not everyone in the society is studying the potential socio-economic intricacies and cultural drifts that AI can bring about. It is prudence to reflect from our historica...

  20. Do older t'ai chi practitioners have better attention and memory function?

    Science.gov (United States)

    Man, David W K; Tsang, William W N; Hui-Chan, Christina W Y

    2010-12-01

    Cognitive declines are common in older people and can be a major health issue in an aging world. One type of body-mind exercises, t'ai chi, can be a possible means to help maintaining older adults' cognitive abilities, in addition to beneficial effects of physical exercises. The purpose of this study was to investigate whether t'ai chi practitioners had better attention and memory functions than older people with or without regular exercises. A cross-sectional study examining the relationship between t'ai chi practice and age-, gender- and education-similar older peoples' attention and memory functions. Forty-two (42) community-dwelling elderly subjects, aged 60 or older, recruited from t'ai chi clubs in Hong Kong formed the t'ai chi group. Another 49 elderly having regular exercise habits were recruited from community centers for inclusion in the exercise group. A nonexercise group (normal healthy control) consisting of 44 subjects were also recruited by random selection and through contacting local elderly centers. They were also screened by the Modified Barthel Index, Chinese Mini-mental Status Examination, Geriatric Depression Scale, and evaluated by attention tests (Color Trail Form A-1 and 2) and memory tests (including Rivermead Behavioral Memory Test and The Hong Kong List Learning Test). The main finding was that the three groups differed in attention and memory functions, and the t'ai chi group had demonstrated better performance than the other two groups in most subtests. As a causal relationship cannot be assumed in the present cross-sectional study, future research is required to examine how t'ai chi can improve cognitive function using a randomized control trial as well as determining whether t'ai chi practice can lead to better health status among elderly people.

  1. Augmentation index (AI) in a dose–response relationship with smoking habits in males

    Science.gov (United States)

    Tsuru, Tomoko; Adachi, Hisashi; Enomoto, Mika; Fukami, Ako; Kumagai, Eita; Nakamura, Sachiko; Nohara, Yume; Kono, Shoko; Nakao, Erika; Sakaue, Akiko; Morikawa, Nagisa; Fukumoto, Yoshihiro

    2016-01-01

    Abstract We investigated the relationship between augmentation index (AI) and smoking habits in community-dwelling Japanese. This cross-sectional study enrolled 1926 subjects (769 males and 1157 females) aged 40 to 95 years who underwent a health check-up in a Japanese cohort of the Seven Countries Study, in Tanushimaru, a typical farming town in Kyushu Island in 2009. The subjects’ medical history, alcohol intake, smoking habit, and current medications for hypertension, dyslipidemia, and diabetes were ascertained by questionnaire. Radial arterial pressure wave analysis was used to obtain AI. We analyzed the data stratified by gender. Age-adjusted means of AI in males showed a clear dose–response relationship in 4 categories of smoking habits (P = 0.010). There was no significant relationship between AI and smoking habits in females (P = 0.127). The significant dose–response relationship (P = 0.036) in males between AI and 4 categories of smoking habits still remained even after adjustment for age, body mass index, systolic blood pressure, estimated glomerular filtration rate, glucose, hypertensive medication, and alcohol intake. The present study demonstrated that AI values were significantly associated with smoking habits in a dose-dependent manner in Japanese males. PMID:28002323

  2. Dry eyes and AIs: If you don't ask you won't find out.

    Science.gov (United States)

    Inglis, Holly; Boyle, Frances M; Friedlander, Michael L; Watson, Stephanie L

    2015-12-01

    Our objective was to investigate the hypothesis that women on adjuvant aromatase inhibitors (AIs) for treatment of breast cancer have a higher prevalence of dry eye syndrome (DES) compared with controls. Exposure and control groups were recruited. A cross sectional questionnaire-based study was performed. Demographic data and medical histories were collected. The presence of dry eye syndrome was determined by the ocular surface disease index (OSDI). The Functional Assessment of Cancer Treatment - Endocrine Subscale (FACT-ES) was performed to investigate correlations with other side effects of AIs. 93 exposure group and 100 control group questionnaires were included. The groups were similar in all demographic variables. The prevalence of dry eye syndrome was 35% (exposure) and 18% (control) (p dry eyes. The OSDI score was negatively correlated with the total FACT-ES score and positively correlated with duration of treatment. Our study is the first to use a validated questionnaire to assess for DES in this population. DES is significantly more prevalent in women on AIs compared with controls. This is a newly emerging, and easily treated side effect of AIs. Self-reporting of dry eye symptoms underestimates the prevalence of DES with AIs. We recommend routine screening of patients on AIs with the OSDI with the aim of improving patient quality of life and possibly adherence. Copyright © 2015 Elsevier Ltd. All rights reserved.

  3. Combining AI Methods for Learning Bots in a Real-Time Strategy Game

    Directory of Open Access Journals (Sweden)

    Robin Baumgarten

    2009-01-01

    Full Text Available We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generate a new plan using a method based on decision tree learning. In addition, we have implemented more sophisticated control over low-level actions that enable the AI-bot to synchronize bombing runs, and used a simulated annealing approach for assigning bombing targets to planes and opponent cities to missiles. We describe how our AI-bot operates, and the experimentation we have performed in order to determine an optimal configuration for it. With this configuration, our AI-bot beats Introversion's finite state machine automated player in 76.7% of 150 matches played. We briefly introduce the notion of ability versus enjoyability and discuss initial results of a survey we conducted with human players.

  4. Development and Validation of the Alcohol Identity Implicit Associations Test (AI-IAT)

    Science.gov (United States)

    Gray, Heather M.; LaPlante, Debi A.; Bannon, Brittany L.; Ambady, Nalini; Shaffer, Howard J.

    2011-01-01

    Alcohol identity is the extent to which an individual perceives drinking alcohol to be a defining characteristic of his or her self-identity. Although alcohol identity might play an important role in risky college drinking practices, there is currently no easily administered, implicit measure of this concept. Therefore we developed a computerized implicit measure of alcohol identity (the Alcohol Identity Implicit Associations Test; AI-IAT) and assessed its reliability and predictive validity in relation to risky college drinking practices. One hundred forty-one college students completed the AI-IAT. Again 3- and 6-months later, we administered the AI-IAT and indices of engagement in risky college drinking practices. A subset of participants also completed the previously-validated implicit measure of alcohol identity. Scores on the AI-IAT were stable over time, internally consistent, and positively correlated with the previously-validated measure of alcohol identity. Baseline AI-IAT scores predicted future engagement in risky college drinking practices, even after controlling for standard alcohol consumption measures. We conclude that the AI-IAT reliably measures alcohol identity, a concept that appears to play an important role in risky college drinking practices. PMID:21621924

  5. Substituted Benzamides Containing Azaspiro Rings as Upregulators of Apolipoprotein A-I Transcription

    Directory of Open Access Journals (Sweden)

    Bin Hong

    2012-06-01

    Full Text Available Apolipoprotein A-I (Apo A-I is the principal protein component of high density lipoprotein (HDL, which is generally considered as a potential therapeutic target against atherosclerosis. The understanding of the Apo A-I regulation mechanism has fuelled the development of novel HDL targeted therapeutic approaches. To identify novel agents that can upregulate Apo A-I expression, we performed a cell-based reporter assay to screen 25,600 small molecules. Based on the dataset obtained from screening, a series of novel analogs of substituted benzamides containing azaspiro rings were assessed for their ability to induce the transcription of the Apo A-I gene, and the structure-activity relationship (SAR around these analogs was also proposed. The results indicated that the trifluoromethyl substituted benzamide containing an azaspiro ring is a promising backbone for designing Apo A-I transcriptional upregulator and could be viable leads for development of new drugs to prevent and treat atherosclerosis in the future.

  6. The Development of Astronomy in Korea and the Emergence of Astrophysics in South Korea

    Science.gov (United States)

    Nha, Il-Seong; L. Nha, Sarah; Orchiston, Wayne

    There are two books and one review paper that have been written about the history of astronomy in Korea. Chronologically, they are the review paper "Astronomy in Korea" (Rufus, Transactions of the Korea Branch of the Royal Asiatic Society, XXVI, 1-69, 1936), and the books The Hall of Heavenly Records, Korean Astronomical Instruments and Clocks 1380-1780 (Needham et al., Cambridge University Press, Cambridge, 1986a) and History of Astronomy in Korea (Nha, Seoul National University Press, Seoul, 2000). In order to overview the emergence and development of modern astronomy and astrophysics in South Korea, much of the present chapter is based on these three references, along with various papers published by the present authors and other astronomers.

  7. Research reactor's role in Korea

    International Nuclear Information System (INIS)

    Choi, C-O.

    1995-01-01

    After a TRIGA MARK-II was constructed in 1962, new research activity of a general nature, utilizing neutrons, prevailed in Korea. Radioisotopes produced from the MARK-II played a good role in the 1960's in educating people as to what could be achieved by a neutron source. Because the research reactor had implanted neutron science in the country, another TRIGA MARK-III had to be constructed within 10 years after importing the first reactor, due to increased neutron demand from the nuclear community. With the sudden growth of nuclear power, however, the emphasis of research changed. For a while research activities were almost all oriented to nuclear power plant technology. However, the specifics of nuclear power plant technology created a need for a more highly capable research reactor like HANARO 30MWt. HANARO will perform well with irradiation testing and other nuclear programs in the future, including: production of key radioisotopes, doping of silicon by transmutation, neutron activation analysis, neutron beam experiments, cold neutron source. 3 tabs., 2 figs

  8. The Diabetes Epidemic in Korea

    Directory of Open Access Journals (Sweden)

    Junghyun Noh

    2016-09-01

    Full Text Available Diabetes is one of the foremost public health issues worldwide that can lead to complications in many organ systems, and has become a significant cause of morbidity and mortality in Korea. According to data from the National Health Insurance Service (NHIS, about 2.7 million Koreans (8.0% aged 30 years or older had type 2 diabetes mellitus (T2DM in 2013. The prevalence of T2DM increased with age and rose from 5.6% in 2006 to 8.0% in 2013. Using data based on The Health Screening Service of the NHIS, 25% of Korean adults were reported to have prediabetes in 2013. The prevalence of an impaired fasting glucose tended to increase over time from 21.5% in 2006 to 25.0% in 2013. Even though nationwide health screening has been regularly conducted as a public service, the proportion of undiagnosed cases of diabetes was still reported to be on the higher side in the latest study. Based on the results of these epidemic studies, further actions will be needed to effectively implement lifestyle changes on a social level and increase measures for the early detection of diabetes to stem the tide of the epidemic.

  9. Do adolescent idiopathic scoliosis (AIS neglect proprioceptive information in sensory integration of postural control?

    Directory of Open Access Journals (Sweden)

    Christine Assaiante

    Full Text Available INTRODUCTION: It has been reported that AIS rely much more on ankle proprioception to control the amplitude of the balance control commands as compared to age-matched healthy adolescents. Our hypothesis was that AIS do not neglect proprioceptive information to control posture probably because of their vestibular deficits. We investigated the proprioceptive contribution to postural control in AIS which expresses spinal deformity during a crucial transitional period of ontogenesis. METHODS: 10 adolescents with idiopathic scoliosis (AIS with moderate spinal deformity (10° 35° and 10 control adolescents (CA had to maintain vertical stance while very slow oscillations in the frontal plane (below the detection threshold of the semicircular canal system were applied to the support with the eyes open and closed. Postural orientation and segmental stabilisation were analysed at head, shoulder, trunk and pelvis levels. RESULTS: Scoliosis did not affect vertical orientation control and segmental stabilization strategies. Vision improves postural control in both CA and AIS, which seem more dependent on visual cues than adults. CONCLUSIONS: AIS as CA were unable to control efficiently their postural orientation on the basis of the proprioceptive cues, the only sensory information available in the EC situation, whereas in the same condition healthy young adults present no difficulty to achieve the postural control. This suggests that AIS as CA transitory neglect proprioceptive information to control their posture. These results and previous studies suggest the existence of different afferent pathways for proprioceptive information subserving different parts in sensory integration of postural control. We conclude that the static proprioceptive system is not affected by the idiopathic scoliosis, while the dynamic proprioceptive system would be mainly affected.

  10. Seismic noise level variation in South Korea

    Science.gov (United States)

    Sheen, D.; Shin, J.

    2008-12-01

    The variations of seismic background noise in South Korea have been investigated by means of power spectral analysis. The Korea Institute of Geoscience and Mineral Resources (KIGAM) and the Korea Meteorological Administation (KMA) have national wide seismic networks in South Korea, and, in the end of 2007, there are 30 broadband stations which have been operating for more than a year. In this study, we have estimated the power spectral density of seismic noise for 30 broadband stations from 2005 to 2007. Since we estimate PSDs from a large dataset of continuous waveform in this study, a robust PSD estimate of McNamara and Buland (2004) is used. In the frequency range 1-5 Hz, the diurnal variations of noise are observed at most of stations, which are especially larger at coastal stations and at insular than at inland. Some stations shows daily difference of diurnal variations, which represents that cultural activities contribute to the noise level of a station. The variation of number of triggered stations, however, shows that cultural noise has little influence on the detection capability of seismic network in South Korea. Seasonal variations are observed well in the range 0.1-0.5 Hz, while much less found in the frequency range 1-5 Hz. We observed that strong peaks in the range 0.1-0.5 Hz occur at the summer when Pacific typhoons are close to the Korean Peninsula.

  11. CERN welcomes Korea as an official collaborator

    CERN Multimedia

    2006-01-01

    His Excellency Mr. Won-Hwa Park, Ambassador of the Republic of Korea to Switzerland, with CERN's Director-General at the signature ceremony to mark Korea as an official collaborator. On 25 October, the Ambassador of the Republic of Korea to Switzerland, His Excellency Mr Won-Hwa Park, visited CERN. He came to sign, together with the Director-General Dr Robert Aymar, a formal Cooperation Agreement between CERN and the Government of the Republic of Korea, witnessed by Dr Joo-Han Kim of the Korean Ministry of Science and Technology. With this agreement that covers the development of scientific and technical cooperation in high-energy physics, Korea's participation in the experimental physics programme of CERN has now been formalised. Two days earlier, Dr Myung-Bak Lee, the former Mayor of Seoul, paid a visit to CERN, accompanied by ten members of his staff and fifteen Korean journalists. CERN was one of the destinations in Europe (together with GSI in Germany) on Dr Lee's agenda to gain information and to estab...

  12. Põhja-Korea leppe hinnaks on energia / Triin Oppi

    Index Scriptorium Estoniae

    Oppi, Triin

    2007-01-01

    Põhja-Korea andis lubaduse seisata 60 päeva jooksul oma olulisim tuumareaktor ja avada taas uksed rahvusvahelistele inspektoritele, kui saab vastutasuks rasket kütteõli. Lisa: Pyongyuang saab vastutasuks. Kaart: Põhja-Korea tuumarajatised

  13. The United States and the Koreas - Adding Substance to Sunshine

    National Research Council Canada - National Science Library

    Hendricks, Robert H

    2003-01-01

    .... These include the development in South Korea of strong democratic institutions, a vibrant economy, and a professional military, juxtaposed to North Korea, variously described as a failing or failed...

  14. Misguided U.S. Food Policy Toward North Korea

    National Research Council Canada - National Science Library

    Bubia, Donald

    1999-01-01

    In 1995, the United Nations' World Food Program published an urgent plea for nations to donate food and medicines to relieve a complex food emergency in the Democratic Peoples Republic of Korea (DPRK or North Korea...

  15. AI Reloaded: Objectives, Potentials, and Challenges of the Novel Field of Brain-Like Artificial Intelligence

    Directory of Open Access Journals (Sweden)

    Rosemarie Velik

    2012-11-01

    Full Text Available The general objective of Artificial Intelligence (AI is to make machines – particularly computers – do things that require intelligence when done by humans. In the last 60 years, AI has significantly progressed and today forms an important part of industry and technology. However, despite the many successes, fundamental questions concerning the creation of human-level intelligence in machines still remain open and will probably not be answerable when continuing on the current, mainly mathematic-algorithmically-guided path of AI. With the novel discipline of
    Brain-Like Artificial Intelligence, one potential way out of this dilemma has been suggested. Brain-Like AI aims at analyzing and deciphering the working mechanisms of the brain and translating this knowledge into implementable AI architectures with the objective to develop in this way more efficient, flexible, and capable technical systems This article aims at giving a review about this young and still heterogeneous and dynamic research field.

  16. Thiophenone Attenuates Enteropathogenic Escherichia coli O103:H2 Virulence by Interfering with AI-2 Signaling.

    Science.gov (United States)

    Witsø, Ingun Lund; Valen Rukke, Håkon; Benneche, Tore; Aamdal Scheie, Anne

    2016-01-01

    Interference with bacterial quorum sensing communication provides an anti-virulence strategy to control pathogenic bacteria. Here, using the Enteropathogenic E. coli (EPEC) O103:H2, we showed for the first time that thiophenone TF101 reduced expression of lsrB; the gene encoding the AI-2 receptor. Combined results of transcriptional and phenotypic analyses suggested that TF101 interfere with AI-2 signalling, possibly by competing with AI-2 for binding to LsrB. This is supported by in silico docking prediction of thiophenone TF101 in the LsrB pocket. Transcriptional analyses furthermore showed that thiophenone TF101 interfered with expression of the virulence genes eae and fimH. In addition, TF101 reduced AI-2 induced E. coli adhesion to colorectal adenocarcinoma cells. TF101, on the other hand, did not affect epinephrine or norepinephrine enhanced E. coli adhesion. Overall, our results showed that thiophenone TF101 interfered with virulence expression in E. coli O103:H2, suggestedly by interfering with AI-2 mediated quorum sensing. We thus conclude that thiophenone TF101 might represent a promising future anti-virulence agent in the fight against pathogenic E. coli.

  17. A regulator's viewpoint on the use of AI in the nuclear industry

    International Nuclear Information System (INIS)

    Wainwright, N.

    1995-01-01

    The regulatory position within the UK places the responsibility for safety on a nuclear site with the licensee. The licensee must produce a safety case that demonstrates that the plant is safe. Assessment of this safety case is performed by the regulator in the Health and Safety Executive (HSE) using HSE's published Safety Assessment Principles. This paper presents the personal views of a regulator on the use of artificial intelligence (AI) in the nuclear industry. The AI-based system considered are restricted to expert systems, neural networks and fuzzy logic. Some of the safety issues are discussed. The particular concerns associated with software-based systems are compounded by some of the inherent problems of AI-based systems. Such is the nature of these concerns that an acceptable safety case will be difficult to mount for safety systems and post-accident monitoring systems. However, given the present maturity of the technology, acceptable safety cases might be formulated in the areas of operator advisory systems designed to reduce accident frequencies, and robotics where dose reduction is important. There are also arguments that suggests that suitable safety cases could be formulated for AI-based plant control systems. Nevertheless, AI-based systems should be treated with caution - further research is required into suitable designs and safety demonstration techniques. (author)

  18. Emerging trends in geospatial artificial intelligence (geoAI): potential applications for environmental epidemiology.

    Science.gov (United States)

    VoPham, Trang; Hart, Jaime E; Laden, Francine; Chiang, Yao-Yi

    2018-04-17

    Geospatial artificial intelligence (geoAI) is an emerging scientific discipline that combines innovations in spatial science, artificial intelligence methods in machine learning (e.g., deep learning), data mining, and high-performance computing to extract knowledge from spatial big data. In environmental epidemiology, exposure modeling is a commonly used approach to conduct exposure assessment to determine the distribution of exposures in study populations. geoAI technologies provide important advantages for exposure modeling in environmental epidemiology, including the ability to incorporate large amounts of big spatial and temporal data in a variety of formats; computational efficiency; flexibility in algorithms and workflows to accommodate relevant characteristics of spatial (environmental) processes including spatial nonstationarity; and scalability to model other environmental exposures across different geographic areas. The objectives of this commentary are to provide an overview of key concepts surrounding the evolving and interdisciplinary field of geoAI including spatial data science, machine learning, deep learning, and data mining; recent geoAI applications in research; and potential future directions for geoAI in environmental epidemiology.

  19. A study on the applications of AI in finishing of additive manufacturing parts

    Science.gov (United States)

    Fathima Patham, K.

    2017-06-01

    Artificial intelligent and computer simulation are the technological powerful tools for solving complex problems in the manufacturing industries. Additive Manufacturing is one of the powerful manufacturing techniques that provide design flexibilities to the products. The products with complex shapes are directly manufactured without the need of any machining and tooling using Additive Manufacturing. However, the main drawback of the components produced using the Additive Manufacturing processes is the quality of the surfaces. This study aims to minimize the defects caused during Additive Manufacturing with the aid of Artificial Intelligence. The developed AI system has three layers, each layer is trying to eliminate or minimize the production errors. The first layer of the AI system optimizes the digitization of the 3D CAD model of the product and hence reduces the stair case errors. The second layer of the AI system optimizes the 3D printing machine parameters in order to eliminate the warping effect. The third layer of AI system helps to choose the surface finishing technique suitable for the printed component based on the Degree of Complexity of the product and the material. The efficiency of the developed AI system was examined on the functional parts such as gears.

  20. Republic of Korea. Country feature.

    Science.gov (United States)

    Cho, N H

    1985-03-01

    The Government of Korea's 5th 5-Year Economic and Social Development Plan (1982-86) seeks to reduce the population growth rate from its 1982 level of 1.58% to 1.49% by 1986; it is assumed that the population replacement level of fertility (total fertility rate, 2.1) will be attained in 1988. The task of achieving these demographic targets is expected to be made more difficult by factors such as the impact of the 1950s baby boom and widespread son preference. New population control policy measures announced in 1981 call for improvements in the current family planning program management system; a new social and institutional support system to inculcate the small family size norm; strengthened information, education, and communication activities for family planning; and establishment of coordination among the government organizations involved in population-related activities. Numerous social support measures have already been put into effect, including income tax exemptions for up to 2 children, inclusion of population education in the school curriculum, priority in alloting public housing to sterilization acceptors with 2 or fewer children, and provision of IUD services through the medical insurance system. The number of contraceptive acceptors in the government program increased 78.3% from 1981-83, from 614,000 to 1,094,600. Sterilization and menstrual regulation services have shown particularly sharp increases. Program achievement for 1983 was equivalent to 19% of eligible women ages 15-44 years. The total fertility rate stood at 2.7 in 1982. Major efforts now must be directed toward eradicating the strong parental son preference and ensuring better family planning program efficiency and effectiveness.

  1. Study on Chinese Impact on Economic Sanctions against North Korea

    OpenAIRE

    Oh, Jinhwan; Ryu, Jiyong

    2011-01-01

    As the U.S. and South Korea expressed solidarity in blaming North Korea for its attack on the South Korean warship Cheonan and in imposing further sanctions on North Korea, global attention is now focused on China with regard to whether it will cooperate in inflicting punitive measures on its ally. Despite the worsening cleavages between China and North Korea since October 2006 when the latter tested its nuclear weapons, this study shows that their relations has remained robust in the economi...

  2. [Feminism in nursing science in Korea].

    Science.gov (United States)

    Yi, Myungsun

    2005-08-01

    Although feminism has been actively discussed and applied to nursing in Western societies since the 1980s, it is little known among Korean scholars as well as Korean nurses. This article explores the use of feminist perspectives in nursing science in other developed countries and suggests how feminism could be applied to nursing science in Korea. The literature related to nursing and feminism were reviewed in terms of nursing practice, education, and research. This article describes what feminism is and how feminism and nursing have evolved historically over time in other countries, especially in Western societies. In addition, it discusses how it can be applied to nursing practice, education, and research in Korea. Accepting feminist perspective in Korean nursing could benefit in empowering nurses by valuing nursing, by raising self-esteem of nurses, and by raising the consciousness of socio-political realities. Eventually it could benefit in changing and developing nursing science in Korea.

  3. Natural gas demand prospects in Korea

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Young-Jin [Korea Electric Power Corp. (KEPCO), Seoul (Korea, Republic of)

    1997-06-01

    Korea s natural gas demand has increase enormously since 1986. Natural gas demand in Korea will approach to 29 million tonnes by the year 2010, from little over 9 million tonnes in 1996. This rapid expansion of natural gas demand is largely due to regulations for environmental protection by the government as well as consumers preference to natural gas over other sources of energy. Especially industrial use of gas will expand faster than other use of gas, although it will not be as high as that in European and North America countries. To meet the enormous increase in demand, Korean government and Korea Gas Corporation (KOGAS) are undertaking expansion of capacities of natural gas supply facilities, and are seeking diversification of import sources, including participation in major gas projects, to secure the import sources on more reliable grounds. (Author). 5 tabs.

  4. Offshore Wind Power Planning in Korea

    DEFF Research Database (Denmark)

    Seo, Chul Soo; Cha, Seung-Tae; Park, Sang Ho

    2012-01-01

    this possible, Korea has announced the National offshore power roadmap and is now in pursuit. However, large scale offshore wind farms can incur many problems, such as power quality problems, when connecting to a power system.[1][2] Thus, KEPCO is on the process of a research study to evaluate the effects...... that connecting offshore wind power generation to a power system has on the power system. This paper looks over offshore wind power planning in Korea and describes the development of impact assessment technology of offshore wind farms.......Wind power generation is globally recognized as the most universal and reliable form of renewable energy. Korea is currently depending mostly on coal and petroleum to generate electrical power and is now trying to replace them with renewable energy such as offshore wind power generation. To make...

  5. Natural gas demand prospects in Korea

    International Nuclear Information System (INIS)

    Young-Jin Kwon

    1997-01-01

    Korea s natural gas demand has increase enormously since 1986. Natural gas demand in Korea will approach to 29 million tonnes by the year 2010, from little over 9 million tonnes in 1996. This rapid expansion of natural gas demand is largely due to regulations for environmental protection by the government as well as consumers preference to natural gas over other sources of energy. Especially industrial use of gas will expand faster than other use of gas, although it will not be as high as that in European and North America countries. To meet the enormous increase in demand, Korean government and Korea Gas Corporation (KOGAS) are undertaking expansion of capacities of natural gas supply facilities, and are seeking diversification of import sources, including participation in major gas projects, to secure the import sources on more reliable grounds. (Author). 5 tabs

  6. ITER delegation visits the Republic of Korea

    International Nuclear Information System (INIS)

    Aymar, R.

    2003-01-01

    Following the expression of interest of the Republic of Korea in joining the ITER Negotiations, a technical delegation from the ITER International Team and the Participant Teams visited the country on 14-16 April 2003. The goal was to assess, through visits to laboratories and some relevant industries, the capability of the Republic of Korea to contribute 'in kind' to ITER construction. There is presently in the Republic of Korea a strong interest at Government and industry levels in supporting fusion research within the framework of the long term development of alternative energy supplies. The large investment in the Korean Superconducting Tokamak (KSTAR), a very ambitious project from a previously very limited programme, is a concrete demonstration of this interest and the expression of interest to participate in ITER follows the same line

  7. Looking Ahead to COP21: What Korea has done and what Korea should do

    International Nuclear Information System (INIS)

    Chung, Suh-Yong

    2015-06-01

    Korea is the world's 14. largest economy but the eighth largest emitter of CO_2 as of 2013, due largely to an energy-intensive industry structure. Although it has continuously reduced its dependency on petroleum since it introduced the Energy Master Plan in 2008, the relative portion of non-fossil fuel sources, such as renewable energy, is still marginal at best (representing less than 10 percent of the total energy portfolio). In particular, it is difficult for Korea to increase the portion of renewables for various reasons. In this context, Korea has tried to find an adequate role in fighting against climate change. (author)

  8. 15 CFR 742.19 - Anti-terrorism: North Korea.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Anti-terrorism: North Korea. 742.19...-CCL BASED CONTROLS § 742.19 Anti-terrorism: North Korea. (a) License Requirements. (1) All items on... anti-terrorism reasons require a license for export or reexport to North Korea. This includes all items...

  9. Korea: Balancing Economic Growth and Social Protection for Older Adults

    Science.gov (United States)

    Yoon, Hyun-Sook

    2013-01-01

    Population aging in Korea is projected to be the most rapid among Organisation for Economic Co-operation and Development (OECD) countries between 2000 and 2050. However, social spending in Korea remains low, reflecting Korea's relatively young population, limited health and long-term care insurance coverage, and immaturity of its pension system.…

  10. Community Currency in Korea : How do we envision Community Currency?

    NARCIS (Netherlands)

    J. Kang (Joonmo); B.E. Hong (Baeg)

    2015-01-01

    textabstractCommunity currency schemes were first introduced in Korea in 1998. Since then, there have been many efforts to use them but no report or academic research on the topic in Korea. Thus, we conducted a field investigation to identify the scope of community currency schemes in Korea and as

  11. 78 FR 32356 - United States-Korea Free Trade Agreement

    Science.gov (United States)

    2013-05-30

    ...-Korea Free Trade Agreement AGENCIES: U.S. Customs and Border Protection, Department of Homeland Security... treatment and other customs-related provisions of the United States-Korea Free Trade Agreement entered into...-Korea Free Trade Agreement (hereinafter ``UKFTA'' or the ``Agreement''). On December 3, 2010, the United...

  12. P and T research program in Korea

    International Nuclear Information System (INIS)

    Park, C. K.

    1997-01-01

    The national energy demand is taking a sharp rise on account of the rapid growth of economy in Korea. Unfortunately, Korea has not much choice of alternative energy a promising option for Korea. For instance, eleven nuclear plants are in operation and 7 plants are under construction. Several plants are in planning stage. KAERI has played a major role in the design and operation of the plants in Korea. The spent fuel issue is calling for acute attention nationwide as the number of plants increases. Korea is actively seeking a technical solution to that problem surfacing on the horizon. A preliminary conceptual study on the P and T technology was performed from 1992 to 1996 and the future research directions were derived from that study. Because of the situation Korea is facing with, one of the major technical guidelines is that the P and T technology should be developed in compliance with the NPT. The concept of an accelerator driven subcritical system was found to be the most favorable option according to the conceptual study. KAERI set up an ambitious accelerator driven system development program for next 10 years. Key elementary technologies for a high current accelerator and a subcritical system are scheduled to be developed and experimented for the first five years (1997-2001). For the second five years (2002-2006), the accelerator program is pushed for the completion to parameters of 1 GeV, 20mA with capability to drive a subcritical system. For the subcritical system, a detail design study is to be performed and a small mockup system is to be built for bench scale test purpose

  13. AI based HealthCare Platform for Real Time, Predictive and Prescriptive Analytics using Reactive Programming

    Science.gov (United States)

    Kaur, Jagreet; Singh Mann, Kulwinder, Dr.

    2018-01-01

    AI in Healthcare needed to bring real, actionable insights and Individualized insights in real time for patients and Doctors to support treatment decisions., We need a Patient Centred Platform for integrating EHR Data, Patient Data, Prescriptions, Monitoring, Clinical research and Data. This paper proposes a generic architecture for enabling AI based healthcare analytics Platform by using open sources Technologies Apache beam, Apache Flink Apache Spark, Apache NiFi, Kafka, Tachyon, Gluster FS, NoSQL- Elasticsearch, Cassandra. This paper will show the importance of applying AI based predictive and prescriptive analytics techniques in Health sector. The system will be able to extract useful knowledge that helps in decision making and medical monitoring in real-time through an intelligent process analysis and big data processing.

  14. Molecular characterization of AI viruses from poultry and wild bird surveillance in Denmark

    DEFF Research Database (Denmark)

    Larsen, Lars Erik; Krog, Jesper Schak; Madsen, Jesper J.

    Infection with avian influenza virus (AIV) in poultry may cause devastating disease although the same virus may not cause disease in wild birds. Since AI viruses can be exchanged between poultry and wild birds, surveillance in wild birds provides important knowledge for control of disease...... in poultry. AIV’s from the Danish wild bird active surveillance were characterized, focusing on viruses from 2012, and from outbreaks of AI in poultry in Denmark. The matrix (M) gene from more than 50 viruses of different subtypes and the hemagglutinin (HA) gene from more than 30 subtype H5 low pathogenic...... viruses were sequenced and compared by alignment and phylogenetic analyses. The aim was to evaluate: the origin of viruses from outbreaks of AI in Danish poultry, the design of active surveillance in Denmark, and the suitability of the molecular diagnostic RT-PCR tests employed. All M-genes from Danish...

  15. An AI-based layout design system for nuclear power plants

    International Nuclear Information System (INIS)

    Fujita, Kikuo; Akagi, Shinsuke; Nakatogawa, Tetsundo; Tanaka, Kazuo; Takeuchi, Makoto.

    1991-01-01

    An AI-based layout design system for nuclear power plants has been developed. The design of the layout of nuclear power plants is a time-consuming task requiring expertise, in which a lot of machinery and equipment must be arranged in a plant building considering various kinds of design constraints, i.e. spatial, functional, economical etc. Computer aided layout design systems have been widely expected and the application of AI technology is expected as a promising approach for the synthesis phase of this task. In this paper, we present an approach to the layout design of nuclear power plants based on a constraint-directed search; one of the AI techniques. In addition, we show how it was implemented with an object-oriented programming technique and give an example of its application. (author)

  16. Past, present and prospect of an Artificial Intelligence (AI) based model for sediment transport prediction

    Science.gov (United States)

    Afan, Haitham Abdulmohsin; El-shafie, Ahmed; Mohtar, Wan Hanna Melini Wan; Yaseen, Zaher Mundher

    2016-10-01

    An accurate model for sediment prediction is a priority for all hydrological researchers. Many conventional methods have shown an inability to achieve an accurate prediction of suspended sediment. These methods are unable to understand the behaviour of sediment transport in rivers due to the complexity, noise, non-stationarity, and dynamism of the sediment pattern. In the past two decades, Artificial Intelligence (AI) and computational approaches have become a remarkable tool for developing an accurate model. These approaches are considered a powerful tool for solving any non-linear model, as they can deal easily with a large number of data and sophisticated models. This paper is a review of all AI approaches that have been applied in sediment modelling. The current research focuses on the development of AI application in sediment transport. In addition, the review identifies major challenges and opportunities for prospective research. Throughout the literature, complementary models superior to classical modelling.

  17. AIS as key component in modern vessel traffic management and information systems

    Energy Technology Data Exchange (ETDEWEB)

    Lamers, W. [DaimlerChrysler Aerospace AG (DASA), Ulm (Germany)

    1999-07-01

    The objective of this paper is to provide information in respect to universal shipborne identification system (UAIS) as main sensor in various vessel traffic applications. The presented paper will give general information concerning AIS functionality and the standardisation process. Based on experience from recent projects and various IALA working group activities, a typical future VTMIS architectures is also presented being based on AIS as key sensor. The required key performance of AIS associated with the HW components will be described. The results from European technology study Indris are presented and discussed. Finally, a summary and conclusion from the presented material will complete the technical paper. The elaboration of this presentation has been carried out as a joint task between Mr. Andre van Berg, MDS Suedafrika und Mr. Walter Lamers, DASA Ulm. (orig.)

  18. Identification of AI-2 Quorum Sensing Inhibitors in Vibrio harveyi Through Structure-Based Virtual Screening.

    Science.gov (United States)

    Jiang, Tianyu; Zhu, Peng; Du, Lupei; Li, Minyong

    2018-01-01

    Quorum sensing (QS) is a cell-to-cell communication system that regulates gene expression as a result of the production and perception of signal molecules called autoinducers (AIs). AI-2 is a QS autoinducer produced by both Gram-negative and Gram-positive bacteria, in which it regulates intraspecies and interspecies communication. The identification of QS inhibitors is considered a promising strategy for the development of anti-virulence drugs with reduced selective pressure for resistance. Here we describe a high-throughput virtual screening approach to identify AI-2 quorum sensing inhibitors on the basis of Vibrio harveyi LuxPQ crystal structure. Seven potent inhibitors with IC 50 values in the micromolar range were selected with no effect or low effect on V. harveyi growth rate.

  19. AI-2 signalling is induced by acidic shock in probiotic strains of Lactobacillus spp

    DEFF Research Database (Denmark)

    Moslehi Jenabian, Saloomeh; Gori, Klaus; Jespersen, Lene

    2009-01-01

    Survival and ability to respond to various environmental stresses such as low pH are important factors for lactobacilli for their function as probiotics. LuxS-mediated quorum sensing mechanism, which is based on the production of universal signal molecule called autoinducer-2 (AI-2), regulates...... important physiological traits and a variety of adaptive processes in different bacteria. The aim of this study was to investigate the effect of acidic stress on LuxS-mediated quorum sensing (AI-2 signalling) in four probiotic strains of different Lactobacillus species. Initially, the production of AI-2...... concomitant with the reduction of pH, reaching maximum at late exponential phase (L. rhamnosus GG) or at stationary phase (L. salivarius UCC118, L. acidophilus NCFM and L. johnsonii NCC533). Acidic shock experiments were conducted on L. rhamnosus GG and L. acidophilus NCFM after exposure to different acidic...

  20. Nuclear power in the South Korea

    International Nuclear Information System (INIS)

    Molodtsov, S.D.

    1988-01-01

    Data on the state of nuclear power in the South Korea are presented. In the end of 1987 7 power units with 5380 MW total power were in operation in the South Korea. The share of NPP capacity was equal to 26% of the total electric power plant capacity of the country. The cost of NPP power production was equal to 2.2 cent (kw.h). The total established NPP capacity should achieve 7.3 GW by 1990, and exceed 9 GW by 2000

  1. Twenty years of Korea radioisotope association history

    International Nuclear Information System (INIS)

    2005-09-01

    This contents has two parts. The first part describes the present and post of Korea radioisotope association which are about the foundation of the association, organization, main projects and vision of the association. The second part is about the use and the prospect of radiation and radioisotope in Korea, which shows the plan of expansion of use of radiation and radioisotope, the prospect and present condition in fields such as medical, industry and farming, product and distribution, research and development of human resources, system and management of safety of radiation.

  2. Integration of AI-2 Based Cell-Cell Signaling with Metabolic Cues in Escherichia coli.

    Directory of Open Access Journals (Sweden)

    Arindam Mitra

    Full Text Available The quorum sensing molecule Autoinducer-2 (AI-2 is generated as a byproduct of activated methyl cycle by the action of LuxS in Escherichia coli. AI-2 is synthesized, released and later internalized in a cell-density dependent manner. Here, by mutational analysis of the genes, uvrY and csrA, we describe a regulatory circuit of accumulation and uptake of AI-2. We constructed a single-copy chromosomal luxS-lacZ fusion in a luxS + merodiploid strain and evaluated its relative expression in uvrY and csrA mutants. At the entry of stationary phase, the expression of the fusion and AI-2 accumulation was positively regulated by uvrY and negatively regulated by csrA respectively. A deletion of csrA altered message stability of the luxS transcript and CsrA protein exhibited weak binding to 5' luxS regulatory region. DNA protein interaction and chromatin immunoprecipitation analysis confirmed direct interaction of UvrY with the luxS promoter. Additionally, reduced expression of the fusion in hfq deletion mutant suggested involvement of small RNA interactions in luxS regulation. In contrast, the expression of lsrA operon involved in AI-2 uptake, is negatively regulated by uvrY and positively by csrA in a cell-density dependent manner. The dual role of csrA in AI-2 synthesis and uptake suggested a regulatory crosstalk of cell signaling with carbon regulation in Escherichia coli. We found that the cAMP-CRP mediated catabolite repression of luxS expression was uvrY dependent. This study suggests that luxS expression is complex and regulated at the level of transcription and translation. The multifactorial regulation supports the notion that cell-cell communication requires interaction and integration of multiple metabolic signals.

  3. Synthesized and characterization of AI and Gd substitute ferrite for microwave

    International Nuclear Information System (INIS)

    Sudjono, Hans K.; Muljadi; Soepriyanto, Syony

    2000-01-01

    Ferrite for microwave components has been synthesized from garnet ceramics (YIG)substituted by AI and Gd. Magnetic permeability and magnetic polarization changes according to the AI 3+ ion addition. XRD is performed to determined the sintering products at various temperatures. For some samples the magnetic property and performance in microwave region was tested. The testing is conducted in the form of completely assembled circulator which gives data on isolation, insertion loss when microwave circuit analyzer was employed. Due to high level of porosity insertion lost is still to large, improved process is necessary

  4. An Energy Dense-AI-NaBH4-PEMFC Based Power Generator for Unmanned Undersea Vehicles

    Science.gov (United States)

    2016-03-01

    From- To) 03/01/2016 Final 01/28/2013-12/31/2015 4. TITLE AND SUBTITLE Sa. CONTRACT NUMBER An Energy-Dense AI-NaBH4- PEMFC Based Power Generator for...combination of polymer electrolyte membrane fuel cell ( PEMFC ) with a compact hydrogen generator util izing AI-NaBH4 composite fuel. The conditions...ANSI Std. Z39.18 FLORIDA SOLAR ENERGY CENTER. Crl’nrmg EnPrgy lnrll’pendrnr£’ An Energy-Dense Al-NaBH4- PEMFC Based Power Generator for Unmanned

  5. AIS radiometry and the problem of contamination from mixed spectral orders

    Science.gov (United States)

    Conel, J. E.; Adams, S.; Alley, R. E.; Hoover, G.; Schultz, S.

    1988-01-01

    The spectral radiance of test areas under solar illumination is ascertained in view of Airborne Imaging Spectrometer (AIS) data from Mono Lake, CA, establishing an atmospheric correction method for major absorbers on the basis of the spectrometric data themselves. The apparent low contrast of all atmospheric absorption bands leads to a study of contamination from overlapping spectral orders in the AIS data; this contamination is found unambiguously above 1500 nm with a magnitude that is a factor of 1.5-2.0 greater than the expected uncontaminated signal alone.

  6. Effects of herd origin, AI stud and sire identification on genetic evaluation of Holstein Friesian bulls

    OpenAIRE

    Giovanni Bittante; Paolo Carnier; Luigi Gallo Gallo; Riccardo Dal Zotto; Martino Cassandro

    2010-01-01

    The purpose of this study was to estimate the effects of herd origin of bull, AI stud and sire identification number (ID)  on official estimated breeding values (EBV) for production traits of Holstein Friesian proven bulls. The data included 1,005  Italian Holstein-Friesian bulls, sons of 76 sires, born in 100 herds and progeny tested by 10 AI studs. Bulls were required  to have date of first proof between September 1992 and September 1997, to be born in a herd with at least on...

  7. Adolescent's sexual problems in Korea.

    Science.gov (United States)

    Kang, B S

    1990-07-01

    This article discusses primary contributors of sexual problems among Korean adolescents. As a result of improved nutrition, physical maturity is occurring at an earlier age in Korean youths. On the other hand, marital age has increased; the average age for males to marry is 27.3 years and 24.1 years in females. Hence, these factors extend the time frame between onset of sexual maturity and marriage. Enrollment in schools has risen; middle school registration has increased from 74.2% in 1975 to 99.7% in 1985 and from 43.6% to 78.3% in high schools. Increased enrollment has also been observed at the university level which may promote prolonged educational periods; this focus on education may reduce sexual interest among students. Improved employment opportunities may also influence sexual behavior among adolescents; urban migration can encourage casual relationships. Changes in family structure and sexual morals has promoted liberal attitudes regarding sexual practices. Increased exposure to mass media has affected adolescent sexual problems; 99.1% of the households in 1985 possessed televisions. These sexual problems include onset of sexual intercourse at an earlier age, unwanted pregnancies, increased induced abortions, and early childbirth. Overall, sexual activity in females has risen from 3.6% in 1965 to 14.5% in 1981 and from 18.5% in 1971 for males to 27.7% in 1981. Pre-marital pregnancy rates have continually increased since 1950; this has resulted in a rise of unwed mothers' consultations which reflects adolescent childbirths. Sex-related crime have also increased; rape ranks 3rd in crimes committed by Korean youth. Sex education and family planning should be provided for adolescents. Furthermore, counseling services should be available to youth regarding unwanted pregnancies, sexually transmitted diseases, and contraception. The Planned Parenthood Federation of Korea provides youth sex telephone services in which adolescents can acquire information on

  8. Financial structure of Korea Gas Corporation's LNG projects

    International Nuclear Information System (INIS)

    Jeongsoo Ko

    1991-01-01

    When an Indonesian LNG tanker arrived in Korea for the first time in October 1986, Korea became the seventh LNG-consuming nation in the world. The imported LNG has contributed greatly to solving pollution problems and ensuring a stable supply of energy to Korea through the diversification of energy sources. So far, the LNG supply has been confined to the Metropolitan area. The Korea Gas Corporation now plans to expand the LNG supply to cover the entire nation. This paper introduces the experience and future plan of Korea's LNG projects with a special reference to their financial structure

  9. A centennial book of Korea electric power corporation

    International Nuclear Information System (INIS)

    1989-12-01

    This book gives description of KEPC with power and life such as lighting, electric power, electric heat and communication, introduction of electric civilization, establishment and manage of Hansung electric company on opening of electric train, regulation of the train, opening of lamp business, construction of Yongsan generator, the Japanese invasion with trouble of supplying electricity, control over power business and development of water power generation, division of Korea and Korea war on damage out of Korea war and rebuild, development and growth on establishment of Korea electric power, establishment of Korea electric power by private and water power development project, stability and development, and challenge for future.

  10. Kingipaanika, ai, ai, ai! / Mari Rebane

    Index Scriptorium Estoniae

    Rebane, Mari

    2003-01-01

    Jõulukingituseks sobilike raamatute ja heliplaatide tutvustus. Heliplaadid: Urmas Alender "Kohtumine Albertiga", Tõnu Tepandi "Kõlakoda", Pet Shop Boys "Pop Art", Erasure "Very Best Of", Depeche Mode "101", Kylie Minogue "Body Language", Korn "Take a Look in the Mirror", "Once Upon a time in Mexico"

  11. Comparison on using nuclear energy between South Korea and North Korea

    International Nuclear Information System (INIS)

    Lee, Chang Geon; Kim, Nam Ha; Byeon, Jong Dal

    1988-01-01

    This book is useful to compare glossary of science and technique in nuclear energy between South Korea and North Korea. The term on this book are in alphabetical order. This book arranges the term involving nuclear energy which are using in university, research institute and industry. The technical term are in the textbook and magazine and real life. This book features comparison of term and combination between two nations.

  12. Examining professional emergency managers in Korea

    International Nuclear Information System (INIS)

    Ha, Kyoo-Man

    2017-01-01

    Although the number of emergency managers has risen in South Korea (hereafter referred to as Korea) over the years, their role is not yet as defined and noteworthy compared to other professions because of its unidisciplinary approach. This article investigates how Korea has to improve emergency managers' disciplinary approach to ultimately contribute to the goal of effective transnational disaster management. This study uses qualitative content analysis of government policies, college curricula, nongovernmental organizations' (NGOs') emergency-manager certification, and mass media coverage to compare emergency managers' unidisciplinary and multidisciplinary approaches. The key tenet is that Korea must change its emergency managers' unidisciplinary approach into a multidisciplinary approach because the former is less effective when dealing with complicated disaster management systems. To achieve this change, the stakeholders must carry out their assigned responsibilities under risk-oriented management. As for the study's international implications, developing nations may consider the enhancement of related educational curricula, collaborative learning, continuous evaluation, disaster awareness, and disaster prevention for the emergency managers' multidisciplinary approach.

  13. First International Earth Science Olympiad South Korea

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 12; Issue 12. First International Earth Science Olympiad - South Korea. Information and Announcements Volume 12 Issue 12 December 2007 pp 76-76. Fulltext. Click here to view fulltext PDF. Permanent link:

  14. Recent progress in food irradiation in Korea

    International Nuclear Information System (INIS)

    Joong-ho Kwon

    1988-01-01

    This paper discusses progress in research into food irradiation and government approval of the process in Korea. The development of the first cobalt-60 food irradiator is described and the role of international, trade and consumer associations in its commercialization discussed. (U.K.)

  15. Crisis and Employment: The Case of Korea

    Science.gov (United States)

    Cho, Dongchul; Shin, Sukha

    2012-01-01

    This paper examines Korea's employment dynamics and analyzes how adverse impacts could be mitigated during the recent economic crisis in comparison with the 1997 to 1998 Asian crisis. A clear lesson is that policies to mitigate adverse impacts of financial crisis on the macroeconomic level should be given priority for preserving employment. In…

  16. Science and Higher Education in Korea.

    Science.gov (United States)

    Lee, Sungho

    The role and contribution of academic science to national development in the Republic of Korea is discussed. After an overview on the development of the Korean system of higher education, attention is directed to the national research system and its articulation with the academic system. Consideration is given to: factors that contributed to the…

  17. English Textbooks in Japan and Korea

    Science.gov (United States)

    Yuasa, Katsura

    2010-01-01

    English education in Japan and Korea are similar in some respects. Although both countries are not completely but mostly monolingual societies, where citizens do not need English in their daily life, they have begun to realize the importance of English as a tool for international communication, and as a result their English education is becoming…

  18. The Quality of Life in South Korea

    Science.gov (United States)

    Park, Chong-Min

    2009-01-01

    The AsiaBarometer survey of 1,023 respondents shows Life in Korea is highly modernized and digitalized without being much globalized. Despite the modernization and digitalization of their lifestyles, ordinary citizens still prioritize materialistic values more than post-materialistic values, and they remain least satisfied in the material life…

  19. North Korea: Economic Leverage and Policy Analysis

    Science.gov (United States)

    2009-06-04

    human rights is a prominent issue in negotiations between the United States and North Korea, and for other purposes. • H.Res. 309 (Peter King ...the opinion of a North Korean expert at Seoul’s Sejong Institute, “North Korea’s economy had received a death sentence long ago, but it keeps afloat

  20. Examining professional emergency managers in Korea

    Energy Technology Data Exchange (ETDEWEB)

    Ha, Kyoo-Man, E-mail: ha1999@hotmail.com

    2017-01-15

    Although the number of emergency managers has risen in South Korea (hereafter referred to as Korea) over the years, their role is not yet as defined and noteworthy compared to other professions because of its unidisciplinary approach. This article investigates how Korea has to improve emergency managers' disciplinary approach to ultimately contribute to the goal of effective transnational disaster management. This study uses qualitative content analysis of government policies, college curricula, nongovernmental organizations' (NGOs') emergency-manager certification, and mass media coverage to compare emergency managers' unidisciplinary and multidisciplinary approaches. The key tenet is that Korea must change its emergency managers' unidisciplinary approach into a multidisciplinary approach because the former is less effective when dealing with complicated disaster management systems. To achieve this change, the stakeholders must carry out their assigned responsibilities under risk-oriented management. As for the study's international implications, developing nations may consider the enhancement of related educational curricula, collaborative learning, continuous evaluation, disaster awareness, and disaster prevention for the emergency managers' multidisciplinary approach.

  1. Teaching Elementary School Children about Korea.

    Science.gov (United States)

    Van Decar, Patricia

    1988-01-01

    Presents ideas for teaching elementary school students about Korea by introducing them to the country's folktales, clothing, art, music, and food. Includes a folktale adapted as a play and suggestions for teaching about traditional costumes, folk dances, music, and masks, as well as Korean mealtime and table manners. (GEA)

  2. 75 FR 67912 - North Korea Sanctions Regulations

    Science.gov (United States)

    2010-11-04

    ... of UNSCRs 1718 and 1874, including the procurement of luxury goods; and its illicit and deceptive... reexported luxury goods to or into North Korea; (D) To have, directly or indirectly, engaged in money... transactions. 510.202 Effect of transfers violating the provisions of this part. 510.203 Holding of funds in...

  3. [Adaptation experiences in South Korea of men defecting from North Korea].

    Science.gov (United States)

    Kim, Kyoung Mi; Kim, Miyoung

    2013-06-01

    The study was done to explore meanings and essence of the experience in South Korea of men defectors from North Korea. Data were collected from March, 2011 to May, 2012, through in-depth interviews with ten men defectors. Data analysis was conducted using the process of hermeneutic phenomenological reflection. Eight essential themes were extracted; 'buoyant expectation for a new life', 'feeling guilty about family left behind in North Korea', 'inability to become acclimatized due to communication difficulties', 'inability to socialize with South Koreans due to different lifestyles', 'finding strength through trustworthy acquaintances', 'continuing reconciliation with oneself while trying to assimilate into South Korean culture', 'self-realization of one's original self', and 'continuing to feel out the possibility of a future in South Korea'. The findings indicate that North Korean men who defect to South Korea shape their identity through three phases: forming self-image during escape from North Korea, trying to become accustomed to South Korean society, and finding their own identity by self-realization of their original self. Eventually, the whole process enables them to recover their identity, to feel a sense of belonging, and to discover possibilities for a better future.

  4. Feasibility study of EEW application in Korea

    Science.gov (United States)

    Chi, H.; Park, J.; Sheen, D.

    2008-12-01

    At present, it seems almost impossible to predict where and how much strong a earthquake will happen within very limited time such as two or three days before it occurs. However, the advantage of modern electronic techniques can support us very fast communication tools around nation-wide area so that we can receive P- waves arrival information from seismic stations through communication lines before S-waves strike our living site. This is the key of EEW(Earthquake Early Warning) concept that is under development around world especially including Japan, United State of America, and Taiwan. In this pilot study we proposed the direction for developing Korean Earthquake Early Warning System. Considering the state of the art techniques used in Japan, USA and Taiwan, ElarmS would be more adaptable to Korea since ElarmS can work from the low limit of moderate earthquakes around magnitude 3.5, which would annually happen in Korea. We investigate empirical magnitude scaling relationship for South Korea using 27 events ranging in magnitude from 2.2 to 4.9 recorded by the Korea Institute of Geoscience And Mineral Resources (KIGAM) and the Korea Meteorological Administration (KMA) for 2007. We measure the maximum predominant period and the peak displacement or velocity amplitude from the first 4 seconds of P wave arrivals to derive period-magnitude and amplitude-magnitude scaling relationship, respectively. For the period-magnitude relationship, we find that 10 Hz low-pass filter yields better estimate than 3 Hz. This is because the magnitudes of most events used in this study are too small (<3.0). It is also shown that peak displacement for velocity instruments and peak velocity for accelerometers have their own magnitude scaling relationships, respectively. Thus, for the amplitude-magnitude relationship, like the relationships in northern California, two individual amplitude scaling relationships would be necessary.

  5. Progress of Nuclear Hydrogen Program in Korea

    International Nuclear Information System (INIS)

    Lee, Won Jae

    2009-01-01

    To cope with dwindling fossil fuels and climate change, it is clear that a clean alternative energy that can replace fossil fuels is required. Hydrogen is considered a promising future energy solution because it is clean, abundant and storable and has a high energy density. As other advanced countries, the Korean government had established a long-term vision for transition to the hydrogen economy in 2005. One of the major challenges in establishing a hydrogen economy is how to produce massive quantities of hydrogen in a clean, safe and economical way. Among various hydrogen production methods, the massive, safe and economic production of hydrogen by water splitting using a very high temperature gas-cooled reactor (VHTR) can provide a success path to the hydrogen economy. Particularly in Korea, where usable land is limited, the nuclear production of hydrogen is deemed a practical solution due to its high energy density. To meet the expected demand for hydrogen, the Korea Atomic Energy Institute (KAERI) launched a nuclear hydrogen program in 2004 together with Korea Institute of Energy Research (KIER) and Korea Institute of Science and Technology (KIST). Then, the nuclear hydrogen key technologies development program was launched in 2006, which aims at the development and validation of key and challenging technologies required for the realization of the nuclear hydrogen production demonstration system. In 2008, Korean Atomic Energy Commission officially approved a long-term development plan of the nuclear hydrogen system technologies as in the figure below and now the nuclear hydrogen program became the national agenda. This presentation introduces the current status of nuclear hydrogen projects in Korea and the progress of the nuclear hydrogen key technologies development. Perspectives of nuclear process heat applications are also addressed

  6. Pathologies of AI: Responsible use of artificial intelligence in professional work

    NARCIS (Netherlands)

    Stamper, R.K.

    1988-01-01

    Although the AI paradigm is useful for building knowledge-based systems for the applied natural sciences, there are dangers when it is extended into the domains of business, law and other social systems. It is misleading to treat knowledge as a commodity that can be separated from the context in

  7. ReACT!: An Interactive Educational Tool for AI Planning for Robotics

    Science.gov (United States)

    Dogmus, Zeynep; Erdem, Esra; Patogulu, Volkan

    2015-01-01

    This paper presents ReAct!, an interactive educational tool for artificial intelligence (AI) planning for robotics. ReAct! enables students to describe robots' actions and change in dynamic domains without first having to know about the syntactic and semantic details of the underlying formalism, and to solve planning problems using…

  8. Grammaire progressive du français niveau intermédiaire

    CERN Document Server

    Grégoire, Maïa

    2017-01-01

    Quatrième édition de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de Grammaire: une organisation claire : la leçon de grammaire sur la page de gauche; les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues un apprentissage progressif : il suit la progression naturelle des méthodes de français un usage souple : pour la classe ou en auto-apprentissage une préparation adaptée aux certifications : un entreînement efficace pour mieux réussir aux examens NOUVEAU! Appli-web de la Grammaire progressive du français incluse Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales : près de 300 exercices interactifs avec dialogues, instructions, exemples et corrigés ora...

  9. Grammaire progressive du français corrigés : niveau intermédiaire

    CERN Document Server

    Thiévenaz, Odile

    2017-01-01

    Quatrième édition des corrigés de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de grammaire: Une organisation claire : la leçon de grammaire sur la page de gauche, les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues Un apprentissage progressif : il suit la progression naturelle des méthodes de français Un usage souple : pour la classe ou en auto-apprentissage Une préparation adaptée aux certifications : un entraînement efficace pour mieux réussir aux examens NOUVEAU!​ Appli-Web de la Grammaire progressive du français Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales: près de 300 exercices interactifs avec dialogues, instructions, exemples et corri...

  10. Using Ontological Engineering to Overcome AI-ED Problems: Contribution, Impact and Perspectives

    Science.gov (United States)

    Mizoguchi, Riichiro; Bourdeau, Jacqueline

    2016-01-01

    This article reflects on the ontology engineering methodology discussed by the paper entitled "Using Ontological Engineering to Overcome AI-ED Problems" published in this journal in 2000. We discuss the achievements obtained in the last 10 years, the impact of our work as well as recent trends and perspectives in ontology engineering for…

  11. Fragments of a Forgotten Aiōn. An Outline of a Gnostic Myth

    Directory of Open Access Journals (Sweden)

    Ezio Albrile

    2005-07-01

    Full Text Available Gnostics regard the cosmos as the result of an «error» or of a hybris begotten in the transcendent world. Reality is perceived as a great dream intentionally moulded by the Demiurge in order to forget the Light concealed in the creations. By consequence, the power of the Demiurge consists precisely in being the creator and keeper of a level of existence limited in space and time. Gnostic imagination plastically depicts the homicide and ignorant Demiurge with the features of an abnormous creature with the head of a lion and wings, enveloped in the coils of a snake. Thus, Gnostics reinterpreted a key figure in the syncretic pantheon of late Hellenism, i. e. Aiōn, the god of endless eternity, the Saeculum, the Iranic  Zurwān, the Jewish ‘Olām. This means that Aiōn involved contacts with two different visions: the Aiōnes are the creations that populate the gnostic plērōma, immortal and eternal entities, and outside the plērōma the demiurgic Aiōn arises as the result of a divine «fault», a monstrous being whose somatic features can be found in the Orphic and Mithriac iconography.

  12. Automated calculations for massive fermion production with ai-bar Talc

    International Nuclear Information System (INIS)

    Lorca, A.; Riemann, T.

    2004-01-01

    The package ai-bar Talc has been developed for the automated calculation of radiative corrections to two-fermion production at e + e - colliders. The package uses Diana, Qgraf, Form, Fortran, FF, LoopTools, and further unix/linux tools. Numerical results are presented for e + e - -> e + e - , μ + μ - , bs-bar , tc-bar

  13. Quality Control of Boar Sperm Processing : Implications from European AI Centres and Two Spermatology Reference Laboratories

    NARCIS (Netherlands)

    Riesenbeck, A; Schulze, M; Rüdiger, K; Henning, H; Waberski, D

    In recent years, increased automatization has resulted in a higher efficiency of boar semen processing in AI laboratories. Sophisticated laboratory management and efficient quality control programmes are needed for current tendencies in major pork-producing countries to reduce the sperm number per

  14. The (Dis)appearance of Ai Weiwei: Translations and (In)visibilities

    DEFF Research Database (Denmark)

    Glud, Louise Nørgaard; Stenbøg, Anne Sofie Christensen; Albrechtslund, Anders

    This paper offers a study of surveillance themes relating to Ai Weiwei’s highly discussed disappearance and later reappearance in 2011. Our study is based on an Actor-Network Theory (ANT) approach and we focus on the manifold negotiations and (in)visibilities relating to the dramatic events as well...... as Ai’s artwork and life....

  15. A Comparative Evaluation of Procedural Level Generators in the Mario AI Framework

    DEFF Research Database (Denmark)

    Horn, Britton; Dahlskog, Steve; Shaker, Noor

    dierent from another in terms of its output. To remedy this, we have conducted a large-scale comparative evaluation of level generators for the Mario AI Benchmark, a research-friendly clone of the classic platform game Super Mario Bros. In all, we compare the output of seven dierent level generators from...

  16. Vessel classification features using spatial Bayesian inference from historical AIS data

    CSIR Research Space (South Africa)

    Meyer, Rory GV

    2017-07-01

    Full Text Available Detections and classification of non-AIS-compliant vessels is an important ability for countries or institutions interested in MDA. SAR has been proven to be an effective method but there exists a trade-off between the area that can be imaged...

  17. Trimerization of apolipoprotein A-I retards plasma clearance and preserves antiatherosclerotic properties

    DEFF Research Database (Denmark)

    Graversen, Jonas Heilskov; Laurberg, Jacob Marsvin; Andersen, Mikkel Holmen

    2008-01-01

    An increased plasma level of the major high-density lipoprotein (HDL) component, apolipoprotein A-I (apoA-I) is the aim of several therapeutic strategies for combating atherosclerotic disease. HDL therapy by direct intravenous administration of apoA-I is a plausible way; however, a fast renal...

  18. The (Dis)appearance of Ai Weiwei: Translations and (In)visibilities

    DEFF Research Database (Denmark)

    Stenbøg, Sofie; Nørgaard Glud, Louise; Albrechtslund, Anders

    2013-01-01

    This paper offers a study of surveillance themes relating to Ai Weiwei’s highly discussed disappearance and later reappearance in 2011. Our study is based on an Actor-Network Theory (ANT) approach and we focus on the manifold negotiations and (in)visibilities relating to the dramatic events as well...... as Ai’s artwork and life....

  19. Prediction of shipboard electromagnetic interference (EMI) problems using artificial intelligence (AI) technology

    Science.gov (United States)

    Swanson, David J.

    1990-08-01

    The electromagnetic interference prediction problem is characteristically ill-defined and complicated. Severe EMI problems are prevalent throughout the U.S. Navy, causing both expected and unexpected impacts on the operational performance of electronic combat systems onboard ships. This paper focuses on applying artificial intelligence (AI) technology to the prediction of ship related electromagnetic interference (EMI) problems.

  20. Secondhand Tobacco Smoke Exposure and Lung Adenocarcinoma In Situ/Minimally Invasive Adenocarcinoma (AIS/MIA).

    Science.gov (United States)

    Kim, Claire H; Lee, Yuan-Chin Amy; Hung, Rayjean J; Boffetta, Paolo; Xie, Dong; Wampfler, Jason A; Cote, Michele L; Chang, Shen-Chih; Ugolini, Donatella; Neri, Monica; Le Marchand, Loic; Schwartz, Ann G; Morgenstern, Hal; Christiani, David C; Yang, Ping; Zhang, Zuo-Feng

    2015-12-01

    The aim of this study was to estimate the effect of exposure to secondhand tobacco smoke on the incidence of lung adenocarcinoma in situ/minimally invasive adenocarcinoma (AIS/MIA). Data from seven case-control studies participating in the International Lung Cancer Consortium (ILCCO) were pooled, resulting in 625 cases of AIS/MIA and 7,403 controls, of whom 170 cases and 3,035 controls were never smokers. Unconditional logistic regression was used to estimate adjusted ORs (ORadj) and 95% confidence intervals (CI), controlling for age, sex, race, smoking status (ever/never), and pack-years of smoking. Study center was included in the models as a random-effects intercept term. Ever versus never exposure to secondhand tobacco smoke was positively associated with AIS/MIA incidence in all subjects (ORadj = 1.48; 95% CI, 1.14-1.93) and in never smokers (ORadj = 1.45; 95% CI, 1.00-2.12). There was, however, appreciable heterogeneity of ORadj across studies (P = 0.01), and the pooled estimates were largely influenced by one large study (40% of all cases and 30% of all controls). These findings provide weak evidence for an effect of secondhand tobacco smoke exposure on AIS/MIA incidence. Further studies are needed to assess the impact of secondhand tobacco smoke exposure using the newly recommended classification of subtypes of lung adenocarcinoma. ©2015 American Association for Cancer Research.

  1. Cognitive Maps, AI Agents and Personalized Virtual Environments in Internet Learning Experiences.

    Science.gov (United States)

    Maule, R. William

    1998-01-01

    Develops frameworks to help Internet media designers address end-user information presentation preferences by advancing structures for assessing metadata design variables which are then linked to user cognitive styles. An underlying theme is that artificial intelligence (AI) methodologies may be used to help automate the Internet media design…

  2. LE RACCOMANDAZIONI SERVONO? MORAL SUASION SULLA GEO-LOCALIZZAZIONE PER SERVIZI AI CITTADINI

    Directory of Open Access Journals (Sweden)

    Mauro Salvemini

    2014-12-01

    Full Text Available Con modestia, ma con determinazione AMFM GIS Italia ha inteso esercitare la suafunzione di entità non governativa elaborando nell'anno in corso nove raccomandazioni circa LA GEO-LOCALIZZAZIONE COME ELEMENTO UNIFICANTE DELLE AZIONI E DELLE INFORMAZIONI PER I SERVIZI AI CITTADINI.

  3. Autonomously generating operations sequences for a Mars Rover using AI-based planning

    Science.gov (United States)

    Sherwood, Rob; Mishkin, Andrew; Estlin, Tara; Chien, Steve; Backes, Paul; Cooper, Brian; Maxwell, Scott; Rabideau, Gregg

    2001-01-01

    This paper discusses a proof-of-concept prototype for ground-based automatic generation of validated rover command sequences from highlevel science and engineering activities. This prototype is based on ASPEN, the Automated Scheduling and Planning Environment. This Artificial Intelligence (AI) based planning and scheduling system will automatically generate a command sequence that will execute within resource constraints and satisfy flight rules.

  4. Campus 3 méthode de français

    CERN Document Server

    Pécheur, Jacques; Molinié, Muriel

    2003-01-01

    Méthode de français pour grands adolescents et adultes sur 3 niveaux. Ce niveau comprend : un livre de l'élève, un cahier d'exercices, un livre du professeur, une vidéo, des cassettes audio collectives au CD, et pour l'élève : une cassette audio individuelle ou CD.

  5. NASA space station automation: AI-based technology review. Executive summary

    Science.gov (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Cheeseman, P. C.; Goldberg, J.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

    1985-01-01

    Research and Development projects in automation technology for the Space Station are described. Artificial Intelligence (AI) based technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics.

  6. 142 Perspective Actionelle Visa-a-Vis L'enseignement du Français ...

    African Journals Online (AJOL)

    NGOZI

    29 avr. 2010 ... Français Langue Entrangele au Nigeria : Problem et. Vision. Scholastica .... La langue est conçue comme un instrument de communication et ... langue est un outil fournissant une base commune pour l'enseignement et ...

  7. Studies on Anti-Hepatoma Effect of Gan-Ai-Xiao Decoction | Yuan ...

    African Journals Online (AJOL)

    Purpose: To explore the anti-hepatoma effect of Gan-Ai-Xiao Decoction (GAXD), a folk remedy. Methods: High performance liquid chromatography (HPLC) was used to identify the major chemical components of GAXD ethanol extract (EE). The cytotoxic effect of GAXD EE against HepG2 cells was measured by methyl ...

  8. Lexique Pove–Français/Français– Pove, Mickala Manfoumbi ...

    African Journals Online (AJOL)

    rbr

    Français/Français–. Pove (Mickala Manfoumbi 2004) fait par Mavoungou (2005). En dehors des réserves sur les ques- tions purement lexicographiques, l'ouvrage de Mickala Manfoumbi suscite des interrogations inté- ressantes qui dépassent le ...

  9. Vers l'integration des textes dans le programme du fran9ais langue ...

    African Journals Online (AJOL)

    Au Malawi, on enseigne le fran9ais en tant que langue etrangere depuis une quarantaine d'annees .... !'organisation institutionnelle du systeme educatif du Malawi, le palier secondaire en ... Les objectifs du type : rediger une lettre, decrire une .... nouveau (rheme). Charolles souligne qu'il s'agit d'une performance delicate.

  10. The Simulation of a Major Automated Information System (AIS) on a Microcomputer

    Science.gov (United States)

    1984-03-01

    The AIS would be selected from a public zec cor application. Rationale for this choice are: a. Many public sector organizations have a far richer...19. Boehm, Barry W. and others, Characteristics of Software Quality, North-Holland, 1978. 20. Freeman, Peter and Wasserman, Anthony I., Tutorial on

  11. AI-2 signalling is induced by acidic shock in probiotic strains of Lactobacillus spp.

    Science.gov (United States)

    Moslehi-Jenabian, Saloomeh; Gori, Klaus; Jespersen, Lene

    2009-11-15

    Survival and ability to respond to various environmental stresses such as low pH are important factors for lactobacilli for their function as probiotics. LuxS-mediated quorum sensing mechanism, which is based on the production of universal signal molecule called autoinducer-2 (AI-2), regulates important physiological traits and a variety of adaptive processes in different bacteria. The aim of this study was to investigate the effect of acidic stress on LuxS-mediated quorum sensing (AI-2 signalling) in four probiotic strains of different Lactobacillus species. Initially, the production of AI-2-like molecule was investigated in four strains of Lactobacillus spp. at standard growth conditions using Vibrio harveyi bioluminescence assay. Species variation in AI-2 activity was observed. AI-2 activity started at early-exponential growth phase and increased during the mid-exponential phase concomitant with the reduction of pH, reaching maximum at late exponential phase (L. rhamnosus GG) or at stationary phase (L. salivarius UCC118, L. acidophilus NCFM and L. johnsonii NCC533). Acidic shock experiments were conducted on L. rhamnosus GG and L. acidophilus NCFM after exposure to different acidic shocks (pH 5.0, 4.0 and 3.0) and to pH 6.5 as control, measuring AI-2 activity and transcription of the luxS gene. AI-2 activity increased by lowering the pH in a dose dependent manner and was negatively influenced by acid adaptation. In both species, the luxS gene was repressed after exposure to pH 6.5 as control. However, after acidic shock (pH 4.0) a transient response of luxS gene was observed and the transcription augmented over time, reaching a maximum level and decreased subsequently. Acid adaptation of cells attenuated the transcription of this gene. Based on the observations done in the present study, the luxS gene appears to have a clear role in acidic stress response in probiotic lactobacilli. This might be important in the survival of these bacteria during the passage

  12. Appreciative Inquiry and Autonomy-Supportive Classes in Business Education: A Semilongitudinal Study of AI in the Classroom

    Science.gov (United States)

    Conklin, Thomas A.; Hartman, Nathan S.

    2014-01-01

    In this article, we describe 10 separate classroom experiences where an appreciative inquiry (AI) exercise was used for course creation. Post-exercise surveys of students showed that the AI exercise was perceived to be a successful practice. Students indicated putting effort toward reaching their peak learning experience and were satisfied with…

  13. English Learners (ELs) Who Are American Indian and/or Alaska Native (AI/AN). Fast Facts

    Science.gov (United States)

    Office of English Language Acquisition, US Department of Education, 2016

    2016-01-01

    The Office of English Language Acquisition (OELA) has synthesized key data on English learners (ELs) into two-page PDF sheets, by topic, with graphics, plus key contacts. The topics for this report on English Learners (ELs) Who Are American Indian and/or Alaska Native (AI/AN) include: (1) States With the Highest Percentage of ELs Who Were AI/AN:…

  14. Purification and Characterization of BmooAi: A New Toxin from Bothrops moojeni Snake Venom That Inhibits Platelet Aggregation

    Directory of Open Access Journals (Sweden)

    Mayara Ribeiro de Queiroz

    2014-01-01

    Full Text Available In this paper, we describe the purification/characterization of BmooAi, a new toxin from Bothrops moojeni that inhibits platelet aggregation. The purification of BmooAi was carried out through three chromatographic steps (ion-exchange on a DEAE-Sephacel column, molecular exclusion on a Sephadex G-75 column, and reverse-phase HPLC chromatography on a C2/C18 column. BmooAi was homogeneous by SDS-PAGE and shown to be a single-chain protein of 15,000 Da. BmooAi was analysed by MALDI-TOF Spectrometry and revealed two major components with molecular masses 7824.4 and 7409.2 as well as a trace of protein with a molecular mass of 15,237.4 Da. Sequencing of BmooAi by Edman degradation showed two amino acid sequences: IRDFDPLTNAPENTA and ETEEGAEEGTQ, which revealed no homology to any known toxin from snake venom. BmooAi showed a rather specific inhibitory effect on platelet aggregation induced by collagen, adenosine diphosphate, or epinephrine in human platelet-rich plasma in a dose-dependent manner, whereas it had little or no effect on platelet aggregation induced by ristocetin. The effect on platelet aggregation induced by BmooAi remained active even when heated to 100°C. BmooAi could be of medical interest as a new tool for the development of novel therapeutic agents for the prevention and treatment of thrombotic disorders.

  15. AI-2 does not function as a quorum sensing molecule in Campylobacter jejuni during exponential growth in vitro

    NARCIS (Netherlands)

    Holmes, K.; Tavender, T.J.; Winzer, K.; Wells, J.; Hardie, K.

    2009-01-01

    Background - Campylobacter jejuni contains a homologue of the luxS gene shown to be responsible for the production of the signalling molecule autoinducer-2 (AI-2) in Vibrio harveyi and Vibrio cholerae. The aim of this study was to determine whether AI-2 acted as a diffusible quorum sensing signal

  16. Download and multiply sharing robot minds and bodies over the Web could take AI to the next level

    CERN Multimedia

    Graham-Rowe, D

    2002-01-01

    Some AI researchers believe progress is being held back because the problems are too great for any individual group to solve alone. They have suggested that instead of just publishing results in journals, AI software and robots should be made available across the Internet and accessible even to complete novices (1 page).

  17. Rétrospective de la diffusion du français en Espagne

    Directory of Open Access Journals (Sweden)

    Isabelle Cros

    2014-12-01

    Full Text Available Le français bénéficia longtemps en Espagne d’une vieille tradition francophile et de la forte implantation de l’Alliance française. Ainsi, il prédomina dans le système éducatif espagnol jusqu’au milieu du 20ème siècle sans intervention de l’État français pour en assurer la diffusion. Son déclin, amorcé sous Franco, nécessita toutefois la mise en place d’une politique linguistique et éducative compensatoire qui aboutit à un premier accord bilatéral favorisant surtout le développement de l’enseignement en français au sein du réseau de la Mission laïque mais qui eut peu d’effets à l’école espagnole où le français fut relégué au rang de deuxième langue étrangère. Cependant, suite à son adhésion à l’Europe, l’Espagne a recréé, en partenariat avec la France, une dynamique pour le français, notamment grâce aux sections bilingues qui connaissent un succès croissant. La langue française, considérée à présent davantage comme une langue utile, de communication et de travail, est enseignée suivant une méthodologie communicative plus adaptée aux réalités socio-économiques.

  18. Ship Emission Inventories in Estuary of the Yangtze River Using Terrestrial AIS Data

    Directory of Open Access Journals (Sweden)

    Xin Yao

    2016-12-01

    Full Text Available Estuary forms a transition zone between inland river and open sea. In China, the estuary of the Yangtze River plays a vital role in connecting the inland and oversea shipping, and witnesses heavy vessel traffic in the recent decades. Nowadays, more attentions have been directed to the issue of ship pollution in busy waterways. In order to investigate the ship emission inventory, this paper presents an Automatic Identification System(AIS based method. AIS data is the realistic data of vessel traffic including dynamic information (position, speed, course, etc. and static information (ship type, dimensions, name, etc.. According to ship dimensions, the power of engines is estimated for different ship types. By using AIS based bottom-up approach, ship emission inventories and shares of air pollutants and GHGs (Greenhouse gases are developed. Spatial distribution of ship emissions is illustrated in the form of heat map. As a case study, the emission inventories are analyzed using AIS data of 2010 in the estuary, and following results are made:(1 shares of the emission are cruise ships 6.59%, bulk carriers 5.16%, container ships 52.96%, tankers 15.16%, fishing ships 9.16%, other ships 10.97%; (2 CO2 is the dominant part of the emission. (3 Areas of highest emission intensity are generally clustered around the South Channel, the North Channel and ports in the vicinity. The proposed method is promising because it is derived from the AIS data which contains not only real data of individual ship but also vessel traffic situation in the study area. It can server as a reference for other researchers and policy makers working in this field.

  19. An artificial intelligence (AI) NOx/heat rate optimization system for Ontario Hydro`s fossil generating stations

    Energy Technology Data Exchange (ETDEWEB)

    Luk, J.; Frank, A.; Bodach, P. [Ontario Hydro, Toronto, ON (Canada); Warriner, G. [Radian International, Tucker, GA (United States); Noblett, J. [Radian International, Austin, TX (United States); Slatsky, M. [Southern Company, Birmingham, AL (United States)

    1999-08-01

    Artificial intelligence (AI)-based software packages which can optimize power plant operations that improves heat rate and also reduces nitrogen oxide emissions are now commonly available for commercial use. This paper discusses the implementation of the AI-based NOx and Heat Rate Optimization System at Ontario Hydro`s generation stations, emphasizing the current AI Optimization Project at Units 5 and 6 of the Lakeview Generating Station. These demonstration programs are showing promising results in NOx reduction and plant performance improvement. The availability of the plant Digital Control System (DCS) in implementing AI optimization in a closed-loop system was shown to be an important criterion for success. Implementation of AI technology at other Ontario Hydro fossil generating units as part of the overall NOx emission reduction system is envisaged to coincide with the retrofit of the original plant control system with the latest DCS systems. 14 refs., 3 figs.

  20. Prediction of future subsurface temperatures in Korea

    Science.gov (United States)

    Lee, Y.; Kim, S. K.; Jeong, J.; SHIN, E.

    2017-12-01

    The importance of climate change has been increasingly recognized because it has had the huge amount of impact on social, economic, and environmental aspect. For the reason, paleoclimate change has been studied intensively using different geological tools including borehole temperatures and future surface air temperatures (SATs) have been predicted for the local areas and the globe. Future subsurface temperatures can have also enormous impact on various areas and be predicted by an analytical method or a numerical simulation using measured and predicted SATs, and thermal diffusivity data of rocks. SATs have been measured at 73 meteorological observatories since 1907 in Korea and predicted at same locations up to the year of 2100. Measured SATs at the Seoul meteorological observatory increased by about 3.0 K from the year of 1907 to the present. Predicted SATs have 4 different scenarios depending on mainly CO2 concentration and national action plan on climate change in the future. The hottest scenario shows that SATs in Korea will increase by about 5.0 K from the present to the year of 2100. In addition, thermal diffusivity values have been measured on 2,903 rock samples collected from entire Korea. Data pretreatment based on autocorrelation analysis was conducted to control high frequency noise in thermal diffusivity data. Finally, future subsurface temperatures in Korea were predicted up to the year of 2100 by a FEM simulation code (COMSOL Multiphysics) using measured and predicted SATs, and thermal diffusivity data in Korea. At Seoul, the results of predictions show that subsurface temperatures will increase by about 5.4 K, 3.0 K, 1.5 K, and 0.2 K from the present to 2050 and then by about 7.9 K, 4.8 K, 2.5 K, and 0.5 K to 2100 at the depths of 10 m, 50 m, 100 m, and 200 m, respectively. We are now proceeding numerical simulations for subsurface temperature predictions for 73 locations in Korea.

  1. Põhja-Korea pani tuumarelvaohte ümber hindama / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2006-01-01

    Põhja-Korea tuumakatsetusest. Praegu on varasemad oletused Põhja-Korea peatsest tuumarünnakust USA-le asendunud teadmisega, et Põhja-Korea raketid suudavad lennata 1300 km. Kaart: Põhja-Korea tuumarelvaohu ulatus. Lisa: Korea teadlasi õpetasid venelased

  2. Divorce in Korea: Trends and Educational Differentials

    Science.gov (United States)

    Park, Hyunjoon; Raymo, James M.

    2012-01-01

    The authors extend comparative research on educational differences in divorce by analyzing data from Korea. A primary motivation was to assess whether the theoretically unexpected negative educational gradient in divorce in Japan is also observed in Korea. Using vital statistics records, for marriages and divorces registered between 1991 and 2006, the authors calculated cumulative probabilities of divorce, by marriage cohort (N = 5,734,577) and educational attainment. The results indicated that the relationship between education and divorce was negative even in the earliest cohort and that this negative gradient has become more pronounced in more recent cohorts. Contrary to expectations, however, little evidence was found that the concentration of divorce at lower levels of education was exacerbated by the Asian economic crisis in the late 1990s. The authors discuss these findings in light of conventional emphases on the costs of divorce and highlight the importance of better understanding this distinctive east Asia pattern of divorce. PMID:23440624

  3. Establishment of Modern Universities in Korea

    Directory of Open Access Journals (Sweden)

    Jeong-Kyu Lee

    2001-07-01

    Full Text Available The purpose of this study is to examine the historical factors which affected the rise of modern higher education during the late Choson period (1880-1910, and to analyze the implications of these historical factors on educational policies in contemporary higher education in Korea. The rise of modern higher education in Korea can be viewed as occurring in three principal phases: Confucian Choson Royal Government, Western Christian missionaries, and patriotic nationalists. The author points out that the major historical factors influencing the development of modern higher education were Confucianism, Christianity, and Korean nationalism. In particular, Confucianism and Christianity have had substantial impacts on the planning of educational policies in contemporary Korean higher education; the former is viewed as an original source of educational enthusiasm which has expanded Korean higher education, and the latter a matrix of modern Korean higher education which has embodied educational enthusiasm.

  4. Status of nuclear data activities in Korea

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Young-Ouk; Chang, Jonghwa [Nuclear Data Evaluation Lab., Korea Atomic Energy Research Inst., Yusung, Taejon 305-600 (Korea, Republic of)

    1998-03-01

    Although nuclear data activities in Korea are still in the early stage, considerable demands for more accurate and wide-range nuclear data from nuclear R and D fields activated a new nuclear data project titled as `Development of Nuclear Data System`. It was launched this year as one of nation-wide long-term nuclear R and D programs in Korea for the next decade. Its main goals are (1) to establish nuclear data system, (2) to build up the infra-structure for utilization of nuclear data and (3) to develop highly reliable nuclear data system. To achieve these goals, international cooperation and cultivation of human resource as well as construction of measurement facilities will be indispensable. This report briefly describes the demands of nuclear data from the nuclear R and D programs, current nuclear data activities and future plan with its strategy. (author)

  5. Status of nuclear data activities in Korea

    International Nuclear Information System (INIS)

    Lee, Young-Ouk; Chang, Jonghwa

    1998-01-01

    Although nuclear data activities in Korea are still in the early stage, considerable demands for more accurate and wide-range nuclear data from nuclear R and D fields activated a new nuclear data project titled as 'Development of Nuclear Data System'. It was launched this year as one of nation-wide long-term nuclear R and D programs in Korea for the next decade. Its main goals are 1) to establish nuclear data system, 2) to build up the infra-structure for utilization of nuclear data and 3) to develop highly reliable nuclear data system. To achieve these goals, international cooperation and cultivation of human resource as well as construction of measurement facilities will be indispensable. This report briefly describes the demands of nuclear data from the nuclear R and D programs, current nuclear data activities and future plan with its strategy. (author)

  6. Obesity and Metabolic Syndrome in Korea

    Directory of Open Access Journals (Sweden)

    Sang Woo Oh

    2011-12-01

    Full Text Available In Korea, a person with a body mass index (BMI ≥25 kg/m2 is considered obese, and a person with a BMI ≥30 kg/m2 is classified as severely obese. Central obesity is defined as a waist circumference ≥90 cm for Korean men and ≥85 cm for Korean women. Recent epidemiologic data show that the prevalence of severe obesity and metabolic syndrome is steadily increasing. These epidemics increased morbidity and mortality of type 2 diabetes, cardiovascular diseases, and obesity-related cancers such as breast, colorectal, and other cancers in Korea. Decreased physical activity, increased fat and alcohol consumption, heavy smoking, and stress/depressed mood are the primary modifiable life-style risk factors for Koreans. Recently, public health interventions to encourage life-style changes have shown promising results in reducing the prevalence of severe obesity and metabolic syndrome.

  7. Calculus teaching and learning in South Korea

    OpenAIRE

    Natanael Karjanto

    2013-01-01

    This article discusses an experience of teaching Calculus classes for the freshmen students enrolled at Sungkyunkwan University, one of the private universities in South Korea. The teaching and learning approach is a balance combination between the teacher-oriented traditional style of lecturing and other activities that encourage students for active learning and classroom participation. Based on the initial observation during several semesters, some anecdotal evidences show that students'...

  8. Calculus teaching and learning in South Korea

    OpenAIRE

    Karjanto, N.

    2015-01-01

    This article discusses an experience of teaching Calculus classes for the freshmen students enrolled at Sungkyunkwan University, one of the private universities in South Korea. The teaching and learning approach is a balance combination between the teacher-oriented traditional style of lecturing and other activities that encourage students for active learning and classroom participation. Based on the initial observation during several semesters, some anecdotal evidences show that students' le...

  9. Bilateral relations Mexico-Korea today

    Directory of Open Access Journals (Sweden)

    Cecilia Ramírez Figueroa

    2007-06-01

    Full Text Available The ambassador of the Republic of Korea in Mexico, Sr. Cho Kyuhyung, remember us the first century if the korean migration to Mexico. In this one hundred years ours countries have approched and lauched a joint work with great value. They have worked for growth of trade and investment, They have promoted cultural and scientific exchanges. They have worked, especially in the enrichment of a friendship that will surely last for many more years.

  10. Lessons from Mexico and South Korea

    OpenAIRE

    De Luna Martinez, Jose

    2010-01-01

    This study analyzes the causes of the financial crises of Mexico (1994) and South Korea (1997). The main hypothesis of this work is that both the Mexican as well as the Korean financial authorities had not understood the new rules of the game in the international financial system. In particular, they did not know that with the opening of their financial systems to international capital flows they had lost their autonomy and capacity to implement economic policies that challenged the interests...

  11. India-Korea CEPA: Potentials and Realities

    OpenAIRE

    Ahmed, Shahid

    2010-01-01

    The present study investigates the potential economic impacts of India- Korea CEPA using trade indices, partial equilibrium and computable general equilibrium. One hypothetical scenario is examined in SMART model and two hypothetical tariff liberalization scenarios are examined in GTAP model focusing on short run and long run. Using the partial equilibrium WITS-SMART model, we tried to assess the impact of liberalization under the CEPA, assuming full liberalization of imports from the India i...

  12. Three Decades Of Environmental Polices In Korea

    International Nuclear Information System (INIS)

    2010-01-01

    This book reports three decades of environmental polices in Korea, which deals with development process of environmental polices such as appearance of environment problems, social agenda as national policy on environment problems, overcoming of pollution, ensuring and advancing of environment policies and practice of idea with continuous development, change of propel system on environment administration. It also introduces three decades of environmental polices by fields, related public institution and major similar institution.

  13. Climate change with Korea as the center

    International Nuclear Information System (INIS)

    Kim, Yeon Ok

    1998-04-01

    This book deals with climate change with Korea as the center, which is divided into ten chapters. It explain climate change by human life. The contents of this book are climate change, climate before human period, great ice age of prehistoric period, prehistoric times of last glacial era, climate change in historical era, change during observation time for 100 years, warming period, global environment period, the cause of climate change and climate and human. It has reference and an index.

  14. Technological competence and competitiveness of Korea industry

    International Nuclear Information System (INIS)

    Lee, Geun

    1997-06-01

    This book introduces technology and competitiveness and industrial policy of economics, technological competence and technological innovation system of Korea, a newly industrialized country, development of technological innovation and competence of semiconductor industry, development of technological innovation and competence of synthetic fiber industry, development of technological innovation and competence of machine tool industry, development of technological competence of automobile industry, improvement and delay of technological competence of computer industry, and development of technological innovation and competitiveness of appliance industry.

  15. North Korea: Return to an Engagement Strategy

    Science.gov (United States)

    2004-01-01

    CDR KEVIN T. McCARTHY, USN 5601 FUNDEMENTALS OF STRATEGIC LOGIC SEMINAR F PROFESSOR ROBERT CALLAHAN ADVISOR CAPT ROBERT B. BRANNON, USN...Despite that, it has invested heavily in military technology through the development, testing, and export of ballistic missiles and recent resumption of...North Korea respond to additional sanctions or lash out? A final element of economic power that needs to be part of the dialogue is investment

  16. Green Chemistry at the present in Korea.

    Science.gov (United States)

    Lee, Seung-Kyu; Park, Hyeon-Soo

    2015-01-01

    Despite the great contribution made by chemical substances to the development of modern civilization, their indiscriminate use has caused various kinds of damage to the global environment and human beings. Accordingly, the major developed countries and international society have tried to ensure the safe use of chemicals and a reduction in the use of hazardous chemicals through the establishment of the United Nations Environment Programme and various international agreements. In this reason, we tried to introduce about Green Chemistry progress at the present in worldwide and Korea. We checked and analyzed relative journals, reports using keyword as like Green Chemistry, alternative chemicals, eco-friendly etc. and major country's government homepage search. Green Chemistry theory, which argues for the reduction or removal of harmfulness in chemicals throughout their entire life-cycle, has been spreading, and major developed countries, such as the US and Denmark, have developed and operate programs to provide reliable chemical information to help replace hazardous chemicals. Korea has also been conducting studies as like eco-innovation project. Through this project the "Alternative Chemical Search program," has been developed, distributed, and operated since 2011 to provide reliable information to small and medium-sized businesses that have difficulties collecting information to ensure conformity to international regulations. The program provides information that includes the regulations of major countries and Korea, information on 340 alternative chemicals, 70 application cases, and 1:1 consulting. The Alternative Chemical Search program is expected to contribute to the establishment of response systems for regulation of Korean small and medium-sized businesses, and it also will be used to provide basic data for Korean hazardous chemical regulation, together with the Act on the Registration and Evaluation, etc. of Chemical Substances and the Chemical Control act

  17. U.S.-South Korea Relations

    Science.gov (United States)

    2014-02-12

    The TPP negotiating parties are Australia, Brunei, Canada, Chile, Japan, Malaysia , Mexico, New Zealand, Peru, Singapore, the United States, and...Korea’s progressive groups, who have opposed much of Park and Lee’s policy agenda and their governing styles . U.S.-South Korea Relations...banks can be granted an exemption from sanctions if the President certifies that the parent country of the bank has significantly reduced its purchases

  18. Epidemiology of Postherpetic Neuralgia in Korea

    Science.gov (United States)

    Hong, Myong-Joo; Kim, Yeon-Dong; Cheong, Yong-Kwan; Park, Seon-Jeong; Choi, Seung-Won; Hong, Hyon-Joo

    2016-01-01

    Abstract Postherpetic neuralgia (PHN) is a disease entity defined as persistent pain after the acute pain of herpes zoster gradually resolves. It is associated with impaired daily activities, resulting in reduced quality of life. General epidemiological data on PHN is necessary for the effective management. However, data on the epidemiology of PHN in Korea is lacking. The aim of this study was to evaluate the epidemiological features of PHN in the general population. We used population-based medical data for 51,448,491 subscribers to the Health Insurance Service in the year of 2013 to analyze of PHN epidemiology in Korea, such as the incidence, regional distribution, seasonal variation, and healthcare resource utilization. Total number of patients and medical cost on PHN were analyzed from 2009 to 2013. Findings indicate that the incidence of PHN in Korea was 2.5 per 1000 person-years, which was strongly correlated with age and sex. There were no differences in seasonal variation or regional distribution. The medical cost increased steadily over the study period. When admitted to general hospitals, patients with PHN were mainly managed in the dermatology and anesthesiology departments. The incidence and prevalence rates of PHN in Koreans appear to be considerably higher compared to those in western populations, while the sex and age predisposition was similar. Considering that the pain associated with PHN can have a marked impact on a patient's quality of life resulting in a medicosocial economic burden, anesthesiology physicians have an important role in primary care in Korea. Future research on the cost-effectiveness of the management of PHN is needed. PMID:27057902

  19. Translations on North Korea, Number 599.

    Science.gov (United States)

    1978-06-30

    Official *+9 DPRK Friendship Group Leaves 50 DPRK Army Team 50 Badminton Team Leaves DPRK 50 Group Views Gymnastic Display 5° Finnish CP Supports...leading member of the Chinese Football Association. [Peking NCNA in English 1813 GMT 23 May 78 OW] BADMINTON TEAM LEAVES DPRK—Pyongyang, 3 Jun—Chinese...men’s and women’s badminton teams led by Yang Kuo-chang left for home today, winding up their friendly visit to Korea. The teams had three

  20. Achievements in and Challenges of Tuberculosis Control in South Korea.

    Science.gov (United States)

    Kim, Ji Han; Yim, Jae-Joon

    2015-11-01

    After the Korean War (1950-1953), nearly 6.5% of South Korea's population had active tuberculosis (TB). In response, South Korea implemented the National Tuberculosis Program in 1962. From 1965 to 1995, the prevalence of bacteriologically confirmed pulmonary TB in South Korea decreased from 940 to 219 cases per 100,000 population. Astounding economic growth might have contributed to this result; however, TB incidence in South Korea remains the highest among high-income countries. The rate of decrease in TB incidence seems to have slowed over the past 15 years. A demographic shift toward an older population, many of whom have latent TB and various concurrent conditions, is challenging TB control efforts in South Korea. The increasing number of immigrants also plays a part in the prolonged battle against TB. A historical review of TB in South Korea provides an opportunity to understand national TB control efforts that are applicable to other parts of the world.

  1. Review Essay: Governmentality in Late Colonial Korea?

    Directory of Open Access Journals (Sweden)

    Henry Em

    2012-12-01

    Full Text Available Takashi Fujitani, Race for Empire: Koreans as Japanese and Japanese as Americans during World War II. Berkeley: University of California Press, 2011. 520 pp. $65 (cloth.Jun Uchida, Brokers of Empire: Japanese Settler Colonialism in Korea, 1876-1945. Cambridge, MA: Harvard University Press, 2011. 500 pp. $50 (cloth.In South Korea, more so than in most other postcolonial countries, the issue of sovereignty and the colonial past remains a central feature of politics. Most recently, during a televised presidential debate on December 4, 2012, Lee Jung-hee of the Unified Progressive Party said something that likely had never been said on South Korean television: “Takaki Masao signed an oath of loyalty [to the Emperor of Japan], in his own blood, to become an officer in the Japanese [Imperial] Army. You know who he is. His Korean name is Park Chung Hee.” Lee Jung-hee then made the connection between that colonial past and the willingness to sell out the nation’s sovereignty in the present. The conservative candidate Park Geun-hye, the daughter of the late President Park Chung Hee who ruled South Korea from 1961 through 1979, and members of Park’s Saenuri Party, remain true to their “roots”: these “descendants of pro-Japanese collaborators and dictators” (again sold out South Korea’s sovereignty (on November 22, 2011 when they rammed the US-ROK Free Trade Agreement through the National Assembly.

  2. Volunteering among older people in Korea.

    Science.gov (United States)

    Kim, Jibum; Kang, Jeong-Han; Lee, Min-Ah; Lee, Yongmo

    2007-01-01

    Faced with aging societies, there is an immense need to better understand the nature of volunteering outside advanced Western industrial countries. As a case of a rapidly aging society, we identify robust factors associated with elderly volunteering in Korea in terms of a resource framework. Data were derived from the Social Statistics Survey conducted by the Korea National Statistical Office in 1999 (N = 7,135) and 2003 (N = 8,371). We first determined overall and age-related volunteer rates for Korea compared to the United States. Using logistic regression, we then examined the effects of human, cultural, and social capital variables on volunteering. Approximately 6% of Koreans aged 65 years and older participate in volunteer programs. All human capital variables are positively related with volunteering. For cultural capital, those who identify their religion as Buddhism or Catholicism are more likely to volunteer than those who have no religion. But surprisingly, Protestantism does not consistently promote volunteering across both years. For social capital, older adults who live alone or with a spouse are more likely to volunteer than those living with both a spouse and children. In contrast to human capital, cultural and social capital on elderly volunteering appears to be contoured by social contexts.

  3. The Military and National Reconciliation: German Lessons for Koreas Reunification

    Science.gov (United States)

    2017-05-25

    Korea) to the Republic of Korea (the ROK, or South Korea) has increased rapidly. In May 2016, twelve North Koreans waitresses, working at a restaurant ...More N. Korean Restaurant Staff Escape from China,” Chosunilbo, May 24, 2016, accessed October 11, 2016, http://english.chosun.com/site/data...after March 1991.62 When selecting personnel to be incorporated into the Bundeswehr, the volunteers from the NVA came under close scrutiny as the

  4. S. Korea nuclear: a cautious path to self-reliance

    International Nuclear Information System (INIS)

    Anon.

    1994-01-01

    The South Korean nuclear power industry is described in this article. By comparing policy on nuclear technology in North and South Korea, differing political allegiances are highlighted. South Korea, rather than pursuing nuclear weapons capability like North Korea, has worked hard to produce a rapidly expanding nuclear powered electricity supply industry, which is described. Government targets which aim to meet predicted increases in demand for electricity are noted, but the problems of waste management and reprocessing have yet to be solved. (UK)

  5. Korea presses forward; but who gets the orders

    International Nuclear Information System (INIS)

    Robins, B.

    1986-01-01

    A decision is expected soon as to the successful bidders to build two nuclear power stations in South Korea. The competition is keen with Westinghouse, Framatone, AE of Canada and Combustion Engineering all bidding. However, a final decision may be delayed following a review of Korea's future electricity demand. This paper shows a reduction in the electricity demand previously predicted. Korea's electricity supply and demand and the Government's energy policy is discussed. (UK)

  6. Korea's choice of a new generation of nuclear plants

    International Nuclear Information System (INIS)

    Redding, J.R.

    1994-01-01

    The ABWR and SBWR design, both under development at GE, provide the best platform for developing the next generation advanced plants. The ABWR, which is rapidly setting the standard for new nuclear reactor plants, is clearly the best choice to meet the present energy needs of Korea. And through a GE/Korea partnership to develop the plant of the next century, Korea will establish itself as a leader in innovative reactor technology

  7. 9-cis-retinoic acid increases apolipoprotein AI secretion and mRNA expression in HepG2 cells.

    Science.gov (United States)

    Haghpassand, M; Moberly, J B

    1995-10-01

    HepG2 cells were studied as a model for regulation of hepatic apolipoprotein AI (apo AI) secretion and gene expression by 9-cis-retinoic acid. HepG2 cells cultured on plastic dishes were exposed to 9-cis-retinoic acid (9-cis-RA) for 48 h with a complete media change at 24 h. Apo AI mass in cultured media was determined by ELISA, by quantitative immunoblotting and by steady-state 35S-methionine labeling. Messenger RNA levels were determined by RNase protection using probes for apo AI and the housekeeping gene, glyceraldehyde 3-phosphate dehydrogenase (G3PDH). 9-cis-RA increased secretion of apo AI by 52% at doses of 10 and 1 microM (6.3 +/- 0.6 vs. 4.2 +/- 0.3; P G3PDH mRNA was slightly decreased (14%, P < 0.05). Thus, 9-cis-RA stimulates apo AI expression in HepG2 cells, suggesting a role for retinoids in activating endogenous apo AI gene expression.

  8. Microstructural studies of suck cast (Zr-SS)-3 and 5 AI alloys for nuclear metallic waste form

    International Nuclear Information System (INIS)

    Kumar, P.; Das, N.; Sengupta, P.; Arya, A.; Dey, G.K.

    2015-01-01

    Management of radioactive metallic waste using 'alloy melting route' is currently being investigated. For disposal of Zr and SS base nuclear metallic wastes, Zr-stainless steel (SS) hybrid alloys are being considered as baseline alloys for developing metallic-waste-form (MWF) alloys. In this context Zr-16 wt. %55 has been selected for MWF alloy in our previous study. In present study, to include amorphous phase in this alloy, 3 and 5 wt. % Al has been added in order to improve desirable properties and useful features of MWF and the two alloys have been prepared by suck casting techniques. Microstructure of these alloys have been investigated by optical and electron microscopy which shows occurrence of two different phases, e.g. dark grey and white phases, in (Zr-16 SS)-3 Al and three different phases, e.g. grey, dark grey and white phases in (Zr-16 SS)-5 AI. Electron diffraction and X-ray diffraction (XRD) analyses of these two alloy specimens revealed the occurrence of Zr (Fe, Cr, AI) (dark grey) and Zr 2 (Fe, Cr, AI) (white) phases in (Zr-16 SS)-3 Al whereas, Zr (Fe, Cr, AI) (dark grey), Zr 2 (Fe, Cr, AI) (grey) and Zr 3 (Fe, Cr, AI) (white) phases were found in (Zr-16 SS)-5 AI. In addition, presence of amorphous phase was indicated by XRD analysis that could be confirmed by transmission electron microscopy of these two alloys. (author)

  9. Japan's Post-Cold War North Korea Policy: Hedging toward Autonomy?

    National Research Council Canada - National Science Library

    Fouse, David

    2004-01-01

    ... (and to a much lesser extent the Republic of Korea). With little at stake in North Korea economically, Japan's pursuit of better diplomatic relations with the Democratic People's Republic of Korea (DPRK...

  10. Põhja-Korea vanglast põgenes 120 poliitvangi / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2007-01-01

    Lõuna-Korea ajakirjanduse väitel on Põhja-Korea vangilaagrist põgenenud 120 poliitvangi, 21 tabati, kuid enamik on jõudnud Hiinasse. USA andmeil on Põhja-Korea vangilaagrites ligi 200 000 poliitvangi

  11. Formal Safety Assessment (FSA for Analysis of Ship Collision Using AIS Data

    Directory of Open Access Journals (Sweden)

    Muhammad Badrus Zaman

    2015-03-01

    Full Text Available Currently, Maritime safety is the best issue in the world. International Maritime organization (IMO have recommended FSA methodology to enhance maritime safety. In this paper, the research conducted in the Malacca Strait. Malacca Strait is an area that has a high risk for shipping navigation. Many accidents occur in the area are like collision, fire, grounding and so on. Therefore a study on improving safety in this area is very important. it is to produce an output that can be used to provide input to the master and multiple stakeholders to improve safety on board at the time of sailing. In this study, AIS is used as a data source. Sea condition data collected actual traffic through the Automatic Identification System (AIS equipment installed at Kobe University, Japan, and Universiti Teknologi Malaysia (UTM in Johor, Malaysia. The data is applied to define a method with the help of Geographic Information Systems (GIS.

  12. Development of X-ray diffractometers XD-D1 AI qualitative analysis system

    International Nuclear Information System (INIS)

    Arai, Hiroshi; Uota, Atsushi; Ishida, Hidenobu

    1994-01-01

    Qualitative X-ray diffraction is a very important analytical method, however, it is also very difficult to perform and needs some special skills. Also, the analysis accuracy depends on the operators' knowledge of qualitative analysis. In order that even a beginner analyst can obtain accurate results, we have developed the 'XD-D1 AI Qualitative Analysis System'. This system can support analytical operations with the experts' knowledge made available by AI techniques. Systematizing the experts' knowledge, we applied the system to our expert shell 'GENZO-I/PRO'. This system enabled a beginner analyst to get the same results as a specialist would get. In this paper, we will describe the process of system design, system construction and an example analysis. (author)

  13. Polychronous Zirconology of Navysh Volcanics of the Ai Formation (Southern Urals)

    Science.gov (United States)

    Krasnobaev, A. A.; Puchkov, V. N.; Sergeeva, N. D.

    2018-01-01

    In order to resolve the age of Navysh volcanics (NV), which is usually attributed to the Lower Riphean of the Ai Formation, we have used geochronological, petrologic, and mineralogical methods of zirconology, apart from the SHRIMP isotopic data of single zircon grains. Moreover, TIMS isotope age analyses have been conducted, the results of which can be regarded as both controlling and providing the most correct information. The TIMS and SHRIMP data make it possible to suggest a polychronous character of the NV, which include not only Riphean, but also Paleozoic groups of volcanics. In this situation, an assessment of the scales of such polychroneity of NV and, correspondingly, of the Ai Formation as a whole becomes urgent.

  14. S&T converging trends in dealing with disaster: A review on AI tools

    International Nuclear Information System (INIS)

    Hasan, Abu Bakar; Isa, Mohd Hafez Mohd.

    2016-01-01

    Science and Technology (S&T) has been able to help mankind to solve or minimize problems when arise. Different methodologies, techniques and tools were developed or used for specific cases by researchers, engineers, scientists throughout the world, and numerous papers and articles have been written by them. Nine selected cases such as flash flood, earthquakes, workplace accident, fault in aircraft industry, seismic vulnerability, disaster mitigation and management, and early fault detection in nuclear industry have been studied. This paper looked at those cases, and their results showed nearly 60% uses artificial intelligence (AI) as a tool. This paper also did some review that will help young researchers in deciding the types of AI tools to be selected; thus proving the future trends in S&T

  15. S&T converging trends in dealing with disaster: A review on AI tools

    Science.gov (United States)

    Hasan, Abu Bakar; Isa, Mohd. Hafez Mohd.

    2016-01-01

    Science and Technology (S&T) has been able to help mankind to solve or minimize problems when arise. Different methodologies, techniques and tools were developed or used for specific cases by researchers, engineers, scientists throughout the world, and numerous papers and articles have been written by them. Nine selected cases such as flash flood, earthquakes, workplace accident, fault in aircraft industry, seismic vulnerability, disaster mitigation and management, and early fault detection in nuclear industry have been studied. This paper looked at those cases, and their results showed nearly 60% uses artificial intelligence (AI) as a tool. This paper also did some review that will help young researchers in deciding the types of AI tools to be selected; thus proving the future trends in S&T.

  16. A photometric and spectroscopic study of the early-type binary AI Crucis

    International Nuclear Information System (INIS)

    Bell, S.A.; Kilkenny, D.; Malcolm, G.J.

    1987-01-01

    New Stroemgren photometry and medium-dispersion spectroscopy of the early-type eclipsing binary AI Cru are presented. The masses and radii of the two components are found to be (9.8 +-0.5) and (5.8 +-0.3) solar masses and (4.9 +- 0.1) and (4.4 +- 0.1) solar radii, respectively. The semi-detached nature of the system is confirmed and by comparison with stationary models by previous authors it is shown that AI Cru has probably passed through the rapid phase of Case A mass transfer. It is suggested that the original system may have had a period of about 1.3 day and that the roles of the current primary and secondary components were at that time reversed. (author)

  17. S&T converging trends in dealing with disaster: A review on AI tools

    Energy Technology Data Exchange (ETDEWEB)

    Hasan, Abu Bakar, E-mail: abakarh@usim.edu.my; Isa, Mohd Hafez Mohd. [Faculty of Science and Technology, Universiti Sains Islam Malaysia, 71800 Nilai, Negeri Sembilan (Malaysia)

    2016-01-22

    Science and Technology (S&T) has been able to help mankind to solve or minimize problems when arise. Different methodologies, techniques and tools were developed or used for specific cases by researchers, engineers, scientists throughout the world, and numerous papers and articles have been written by them. Nine selected cases such as flash flood, earthquakes, workplace accident, fault in aircraft industry, seismic vulnerability, disaster mitigation and management, and early fault detection in nuclear industry have been studied. This paper looked at those cases, and their results showed nearly 60% uses artificial intelligence (AI) as a tool. This paper also did some review that will help young researchers in deciding the types of AI tools to be selected; thus proving the future trends in S&T.

  18. New progress of FEM simulation and AI application in rolling at RAL

    International Nuclear Information System (INIS)

    Liu Xianghua; Wang Guodong; Zhao Kun

    2000-01-01

    New progresses on FEM simulation and AI application in rolling have been achieved at RAL recently. The existence and uniqueness of the extreme point of total functional for rolling problem has been proved. Different rolling processes, such as H-beam rolling, ribbing strip rolling, slab sizing, have been solved by our in-house FEM software package. The simulation results have been put into production use to improve the precision of math models. The Artificial Neural Network has been used to predict rolling force, coiling temperature, microstructure and properties of the rolled products. An expert system for deviation diagnoses of strip thickness has been developed for industry use. Synergetic Artificial Intelligence has also been applied to rolling scheduling. We are making continuous efforts to develop AI applications for rolling line co-operating in China steel industry. (author)

  19. LE FRANÇAIS DANS LA PRESSE ECRITE DU NORD-CAMEROUN : DIAGNOSTIC, CRITIQUES ET ORIENTATIONS

    Directory of Open Access Journals (Sweden)

    Moïse MBEY MAKANG

    2013-11-01

    Full Text Available La présente réflexion tire son origine de la crise linguistique observée au sein de la presse écrite du Nord-Cameroun. Celle-ci fait échos des irrégularités de la langue de Voltaire dans la presse écrite de cette partie du pays. De plus en plus, on y assiste à une émergence des déviances syntaxiques et une profusion des écarts langagiers à connotation dépréciative. L’indécence verbale de la société, la mauvaise prestation des élèves en classe et lors des examens officiels en sont des indicateurs pertinents. Il est important de mentionner que la cohabitation entre les langues camerounaises et le français, la sous-scolarisation et ou l’ignorance, le laxisme des rédacteurs en chef, etc. sont les mobiles profonds de cette incorrection. Pourtant, nous savons tous que les media sont une forteresse où la langue doit être préservée de toute entorse et représentent un modèle pour la société. Néanmoins, des traits caractéristiques du français de la presse écrite du Nord-Cameroun s’inscrivent en faux par rapport à cette vocation naturelle des media. Dès lors, la question que nous pouvons nous poser est celle de savoir si ces mobiles ci-dessus cités sont des éléments qui favorisent l’émergence de cette dialectalisation du français. En clair qu’est-ce qui caractérise le français des journalistes? Quelle est la structure morphosyntaxique du français des rédacteurs des journaux? S’agit-il d’un français conforme à une norme locale ou (y retrouvons-nous des énoncés exogènes ? Quel type de morphosyntaxe utilisent les rédacteurs ? Une morphosyntaxe endogène, morphosyntaxe qui leur est propre, ou plutôt une morphosyntaxe exogène, supposée unique à tous les francophones ? Peut-on parler d’alternance codique, d’argotisation, ou de créolisation ? La présente analyse a pour ambitions de s’interroger sur les mobiles profonds qui incitent des journalistes à s’écarter de la norme du français

  20. A sidelight on the history Korea nuclear energy

    International Nuclear Information System (INIS)

    Park, Ik Su

    1999-12-01

    It deals with a sidelight on the history of Korea nuclear energy through debate. It includes a lot of debates, which are about opinions on agreement of nuclear energy, three people's debates on agreement of nuclear energy between Korea and U.S.A development of nuclear energy and revolution of technology, introduction of reactor for generation of electricity, discuss over business of Korea nuclear power, the system of nuclear power plants, the issues on administration for nuclear power and radiation safety, the important things of Korea nuclear power business and Let's keep the first reactor; TRIGA-MARK-II and III.

  1. Sectoral Innovation System Foresight in Brazil and Korea

    DEFF Research Database (Denmark)

    Dahl Andersen, Allan; Andersen, Per Dannemand; Park, Byeongwon

    involved in strategic innovation system (IS) transformation. This paper seeks to address the latter research gaps by exploring sector foresight in Brazil and South Korea (henceforth Korea). Though very different, both countries face challenges of IS transformation. In both countries sector level foresight...... in emerging economies as Brazil and Korea. Chapter two will outline the basic principles of ISF that will be translated into indicators for our measuring of ISF. Also, it will illustrate why the sector-level approach is necessary. Chapter three presents sector foresight cases from Brazil and Korea. Chapter...

  2. Country Report for Republic of Korea

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Seong Woon [Shinil General Hospital, 47-7, Suyou5dong, Kangbuk-Gu, 142-070 Suyou 5 Dong (Korea, Republic of)

    2008-07-01

    Nuclear Power in Korea: Electric generation from 20 reactors: 130,715 million kWh/y; Nuclear generation of total electricity: 40 %. Reactor types: - 4 PHWR (Candu), 16 PWR (6 USA-Westinghouse, 2 French-Framatome, 8 Korean-OPR1000). Nuclear future: - Under Construction: 4 PWR (OPR1000), 2 PWR (APR1400, ShinKori no 3 and 4). - Planned: 2 PWR (APR1400, ShinWooljin no 3 and 4). - R and D investment plan in 2008 managed by MEST (ex- MOST) due to new governmental unification: - next generation reactor: 2 units of APR1400 construction and development of APR1400+, - NTP cooperative research: Gen-IV with SFR, Pyro-process, - Nuclear application: SMART, KSTAR for ITER construction, - Waste disposal management: LILW, SF, Decommission, - RFT, Safety enforcement, radiation protection, public communication, medical use, etc. Nuclear Power in Korea: Status of Radioactive Waste Disposal Site: - Site: Kyeongju, southeast part of Korea, - Size: 2,098,419 m{sup 2}, - Waste type: Low/Intermediate Level Waste (LILW) and RI waste, - Disposal type: Cavern, - Capacity: 1. stage 100,000 drums (total 800,000 drums), - Under Licensing Process for Construction WIN-Korea Activity in 2007: 250 members and 11 organization sponsors. 1. 2007 Symposium on Nuclear with Women: - Topic: 'Rendezvous of Nuclear and Renewable Energy', October 11, 2007 at Conference Hall of National Congress. Audience: 400 from Women NGO and the Assembly. - Panel: six specialists from energy, journalism, and women NGO's discussed about energy secure, saving, development of environment friendly energy, protection from global warming. - Results: public communication effect from mass media. 2. 2007 Symposium Conferences: General Meeting/workshop, Nov. 6, 2007, sponsored by KOFWST (Korea Federation of Women's Science and Technology Associations)/Seoul Education Culture Centre. participants: 100 members. Lectures: 'Women's Self Leadership', 'Survey Results of Public understanding on

  3. The Singularity, or How I Learned to Stop Worrying and Love AI

    OpenAIRE

    Bishop, Mark (J. M.)

    2015-01-01

    Professor Stephen Hawking recently warned about the growing power of Artificial Intelligence (AI) to imbue robots with the ability to both replicate them- selves and to increase the rate at which they get smarter - leading to a tipping point or ‘technological singularity’ when they can outsmart humans. In this chapter I will argue that Hawking is essentially correct to flag up an existential danger surrounding widespread deployment of ‘autonomous machines’, but wrong to be so concerned about ...

  4. Feeding Supplementation And Radioimmunoassay (RIA) Technique For The Improvement Of artificial Insemination (AI) Efficiency

    International Nuclear Information System (INIS)

    Tjiptosumirat, Totti; Supandi, Dadang; Firsoni

    2002-01-01

    Recent research activities have showed that RIA techniques may be use as a tool in the improvement of dairy cattle AI in . Cisurupan district, Garut. Although already indicate in the previous research, with a small number of dairy cattle tested, a more in depth study on the utilization of RIA for the improvement of AI efficiency is still required. It is indicated from the previous experiment results that administration of feeding supplementation might improved the efficiency of reproductive performance of dairy cattle. The current Study is a continuation from the previous study with a larger number of dairy cattle and wider area covered. The experiment is aimed to monitor the impact of feeding supplementation on the reproductive performance of dairy cattle using Artificial Insemination Database Application (AIDA) and RIA technique. Result from this study indicated that feeding supplementation improved conception rate between pre-supplemented and post-supplemented dairy cattle; 25% vs 40%, respectively, therefore improve ratio of Service per Conception of 4.0 vs 2.3, respectively for pre-supplemented and post-supplemented dairy cattle. Result of this experiment also showed that RIA might be use as an effective tool in monitoring the early failure of AI compared to if just relying on the conventional method, the rectal palpation. However, due to an increase in milk production as a result of feeding supplementation, tanners tend to lengthen the lactation period from 10.20 ± 0.5 months to 11.8 ± 0.6 months, respectively in dairy cattle pre-supplemented and post-supplemented. It can be conclude from this study that supplementation feeding improve reproductive performance. However, even AIDA and RIA may be of effective tool in monitoring the reproductive performance of dairy cattle, as an holistic approach for an improvement dairy farm management is still required due to other factors play important role for AI efficiency

  5. Des résumés en français

    Directory of Open Access Journals (Sweden)

    Bogdan Patrut

    2010-09-01

    Full Text Available Des résumés en français
    BRAIN. Broad Research in Artificial Intelligence and Neuroscience
    CERVEAU. Recherche large en intelligence artificielle et neurosciences
    Volume 1, Numéro 4
    Juillet 2010: « Automne 2010»
    www.brain.edusoft.ro
    Sous la direction de: Bogdan Pătruţ

  6. Administration of a luteolytic dose of PGF2α at the time of AI

    Directory of Open Access Journals (Sweden)

    G. Neglia

    2010-02-01

    Full Text Available The aim of this study was to verify if the administration of a luteolytic dose of PGF2α at the time of AI is able to anticipate ovulation and, hence, to increase fertility rate. Furthermore, the presence of a “farm effect” was also evaluated. The trial was performed in two commercial farms (A and B located in Caserta on 584 buffaloes (Farm A: n=389; Farm B: n=195, synchronized by the Ovsynch-TAI Program. In each farm buffaloes were divided in two groups: treated group (n=181 and n=95, respectively in farms A and B received an intramuscular injection of 0.524 mg cloprostenol (Estrumate®, Schering-Plough Animal health, S.p.A., Milan, Italy at the time of AI while control group (n=208 and n=100 received an intramuscular injection of physiologic saline (0.9% NaCl. No differences were present with regard to the number of AI/subject, in terms of pregnancy rate and ovulation rate between treated and control groups. It is worth pointing out that the control group in farm A showed a higher (P<0.01 conception rate compared to the control group in farm B (46.15 vs. 30.00. Furthermore, within farm B buffaloes treated by cloprostenol on the day of AI showed higher (P<0.01 pregnancy rate vs. animals that received saline (51.58% vs. 30.00%. These results suggest that if fertility in control group is high, treatment by cloprostenol does not affect pregnancy rate and ovulation rate.

  7. Citadels AI

    OpenAIRE

    Pekárek, Jakub

    2015-01-01

    The aim of this thesis is to implement a playable version of the game Citadels with console interface, and to use it for analysis of the game's properties and development of artificial intelligence. This thesis includes an analysis of strategies, a scheme for their design, an organization of turn processing, a model of intelligence implementation and testing tools. A number of approaches to specific moves have been developed, all of which achieved positive impact on overall intelligence perfo...

  8. LE CINÉMA FRANÇAIS EN ROUMANIE DANS L’ENTRE-DEUX-GUERRES

    Directory of Open Access Journals (Sweden)

    Georgiana MEDREA

    2013-05-01

    Full Text Available Avant même d’aborder la nature des films français importés en Roumanie dans l’entre-deux-guerres, il convient de situer cette production cinématographique dans l’ensemble de celles présentes sur le marché roumain, ce que permettent documents et articles critiques contemporains. La diversité des mises en scène et des acteurs, la variété des sujets traités plaisent à un large public. La plus grande place que connaît le cinéma français en Roumanie dans les années trente est sans doute due,également, à la présence, dans le monde cinématographique français, d’artistes roumains qui manifestent un souci d’intégration dans une culture d’accueil qu’ils admirent. Les exemplesde coopérations franco-roumaines sont nombreuses, jusqu’à se manifester parfois sous la forme de coproductions

  9. Application of Artificial Intelligence (AI) Programming Techniques to Tactical Guidance for Fighter Aircraft

    Science.gov (United States)

    McManus, John W.; Goodrich, Kenneth H.

    1989-01-01

    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within-Visual-Range (WVR) air combat engagements is discussed. The application of AI methods for development and implementation of the TDG is presented. The history of the Adaptive Maneuvering Logic (AML) program is traced and current versions of the AML program are compared and contrasted with the TDG system. The Knowledge-Based Systems (KBS) used by the TDG to aid in the decision-making process are outlined in detail and example rules are presented. The results of tests to evaluate the performance of the TDG versus a version of AML and versus human pilots in the Langley Differential Maneuvering Simulator (DMS) are presented. To date, these results have shown significant performance gains in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify than the updated FORTRAN AML programs.

  10. Technological differences between açai and juçara pulps and their sorbets

    Directory of Open Access Journals (Sweden)

    Ana Paula Silva Siqueira

    2017-11-01

    Full Text Available Abstract Açai and juçara are palm trees that produce similar fruits. However, only the sale of açai is growing on the market for pulps and processed products for human consumption. The aim of this study was to compare açai and juçara pulps from the chemical, bioactive, rheological and technological points of view. Sorbets were elaborated with the pulps and evaluations were carried out regarding the antioxidant activity, polyphenols, anthocyanins, pH, acidity, soluble solids, ratio and colour. The pulps were evaluated rheologically and the sorbets for melting time. Juçara showed better results regarding the bioactive parameters (antioxidants ≈ 151 uM ferrous sulphate/ g and anthocyanins ≈ 77 mg.100g-1 and presented a more intense colour (Chroma 17. The pulps were physicochemically similar. The sorbet preserved much of the nutrients and presented a very intense colour, mainly in the juçara sorbet.

  11. Goldfish Leptin-AI and Leptin-AII: Function and Central Mechanism in Feeding Control

    Directory of Open Access Journals (Sweden)

    Ai-Fen Yan

    2016-05-01

    Full Text Available In mammals, leptin is a peripheral satiety factor that inhibits feeding by regulating a variety of appetite-related hormones in the brain. However, most of the previous studies examining leptin in fish feeding were performed with mammalian leptins, which share very low sequence homologies with fish leptins. To elucidate the function and mechanism of endogenous fish leptins in feeding regulation, recombinant goldfish leptin-AI and leptin-AII were expressed in methylotrophic yeast and purified by immobilized metal ion affinity chromatography (IMAC. By intraperitoneal (IP injection, both leptin-AI and leptin-AII were shown to inhibit the feeding behavior and to reduce the food consumption of goldfish in 2 h. In addition, co-treatment of leptin-AI or leptin-AII could block the feeding behavior and reduce the food consumption induced by neuropeptide Y (NPY injection. High levels of leptin receptor (lepR mRNA were detected in the hypothalamus, telencephalon, optic tectum and cerebellum of the goldfish brain. The appetite inhibitory effects of leptins were mediated by downregulating the mRNA levels of orexigenic NPY, agouti-related peptide (AgRP and orexin and upregulating the mRNA levels of anorexigenic cocaine-amphetamine-regulated transcript (CART, cholecystokinin (CCK, melanin-concentrating hormone (MCH and proopiomelanocortin (POMC in different areas of the goldfish brain. Our study, as a whole, provides new insights into the functions and mechanisms of leptins in appetite control in a fish model.

  12. ai Palm Fruit (Euterpe oleracea Mart.) Pulp Improves Survival of Flies on a High Fat Diet

    OpenAIRE

    Sun, Xiaoping; Seeberger, Jeanne; Alberico, Thomas; Wang, Chunxu; Wheeler, Charles T.; Schauss, Alexander G.; Zou, Sige

    2010-01-01

    Reducing oxidative damage is thought to be an effective aging intervention. Açai, a fruit indigenous to the Amazon, is rich in phytochemicals that possesses high anti-oxidant activities, and has anti-inflammatory, anti-cancer and anti-cardiovascular disease properties. However, little is known about its potential anti-aging properties especially at the organismal level. Here we evaluated the effect of açai pulp on modulating lifespan in Drosophila melanogaster. We found that açai supplementat...

  13. Balzac peint les français: social satire and construction of ideal types in Les français peints par eux-mêmes.

    Directory of Open Access Journals (Sweden)

    Marilisa Moccia

    2017-02-01

    Full Text Available Tra il 1840 e il 1842, negli stessi anni in cui prendeva forma quella che sarà di lì a poco la Comédie Humaine, furono dati alle stampe nove volumi dell’opera Les Français peints par eux-mêmes, pubblicata da Léon Curmer. L’opera vide la collaborazione di disegnatori e scrittori fra i quali Honoré de Balzac che contribuì al progetto scrivendo due voci l’épicier e la femme comme il faut. Les Français peints par eux-mêmes, definito nel sottotitolo Encyclopédie morale du XIXe siècle, è uno dei maggiori esempi di «letteratura panoramica», come ebbe a definirla Walter Benjamin (Benjamin 1979, e vi si mescolano caricatura e determinismo fisiologico impiegati per ritrarre, e non semplicemente descrivere, i tipi umani e sociali che popolano Parigi e la Provincia. L’introduzione di Léon Curmer e Jules Janin colloca il progetto globale dell’opera sotto l’etichetta di «tableau», già utilizzata da Louis-Sébastien Mercier (Mercier 1782, della società contemporanea messa al servizio della storia dei costumi. Da un lato, il dispositivo umoristico dell’opera scatena dall’idea di classificare gli uomini, svuotati della loro soggettività e degradati a tipi sociali, al pari delle specie animali e vegetali, ricalcando e “scoronando”, dunque, l’intento normalizzante dell’Enciclopedia dei lumi. Per questo motivo, la mise en page (ogni voce dell’opera è strutturata in type, tête de page, cul de lampe, contribuisce a creare un transtesto (Genette 1997, che stringe l’occhio al lettore del tempo, nutrito dalle opere di Buffon e Cuvier.  Dall’altro, però, l’intento dichiaratamente “serio” dell’opera che deve occuparsi di spiegare, con intento pedagogico e attraverso l’escamotage dell’autoritratto, i francesi ai Francesi, suggerisce una seconda ipotesi: la società tutta è risibile perché ridicola è la borghesia del regno di Luigi Filippo. Il contributo si propone di indagare il tipo di satira che

  14. LONGEVITY IN NORTH KOREA AND SOUTH KOREA: PREVALENCE OF CENTENARIANS IN ONE THE POOREST AND ONE OF THE RICHEST NATIONS.

    Science.gov (United States)

    Schwekendiek, Daniel

    2018-03-01

    Over recent decades, economic living conditions have dramatically improved in South Korea, which now represents one of the most developed nations. At the same time, its twin in the North remains one of the poorest countries on earth. Thus, the Korean peninsula represents a unique historical experiment that allows for study of the effects of environment on human development under a variety of ceteris paribus cultural, genetic and climatic conditions. Previous studies comparing the biosocial performances of the two Koreas have focused on indicators such as weight, height, mid-upper arm circumference and age at menarche. The purpose of the present study was to investigate longevity based on the number of centenarians living in the two Koreas by drawing on censuses implemented around 1925 and 2010. The study found that North Korea had some 0.7 centenarians per one million persons in 1925, and this rate moderately improved to 2.7 around 2010. Conversely, rates skyrocketed in South Korea from 2.7 in 1925 to 38.2 around 2010. This suggests that the rate of centenarians in North Korea around 2010 corresponds to that of South Korea in 1925, suggesting a chronological lag in delayed human development of some 85 years. The prevalence of centenarians is fourteen times higher in contemporary South Korea compared with the North - broadly confirming previous biosocial studies on the two Koreas and two Germanies reporting improved human development in market-oriented systems compared with socialist ones.

  15. School Expansion in North Korea and South Korea: Two Systems, Two Approaches.

    Science.gov (United States)

    Lee, Hyangkue

    2001-01-01

    Examines differences in the public-policy objectives and financing of school expansion efforts in North and South Korea. Institutionalizing credentialism and reliance on financing private education dominates South Korean school expansion, while the financing of public schools and greater government control of education dominates North Korean…

  16. The Growing Relationship Between South Korea and China: Consequences for North Korea

    Science.gov (United States)

    2006-03-01

    vassal state. Korean kings only “rendered obeisance” to China because it “signified their cultural respect for China as the center of…the civilized...Korea Game," Far Eastern Economic Review 163, no. 24 (Jun 15 2000): 16. The authors are quoting Lee Jong Seok, a senior Pyongyang watcher at Sejong

  17. Report on the ALMERA Meeting 2006 at the Korea Institute of Nuclear Safety (KINS), Daejeon, Korea

    International Nuclear Information System (INIS)

    2007-03-01

    The present document reports the new structure of the ALMERA network, as was discussed and approved during the third ALMERA coordination meeting, held at KINS. Comments made by those ALMERA participants that did not attend the meeting in Korea have also been taken into account in the preparation of this document

  18. Book review: F. Azouvi, Le Mythe du grand silence: Auschwitz, les Français, la mémoire

    OpenAIRE

    Cavaletto , Andrea

    2014-01-01

    International audience; Review of: F. Azouvi, "Le Mythe du grand silence: Auschwitz, les Français, la mémoire", Fayard, 2012. Journal of Interdisciplinary History of Ideas, vol.2, n.4, December 2013

  19. Sexual Violence among Men in the Military in South Korea

    Science.gov (United States)

    Kwon, Insook; Lee, Dong-Ok; Kim, Elli; Kim, Hyun-Young

    2007-01-01

    This research is about sexual violence among men in the military in South Korea. The authors investigated the frequencies, causes, and circumstances surrounding sexual violence and looked for characteristic features of sexual violence among men in the military in South Korea. They found a high frequency of physical sexual violence and a high level…

  20. Building a Cyber Training Center for Teachers in Korea.

    Science.gov (United States)

    Baek, Young-Kyun; Westrom, Marv

    2001-01-01

    Describes the development of a system for the delivery of teacher retraining on the Internet in Korea. Explains cooperation between the government and Korea National University of Education; and discusses goals of the project, including minimizing teacher's retraining costs and making inservice training available to all teachers. (Author/LRW)